1KU3A

Crystal structure of thermus aquaticus rna polymerase sigma subunit fragment, region 4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
ELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the bacterial RNA polymerase promoter specificity sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription
molecule keywords sigma factor sigA
total genus 20
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku3A00
3IWFA 5H6QA 2F5DA 3ZMUA 2ZXJA 2DK5A 3JW4A 3FZVA 5CJ9A 5IT3A 3WTWC 1KQ9A 1V4RA 1J5YA 1SD5A 2XKPA 4KUMA 3CJNA 3EYIA 2ETHA 3SXYA 1SD6A 1BM9A 3FM3A 1H0MA 3COAC 3I0TA 4WXDA 2WC2A 4CO8A 3WTVC 1HQCA 2UXXA 4I2OA 3GWZA 3S2WA 1YLFA 2QVOA 1XSDA 1RIOH 1R36A 4L0ZB 1MJBA 4EJOA 3BPXA 4P9FA 3Q9SA 1J2XA 3LA2A 4G7ZF 2ZMEB 1LDDA 3L7WA 4DQ2A 3CUQC 3MAJA 2OQRA 4TV7A 2VE8A 2EA4A 3V8KA 1BIBA 1CF7A 1BJAA 4FX4A 3P9CA 1QQIA 4UVBA 4KYWA 1C0WA 3I54A 2VODA 4UNOA 4ETSA 3R6SA 4N9HA 5FFXA 1QO0D 1DP7P 5CYVA 5LHGA 2RV8A 1S3JA 1WQ2A 3N97A 2VE9A 1BI3A 2K27A 2DAOA 4ENNA 2M30A 4NQWA 4U7BA 1ZG1A 3ULQB 3V7CA 1RZ4A 4KN7X 1OPCA 5FD5A 3H92A 5CVUA 1ZRDA 3E5XA 3RKXA 3RYPA 2KJBA 3VB2A 3DF8A 1LJ9A 4D0PA 3TOBA 4OMYA 4CHUA 4L9TA 2J5OA 3WTZA 1IF1A 3C18A 5BS6A 4AIHA 4ENJA 2P8TA 5D6FA 4RAYA 1ZGJA 2EB7A 2QQBA 1G3YA 1SFUA 4UHTA 4LG0A 5K5RA 4H0EA 2TDXA 1B6AA 4HZFA 5DCMB 1KU9A 1B59A 2KIFA 4XBFA 2P6SA 1U5TA 3K1PA 2IT0A 5HOOA 3L2CA 4WK8F 5HDKA 1K79A 3DXJF 5BOXA 3BOQA 1ZGAA 1IRFA 5AIQA 3I5UA 3KCCA 2QQAA 2NS0A 1FX7A 3B02A 3T8RA 1F9NA 1YG2A 5E20A 4AIJA 2RDPA 5LEKA 2A68F 1HBXG 2PFBA 3SQNA 4P9UA 2E1NA 3I64A 2JZYA 3MCZA 2RQPA 4BXUA 1OYWA 4EGYA 3FXRA 1BI1A 2E1CA 5ILUA 4KIGA 2FQ3A 5DEQA 3KLNA 1LNWA 4ZYDA 3WTUC 4UV9A 4A6DA 1TLHB 2A61A 2P5VA 3JTHA 3BPVA 2EJRA 4HDVA 1FSEA 3I71A 2XVCA 2IPQX 5E1WA 1R00A 2D45A 4LD5A 2XASA 3U2RA 1R23A 3WE2A 4MQVA 2XGXA 4NHJA 3DEUA 3J81K 4S04A 3V8JA 1ZLKA 4LJZF 3EQLF 1Z7UA 2P5LC 1ZHFA 1BC7C 1FBQA 5D6EA 4A0ZA 5L3GA 2C6YA 5HS7A 3WTXC 1ZRFA 1R5GA 4UXNA 1UHWA 2GA2A 3LFKA 2XHKA 2EFNA 1R58A 4BYYA 4HLXA 3T1BA 2JPCA 1T38A 4OOIA 2M8EA 1IZ1A 4L9JA 1MGTA 3K1NA 2VBZA 3HSFA 4G8XA 4IRIA 4HQMA 3ZMDA 4LK1F 1FP1D 3JSPA 2KJCA 3L09A 1J0RA 3O6BB 1J59A 4KIBA 2HEOA 3QPHA 5CVJA 2FA5A 2DLLA 2MC3A 4AVPA 1P92A 3IRQA 1K78B 2CO5A 1CF7B 2QQ9A 5J8CA 1H9GA 3ELKA 5A2QK 2XAGA 4M6XA 4Y17A 2KKOA 4HF0A 3GFJA 5JR3A 1XGNA 2O3FA 1O3RA 1W7PD 4WF2A 2P6TA 2QENA 1WWXA 4G94A 1FY7A 2QM3A 1EV7A 1LDKB 3MQ0A 1IAWA 1YS7A 3KE2A 3KP2A 1HXDA 3GFLA 1XGMA 3DQVC 4HW0A 1RNLA 4HBLA 2PI0A 3DV8A 4HV5A 3RIRA 2Z5UA 1BC8C 3KP7A 3ZMVA 5F64A 1X3UA 3CLOA 4LFUA 2XAHA 4AWXB 4Q4ZF 2G9WA 3IL2A 2ELHA 4GO1A 3BWGA 4G6QA 3AAFA 2YU3A 4N9IA 4GYIA 2RC4A 4B09A 2FE3A 1B1BA 3CTAA 4O3MA 1MDMA 3WU0A 3IKVA 1TQIA 2BYVE 1JXSA 1U6GA 4M9XA 2MLGA 1JHFA 1KU7A 3E6MA 2EV0A 1J7KA 2XRNA 4ZYEA 1Z91A 4IRGA 5BMZA 1S8NA 5FB2A 1FNNA 2ESNA 3Q5FA 4JBAA 1T39A 3R61A 3GZ6A 5LRRA 5J8FA 3TOAA 2KIMA 3CUQB 5IT9K 2UXNA 2HTJA 1W4MA 5KVRA 3LA3A 2H6CA 1D8KA 2GQQA 2IA0A 3HSEA 1YW9A 1EH6A 4R79A 3K1MA 1K7AA 2XV4S 5L3BA 1FBSA 3J80K 3TQNA 4A5NA 1P4WA 1ZARA 3E3VA 3GVAA 3BP8A 4BHBA 2YPRA 1D5VA 2X0LA 1LDJA 5JHUA 4L18B 1STZA 4UV8A 5DDGA 1U5TC 5ICGA 3M7GA 4I0BA 2FF4A 2GXGA 2Q0OA 4KMUX 1S29A 3P9KA 5LEJA 3HRMA 3F72A 4OIRF 5BPDA 3ECOA 4RB1A 1P6RA 1RUNA 2QYOA 2BGCA 1JHHA 1FSHA 2Y75A 2XUBA 1XMKA 1HW1A 4PGGA 3LWFA 5D8LB 2YSRA 2F5EA 1EH7A 4I0AA 1XDSA 1AOYA 4EMSA 2VONA 1BBYA 2PG4A 5E18F 5FLXZ 2M45A 3TDZC 5ILVA 4CDGA 2LKPA 2PN6A 2BEOA 1ODDA 2H94A 4MNUA 4XRFA 5JI6A 3FMSA 3M8EA 1XMAA 3RYRA 2O6GE 3D0SA 4EQQA 4ZYHA 3ZMTA 1B4AA 5DD4A 2CGPA 2ZKZA 2W84A 4M6YA 4KN4X 1FYKA 4ZZDA 2DQLA 2EFWA 1J75A 2UWMA 3T0YA 2F5FA 1ZLJA 2VOPA 1FC3A 3ZMSA 3P7NA 3K9TA 1P4XA 2AXLA 4HX8A 2ZO4A 1I1GA 1UHMA 1KU3A 3F8BA 3KP3A 2O0YA 2P7VB 3MZYA 3HOSA 1HKSA 3M9AA 2QZ8A 3M1EA 1QGPA 1SAXA 5L3FA 1FWZA 4U0WA 4WWCA 2ZJ2A 4EJUA 1R5HA 4WXCA 2D1VA 3HRUA 1F5TA 3EUHA 5D5XB 2CWEA 1D3YA 3FXQA 1IN6A 1KYZA 5E17F 4Q47A 4WX9A 3ECHA 5HS8A 3GO5A 1YS6A 4M74A 2VXZA 4RGXA 2LF7A 1FYLA 1SD7A 3PQKA 2HKXA 4U0VA 1O7LA 4OINF 3HUGA 4EM0B 4PZJA 2STTA 1Y0UA 3V4GA 4EJTA 4NB5A 1PUEE 4XLNF 2B0LA 3I4PA 4IJAA 2A5YB 1XGSA 1T98A 4LG0B 3HTSB 4FT8A 2L01A 1A04A 1P4AA 3DKWA 3Q9VA 2D1HA 1KA8A 2ZNYA 4RB0A 2PMHA 3RI4A 4KNYA 2Z99A 5HDGA 4IHSA 1PDNC 2HFHA 2OBPA 3CO6C 1MD0A 5DCFA 3BJAA 1XCVA 4U0YA 4P5OA 2ZBKA 1BIAA 3J80Z 3KEOA 4XSZF 1FZPB 4I09A 2EFPA 1HSJA 2DO7A 2LNBA 4IHTA 3I58A 4PGHA 1KU2A 3VODA 1LEBA 3LSTA 3TO7A 2Z3YA 1Z1DA 3TDUC 2FU4A 4RS8A 1USSA 2YR2A 1FYMA 4Q5SF 1WKMA 2V1XA 5E1XA 1ON2A 1YFHA 5JVTA 5FLXK 5KK1A 5D5UB 3GF2A 2W85A 3V7SA 4ENKA 2DU9A 1O57A 3ZN0A 3E6BA 2V6CA 5HVQC 1HKQA 5BPIA 1T6SA 2R3SA 1YYVA 2YX4A 3QRFF 2QWWA 2FSWA 1W7PB 2IVMA 4O6JA 1MJAA 1QNTA 2PJPA 5DD8A 3C3WA 1L3LA 4EJVA 2J5PA 1I27A 1KYWA 2IP2A 3G73A 3MFKA 3HRTA 5DUKA 2P7CB 3NEUA 3GFIA 5L3CA 2DFIA 2VC0A 2ZNZA 5HLIA 2PBIA 1F1ZA 4R8HA 3V8LA 1G3SA 4R1HA 5H20A 2EWNA 4M73A 4Y13A 1D8JA 3JAMK 3WGHA 4KT5C 3QAHA 5L3EA 2W57A 4RGSA 4IXAA 5LHHA 1YW8A 1RI7A 1TNTA 3F8MA 2MH2A 3F8CA 4RB3C 4IRHA 1Q1HA 3E97A 2K4JA 2LF8A 1IXCA 1GXQA 2H27A 3NQOA 3PQJA 4N0BA 4FHTA 3HHGA 1U8RA 4OMZA 4A0XA 2EFQA 2DT5A 3F6VA 2EV5A 4CZZA 4LB6B 2V1UA 4G9YA 3H3UA 1IUYA 2MLKA 3VEPA 3ZMZA 1XDUA 2Q2EA 3R0AA 1HW2A 1YIOA 1HW5A 4CGZA 2V1DA 2E7XA 1S7OA 5LHIA 4I01A 2ISZA 5K5QA 2AS5F 1TW2A 2DK8A 2HDCA 3TGNA 2OZ6A 3DFGA 5EEHA 2OQGA 1TNSA 2RVCA 1TQMA 3CDHA 1ZN2A 1JE8A 4U7DA 5FD6A 3D5LA 4LMYA 1BI2A 1USTA 2HYGD 4WXHA 2PEXA 4M72A 2OU2A 3MEXA 1XB4A 2HR3A 3LQRA 2M1BA 4XSXF 5LLQA 5CVIA 3I53A 2A6EF 2Y0MA 1IXSB 5H6RA 4G7HF 3RTRA 4M71A 3PFIA 4MEYF 3F6OA 5ICCA 1YTYA 1Z05A 2M87A 1LVAA 4OU0A 3F23A 2Z9OA 1LQ1A 2MBFA 4I02A 5E1ZB 2CSOA 2CW0F 2FNAA 5EEGA 3ERED 4HX4A 2JSCA 2W24A 1UFMA 3HIFA 2MH9A 2HWVA 2O61A 4KA4A 3R0JA 4I7HA 2GXBA 5BQTA 1ON1A 4GGGA 4BHPA 1K6OA 5AONA 1SFEA 4HYEA 5LGNA 1TW3A 2HTSA 4GXOA 4LB5A 4UVAA 2DTRA 1UCRA 3FHZA 5AIPA 2ESHA 2GIVA 2K02A 2FEZA 2FNPA 2GWRA 1F4KA 4EM2A 1G4DA 3WTTC 4HOBA 2DI3A 3SZTA 2VOOA 3FX3A 1SFXA 4M9SA 2A6HF 5D5VB 2P4WA 1BN5A 1XSVA 4XLPF 4KMFA 3HHHA 4LLNA 1ZH5A 5LGTA 1L0OC 2A69F 4E70A 2GZWA 4OIPF 2RKHA 3GX4X 3ISPA 2K7LA 1V3FA 2ACJA 5E8IA 1G3TA 4HF1A 1TTYA 3WTYC 3HOTA 4YIFA 2VN2A 3JAMZ 2FOKA 3E6DA 4EM1A 3OOPA 1IN4A 3GW2A 3EDPA 5K5OA 2RGVA 2FBKA 2F5CA 4YFXF 1RUOA 4GYGA 4A5MA 2PMUA 1Z9CA 1OR7A 3JSOA 4HLYA 1KGSA 1GVJA 2VBXA 3KZYA 2QBYA 1ZG5A 3GUDA 4IF4A 3GFMA 2XAQA 5D8KB 4HF2A 4PCQA 1R1VA 2KIUA 1GXPA 2V79A 2W25A 4MTDA 2FMYA 6PAXA 2H6BA 2EFOA 2QLZA 1HSTA 1MZBA 3FF5A 3NRVA 2IJLA 4A2UA 1T2KA 4ON0A 3HSRA 1SMYF 1E17A 2IA1A 5LGUA 2EA2A 1W7PA 2O8XA 3WE3A 2G7HA 2Q8KA 2H09A 1QPMA 5CVVA 3WU1B 4DNCA 5LBQA 1DPUA 3KLOA 4IVNA 4KICA 3F8FA 1KQ0A 3E6CC 1R1UA 4GCVA 3IKTA 2CQKA 3VFZA 5ICEA 1O3QA 3VOEA 2HOEA 3LQQA 2BV6A 2FBHA 3FMRA 4P55A 2WWYA 1W5TA 3IC7A 4OIOF 3RJPA 2K4BA 5K1YA 2HKOA 5FFZA 1G3WA 3CUOA 3U1DA 5A2QZ 3KZZA 1FBUA 3WODF 3GEZA 2BBYA 3W6JB 3TO9A 1IN8A 2IA2A 2M5WA 3WTSC 2UZKA 3OV8A 1ZYRF 3ZPLA 4L9NA 2XROA 3REOA 1I6XA 1QBJA 4ESFA 1HKTA 4HAMA 2KRFA 3RKYA 3SFZA 2NNYA 4LLGF 2CYYA 3WG9A 3ML6A 4PDKA 4LLLA 3N4MA 1ZAOA 3CUQA 4MHGA 2OD5A 2NNNA 3SZPA 1BI0A 4L9VA 3HTUA 1ZG3A 3ZP5A 1WSUA 1S7AA 3E5QA 1EH8A 2Z33A 1PP8F 1ULYA 1DDNA 2HQNA 4EV0A 4ZH4F 1U2WA 3GLXA 3V7RA 2ADUA 4B8XA 1Z6RA 3MZHA 1H9TA 2D2WA 1AWCA 4BH9A 2JPBA 1REPC 2R7DA 2YX7A 3R60A 3J81Z 1J9IA 2FBIA 1XN7A 3IWZA 3I59B 1IN5A 3KP6A 4Y15A 3BJOA 1Z6TA 4IPAA 2L02A 5FGMA 3F8NA 4WCGA 4HV6A 4MEXF 2A3SA 2VBYA 3K2ZA 1TQPA 4AIKA 5F6FA 5CLSA 3KFWX 2X4HA 3SHFA 2MD5A 3O3KA 4G6DA 2VC1A 1U3EM 1B9NA 4EJWA 1KQ8A 1FP2A 5ERIA 3F21A 4UVCA 3CO7C 1B9MA 3HRSA 4HX7A 2RNJA 3LA7A 3WGIA 2XKOA 4ZZLA 4LGWA 3C7JA 3QU6A 2V9VA 4S05A 2E7WA 1K78A 2PLYA 4EVIA 1PP7U 4CICA 4BHCA 2EK5A 4ESBA 5D4RA 2ZFWA 3RPQA 4K2EA 2LSOA 2NYXA 3QP6A 3DPTA 4O5VA 4CXFA 3E5UA 5ILSA 2DBBA 4A12A 1OMIA 4BQAA 3ZQ7A 3BROA 4AD9A 3KP5A 2A07F 3K0LA 3TO6A 4M9ZA 1E2XA 1IN7A 3L00A 2JTVA 3LAJA 1S6LA 1YQAA 2GAUA 1T0FA 3RKWA 5LRSA 1FOKA 4U88A 4L5JA 3JTGA 3K69A 4YIIA 3QU3A 4KIFA 1O3SA 5HDNA 1QZYA 5HLHA 2ZCWA 4MTEA 4RGUA 1VTNC 4MGRA 1MDMB 1ZRCA 3QOPA 3FXUA 1SMTA 3EETA 2JRTA 5ED4A 2FRHA 2HQRA 2HGCA 4QLCU 5IT9Z 3C1DA 2LDUA 5D5WB 2R7FA 1JGSA 1G6NA 3DPLC 5D4SA 2JT1A 1FT9A 2OA4A 2MA3A 4Z2YA 4KFCA 3M8FA 5DV5A 3IHUA 2IW5A 1ONVA 2CFXA 3BDDA 2PQ8A 3FWEA 5J6XA 4HA8A 4KDPA 3T8TA 2NAZA 4RGRA 1MKMA 5CVRA 4L0YB 1GHCA 1YW7A 1U5TB 1WI9A 2G7UA 3H3ZA 4OIQF 3LAPA 4I98B 2DQRA 2STWA 1IRGA 3HYIA 4ZYGA 1DUXC 2O03A 3T5XA 4F7ZA 4HDUA 2WTEA 3RDIA 5F1RA 2DPUA 3EYYA 3MWMA 2L4AA 4A0YA 5TRDA 4UUVA 1FLIA 2VBWA 2FMLA 4ASNA 4JQFA 3ABTA 2RN7A 2DW4A 3TKYA 1I5ZA 2GA1A 4JK1X 4BAYA 1ZREA 2ISYA 3O2PE 3KP4A 1CGPA 3BY6A 4YG2F 4ENMA 1OYIA 5TJJA 1U78A 2OZUA 4RB2C 2HS5A 5HLGA 1MJ9A 2IRFG 4HQEA 3G3ZA 1XSXA 1NHAA 3J7AO 4FX0A 3WGGA 4G7OF 3IRRA 1TBXA 4YFNF 3GYHX 2K86A 3F3XA 4RAZA 2Y48A 4LK0F 4YFKF 2XIGA 3FM5A 5JFRA 1SD4A 3GZ5A 2EV6A 2F2EA 5L3DA 3KETA 4ESJA 4Q48A 4MQ9F 5DUIA 1LB2A 4EGZA 3U9GA 3ROUA 1QZZA 1W5SA 3I59A 5E8GA 3W6KB 4A6EA 3ABUA 2QBYB 4QWQA 2HZTA 2OAZA 1XGOA 2HYFA 2FXAA 3F22A 2XAFA 3KEQA 1LEAA 1IW7F 1XD7A 4CYDA 1IXRC 1R1TA 2P5KA 3RPUA 2VT2A 1O7FA 1UB9A 2BE5F 1I1SA 3FMQA 2WV0A 3DP7A 2L54A 5ICFA 1YO5C 1WRJA 2NRAC 2COMA 1FPQA 3GXOA 4BNCA 4L5IA 1O3TA 3L9FA 1OKRA 1BOAA 1XCBA 2DPDA 3QP5A 3QPTA 3BZ6A 1P2FA 1R22A 5DCMA 4P96A 5DYMA 3P9IA 2L3DA 1R7JA 1DPRA 5HS9A 2CG4A 5FO5A 1OYYA 2QUFA 2L4MA 2XAJA 3B73A 3BJ6A 2VT3A 3R4KA 2ZMEA 3ZN1A
chains in the Genus database with same CATH superfamily
3IWFA 4A3EJ 5H6QA 1G8XA 4B3XA 2F5DA 3HOVJ 3ZMUA 2EZIA 2ZXJA 2DK5A 3JW4A 1X1PA 2VI6A 3FZVA 3OYBA 5CJ9A 5IT3A 2KMUA 3ZRGA 3WTWC 3F9KA 4E7HA 2GLOA 5GADJ 1KQ9A 2LY9A 1V4RA 1J5YA 2MW8A 1SD5A 2XKPA 3KEYA 2EIJH 2L9RA 1YRNB 2H8RA 4KUMA 3CJNA 2CW8A 2OC6A 3EYIA 2ETHA 3DCFA 3SXYA 3JRBA 3H0GJ 1T08B 2R93J 2ID6A 1SD6A 4AM3A 4UB8C 1BM9A 1JTYA 3FM3A 5M5WJ 1H0MA 2K3FA 3COAC 3I0TA 4PJ0C 4WXDA 2CV2A 2WC2A 2F4MB 2HXOA 1ETVA 4CO8A 3WTVC 1HQCA 2O9LA 4E7JA 2UXXA 4I2OA 3GWZA 3S2WA 1YLFA 4IKFA 2QVOA 3HG9A 1XSDA 1RIOH 1R36A 2VQGA 1DU6A 4L0ZB 1MJBA 4EJOA 3BPXA 4P9FA 3Q9SA 1J2XA 3LA2A 3H9GA 2IS1A 2M4KA 4G7ZF 2ZMEB 1LDDA 3RPUD 1K61A 2D5VA 3K7AJ 2Y69H 3L7WA 3OYAA 2R5ZA 3PM1A 3CUQC 4DQ2A 2LMDA 3MAJA 4JX5A 2OQRA 2E2HJ 4A3DJ 4TV7A 3CMMA 2VE8A 2EA4A 2HXIA 3G4SI 2DA4A 2I10A 3JRFA 3V8KA 1BIBA 4ZTFA 3ZCOA 1CF7A 1BJAA 4FISA 2EH3A 4FX4A 5GP9A 3CC7I 3P9CA 2OCEA 1QQIA 4UVBA 4KYWA 2NOGA 3K4KA 2KDZA 1C0WA 3Q0VA 1R6RA 3I54A 2VODA 2FQ4A 3G6EI 1E3PA 3GTMJ 4X6AJ 4UNOA 4ETSA 3R6SA 4N9HA 5FFXA 3OYEA 1QO0D 1DP7P 1N75A 5CYVA 3H0DA 4GFBA 1OJLA 5LHGA 1OR7C 3VDXA 2M3AA 2XAUA 2RV8A 1S3JA 1BOBA 1WQ2A 3N97A 1XX5A 3GLLA 2VE9A 1SC7A 1BI3A 5CPRB 2K27A 2DAOA 2WBMA 4ENNA 2M30A 4NQWA 4U7BA 1ZG1A 1VZ0A 1LE8A 3TEDA 3ULQB 3V7CA 5EDNA 1O4XA 2CFOA 4PJNA 4NNJA 1RZ4A 4KN7X 1OPCA 5FD5A 3H92A 5CVUA 1ZRDA 3MKYB 5C4JJ 3H1CA 3E5XA 1ZR2A 1NG6A 3RKXA 3RYPA 1FTZA 2OTLI 4IZZA 3C2BA 3DLLF 4HRIA 2KJBA 3I3LA 2LBFA 3TMOA 3VB2A 1IDYA 5GTHC 3AKZA 4QPQA 2E71A 1LPQA 3G1MA 2BY0A 3DF8A 4BEHA 1SFOJ 2Q1ZB 1LJ9A 3OYHA 4EATA 4D0PA 3TOBA 4OMYA 4CHUA 2X85A 4L9TA 2J5OA 3DU6A 3I56I 2NXNB 2KFDA 3HC7A 1QRYA 2GM4A 3WTZA 1IF1A 2VQCA 3SZGA 1G59A 3C18A 5BS6A 4AIHA 4ENJA 4II2A 1TL8A 2P8TA 5D6FA 4RAYA 3G2BA 1ETKA 2WA0A 1ZGJA 2EB7A 2QQBA 1G3YA 3JRIA 1SFUA 4UHTA 4LG0A 1RESA 3FK7A 5E3NA 5K5RA 2TDXA 4H0EA 1B6AA 2M0MA 4HZFA 5DCMB 1K4SA 1KU9A 1B59A 2KIFA 4XBFA 3ZQHA 2P6SA 1U5TA 5FKNA 3K1PA 4ZC3A 2IT0A 3AG2H 3NARA 2ZXHA 3ESWB 5HOOA 2H1LA 3P5JA 3N05A 3QOEA 4FCYA 3L2CA 3OYIA 2IGOA 5HDKA 4WK8F 1K79A 3OS1A 2ECCA 3DXJF 5BOXA 2JA7J 3BOQA 3CCRI 2DMPA 1OCPA 1ZGAA 2E34A 2R7XA 1IRFA 5AIQA 3I5UA 2JMWA 3KCCA 2QQAA 2R7TA 2NS0A 1FX7A 4C3JJ 3B02A 3T8RA 4RM3A 1F9NA 1YG2A 5E20A 4AIJA 2RDPA 5LEKA 2QF7A 1VQKI 4BE0A 2JUCA 3LSJA 5E3OA 1YE9A 2ZSHB 2V9KA 1X1CA 2A68F 1HBXG 4DGWB 2PFBA 1ITYA 3CP2A 2L7KA 2GOXB 1VNDA 3SQNA 1V5FA 3H5RA 3TW6A 3KIOA 5J40A 4NDLA 1VQ8I 4P9UA 2E1NA 1WPKA 3I64A 2JZYA 4XKCA 3MCZA 3UKGA 1BR2A 2RQPA 4BXUA 2CMPA 1OYWA 3S2DJ 4EGYA 3FXRA 1BI1A 2E1CA 2DOEA 1Y8QB 5ILUA 4KIGA 4PSWA 1EA3A 2R7VA 5C3EJ 2FQ3A 5DEQA 1OCCH 3KLNA 1LNWA 4ZYDA 4XNFA 3WTUC 3PNYA 1LUJB 4UV9A 4A6DA 1TLHB 2A61A 3CJQB 4CH7A 2P5VA 3JTHA 4PSXA 3TL4X 4BXXJ 4C9YA 1B72A 3BPVA 2EJRA 4HDVA 4IOAF 2R92J 1FSEA 3I71A 2XVCA 2IPQX 2GXAA 5E1WA 1ETQA 1R00A 2D45A 4LD5A 2XASA 3PL8A 3U2RA 2ZJQF 1R23A 3WE2A 4MQVA 1JT6A 2XGXA 4CCKA 3GTGJ 2LR8A 4HEA2 3S2HJ 3MKWB 4NHJA 3DEUA 3J81K 5HNHA 4S04A 3V8JA 1ZLKA 4LJZF 4DZJA 3K70C 3EQLF 4UY8I 3WHBA 4Y52J 3OL4A 3M07A 4LITA 5FLVA 1LFBA 1Y0NA 2E2IJ 1Z7UA 4IHVA 2TRTA 1Z0XA 2P5LC 2X9DA 3A0BC 3OYDA 1ZHFA 1BC7C 4W97A 1D1CA 1FBQA 5D6EA 4A0ZA 5L3GA 2C6YA 5HS7A 4XOPA 2M9HA 1J09A 3OS0A 2DFEA 3BR2A 4MFEA 3WTXC 1WJFA 1ZRFA 4BACA 1R5GA 4J19A 4UXNA 1UHWA 2GA2A 3LFKA 2XHKA 2EFNA 2F4IA 1R58A 5E79C 1P7JA 5B1BH 4BYYA 4HLXA 3FXKA 3T1BA 2Z1DA 3DTKA 5J3LA 4KITB 2JPCA 3S32A 3TW7A 1T38A 4BY7J 2K9NA 4OOIA 5JHFA 2IGNA 2M8EA 2KRCA 2PJRA 1IZ1A 4L9JA 1MGTA 2X1DA 1BW5A 3K1NA 2VBZA 2G0EA 3HSFA 4G8XA 4HG2A 4HQMA 3ZMDA 3OYFA 1U8BA 4IRIA 4LK1F 1FP1D 3VSKA 2UUZA 3JSPA 5IY5H 1MBJA 3I9V2 5EZHA 5IYCJ 1EJ9A 2NS8A 2KJCA 2VKDA 3L09A 3KZIC 3IP4B 1J0RA 3O6BB 1R71A 1J59A 4KIBA 2JA5J 2HEOA 1E3HA 3QPHA 2JA6J 5CVJA 2FA5A 2L5QA 3ONQA 2DLLA 2MC3A 5J47A 3DEWA 5DS9A 1ZGWA 5KAFC 1MBKA 4AVPA 1NG7A 3HKZA 2HVRA 1P92A 2JSPA 2VKEA 3FHNA 5KAIC 2BW3B 3HL2A 2QGUA 3IRQA 1QPIA 3LOCA 2K40A 3FBIB 1K78B 2CO5A 3ZXSA 1CF7B 4N4NB 2QQ9A 5J8CA 1H9GA 3ELKA 5A2QK 2XAGA 4B3AA 4I76A 2K5CA 4CCJA 2VKVA 4ZDOA 3IUOA 1X1DA 1QVTA 2BVLA 2R5ZB 4B1RA 4M6XA 4PJLA 4Y17A 2DA3A 4A3KJ 1FIPA 2WY7Q 2KKOA 2JQ7A 3SEZA 4HF0A 2V1NA 3GFJA 5JR3A 1XGNA 2O3FA 4OAYA 1O3RA 4FE4A 1W7PD 4WF2A 5IOZA 1RKWA 4DOZA 1R9TJ 2XC7A 2P6TA 2YUSA 1MBFA 1V54H 1WWXA 2QENA 4G94A 4A3MJ 1FY7A 2QM3A 3K4CA 1A6QA 2CRGA 3RZOJ 1EV7A 1LDKB 3MQ0A 1IAWA 1YS7A 1K83J 3KE2A 1JUSA 1RRJA 2E5ZA 3KP2A 1HXDA 3GFLA 3PUBA 1XGMA 2X48A 3DQVC 2CV0A 3H9JA 2EZLA 3S16J 4U87A 4HW0A 1ORKA 3BG3A 1RNLA 4DIQA 1JKOC 4HBLA 2PI0A 3DV8A 4HV5A 3K4MA 3HXLA 5H2FC 3RIRA 2Z5UA 2CQQA 2PX9A 3B6CA 1BC8C 4M6VA 3KP7A 5GPCA 3ZMVA 5F64A 1X3UA 2XGEA 3CLOA 5J1UA 4LFUA 2NVUB 1PUFB 2F48A 4A3BJ 2X1CA 2XAHA 4AWXB 4Q4ZF 5DTDA 2G9WA 3IL2A 2ELHA 4GO1A 2LKXA 3BWGA 4G6QA 2QA4I 4E7LA 2AQEA 1EKEA 3AAFA 2GIZA 3M8JA 2YU3A 4N9IA 1FEXA 4GYIA 2RC4A 4B09A 4B47A 4X0GA 4XQFA 3A03A 2FE3A 3FDYA 2HOTA 1B1BA 3CTAA 3DKXA 2FX0A 2ELKA 1JGGA 4NBQA 1MBHA 1FTTA 2TCTA 2DFHA 5IPAA 4C30A 2QCOA 1MDMA 4O3MA 4KJZA 3WU0A 4BJ6C 3IKVA 4FASD 1TQIA 4XK4A 1GV2A 2BYVE 4L5EA 4CZCA 1JXSA 1U6GA 4M9XA 2MLGA 1JHFA 1KU7A 3D5RC 3E6MA 2EV0A 3BR0A 1J7KA 2XRNA 3AG3H 4RLQA 1VI0A 4ZYEA 3HGYA 1BJZA 1Z91A 1WH5A 3DLAA 4IRGA 5BMZA 1S8NA 1SEUA 5FB2A 1FNNA 1ZTRA 2ESNA 3PNTA 2ID3A 3Q5FA 4JBAA 3BT9A 3CCYA 3W2AA 1K6YA 1T39A 3R61A 4KISA 3GZ6A 4JP0A 2CQXA 5LRRA 5J8FA 2H8WA 3TOAA 2B63J 2KIMA 3CUQB 5IT9K 2UXNA 4BY1J 2HTJA 1W4MA 2HYJA 5KVRA 1IC8A 3LA3A 2H6CA 4E7ZA 1D8KA 2GQQA 3K4JA 3K4BA 5EZGA 2IA0A 3HSEA 1YW9A 2VXDA 1EH6A 1U9OA 4R79A 3K1MA 1K7AA 1MMGA 2XV4S 3I4NJ 5L3BA 1FBSA 3J80K 3TQNA 4A5NA 3HUGB 1P4WA 1ZARA 3E3VA 3GVAA 3ZQQA 3BP8A 4BHBA 3HGGA 2YPRA 1D5VA 1BR1A 2X0LA 5IOYA 4C2TA 2DA7A 1LDJA 2DN0A 5JHUA 4L18B 2ZC2A 1STZA 2X6YA 4F91B 3L2VA 5K7FA 4UV8A 5DDGA 3OS2A 1U5TC 2NVYJ 5ICGA 3M7GA 3HJEA 2VJIA 3GTJJ 4I0BA 2FF4A 1S7EA 2GXGA 4D5CA 3CCUI 2Q0OA 4KMUX 1S29A 3P9KA 1PJRA 5J4VA 5LEJA 2Q2EB 3HRMA 2CU7A 3OMYA 3FBNB 3F72A 4OIRF 2PJRB 5EGOA 1MMSA 3H3VK 2AHQA 4DZPA 3ERMA 5BPDA 3Q0UA 2F5VA 3ECOA 4FETA 4RB1A 1LVKA 2DA2A 1P6RA 3BCAA 4E4HA 3JRHA 1NTCA 1RUNA 4A3IJ 4V2FA 2Y9YA 2DA6A 2QYOA 2BGCA 1JHHA 2XSJC 2DA1A 4F55A 1FSHA 2VKHA 4DYRA 2Y75A 4ZDLA 3RQ4A 5EJCA 1D1BA 1UELB 2XUBA 4CSWA 3OL3A 1XMKA 3A01A 1HW1A 4PGGA 2OF7A 1JT0A 3LWFA 1IRXA 3O8HA 3LSGA 3SDBA 2EIMH 2YSRA 5D8LB 2F5EA 2KZGA 1EH7A 1LE8B 4I0AA 1WJ5A 3HOWJ 3CCJI 4C3HJ 3MKLA 1XDSA 2ZB9A 4DBRA 1S9HA 2IGMA 4EMSA 1AOYA 2VONA 1BBYA 2PG4A 2IS4A 5E18F 2VIXA 5K7HA 5FLXZ 5LFAA 4EEFG 1MNEA 1Z67A 2LOOA 2M45A 3TDZC 2M2EA 4H4KC 5ILVA 1AU7A 4CDGA 1Y6IA 2LKPA 2PN6A 2BEOA 3J7ZI 1ODDA 2H94A 4MNUA 4XRFA 2O8KA 2O5RA 5JI6A 3FMSA 3M8EA 5CQGA 3BR6A 2V7FA 1XMAA 3RYRA 1WVRA 3TP0A 3CCQI 2ELJA 3PNVA 1BL0A 5DM6F 2P0WA 4IL6C 3D0SA 2O6GE 4EQQA 3J7AY 4ZYHA 3ZMTA 1B4AA 5DD4A 2CGPA 2ZKZA 2W84A 4M6YA 4KN4X 1Y56A 2RAEA 1FYKA 4ZZDA 1TWCJ 3L2UA 2DMNA 2XSDC 3BTLA 4OWRB 4XKWA 2DQLA 4BE2A 2E1MC 3GTOJ 1JUPA 2EFWA 1J75A 2UWMA 3T0YA 4J01A 4NUBA 2F5FA 3FXLA 2DDAA 2ZSIB 1ZLJA 2KHMA 3M4OJ 2VOPA 3JCUC 1FC3A 3ZMSA 3P7NA 1DQUA 5FLMJ 3K9TA 1P4XA 2AXLA 3JRDA 4HX8A 2ZO4A 1I1GA 1S5LC 4IHWA 1UHMA 1KU3A 3F8BA 2DMTA 1WHUA 3KP3A 2O0YA 2P7VB 3MZYA 4JX4A 3HOSA 1PYVA 3L2WA 1HKSA 3M9AA 1WZ2A 2QZ8A 3DEEA 2DYRH 3M1EA 5GTIC 1FJLA 1QGPA 3K10A 1SAXA 2CH0A 2NVQJ 1MH4A 5L3FA 1FWZA 4U0WA 1Z3YA 5JLXA 2VJ5A 4WWCA 2ZJ2A 4EJUA 1DGWY 1R5HA 4WXCA 1BA5A 2D1VA 3OR2C 3HRUA 1F5TA 3EUHA 5D5XB 2CWEA 1D3YA 2MC4A 3FXQA 1IJWC 1WJEA 1IN6A 1KYZA 5F0CA 5E3LA 5E17F 4Q47A 2JVHA 4WX9A 1D1AA 2DTZA 1IUFA 3ECHA 3OYMA 3E7LA 5HS8A 1MNMC 3GO5A 2DXIA 1YS6A 2EPFA 1YX3A 4M74A 4CCNA 2VXZA 4BE1A 4RGXA 1LFPA 2LF7A 3GCMA 3FKJA 4IOCF 2WY8Q 1FYLA 1SD7A 1UHSA 1FMWA 2HKXA 3PQKA 2P81A 3CDIA 1O7LA 4U0VA 2V6EA 1TWAJ 3AG1H 4OINF 2MABA 3HUGA 4EM0B 4PZJA 2CS3A 2STTA 2XGCA 1Y0UA 1DGRM 1W0UA 1VF9A 2XB5A 3V4GA 3CC2I 2CUZA 3IH2A 2WAQN 5J1YA 2N8GA 4F3QA 2L2OA 4EJTA 4NB5A 1PUEE 4XLNF 2B0LA 3I4PA 4IJAA 2A5YB 1XGSA 1T98A 2LH9A 1SVOA 4LG0B 3AL0B 3HTSB 1MSFC 5M5YJ 4FT8A 2L01A 1A04A 3MD2A 1P4AA 2XF7A 3DKWA 1NK2P 2HOSA 3Q9VA 2L9NA 4JYKA 2D1HA 2E1MB 4NC8A 4A3FJ 3OYLA 1RPWA 4XOTA 1KA8A 2ZNYA 3I4MJ 4RB0A 3S17J 2PMHA 3GBGA 3PSIA 3RI4A 4KNYA 2R7OA 1R4MB 4BDYA 4BDZA 2Z99A 3VSLA 5HDGA 4XLCA 4IHSA 2OBPA 2HFHA 1PDNC 3K70D 3CO6C 1MD0A 5DCFA 4DBQA 1IGNA 2BXZA 2L9SA 2LRDA 3B6AA 5GAGJ 2BY3A 3FXJA 3BJAA 1XCVA 2KPMA 4M3DA 4HNUA 5FRNA 2HVSA 4U0YA 3GMEA 4P5OA 2ZBKA 1BIAA 2EILH 3J80Z 3KEOA 4XSZF 1FZPB 4I09A 2EFPA 3WHCA 1WJAA 1FMVA 1HSJA 2DO7A 2OPTA 5F27A 2LNBA 1A35A 4IHTA 3I58A 4PGHA 1KU2A 4LG3A 3VODA 1LEBA 3LSTA 3TO7A 2Z3YA 3HBLA 2M4GA 3OYCA 2CQNA 1Z1DA 2KIQA 4M3GA 3TDUC 2FU4A 2A05A 3FISA 4RS8A 2KZVA 3S8PA 4XKVA 1USSA 3MZ8A 1X2NA 1YJ9I 1M1EB 4IHYA 2YR2A 1FYMA 4Q5SF 1WKMA 2V1XA 3H36A 5E1XA 1EF4A 2OCCH 2RREA 1ON2A 2OV7A 1YFHA 5JVTA 5FLXK 5KK1A 2W4SA 5D5UB 2BY1A 3GF2A 2W85A 3V7SA 4ENKA 2DU9A 1O57A 1MH3A 5C4XJ 2EBIA 1ZELA 5C44J 3ZN0A 2E35A 2V6CA 3E6BA 5HVQC 3A0HC 1HKQA 2DYSH 5BPIA 5BNGA 2UV1A 4XR6A 1T6SA 2R3SA 4UB6C 1YYVA 4BQNA 2YX4A 3QRFF 4ZTJA 3BG5A 2QWWA 5HODA 3HDDA 2FSWA 1W7PB 2IVMA 1QZEA 4O6JA 1MJAA 1QNTA 4ZDPA 3HOUJ 2PJPA 5DD8A 5FKOA 3C3WA 1L3LA 4EJVA 2LREA 3W6VA 1SAUA 4XRSA 2J5PA 1I27A 1KYWA 4D9JA 2IP2A 3G73A 2I5UA 3MFKA 2AXTC 3HRTA 5DUKA 3OSFA 1RKTA 2P7CB 3NEUA 4D1QA 3GFIA 1WH7A 5F0FA 5L3CA 2DFIA 2VC0A 2ZNZA 5HLIA 5KNLA 2PBIA 3OYKA 3OSGA 1F1ZA 4R8HA 4PK4A 1X4OA 3V8LA 2LKSA 5J4YA 1G3SA 2EQRA 2R5YA 1P9QC 2MFZA 4R1HA 5H20A 1IG7A 5EG0B 2EWNA 4M73A 5EYRA 3I55I 3VYSB 2VUMJ 4Y13A 1D8JA 3JAMK 1UAAA 1MNDA 3WGHA 1F36A 2K9SA 4KT5C 2LD5A 3QAHA 5L3EA 2W57A 4IEJA 1RETA 4RGSA 4IXAA 3PIPF 3A1YA 5LHHA 1YW8A 3KYLA 1RI7A 2K9LA 1TNTA 3F8MA 3OY9A 1WJDA 3BG6A 2K9MA 2MH2A 3F8CA 3LSMA 2HDDA 4CUGA 1H89C 4RB3C 1X19A 4IRHA 1X3ZB 2NVXJ 1Q1HA 2BHZA 3E97A 2K4JA 2LF8A 2HI3A 3FXOA 3PSFA 4A3LJ 2JVGA 1MIJA 1ZKGA 3HZJA 1IXCA 1I3AA 3HOYJ 1GXQA 2E19A 2DCEA 2H27A 3NQOA 3PQJA 4FE7A 4N0BA 4FHTA 2LC2A 3QPLA 1Z7LA 3HHGA 1U8RA 4OMZA 3ZOBA 4A0XA 1SVMA 1UJ8A 2EFQA 2DT5A 3DBRB 3HM5A 4XICA 2NOJB 3BG9A 3F6VA 5B5EC 1XS9A 1UG2A 2EV5A 4CZZA 4LB6B 2V1UA 2CUJA 4G9YA 3H3UA 1K4TA 3FXMA 1IUYA 2MLKA 3VEPA 3ZMZA 1AHDP 3CCSI 5KHDA 4C2UA 1XDUA 2Q2EA 5GAEJ 3R0AA 1HW2A 3ABMH 1YIOA 3PJRA 3SYTA 3EUKL 1HW5A 2ME0A 2WAEA 4CGZA 2V1DA 2E7XA 2NS7A 4BS9A 1S7OA 1VQPI 3CMYA 3CCVI 5LHIA 4I01A 2ISZA 3BZCA 4CYCB 1XTAA 4ITVA 5TGTA 4Y3OA 5K5QA 3CCEI 2AS5F 3RZDJ 4B43A 4NC7A 1TW2A 2DK8A 1F43A 2HDCA 3HKZN 2ZXIA 3TGNA 2VJ4A 4XN3A 2OZ6A 3DFGA 5EEHA 2OQGA 2ZXWH 2E2JJ 1TNSA 2RVCA 4BUPA 1TQMA 1JI8A 3CDHA 1ZN2A 4AYBA 2B9SA 1JE8A 2LYCA 1GT0C 1AKHB 4U7DA 5FD6A 3D5LA 4LMYA 2QSHX 3IAS2 1TT5B 2QQ8A 2AO9A 5IP9J 1BI2A 1USTA 2HYGD 4WXHA 2PEXA 3JRCA 4M72A 2QKMB 2OU2A 3TP3A 3RKQA 3MEXA 1XB4A 2L7FP 2L7MP 4RLFA 2HR3A 3LQRA 4DYCA 3ASOH 2KP6A 2M1BA 4XSXF 2MG4A 3OIPA 5LLQA 3GTQJ 5CVIA 1P7IA 9ANTA 3BLYA 2CUEA 2DOFA 3I53A 2CUFA 2A6EF 2Y0MA 4XORA 1XMXA 4MLOA 4I99C 1IXSB 3WU2C 1U9NA 3CZ6A 2R7UA 4BQQA 4AUXA 3EPZA 3Q3SA 4E7IA 1N78A 2X6XA 3SJMA 1GUUA 4F52A 5H6RA 4G7HF 2V26A 3IAM2 4UUSB 4PFPA 3RTRA 1HC8A 2KT0A 1VQOI 4M71A 2DDBA 3PFIA 4MEYF 2ZMEC 2R7ZJ 1OCZH 3F6OA 5ICCA 1YTYA 1HDPA 2WV1A 2E60A 2XPWA 3V42A 1YI2I 1W36D 1Z05A 2M87A 2JUGA 2BW3A 1TWGJ 1LVAA 3E0JB 1X4PA 4OU0A 3HOZJ 3F23A 2Z9OA 1LQ1A 2Y2ZA 5K7ZA 2MBFA 1WJCA 4I02A 2FUG2 5E1ZB 4UUTA 2CSOA 2CW0F 2FNAA 2VQLA 5J1RA 2ZJRF 3X2QH 1TWHJ 3NWSA 4HSTA 4RBOA 4BJTA 5EEGA 3CF2A 3ERED 4HX4A 2JSCA 2W24A 1UFMA 2YS9A 1V5EA 2HNHA 3OYGA 3HIFA 2NVTJ 2MSYA 5B3SH 3LL7A 2KQRA 2MH9A 2PMZN 2HWVA 3NWTA 1LKXA 2RNGA 4KA4A 2O61A 3R0JA 4I7HA 2GXBA 1YIJI 1ON1A 4GGGA 4BHPA 5BQTA 4LIUA 1TZLA 2HDWA 3S1QJ 1A5JA 1K6OA 5AONA 1SFEA 4AYBN 4HYEA 5LGNA 1TW3A 2HTSA 1TWFJ 4GXOA 3SFIA 4UVAA 4LB5A 3FIWA 2DTRA 1UCRA 4M3BA 1T8IA 2V9PA 5TISC 1IRZA 3FHZA 5AIPA 2CW7A 2ESHA 2WAFA 3S1MJ 2GIVA 2K02A 3S1NJ 1XG1A 2FEZA 2FNPA 2XB0X 2GWRA 4MIMA 5F04A 2QEXI 4F92B 2VLAA 1I3QJ 2M7BA 1F4KA 4A69C 4DYQA 4EM2A 1G4DA 1QU3A 5M5XJ 3WTTC 1DP3A 4HOBA 2DI3A 3SZTA 2VOOA 3FX3A 1X2MA 1SFXA 4M9SA 2A6HF 5D5VB 2P4WA 5LD2C 1BN5A 4YRVA 1XSVA 4G12A 3L2QA 4XLPF 2L9VA 2JA8J 4KMFA 3HHHA 4LLNA 1BR4A 1ZH5A 1FIAA 3PIOF 5LGTA 3GTKJ 3QODA 2IS2A 2R5YB 1L0OC 2A69F 4BGDA 1Y8RB 2JRMA 4E70A 1X1AA 2GZWA 4OIPF 2HZDA 2RKHA 2GBYA 3GX4X 3ISPA 1CQTA 2MGQA 2K7LA 1V3FA 5E8IA 2ACJA 2LG4A 1WI3A 1G3TA 3OYNA 4HF1A 1TTYA 2VASA 3WTYC 3HOTA 3SEQA 4YIFA 2VN2A 3HB9A 3U21A 3JAMZ 1U0JA 1V5GA 2FOKA 3E6DA 4EM1A 3J7YJ 1YOVB 3OOPA 4Y33A 1IN4A 2VL8A 3GW2A 1WJBA 3BG7A 3EDPA 5K5OA 1ACIA 2RGVA 3RCOA 2FBKA 2F5CA 2LLKA 4YFXF 1OFCX 3CMEI 5E3MA 1RUOA 1MBEA 4GYGA 2LP0A 4A5MA 1SANA 2PMUA 2HU9A 2ME6A 1Z9CA 2LK2A 3LSKA 3M3YJ 3DKYA 3BR1A 2M34A 1WGXA 1OR7A 3ABKH 3JSOA 4HLYA 5EEAA 1B8IA 3D1NI 1KGSA 2LY1A 1GVJA 1WFXA 2VBXA 3KZYA 2XDVA 2LBFB 4PUSA 1YJWI 4M3FA 2DJIA 2QBYA 4ANJA 2XGDA 1FOYA 1ZG5A 1AKHA 3GUDA 4IF4A 1Y1VJ 2OTJI 3GFMA 3IH3A 1MMNA 2XAQA 3Q0WA 5D8KB 5IP7J 2VPLA 4HF2A 3PO2J 4CYCA 3JREA 4PCQA 3GTPJ 1R1VA 1UZCA 2V4JC 2IBDA 2KIUA 1GXPA 2V79A 2W25A 1VQ9I 4MTDA 4XRMA 2FMYA 4XLAA 6PAXA 2KDOA 2H6BA 2EFOA 2W1OA 2QLZA 2XF5A 4E7SA 1HSTA 1N77A 3DWLE 3RSNA 3QWLA 3S15J 1MZBA 3GZNB 1Z21A 3FF5A 2DMUA 3EUHC 3NRVA 2IJLA 4A2UA 1T2KA 2R7QA 4ON0A 4A3GJ 3BR3A 3HSRA 1SMYF 1VQLI 4LOCA 2I8DA 1E17A 1YHQI 2IA1A 4BQOA 3BTJA 5LGUA 1H8AC 2EA2A 1OQYA 3A01B 3QYEA 1W7PA 2O8XA 3WE3A 2R4GA 2G7HA 1WCMJ 2Q8KA 4GDFA 3S3OA 3MMYB 4YEJA 3WG7H 2H09A 3K4LA 3UNGC 1D5YA 1QPMA 4CA0A 5CVVA 3ASNH 3WU1B 4DNCA 5LBQA 3VYUB 1DPUA 3KLOA 2PMZA 4IVNA 4KICA 3F8FA 4BXFA 1KQ0A 4C2MJ 2Y0SN 3E6CC 1YJNI 1R1UA 2LTPA 1OCRH 1VQMI 3BTIA 1OCTC 4GCVA 3IKTA 1POGA 2CQKA 4XLEA 3VFZA 4XN0A 4QTRA 4CCOA 4XRSG 1N25A 5ICEA 1O3QA 2AQFA 3VOEA 3H9QA 2HOEA 3LQQA 2BV6A 2Y9ZA 2O7OA 2VB6A 2FBHA 3FMRA 4P55A 2VJJA 2WWYA 1W5TA 3OR1C 2BY2A 5GAHJ 3IC7A 2H1KA 4OIOF 3KYDB 3RJPA 1HA8A 3VWBA 4ABZA 1ERDA 2K4BA 2KL4A 2QSGX 4PJMA 5K1YA 2HKOA 5FFZA 1G3WA 1HLVA 3ZQGA 3CUOA 5IYDJ 2M8GX 1A31A 3U1DA 1JKRC 5A2QZ 1JTXA 1OCOH 2R7RA 3KZZA 2KLOA 3LSIA 1FBUA 3WODF 3GEZA 2COBA 1QHHD 1APLC 4D7MA 2BBYA 3W6JB 1E0EA 5EF6A 4KT6A 3TO9A 1IN8A 2IA2A 3BR5A 2M5WA 3WTSC 2UZKA 3OV8A 1TC3C 1W36C 1ZYRF 3ZPLA 3AG4H 4L9NA 2XROA 3REOA 1I6XA 1QBJA 4NQWB 4ESFA 1HKTA 1QA6A 4HAMA 4HSRA 1I6HJ 2KRFA 2Y30A 3W2VA 4NC6A 3RKYA 3SFZA 2NNYA 1B72B 4LLGF 3W2WA 2CYYA 1G2HA 2K9QA 4P1WA 3ML6A 3WG9A 4PDKA 4LLLA 1JJ8C 2IS6A 3N4MA 3IV5A 3QYFA 1Q1VA 1ZAOA 2A6TA 3CUQA 4II3A 4FQGA 4MHGA 3H35A 2OD5A 2NNNA 3IH4A 3SZPA 1BI0A 3S3NA 5KCMA 3G71I 4L9VA 3HTUA 1ZG3A 3ZP5A 1WSUA 2IAIA 1S7AA 3E5QA 1EH8A 2M0CA 2Z33A 1PP8F 1ULYA 1HDDC 1DDNA 2HQNA 2X51A 4EV0A 4ZH4F 1U2WA 3GLXA 1YX5A 3V7RA 2ADUA 4B8XA 1Z6RA 2Y31A 3MZHA 1H9TA 4YIRX 2D2WA 1AWCA 3K2AA 4HNTA 4PJJA 4BH9A 2JPBA 1REPC 1GVDA 2R7DA 3W3CA 2YX7A 3R60A 3J81Z 3OIOA 4BKXA 3MKZA 1J9IA 2E5NA 2FBIA 2BZTA 2K85A 3A2KA 1XN7A 3IWZA 1VQNI 2QSFX 3I59B 1IN5A 1OLTA 4V2GA 3KP6A 4Y15A 2K3PA 3BJOA 1Z6TA 4IPAA 1FOXA 2L02A 2IEKA 5FGMA 1Z3XA 2E1OA 3F8NA 2XRLA 4F93B 4HV6A 4WCGA 1VQ5I 5B1AH 2DMQA 4MEXF 2A3SA 4B48A 3CD6I 2VBYA 5F0HA 4AC0A 3K2ZA 4B44A 1TQPA 1JKPC 3DTIA 4AIKA 4RDUA 3DTEA 5F6FA 3CF5F 5CLSA 3KFWX 1DU0A 2CJJA 2LFBA 2HPIA 2X4HA 1Y39A 1XPXA 2FOWA 5JLWA 2XPVA 3KPHA 3SHFA 4S0HB 3S1RJ 3DBHB 4HPQA 2MD5A 2JN6A 3O3KA 3UR3C 3K4NA 3A4CA 1SVLA 3S14J 2BOLA 3LSHA 4G6DA 2VC1A 3BQYA 2LY2A 1B9NA 1U3EM 4EJWA 1KQ8A 1FP2A 2WAQA 5ERIA 3F21A 4UVCA 2R7SA 1B9MA 4XM3A 3HRSA 3CO7C 3O8GA 4HX7A 2RNJA 1X58A 3LA7A 3WGIA 4IQ4A 2XF6A 4XLFA 2XKOA 4AIDA 4I6ZA 1W1WE 4ZZLA 4LGWA 3C7JA 5M3MJ 1HCRA 3QU6A 2V9VA 4QPOA 2EZHA 4S05A 1Y1WJ 1PVEA 3VPRA 2E7WA 1E3OC 4RA2A 1K78A 2PLYA 3LNQA 4V19K 5CQEA 4EVIA 1PP7U 5EG0A 4CICA 4BHCA 1QHGA 2EK5A 3AL0C 4ESBA 1UG0A 5D4RA 2ZFWA 3RPQA 2DJNA 3G1OA 4A3JJ 4K2EA 2LSOA 1ENHA 3QPSA 3S93A 2ZFUA 3BTCA 2W00A 3U1KA 5FJ8J 2F4OB 2NYXA 1VQ7I 2MYSA 3QP6A 4JX6A 4MFDA 3DPTA 4O5VA 4XKBA 4IO9F 4CXFA 3E5UA 2VPRA 5F08A 2R0QC 1MMAA 2DBBA 1V55H 5ILSA 4C3IJ 4HNVA 4RAGA 2BVMA 4A12A 3ZQLA 1OMIA 4BQAA 1ETOA 3ZQ7A 3BROA 2ECBA 1D0YA 3KP5A 4AD9A 2A07F 3K0LA 3TO6A 4M9ZA 1E2XA 1IN7A 2OJED 3L00A 2JTVA 3LAJA 4IQJA 1S6LA 1IV8A 1YQAA 2GAUA 2EZKA 3RQIA 3E1SA 3ZGKA 2MD0A 2YU9J 1T0FA 4XONA 3ZQFA 4UUSA 3L2RA 1X1BA 3CMAI 5JVGF 4G6TB 1T95A 1HOMA 3VYRB 1I50J 2FJ1A 3RKWA 5IYBJ 2HQ5A 5LRSA 2BHYA 4ZYAA 3K6GA 3ZQCA 4Z6YA 1FOKA 3GTLJ 5IP6A 4U88A 1B8IB 2WB1A 4L5JA 3JTGA 3K69A 4YIIA 1NH3A 3QU3A 4KIFA 1O3SA 5HDNA 1QZYA 3ZQIA 4QIWN 5HLHA 4A3CJ 2W48A 2ZCWA 4MTEA 5DM7F 4RGUA 3HPHA 4BU2A 1VTNC 4MGRA 1MDMB 1ZRCA 1TP4A 1R49A 4OAZA 3CLQA 3QOPA 4DW6A 3FXUA 1JUMA 1SMTA 5EGOB 3EETA 3LSRA 2JRTA 3JRGA 3JR9A 2WADA 2DA5A 5ED4A 1ZQ3P 2FRHA 4DJAA 2HQRA 3FK6A 1TT0A 3LFUA 3NAUA 2HGCA 4QLCU 3CQZJ 5IT9Z 5F1JA 2Z16A 3C1DA 2LDUA 5D5WB 2R7FA 2DT7B 1JGSA 1G6NA 3OIQA 3DPLC 5D4SA 2JT1A 1FT9A 3C2GA 1RR8C 2OA4A 2MA3A 1HF0A 4Z2YA 4KFCA 3CESA 3M8FA 5DV5A 3F0CA 4D7NA 3IHUA 4X1EA 2IW5A 1ONVA 1IDZA 1H88C 4W1UA 1KONA 2CFXA 3BDDA 4IX7A 2PQ8A 3FWEA 5J6XA 1PUFA 4HA8A 4KDPA 2DT6A 3D5SC 2X6OA 3T8TA 1KZHA 2NAZA 1JJ6C 2IXSA 4RGRA 1MKMA 1AA7A 3ABLH 5CVRA 4CCLA 5FKLA 4ZJZA 4L0YB 1GHCA 1YW7A 1U5TB 3PO3J 2FD5A 4YELA 1WI9A 1S72I 3BQZA 1R5ID 3FKIJ 2G7UA 3H3ZA 4OIQF 2HVQA 3LAPA 4I98B 2DQRA 2W82A 4N4OB 2STWA 2DFFA 1IRGA 3HYIA 4ZYGA 1OISA 4RM2A 1DUXC 2O03A 2VQHA 2GOMA 4B4CA 3T5XA 4F7ZA 3BC8A 3PUFA 4HDUA 1GV5A 2DOAA 2WTEA 2R7WA 2XPUA 3RDIA 3MN2A 5F1RA 3L1PA 2DPUA 2BXYA 3EYYA 4AU7A 1SFKA 3MWMA 2L4AA 3LMMA 1W5CC 2JJ7A 2Y0SA 4A0YA 5TRDA 4UUVA 3OWTA 4QSHA 1FLIA 2VBWA 2FMLA 4XIDA 3OOUA 5HNFA 4BEHB 1LFUP 4ASNA 2M7AA 3ABTA 4JQFA 3CCLI 2RN7A 4RAFA 2DW4A 3HPGA 3HEFA 3TKYA 1I5ZA 2GA1A 3OYJA 1D0XA 5GPAA 4JK1X 1BW6A 4PFOA 2E36A 4BAYA 1ZREA 2KISA 2ISYA 4M3EA 4BBRJ 1YITI 3O2PE 3CP8A 1ZK8A 3KP4A 4BJ5C 1CGPA 1UMQA 2HQAA 2JK3A 3BY6A 3DU5A 4YG2F 2RQQA 4ENMA 1OYIA 5TJJA 3CC4I 1U78A 5FKKA 2OZUA 4BBSJ 4RB2C 2HS5A 5HLGA 4FTHA 1MJ9A 2IRFG 3SDGA 4HQEA 1T33A 3G3ZA 1XSXA 1NHAA 3J7AO 4FX0A 2HPMA 3WGGA 4G7OF 3IRRA 3CJRB 1TBXA 3TBIA 4BL0B 4YFNF 3GYHX 2K86A 3F3XA 4RAZA 2Y48A 4LK0F 1YRNA 4CCMA 4YFKF 2XIGA 2X1EA 3FM5A 5JFRA 2LVSA 4MO7A 3LSPA 2ZJPF 1SD4A 1W0TA 3DPUA 1MSEC 2CQ7A 3GZ5A 2EV6A 4J00A 2F2EA 1T0FC 5L3DA 3KETA 4ESJA 4Q48A 1FOWA 4MQ9F 3KYCB 5DUIA 4EGZA 1LB2A 3U9GA 3H5NA 1QZZA 1W5SA 3I59A 5E8GA 3ROUA 5M3FJ 3KX2A 1JKQC 3W6KB 4A6EA 3CCMI 3ABUA 2QBYB 1XC5A 4QWQA 2HZTA 2OAZA 1Z77A 1XGOA 1VQ4I 4E6KG 2HYFA 1GLNA 3QYBA 2FXAA 3F22A 2IGKA 2JWTA 3M1CA 2XAFA 1D0ZA 2WB1N 3KEQA 1LEAA 2B7EA 1IW7F 1MMDA 1XD7A 4E7KA 4CYDA 1A36A 3CJTB 1IO2A 1IXRC 2ICWG 1R1TA 3MVPA 2OUMA 2Z2SB 5CKTA 2P5KA 2A5WA 4IHXA 3RPUA 2VT2A 1O7FA 1R4NB 1UB9A 2BE5F 3G1LA 1MBGA 1T56A 1VFCA 3VYTB 3FMQA 1I1SA 2JA2A 3DP7A 2WV0A 2L54A 5ICFA 2HOAA 4XL9A 1YO5C 1IV6A 5FKMA 3H5AA 4JOMA 1WRJA 2NRAC 3ZR8X 1ETWA 2COMA 3S3MA 3PFYA 1FPQA 2F6CA 3JRAA 4Y7NJ 3GXOA 4BNCA 2EINH 4L5IA 5HLTA 1O3TA 4D5FA 3L9FA 1OKRA 5FROA 3CDLA 3EUAA 4A93J 2L0KA 2KRHA 3AFHA 1BOAA 2CV1A 1XCBA 3QQAA 1QVUA 3DBLB 3QP5A 2DPDA 3QPTA 1ETXA 1RR7A 3BZ6A 3A02A 3C2HA 1P2FA 1R22A 5DCMA 1MW7A 4P96A 5DYMA 1RC9A 5FRMA 2EIKH 5B66C 3P9IA 1A6IA 4Y4RA 2L3DA 1R7JA 4XLHA 1DPRA 2QKLB 4LIVA 5HS9A 1ZR4A 4GRIA 2CG4A 4RMNA 3HOXJ 1VQ6I 4XMYA 1ETYA 5FO5A 4AVZA 2W7NA 1OYYA 3BZKA 2QUFA 1NK3P 1GDTA 2L7ZA 1I39A 3BCBA 2L4MA 2XAJA 1X3WB 3B73A 3BJ6A 2VT3A 2DODA 2X6WA 3R4KA 2ZMEA 3ZN1A
chains in the Genus database with same CATH topology
3IWFA 5H6QA 2F5DA 3ZMUA 2ZXJA 2DK5A 3JW4A 3FZVA 5CJ9A 5IT3A 3WTWC 1KQ9A 1V4RA 1J5YA 1SD5A 2XKPA 4KUMA 3CJNA 3EYIA 2ETHA 3SXYA 1SD6A 1BM9A 3FM3A 1H0MA 3COAC 3I0TA 4WXDA 2WC2A 4CO8A 3WTVC 1HQCA 2UXXA 4I2OA 3GWZA 3S2WA 1YLFA 2QVOA 1XSDA 1RIOH 1R36A 4L0ZB 1MJBA 4EJOA 3BPXA 4P9FA 3Q9SA 1J2XA 3LA2A 4G7ZF 2ZMEB 1LDDA 3L7WA 4DQ2A 3CUQC 3MAJA 2OQRA 4TV7A 2VE8A 2EA4A 3V8KA 1BIBA 1CF7A 1BJAA 4FX4A 3P9CA 1QQIA 4UVBA 4KYWA 1C0WA 3I54A 2VODA 4UNOA 4ETSA 3R6SA 4N9HA 5FFXA 1QO0D 1DP7P 5CYVA 5LHGA 2RV8A 1S3JA 1WQ2A 3N97A 2VE9A 1BI3A 2K27A 2DAOA 4ENNA 2M30A 4NQWA 4U7BA 1ZG1A 3ULQB 3V7CA 1RZ4A 4KN7X 1OPCA 5FD5A 3H92A 5CVUA 1ZRDA 3E5XA 3RKXA 3RYPA 2KJBA 3VB2A 3DF8A 1LJ9A 4D0PA 3TOBA 4OMYA 4CHUA 4L9TA 2J5OA 3WTZA 1IF1A 3C18A 5BS6A 4AIHA 4ENJA 2P8TA 5D6FA 4RAYA 1ZGJA 2EB7A 2QQBA 1G3YA 1SFUA 4UHTA 4LG0A 5K5RA 4H0EA 2TDXA 1B6AA 4HZFA 5DCMB 1KU9A 1B59A 2KIFA 4XBFA 2P6SA 1U5TA 3K1PA 2IT0A 5HOOA 3L2CA 4WK8F 5HDKA 1K79A 3DXJF 5BOXA 3BOQA 1ZGAA 1IRFA 5AIQA 3I5UA 3KCCA 2QQAA 2NS0A 1FX7A 3B02A 3T8RA 1F9NA 1YG2A 5E20A 4AIJA 2RDPA 5LEKA 2A68F 1HBXG 2PFBA 3SQNA 4P9UA 2E1NA 3I64A 2JZYA 3MCZA 2RQPA 4BXUA 1OYWA 4EGYA 3FXRA 1BI1A 2E1CA 5ILUA 4KIGA 2FQ3A 5DEQA 3KLNA 1LNWA 4ZYDA 3WTUC 4UV9A 4A6DA 1TLHB 2A61A 2P5VA 3JTHA 3BPVA 2EJRA 4HDVA 1FSEA 3I71A 2XVCA 2IPQX 5E1WA 1R00A 2D45A 4LD5A 2XASA 3U2RA 1R23A 3WE2A 4MQVA 2XGXA 4NHJA 3DEUA 3J81K 4S04A 3V8JA 1ZLKA 4LJZF 3EQLF 1Z7UA 2P5LC 1ZHFA 1BC7C 1FBQA 5D6EA 4A0ZA 5L3GA 2C6YA 5HS7A 3WTXC 1ZRFA 1R5GA 4UXNA 1UHWA 2GA2A 3LFKA 2XHKA 2EFNA 1R58A 4BYYA 4HLXA 3T1BA 2JPCA 1T38A 4OOIA 2M8EA 1IZ1A 4L9JA 1MGTA 3K1NA 2VBZA 3HSFA 4G8XA 4IRIA 4HQMA 3ZMDA 4LK1F 1FP1D 3JSPA 2KJCA 3L09A 1J0RA 3O6BB 1J59A 4KIBA 2HEOA 3QPHA 5CVJA 2FA5A 2DLLA 2MC3A 4AVPA 1P92A 3IRQA 1K78B 2CO5A 1CF7B 2QQ9A 5J8CA 1H9GA 3ELKA 5A2QK 2XAGA 4M6XA 4Y17A 2KKOA 4HF0A 3GFJA 5JR3A 1XGNA 2O3FA 1O3RA 1W7PD 4WF2A 2P6TA 2QENA 1WWXA 4G94A 1FY7A 2QM3A 1EV7A 1LDKB 3MQ0A 1IAWA 1YS7A 3KE2A 3KP2A 1HXDA 3GFLA 1XGMA 3DQVC 4HW0A 1RNLA 4HBLA 2PI0A 3DV8A 4HV5A 3RIRA 2Z5UA 1BC8C 3KP7A 3ZMVA 5F64A 1X3UA 3CLOA 4LFUA 2XAHA 4AWXB 4Q4ZF 2G9WA 3IL2A 2ELHA 4GO1A 3BWGA 4G6QA 3AAFA 2YU3A 4N9IA 4GYIA 2RC4A 4B09A 2FE3A 1B1BA 3CTAA 4O3MA 1MDMA 3WU0A 3IKVA 1TQIA 2BYVE 1JXSA 1U6GA 4M9XA 2MLGA 1JHFA 1KU7A 3E6MA 2EV0A 1J7KA 2XRNA 4ZYEA 1Z91A 4IRGA 5BMZA 1S8NA 5FB2A 1FNNA 2ESNA 3Q5FA 4JBAA 1T39A 3R61A 3GZ6A 5LRRA 5J8FA 3TOAA 2KIMA 3CUQB 5IT9K 2UXNA 2HTJA 1W4MA 5KVRA 3LA3A 2H6CA 1D8KA 2GQQA 2IA0A 3HSEA 1YW9A 1EH6A 4R79A 3K1MA 1K7AA 2XV4S 5L3BA 1FBSA 3J80K 3TQNA 4A5NA 1P4WA 1ZARA 3E3VA 3GVAA 3BP8A 4BHBA 2YPRA 1D5VA 2X0LA 1LDJA 5JHUA 4L18B 1STZA 4UV8A 5DDGA 1U5TC 5ICGA 3M7GA 4I0BA 2FF4A 2GXGA 2Q0OA 4KMUX 1S29A 3P9KA 5LEJA 3HRMA 3F72A 4OIRF 5BPDA 3ECOA 4RB1A 1P6RA 1RUNA 2QYOA 2BGCA 1JHHA 1FSHA 2Y75A 2XUBA 1XMKA 1HW1A 4PGGA 3LWFA 5D8LB 2YSRA 2F5EA 1EH7A 4I0AA 1XDSA 1AOYA 4EMSA 2VONA 1BBYA 2PG4A 5E18F 5FLXZ 2M45A 3TDZC 5ILVA 4CDGA 2LKPA 2PN6A 2BEOA 1ODDA 2H94A 4MNUA 4XRFA 5JI6A 3FMSA 3M8EA 1XMAA 3RYRA 2O6GE 3D0SA 4EQQA 4ZYHA 3ZMTA 1B4AA 5DD4A 2CGPA 2ZKZA 2W84A 4M6YA 4KN4X 1FYKA 4ZZDA 2DQLA 2EFWA 1J75A 2UWMA 3T0YA 2F5FA 1ZLJA 2VOPA 1FC3A 3ZMSA 3P7NA 3K9TA 1P4XA 2AXLA 4HX8A 2ZO4A 1I1GA 1UHMA 1KU3A 3F8BA 3KP3A 2O0YA 2P7VB 3MZYA 3HOSA 1HKSA 3M9AA 2QZ8A 3M1EA 1QGPA 1SAXA 5L3FA 1FWZA 4U0WA 4WWCA 2ZJ2A 4EJUA 1R5HA 4WXCA 2D1VA 3HRUA 1F5TA 3EUHA 5D5XB 2CWEA 1D3YA 3FXQA 1IN6A 1KYZA 5E17F 4Q47A 4WX9A 3ECHA 5HS8A 3GO5A 1YS6A 4M74A 2VXZA 4RGXA 2LF7A 1FYLA 1SD7A 3PQKA 2HKXA 4U0VA 1O7LA 4OINF 3HUGA 4EM0B 4PZJA 2STTA 1Y0UA 3V4GA 4EJTA 4NB5A 1PUEE 4XLNF 2B0LA 3I4PA 4IJAA 2A5YB 1XGSA 1T98A 4LG0B 3HTSB 4FT8A 2L01A 1A04A 1P4AA 3DKWA 3Q9VA 2D1HA 1KA8A 2ZNYA 4RB0A 2PMHA 3RI4A 4KNYA 2Z99A 5HDGA 4IHSA 1PDNC 2HFHA 2OBPA 3CO6C 1MD0A 5DCFA 3BJAA 1XCVA 4U0YA 4P5OA 2ZBKA 1BIAA 3J80Z 3KEOA 4XSZF 1FZPB 4I09A 2EFPA 1HSJA 2DO7A 2LNBA 4IHTA 3I58A 4PGHA 1KU2A 3VODA 1LEBA 3LSTA 3TO7A 2Z3YA 1Z1DA 3TDUC 2FU4A 4RS8A 1USSA 2YR2A 1FYMA 4Q5SF 1WKMA 2V1XA 5E1XA 1ON2A 1YFHA 5JVTA 5FLXK 5KK1A 5D5UB 3GF2A 2W85A 3V7SA 4ENKA 2DU9A 1O57A 3ZN0A 3E6BA 2V6CA 5HVQC 1HKQA 5BPIA 1T6SA 2R3SA 1YYVA 2YX4A 3QRFF 2QWWA 2FSWA 1W7PB 2IVMA 4O6JA 1MJAA 1QNTA 2PJPA 5DD8A 3C3WA 1L3LA 4EJVA 2J5PA 1I27A 1KYWA 2IP2A 3G73A 3MFKA 3HRTA 5DUKA 2P7CB 3NEUA 3GFIA 5L3CA 2DFIA 2VC0A 2ZNZA 5HLIA 2PBIA 1F1ZA 4R8HA 3V8LA 1G3SA 4R1HA 5H20A 2EWNA 4M73A 4Y13A 1D8JA 3JAMK 3WGHA 4KT5C 3QAHA 5L3EA 2W57A 4RGSA 4IXAA 5LHHA 1YW8A 1RI7A 1TNTA 3F8MA 2MH2A 3F8CA 4RB3C 4IRHA 1Q1HA 3E97A 2K4JA 2LF8A 1IXCA 1GXQA 2H27A 3NQOA 3PQJA 4N0BA 4FHTA 3HHGA 1U8RA 4OMZA 4A0XA 2EFQA 2DT5A 3F6VA 2EV5A 4CZZA 4LB6B 2V1UA 4G9YA 3H3UA 1IUYA 2MLKA 3VEPA 3ZMZA 1XDUA 2Q2EA 3R0AA 1HW2A 1YIOA 1HW5A 4CGZA 2V1DA 2E7XA 1S7OA 5LHIA 4I01A 2ISZA 5K5QA 2AS5F 1TW2A 2DK8A 2HDCA 3TGNA 2OZ6A 3DFGA 5EEHA 2OQGA 1TNSA 2RVCA 1TQMA 3CDHA 1ZN2A 1JE8A 4U7DA 5FD6A 3D5LA 4LMYA 1BI2A 1USTA 2HYGD 4WXHA 2PEXA 4M72A 2OU2A 3MEXA 1XB4A 2HR3A 3LQRA 2M1BA 4XSXF 5LLQA 5CVIA 3I53A 2A6EF 2Y0MA 1IXSB 5H6RA 4G7HF 3RTRA 4M71A 3PFIA 4MEYF 3F6OA 5ICCA 1YTYA 1Z05A 2M87A 1LVAA 4OU0A 3F23A 2Z9OA 1LQ1A 2MBFA 4I02A 5E1ZB 2CSOA 2CW0F 2FNAA 5EEGA 3ERED 4HX4A 2JSCA 2W24A 1UFMA 3HIFA 2MH9A 2HWVA 2O61A 4KA4A 3R0JA 4I7HA 2GXBA 5BQTA 1ON1A 4GGGA 4BHPA 1K6OA 5AONA 1SFEA 4HYEA 5LGNA 1TW3A 2HTSA 4GXOA 4LB5A 4UVAA 2DTRA 1UCRA 3FHZA 5AIPA 2ESHA 2GIVA 2K02A 2FEZA 2FNPA 2GWRA 1F4KA 4EM2A 1G4DA 3WTTC 4HOBA 2DI3A 3SZTA 2VOOA 3FX3A 1SFXA 4M9SA 2A6HF 5D5VB 2P4WA 1BN5A 1XSVA 4XLPF 4KMFA 3HHHA 4LLNA 1ZH5A 5LGTA 1L0OC 2A69F 4E70A 2GZWA 4OIPF 2RKHA 3GX4X 3ISPA 2K7LA 1V3FA 2ACJA 5E8IA 1G3TA 4HF1A 1TTYA 3WTYC 3HOTA 4YIFA 2VN2A 3JAMZ 2FOKA 3E6DA 4EM1A 3OOPA 1IN4A 3GW2A 3EDPA 5K5OA 2RGVA 2FBKA 2F5CA 4YFXF 1RUOA 4GYGA 4A5MA 2PMUA 1Z9CA 1OR7A 3JSOA 4HLYA 1KGSA 1GVJA 2VBXA 3KZYA 2QBYA 1ZG5A 3GUDA 4IF4A 3GFMA 2XAQA 5D8KB 4HF2A 4PCQA 1R1VA 2KIUA 1GXPA 2V79A 2W25A 4MTDA 2FMYA 6PAXA 2H6BA 2EFOA 2QLZA 1HSTA 1MZBA 3FF5A 3NRVA 2IJLA 4A2UA 1T2KA 4ON0A 3HSRA 1SMYF 1E17A 2IA1A 5LGUA 2EA2A 1W7PA 2O8XA 3WE3A 2G7HA 2Q8KA 2H09A 1QPMA 5CVVA 3WU1B 4DNCA 5LBQA 1DPUA 3KLOA 4IVNA 4KICA 3F8FA 1KQ0A 3E6CC 1R1UA 4GCVA 3IKTA 2CQKA 3VFZA 5ICEA 1O3QA 3VOEA 2HOEA 3LQQA 2BV6A 2FBHA 3FMRA 4P55A 2WWYA 1W5TA 3IC7A 4OIOF 3RJPA 2K4BA 5K1YA 2HKOA 5FFZA 1G3WA 3CUOA 3U1DA 5A2QZ 3KZZA 1FBUA 3WODF 3GEZA 2BBYA 3W6JB 3TO9A 1IN8A 2IA2A 2M5WA 3WTSC 2UZKA 3OV8A 1ZYRF 3ZPLA 4L9NA 2XROA 3REOA 1I6XA 1QBJA 4ESFA 1HKTA 4HAMA 2KRFA 3RKYA 3SFZA 2NNYA 4LLGF 2CYYA 3WG9A 3ML6A 4PDKA 4LLLA 3N4MA 1ZAOA 3CUQA 4MHGA 2OD5A 2NNNA 3SZPA 1BI0A 4L9VA 3HTUA 1ZG3A 3ZP5A 1WSUA 1S7AA 3E5QA 1EH8A 2Z33A 1PP8F 1ULYA 1DDNA 2HQNA 4EV0A 4ZH4F 1U2WA 3GLXA 3V7RA 2ADUA 4B8XA 1Z6RA 3MZHA 1H9TA 2D2WA 1AWCA 4BH9A 2JPBA 1REPC 2R7DA 2YX7A 3R60A 3J81Z 1J9IA 2FBIA 1XN7A 3IWZA 3I59B 1IN5A 3KP6A 4Y15A 3BJOA 1Z6TA 4IPAA 2L02A 5FGMA 3F8NA 4WCGA 4HV6A 4MEXF 2A3SA 2VBYA 3K2ZA 1TQPA 4AIKA 5F6FA 5CLSA 3KFWX 2X4HA 3SHFA 2MD5A 3O3KA 4G6DA 2VC1A 1U3EM 1B9NA 4EJWA 1KQ8A 1FP2A 5ERIA 3F21A 4UVCA 3CO7C 1B9MA 3HRSA 4HX7A 2RNJA 3LA7A 3WGIA 2XKOA 4ZZLA 4LGWA 3C7JA 3QU6A 2V9VA 4S05A 2E7WA 1K78A 2PLYA 4EVIA 1PP7U 4CICA 4BHCA 2EK5A 4ESBA 5D4RA 2ZFWA 3RPQA 4K2EA 2LSOA 2NYXA 3QP6A 3DPTA 4O5VA 4CXFA 3E5UA 5ILSA 2DBBA 4A12A 1OMIA 4BQAA 3ZQ7A 3BROA 4AD9A 3KP5A 2A07F 3K0LA 3TO6A 4M9ZA 1E2XA 1IN7A 3L00A 2JTVA 3LAJA 1S6LA 1YQAA 2GAUA 1T0FA 3RKWA 5LRSA 1FOKA 4U88A 4L5JA 3JTGA 3K69A 4YIIA 3QU3A 4KIFA 1O3SA 5HDNA 1QZYA 5HLHA 2ZCWA 4MTEA 4RGUA 1VTNC 4MGRA 1MDMB 1ZRCA 3QOPA 3FXUA 1SMTA 3EETA 2JRTA 5ED4A 2FRHA 2HQRA 2HGCA 4QLCU 5IT9Z 3C1DA 2LDUA 5D5WB 2R7FA 1JGSA 1G6NA 3DPLC 5D4SA 2JT1A 1FT9A 2OA4A 2MA3A 4Z2YA 4KFCA 3M8FA 5DV5A 3IHUA 2IW5A 1ONVA 2CFXA 3BDDA 2PQ8A 3FWEA 5J6XA 4HA8A 4KDPA 3T8TA 2NAZA 4RGRA 1MKMA 5CVRA 4L0YB 1GHCA 1YW7A 1U5TB 1WI9A 2G7UA 3H3ZA 4OIQF 3LAPA 4I98B 2DQRA 2STWA 1IRGA 3HYIA 4ZYGA 1DUXC 2O03A 3T5XA 4F7ZA 4HDUA 2WTEA 3RDIA 5F1RA 2DPUA 3EYYA 3MWMA 2L4AA 4A0YA 5TRDA 4UUVA 1FLIA 2VBWA 2FMLA 4ASNA 4JQFA 3ABTA 2RN7A 2DW4A 3TKYA 1I5ZA 2GA1A 4JK1X 4BAYA 1ZREA 2ISYA 3O2PE 3KP4A 1CGPA 3BY6A 4YG2F 4ENMA 1OYIA 5TJJA 1U78A 2OZUA 4RB2C 2HS5A 5HLGA 1MJ9A 2IRFG 4HQEA 3G3ZA 1XSXA 1NHAA 3J7AO 4FX0A 3WGGA 4G7OF 3IRRA 1TBXA 4YFNF 3GYHX 2K86A 3F3XA 4RAZA 2Y48A 4LK0F 4YFKF 2XIGA 3FM5A 5JFRA 1SD4A 3GZ5A 2EV6A 2F2EA 5L3DA 3KETA 4ESJA 4Q48A 4MQ9F 5DUIA 1LB2A 4EGZA 3U9GA 3ROUA 1QZZA 1W5SA 3I59A 5E8GA 3W6KB 4A6EA 3ABUA 2QBYB 4QWQA 2HZTA 2OAZA 1XGOA 2HYFA 2FXAA 3F22A 2XAFA 3KEQA 1LEAA 1IW7F 1XD7A 4CYDA 1IXRC 1R1TA 2P5KA 3RPUA 2VT2A 1O7FA 1UB9A 2BE5F 1I1SA 3FMQA 2WV0A 3DP7A 2L54A 5ICFA 1YO5C 1WRJA 2NRAC 2COMA 1FPQA 3GXOA 4BNCA 4L5IA 1O3TA 3L9FA 1OKRA 1BOAA 1XCBA 2DPDA 3QP5A 3QPTA 3BZ6A 1P2FA 1R22A 5DCMA 4P96A 5DYMA 3P9IA 2L3DA 1R7JA 1DPRA 5HS9A 2CG4A 5FO5A 1OYYA 2QUFA 2L4MA 2XAJA 3B73A 3BJ6A 2VT3A 3R4KA 2ZMEA 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWF A;  5H6Q A;  2F5D A;  3ZMU A;  2ZXJ A;  2DK5 A;  3JW4 A;  3FZV A;  5CJ9 A;  5IT3 A;  3WTW C;  1KQ9 A;  1V4R A;  1J5Y A;  1SD5 A;  2XKP A;  4KUM A;  3CJN A;  3EYI A;  2ETH A;  3SXY A;  1SD6 A;  1BM9 A;  3FM3 A;  1H0M A;  3COA C;  3I0T A;  4WXD A;  2WC2 A;  4CO8 A;  3WTV C;  1HQC A;  2UXX A;  4I2O A;  3GWZ A;  3S2W A;  1YLF A;  2QVO A;  1XSD A;  1RIO H;  1R36 A;  4L0Z B;  1MJB A;  4EJO A;  3BPX A;  4P9F A;  3Q9S A;  1J2X A;  3LA2 A;  4G7Z F;  2ZME B;  1LDD A;  3L7W A;  4DQ2 A;  3CUQ C;  3MAJ A;  2OQR A;  4TV7 A;  2VE8 A;  2EA4 A;  3V8K A;  1BIB A;  1CF7 A;  1BJA A;  4FX4 A;  3P9C A;  1QQI A;  4UVB A;  4KYW A;  1C0W A;  3I54 A;  2VOD A;  4UNO A;  4ETS A;  3R6S A;  4N9H A;  5FFX A;  1QO0 D;  1DP7 P;  5CYV A;  5LHG A;  2RV8 A;  1S3J A;  1WQ2 A;  3N97 A;  2VE9 A;  1BI3 A;  2K27 A;  2DAO A;  4ENN A;  2M30 A;  4NQW A;  4U7B A;  1ZG1 A;  3ULQ B;  3V7C A;  1RZ4 A;  4KN7 X;  1OPC A;  5FD5 A;  3H92 A;  5CVU A;  1ZRD A;  3E5X A;  3RKX A;  3RYP A;  2KJB A;  3VB2 A;  3DF8 A;  1LJ9 A;  4D0P A;  3TOB A;  4OMY A;  4CHU A;  4L9T A;  2J5O A;  3WTZ A;  1IF1 A;  3C18 A;  5BS6 A;  4AIH A;  4ENJ A;  2P8T A;  5D6F A;  4RAY A;  1ZGJ A;  2EB7 A;  2QQB A;  1G3Y A;  1SFU A;  4UHT A;  4LG0 A;  5K5R A;  4H0E A;  2TDX A;  1B6A A;  4HZF A;  5DCM B;  1KU9 A;  1B59 A;  2KIF A;  4XBF A;  2P6S A;  1U5T A;  3K1P A;  2IT0 A;  5HOO A;  3L2C A;  4WK8 F;  5HDK A;  1K79 A;  3DXJ F;  5BOX A;  3BOQ A;  1ZGA A;  1IRF A;  5AIQ A;  3I5U A;  3KCC A;  2QQA A;  2NS0 A;  1FX7 A;  3B02 A;  3T8R A;  1F9N A;  1YG2 A;  5E20 A;  4AIJ A;  2RDP A;  5LEK A;  2A68 F;  1HBX G;  2PFB A;  3SQN A;  4P9U A;  2E1N A;  3I64 A;  2JZY A;  3MCZ A;  2RQP A;  4BXU A;  1OYW A;  4EGY A;  3FXR A;  1BI1 A;  2E1C A;  5ILU A;  4KIG A;  2FQ3 A;  5DEQ A;  3KLN A;  1LNW A;  4ZYD A;  3WTU C;  4UV9 A;  4A6D A;  1TLH B;  2A61 A;  2P5V A;  3JTH A;  3BPV A;  2EJR A;  4HDV A;  1FSE A;  3I71 A;  2XVC A;  2IPQ X;  5E1W A;  1R00 A;  2D45 A;  4LD5 A;  2XAS A;  3U2R A;  1R23 A;  3WE2 A;  4MQV A;  2XGX A;  4NHJ A;  3DEU A;  3J81 K;  4S04 A;  3V8J A;  1ZLK A;  4LJZ F;  3EQL F;  1Z7U A;  2P5L C;  1ZHF A;  1BC7 C;  1FBQ A;  5D6E A;  4A0Z A;  5L3G A;  2C6Y A;  5HS7 A;  3WTX C;  1ZRF A;  1R5G A;  4UXN A;  1UHW A;  2GA2 A;  3LFK A;  2XHK A;  2EFN A;  1R58 A;  4BYY A;  4HLX A;  3T1B A;  2JPC A;  1T38 A;  4OOI A;  2M8E A;  1IZ1 A;  4L9J A;  1MGT A;  3K1N A;  2VBZ A;  3HSF A;  4G8X A;  4IRI A;  4HQM A;  3ZMD A;  4LK1 F;  1FP1 D;  3JSP A;  2KJC A;  3L09 A;  1J0R A;  3O6B B;  1J59 A;  4KIB A;  2HEO A;  3QPH A;  5CVJ A;  2FA5 A;  2DLL A;  2MC3 A;  4AVP A;  1P92 A;  3IRQ A;  1K78 B;  2CO5 A;  1CF7 B;  2QQ9 A;  5J8C A;  1H9G A;  3ELK A;  5A2Q K;  2XAG A;  4M6X A;  4Y17 A;  2KKO A;  4HF0 A;  3GFJ A;  5JR3 A;  1XGN A;  2O3F A;  1O3R A;  1W7P D;  4WF2 A;  2P6T A;  2QEN A;  1WWX A;  4G94 A;  1FY7 A;  2QM3 A;  1EV7 A;  1LDK B;  3MQ0 A;  1IAW A;  1YS7 A;  3KE2 A;  3KP2 A;  1HXD A;  3GFL A;  1XGM A;  3DQV C;  4HW0 A;  1RNL A;  4HBL A;  2PI0 A;  3DV8 A;  4HV5 A;  3RIR A;  2Z5U A;  1BC8 C;  3KP7 A;  3ZMV A;  5F64 A;  1X3U A;  3CLO A;  4LFU A;  2XAH A;  4AWX B;  4Q4Z F;  2G9W A;  3IL2 A;  2ELH A;  4GO1 A;  3BWG A;  4G6Q A;  3AAF A;  2YU3 A;  4N9I A;  4GYI A;  2RC4 A;  4B09 A;  2FE3 A;  1B1B A;  3CTA A;  4O3M A;  1MDM A;  3WU0 A;  3IKV A;  1TQI A;  2BYV E;  1JXS A;  1U6G A;  4M9X A;  2MLG A;  1JHF A;  1KU7 A;  3E6M A;  2EV0 A;  1J7K A;  2XRN A;  4ZYE A;  1Z91 A;  4IRG A;  5BMZ A;  1S8N A;  5FB2 A;  1FNN A;  2ESN A;  3Q5F A;  4JBA A;  1T39 A;  3R61 A;  3GZ6 A;  5LRR A;  5J8F A;  3TOA A;  2KIM A;  3CUQ B;  5IT9 K;  2UXN A;  2HTJ A;  1W4M A;  5KVR A;  3LA3 A;  2H6C A;  1D8K A;  2GQQ A;  2IA0 A;  3HSE A;  1YW9 A;  1EH6 A;  4R79 A;  3K1M A;  1K7A A;  2XV4 S;  5L3B A;  1FBS A;  3J80 K;  3TQN A;  4A5N A;  1P4W A;  1ZAR A;  3E3V A;  3GVA A;  3BP8 A;  4BHB A;  2YPR A;  1D5V A;  2X0L A;  1LDJ A;  5JHU A;  4L18 B;  1STZ A;  4UV8 A;  5DDG A;  1U5T C;  5ICG A;  3M7G A;  4I0B A;  2FF4 A;  2GXG A;  2Q0O A;  4KMU X;  1S29 A;  3P9K A;  5LEJ A;  3HRM A;  3F72 A;  4OIR F;  5BPD A;  3ECO A;  4RB1 A;  1P6R A;  1RUN A;  2QYO A;  2BGC A;  1JHH A;  1FSH A;  2Y75 A;  2XUB A;  1XMK A;  1HW1 A;  4PGG A;  3LWF A;  5D8L B;  2YSR A;  2F5E A;  1EH7 A;  4I0A A;  1XDS A;  1AOY A;  4EMS A;  2VON A;  1BBY A;  2PG4 A;  5E18 F;  5FLX Z;  2M45 A;  3TDZ C;  5ILV A;  4CDG A;  2LKP A;  2PN6 A;  2BEO A;  1ODD A;  2H94 A;  4MNU A;  4XRF A;  5JI6 A;  3FMS A;  3M8E A;  1XMA A;  3RYR A;  2O6G E;  3D0S A;  4EQQ A;  4ZYH A;  3ZMT A;  1B4A A;  5DD4 A;  2CGP A;  2ZKZ A;  2W84 A;  4M6Y A;  4KN4 X;  1FYK A;  4ZZD A;  2DQL A;  2EFW A;  1J75 A;  2UWM A;  3T0Y A;  2F5F A;  1ZLJ A;  2VOP A;  1FC3 A;  3ZMS A;  3P7N A;  3K9T A;  1P4X A;  2AXL A;  4HX8 A;  2ZO4 A;  1I1G A;  1UHM A;  1KU3 A;  3F8B A;  3KP3 A;  2O0Y A;  2P7V B;  3MZY A;  3HOS A;  1HKS A;  3M9A A;  2QZ8 A;  3M1E A;  1QGP A;  1SAX A;  5L3F A;  1FWZ A;  4U0W A;  4WWC A;  2ZJ2 A;  4EJU A;  1R5H A;  4WXC A;  2D1V A;  3HRU A;  1F5T A;  3EUH A;  5D5X B;  2CWE A;  1D3Y A;  3FXQ A;  1IN6 A;  1KYZ A;  5E17 F;  4Q47 A;  4WX9 A;  3ECH A;  5HS8 A;  3GO5 A;  1YS6 A;  4M74 A;  2VXZ A;  4RGX A;  2LF7 A;  1FYL A;  1SD7 A;  3PQK A;  2HKX A;  4U0V A;  1O7L A;  4OIN F;  3HUG A;  4EM0 B;  4PZJ A;  2STT A;  1Y0U A;  3V4G A;  4EJT A;  4NB5 A;  1PUE E;  4XLN F;  2B0L A;  3I4P A;  4IJA A;  2A5Y B;  1XGS A;  1T98 A;  4LG0 B;  3HTS B;  4FT8 A;  2L01 A;  1A04 A;  1P4A A;  3DKW A;  3Q9V A;  2D1H A;  1KA8 A;  2ZNY A;  4RB0 A;  2PMH A;  3RI4 A;  4KNY A;  2Z99 A;  5HDG A;  4IHS A;  1PDN C;  2HFH A;  2OBP A;  3CO6 C;  1MD0 A;  5DCF A;  3BJA A;  1XCV A;  4U0Y A;  4P5O A;  2ZBK A;  1BIA A;  3J80 Z;  3KEO A;  4XSZ F;  1FZP B;  4I09 A;  2EFP A;  1HSJ A;  2DO7 A;  2LNB A;  4IHT A;  3I58 A;  4PGH A;  1KU2 A;  3VOD A;  1LEB A;  3LST A;  3TO7 A;  2Z3Y A;  1Z1D A;  3TDU C;  2FU4 A;  4RS8 A;  1USS A;  2YR2 A;  1FYM A;  4Q5S F;  1WKM A;  2V1X A;  5E1X A;  1ON2 A;  1YFH A;  5JVT A;  5FLX K;  5KK1 A;  5D5U B;  3GF2 A;  2W85 A;  3V7S A;  4ENK A;  2DU9 A;  1O57 A;  3ZN0 A;  3E6B A;  2V6C A;  5HVQ C;  1HKQ A;  5BPI A;  1T6S A;  2R3S A;  1YYV A;  2YX4 A;  3QRF F;  2QWW A;  2FSW A;  1W7P B;  2IVM A;  4O6J A;  1MJA A;  1QNT A;  2PJP A;  5DD8 A;  3C3W A;  1L3L A;  4EJV A;  2J5P A;  1I27 A;  1KYW A;  2IP2 A;  3G73 A;  3MFK A;  3HRT A;  5DUK A;  2P7C B;  3NEU A;  3GFI A;  5L3C A;  2DFI A;  2VC0 A;  2ZNZ A;  5HLI A;  2PBI A;  1F1Z A;  4R8H A;  3V8L A;  1G3S A;  4R1H A;  5H20 A;  2EWN A;  4M73 A;  4Y13 A;  1D8J A;  3JAM K;  3WGH A;  4KT5 C;  3QAH A;  5L3E A;  2W57 A;  4RGS A;  4IXA A;  5LHH A;  1YW8 A;  1RI7 A;  1TNT A;  3F8M A;  2MH2 A;  3F8C A;  4RB3 C;  4IRH A;  1Q1H A;  3E97 A;  2K4J A;  2LF8 A;  1IXC A;  1GXQ A;  2H27 A;  3NQO A;  3PQJ A;  4N0B A;  4FHT A;  3HHG A;  1U8R A;  4OMZ A;  4A0X A;  2EFQ A;  2DT5 A;  3F6V A;  2EV5 A;  4CZZ A;  4LB6 B;  2V1U A;  4G9Y A;  3H3U A;  1IUY A;  2MLK A;  3VEP A;  3ZMZ A;  1XDU A;  2Q2E A;  3R0A A;  1HW2 A;  1YIO A;  1HW5 A;  4CGZ A;  2V1D A;  2E7X A;  1S7O A;  5LHI A;  4I01 A;  2ISZ A;  5K5Q A;  2AS5 F;  1TW2 A;  2DK8 A;  2HDC A;  3TGN A;  2OZ6 A;  3DFG A;  5EEH A;  2OQG A;  1TNS A;  2RVC A;  1TQM A;  3CDH A;  1ZN2 A;  1JE8 A;  4U7D A;  5FD6 A;  3D5L A;  4LMY A;  1BI2 A;  1UST A;  2HYG D;  4WXH A;  2PEX A;  4M72 A;  2OU2 A;  3MEX A;  1XB4 A;  2HR3 A;  3LQR A;  2M1B A;  4XSX F;  5LLQ A;  5CVI A;  3I53 A;  2A6E F;  2Y0M A;  1IXS B;  5H6R A;  4G7H F;  3RTR A;  4M71 A;  3PFI A;  4MEY F;  3F6O A;  5ICC A;  1YTY A;  1Z05 A;  2M87 A;  1LVA A;  4OU0 A;  3F23 A;  2Z9O A;  1LQ1 A;  2MBF A;  4I02 A;  5E1Z B;  2CSO A;  2CW0 F;  2FNA A;  5EEG A;  3ERE D;  4HX4 A;  2JSC A;  2W24 A;  1UFM A;  3HIF A;  2MH9 A;  2HWV A;  2O61 A;  4KA4 A;  3R0J A;  4I7H A;  2GXB A;  5BQT A;  1ON1 A;  4GGG A;  4BHP A;  1K6O A;  5AON A;  1SFE A;  4HYE A;  5LGN A;  1TW3 A;  2HTS A;  4GXO A;  4LB5 A;  4UVA A;  2DTR A;  1UCR A;  3FHZ A;  5AIP A;  2ESH A;  2GIV A;  2K02 A;  2FEZ A;  2FNP A;  2GWR A;  1F4K A;  4EM2 A;  1G4D A;  3WTT C;  4HOB A;  2DI3 A;  3SZT A;  2VOO A;  3FX3 A;  1SFX A;  4M9S A;  2A6H F;  5D5V B;  2P4W A;  1BN5 A;  1XSV A;  4XLP F;  4KMF A;  3HHH A;  4LLN A;  1ZH5 A;  5LGT A;  1L0O C;  2A69 F;  4E70 A;  2GZW A;  4OIP F;  2RKH A;  3GX4 X;  3ISP A;  2K7L A;  1V3F A;  2ACJ A;  5E8I A;  1G3T A;  4HF1 A;  1TTY A;  3WTY C;  3HOT A;  4YIF A;  2VN2 A;  3JAM Z;  2FOK A;  3E6D A;  4EM1 A;  3OOP A;  1IN4 A;  3GW2 A;  3EDP A;  5K5O A;  2RGV A;  2FBK A;  2F5C A;  4YFX F;  1RUO A;  4GYG A;  4A5M A;  2PMU A;  1Z9C A;  1OR7 A;  3JSO A;  4HLY A;  1KGS A;  1GVJ A;  2VBX A;  3KZY A;  2QBY A;  1ZG5 A;  3GUD A;  4IF4 A;  3GFM A;  2XAQ A;  5D8K B;  4HF2 A;  4PCQ A;  1R1V A;  2KIU A;  1GXP A;  2V79 A;  2W25 A;  4MTD A;  2FMY A;  6PAX A;  2H6B A;  2EFO A;  2QLZ A;  1HST A;  1MZB A;  3FF5 A;  3NRV A;  2IJL A;  4A2U A;  1T2K A;  4ON0 A;  3HSR A;  1SMY F;  1E17 A;  2IA1 A;  5LGU A;  2EA2 A;  1W7P A;  2O8X A;  3WE3 A;  2G7H A;  2Q8K A;  2H09 A;  1QPM A;  5CVV A;  3WU1 B;  4DNC A;  5LBQ A;  1DPU A;  3KLO A;  4IVN A;  4KIC A;  3F8F A;  1KQ0 A;  3E6C C;  1R1U A;  4GCV A;  3IKT A;  2CQK A;  3VFZ A;  5ICE A;  1O3Q A;  3VOE A;  2HOE A;  3LQQ A;  2BV6 A;  2FBH A;  3FMR A;  4P55 A;  2WWY A;  1W5T A;  3IC7 A;  4OIO F;  3RJP A;  2K4B A;  5K1Y A;  2HKO A;  5FFZ A;  1G3W A;  3CUO A;  3U1D A;  5A2Q Z;  3KZZ A;  1FBU A;  3WOD F;  3GEZ A;  2BBY A;  3W6J B;  3TO9 A;  1IN8 A;  2IA2 A;  2M5W A;  3WTS C;  2UZK A;  3OV8 A;  1ZYR F;  3ZPL A;  4L9N A;  2XRO A;  3REO A;  1I6X A;  1QBJ A;  4ESF A;  1HKT A;  4HAM A;  2KRF A;  3RKY A;  3SFZ A;  2NNY A;  4LLG F;  2CYY A;  3WG9 A;  3ML6 A;  4PDK A;  4LLL A;  3N4M A;  1ZAO A;  3CUQ A;  4MHG A;  2OD5 A;  2NNN A;  3SZP A;  1BI0 A;  4L9V A;  3HTU A;  1ZG3 A;  3ZP5 A;  1WSU A;  1S7A A;  3E5Q A;  1EH8 A;  2Z33 A;  1PP8 F;  1ULY A;  1DDN A;  2HQN A;  4EV0 A;  4ZH4 F;  1U2W A;  3GLX A;  3V7R A;  2ADU A;  4B8X A;  1Z6R A;  3MZH A;  1H9T A;  2D2W A;  1AWC A;  4BH9 A;  2JPB A;  1REP C;  2R7D A;  2YX7 A;  3R60 A;  3J81 Z;  1J9I A;  2FBI A;  1XN7 A;  3IWZ A;  3I59 B;  1IN5 A;  3KP6 A;  4Y15 A;  3BJO A;  1Z6T A;  4IPA A;  2L02 A;  5FGM A;  3F8N A;  4WCG A;  4HV6 A;  4MEX F;  2A3S A;  2VBY A;  3K2Z A;  1TQP A;  4AIK A;  5F6F A;  5CLS A;  3KFW X;  2X4H A;  3SHF A;  2MD5 A;  3O3K A;  4G6D A;  2VC1 A;  1U3E M;  1B9N A;  4EJW A;  1KQ8 A;  1FP2 A;  5ERI A;  3F21 A;  4UVC A;  3CO7 C;  1B9M A;  3HRS A;  4HX7 A;  2RNJ A;  3LA7 A;  3WGI A;  2XKO A;  4ZZL A;  4LGW A;  3C7J A;  3QU6 A;  2V9V A;  4S05 A;  2E7W A;  1K78 A;  2PLY A;  4EVI A;  1PP7 U;  4CIC A;  4BHC A;  2EK5 A;  4ESB A;  5D4R A;  2ZFW A;  3RPQ A;  4K2E A;  2LSO A;  2NYX A;  3QP6 A;  3DPT A;  4O5V A;  4CXF A;  3E5U A;  5ILS A;  2DBB A;  4A12 A;  1OMI A;  4BQA A;  3ZQ7 A;  3BRO A;  4AD9 A;  3KP5 A;  2A07 F;  3K0L A;  3TO6 A;  4M9Z A;  1E2X A;  1IN7 A;  3L00 A;  2JTV A;  3LAJ A;  1S6L A;  1YQA A;  2GAU A;  1T0F A;  3RKW A;  5LRS A;  1FOK A;  4U88 A;  4L5J A;  3JTG A;  3K69 A;  4YII A;  3QU3 A;  4KIF A;  1O3S A;  5HDN A;  1QZY A;  5HLH A;  2ZCW A;  4MTE A;  4RGU A;  1VTN C;  4MGR A;  1MDM B;  1ZRC A;  3QOP A;  3FXU A;  1SMT A;  3EET A;  2JRT A;  5ED4 A;  2FRH A;  2HQR A;  2HGC A;  4QLC U;  5IT9 Z;  3C1D A;  2LDU A;  5D5W B;  2R7F A;  1JGS A;  1G6N A;  3DPL C;  5D4S A;  2JT1 A;  1FT9 A;  2OA4 A;  2MA3 A;  4Z2Y A;  4KFC A;  3M8F A;  5DV5 A;  3IHU A;  2IW5 A;  1ONV A;  2CFX A;  3BDD A;  2PQ8 A;  3FWE A;  5J6X A;  4HA8 A;  4KDP A;  3T8T A;  2NAZ A;  4RGR A;  1MKM A;  5CVR A;  4L0Y B;  1GHC A;  1YW7 A;  1U5T B;  1WI9 A;  2G7U A;  3H3Z A;  4OIQ F;  3LAP A;  4I98 B;  2DQR A;  2STW A;  1IRG A;  3HYI A;  4ZYG A;  1DUX C;  2O03 A;  3T5X A;  4F7Z A;  4HDU A;  2WTE A;  3RDI A;  5F1R A;  2DPU A;  3EYY A;  3MWM A;  2L4A A;  4A0Y A;  5TRD A;  4UUV A;  1FLI A;  2VBW A;  2FML A;  4ASN A;  4JQF A;  3ABT A;  2RN7 A;  2DW4 A;  3TKY A;  1I5Z A;  2GA1 A;  4JK1 X;  4BAY A;  1ZRE A;  2ISY A;  3O2P E;  3KP4 A;  1CGP A;  3BY6 A;  4YG2 F;  4ENM A;  1OYI A;  5TJJ A;  1U78 A;  2OZU A;  4RB2 C;  2HS5 A;  5HLG A;  1MJ9 A;  2IRF G;  4HQE A;  3G3Z A;  1XSX A;  1NHA A;  3J7A O;  4FX0 A;  3WGG A;  4G7O F;  3IRR A;  1TBX A;  4YFN F;  3GYH X;  2K86 A;  3F3X A;  4RAZ A;  2Y48 A;  4LK0 F;  4YFK F;  2XIG A;  3FM5 A;  5JFR A;  1SD4 A;  3GZ5 A;  2EV6 A;  2F2E A;  5L3D A;  3KET A;  4ESJ A;  4Q48 A;  4MQ9 F;  5DUI A;  1LB2 A;  4EGZ A;  3U9G A;  3ROU A;  1QZZ A;  1W5S A;  3I59 A;  5E8G A;  3W6K B;  4A6E A;  3ABU A;  2QBY B;  4QWQ A;  2HZT A;  2OAZ A;  1XGO A;  2HYF A;  2FXA A;  3F22 A;  2XAF A;  3KEQ A;  1LEA A;  1IW7 F;  1XD7 A;  4CYD A;  1IXR C;  1R1T A;  2P5K A;  3RPU A;  2VT2 A;  1O7F A;  1UB9 A;  2BE5 F;  1I1S A;  3FMQ A;  2WV0 A;  3DP7 A;  2L54 A;  5ICF A;  1YO5 C;  1WRJ A;  2NRA C;  2COM A;  1FPQ A;  3GXO A;  4BNC A;  4L5I A;  1O3T A;  3L9F A;  1OKR A;  1BOA A;  1XCB A;  2DPD A;  3QP5 A;  3QPT A;  3BZ6 A;  1P2F A;  1R22 A;  5DCM A;  4P96 A;  5DYM A;  3P9I A;  2L3D A;  1R7J A;  1DPR A;  5HS9 A;  2CG4 A;  5FO5 A;  1OYY A;  2QUF A;  2L4M A;  2XAJ A;  3B73 A;  3BJ6 A;  2VT3 A;  3R4K A;  2ZME A;  3ZN1 A; 
#chains in the Genus database with same CATH topology
 3IWF A;  4A3E J;  5H6Q A;  1G8X A;  4B3X A;  2F5D A;  3HOV J;  3ZMU A;  2EZI A;  2ZXJ A;  2DK5 A;  3JW4 A;  1X1P A;  2VI6 A;  3FZV A;  3OYB A;  5CJ9 A;  5IT3 A;  2KMU A;  3ZRG A;  3WTW C;  3F9K A;  4E7H A;  2GLO A;  5GAD J;  1KQ9 A;  2LY9 A;  1V4R A;  1J5Y A;  2MW8 A;  1SD5 A;  2XKP A;  3KEY A;  2EIJ H;  2L9R A;  1YRN B;  2H8R A;  4KUM A;  3CJN A;  2CW8 A;  2OC6 A;  3EYI A;  2ETH A;  3DCF A;  3SXY A;  3JRB A;  3H0G J;  1T08 B;  2R93 J;  2ID6 A;  1SD6 A;  4AM3 A;  4UB8 C;  1BM9 A;  1JTY A;  3FM3 A;  5M5W J;  1H0M A;  2K3F A;  3COA C;  3I0T A;  4PJ0 C;  4WXD A;  2CV2 A;  2WC2 A;  2F4M B;  2HXO A;  1ETV A;  4CO8 A;  3WTV C;  1HQC A;  2O9L A;  4E7J A;  2UXX A;  4I2O A;  3GWZ A;  3S2W A;  1YLF A;  4IKF A;  2QVO A;  3HG9 A;  1XSD A;  1RIO H;  1R36 A;  2VQG A;  1DU6 A;  4L0Z B;  1MJB A;  4EJO A;  3BPX A;  4P9F A;  3Q9S A;  1J2X A;  3LA2 A;  3H9G A;  2IS1 A;  2M4K A;  4G7Z F;  2ZME B;  1LDD A;  3RPU D;  1K61 A;  2D5V A;  3K7A J;  2Y69 H;  3L7W A;  3OYA A;  2R5Z A;  3PM1 A;  3CUQ C;  4DQ2 A;  2LMD A;  3MAJ A;  4JX5 A;  2OQR A;  2E2H J;  4A3D J;  4TV7 A;  3CMM A;  2VE8 A;  2EA4 A;  2HXI A;  3G4S I;  2DA4 A;  2I10 A;  3JRF A;  3V8K A;  1BIB A;  4ZTF A;  3ZCO A;  1CF7 A;  1BJA A;  4FIS A;  2EH3 A;  4FX4 A;  5GP9 A;  3CC7 I;  3P9C A;  2OCE A;  1QQI A;  4UVB A;  4KYW A;  2NOG A;  3K4K A;  2KDZ A;  1C0W A;  3Q0V A;  1R6R A;  3I54 A;  2VOD A;  2FQ4 A;  3G6E I;  1E3P A;  3GTM J;  4X6A J;  4UNO A;  4ETS A;  3R6S A;  4N9H A;  5FFX A;  3OYE A;  1QO0 D;  1DP7 P;  1N75 A;  5CYV A;  3H0D A;  4GFB A;  1OJL A;  5LHG A;  1OR7 C;  3VDX A;  2M3A A;  2XAU A;  2RV8 A;  1S3J A;  1BOB A;  1WQ2 A;  3N97 A;  1XX5 A;  3GLL A;  2VE9 A;  1SC7 A;  1BI3 A;  5CPR B;  2K27 A;  2DAO A;  2WBM A;  4ENN A;  2M30 A;  4NQW A;  4U7B A;  1ZG1 A;  1VZ0 A;  1LE8 A;  3TED A;  3ULQ B;  3V7C A;  5EDN A;  1O4X A;  2CFO A;  4PJN A;  4NNJ A;  1RZ4 A;  4KN7 X;  1OPC A;  5FD5 A;  3H92 A;  5CVU A;  1ZRD A;  3MKY B;  5C4J J;  3H1C A;  3E5X A;  1ZR2 A;  1NG6 A;  3RKX A;  3RYP A;  1FTZ A;  2OTL I;  4IZZ A;  3C2B A;  3DLL F;  4HRI A;  2KJB A;  3I3L A;  2LBF A;  3TMO A;  3VB2 A;  1IDY A;  5GTH C;  3AKZ A;  4QPQ A;  2E71 A;  1LPQ A;  3G1M A;  2BY0 A;  3DF8 A;  4BEH A;  1SFO J;  2Q1Z B;  1LJ9 A;  3OYH A;  4EAT A;  4D0P A;  3TOB A;  4OMY A;  4CHU A;  2X85 A;  4L9T A;  2J5O A;  3DU6 A;  3I56 I;  2NXN B;  2KFD A;  3HC7 A;  1QRY A;  2GM4 A;  3WTZ A;  1IF1 A;  2VQC A;  3SZG A;  1G59 A;  3C18 A;  5BS6 A;  4AIH A;  4ENJ A;  4II2 A;  1TL8 A;  2P8T A;  5D6F A;  4RAY A;  3G2B A;  1ETK A;  2WA0 A;  1ZGJ A;  2EB7 A;  2QQB A;  1G3Y A;  3JRI A;  1SFU A;  4UHT A;  4LG0 A;  1RES A;  3FK7 A;  5E3N A;  5K5R A;  2TDX A;  4H0E A;  1B6A A;  2M0M A;  4HZF A;  5DCM B;  1K4S A;  1KU9 A;  1B59 A;  2KIF A;  4XBF A;  3ZQH A;  2P6S A;  1U5T A;  5FKN A;  3K1P A;  4ZC3 A;  2IT0 A;  3AG2 H;  3NAR A;  2ZXH A;  3ESW B;  5HOO A;  2H1L A;  3P5J A;  3N05 A;  3QOE A;  4FCY A;  3L2C A;  3OYI A;  2IGO A;  5HDK A;  4WK8 F;  1K79 A;  3OS1 A;  2ECC A;  3DXJ F;  5BOX A;  2JA7 J;  3BOQ A;  3CCR I;  2DMP A;  1OCP A;  1ZGA A;  2E34 A;  2R7X A;  1IRF A;  5AIQ A;  3I5U A;  2JMW A;  3KCC A;  2QQA A;  2R7T A;  2NS0 A;  1FX7 A;  4C3J J;  3B02 A;  3T8R A;  4RM3 A;  1F9N A;  1YG2 A;  5E20 A;  4AIJ A;  2RDP A;  5LEK A;  2QF7 A;  1VQK I;  4BE0 A;  2JUC A;  3LSJ A;  5E3O A;  1YE9 A;  2ZSH B;  2V9K A;  1X1C A;  2A68 F;  1HBX G;  4DGW B;  2PFB A;  1ITY A;  3CP2 A;  2L7K A;  2GOX B;  1VND A;  3SQN A;  1V5F A;  3H5R A;  3TW6 A;  3KIO A;  5J40 A;  4NDL A;  1VQ8 I;  4P9U A;  2E1N A;  1WPK A;  3I64 A;  2JZY A;  4XKC A;  3MCZ A;  3UKG A;  1BR2 A;  2RQP A;  4BXU A;  2CMP A;  1OYW A;  3S2D J;  4EGY A;  3FXR A;  1BI1 A;  2E1C A;  2DOE A;  1Y8Q B;  5ILU A;  4KIG A;  4PSW A;  1EA3 A;  2R7V A;  5C3E J;  2FQ3 A;  5DEQ A;  1OCC H;  3KLN A;  1LNW A;  4ZYD A;  4XNF A;  3WTU C;  3PNY A;  1LUJ B;  4UV9 A;  4A6D A;  1TLH B;  2A61 A;  3CJQ B;  4CH7 A;  2P5V A;  3JTH A;  4PSX A;  3TL4 X;  4BXX J;  4C9Y A;  1B72 A;  3BPV A;  2EJR A;  4HDV A;  4IOA F;  2R92 J;  1FSE A;  3I71 A;  2XVC A;  2IPQ X;  2GXA A;  5E1W A;  1ETQ A;  1R00 A;  2D45 A;  4LD5 A;  2XAS A;  3PL8 A;  3U2R A;  2ZJQ F;  1R23 A;  3WE2 A;  4MQV A;  1JT6 A;  2XGX A;  4CCK A;  3GTG J;  2LR8 A;  4HEA 2;  3S2H J;  3MKW B;  4NHJ A;  3DEU A;  3J81 K;  5HNH A;  4S04 A;  3V8J A;  1ZLK A;  4LJZ F;  4DZJ A;  3K70 C;  3EQL F;  4UY8 I;  3WHB A;  4Y52 J;  3OL4 A;  3M07 A;  4LIT A;  5FLV A;  1LFB A;  1Y0N A;  2E2I J;  1Z7U A;  4IHV A;  2TRT A;  1Z0X A;  2P5L C;  2X9D A;  3A0B C;  3OYD A;  1ZHF A;  1BC7 C;  4W97 A;  1D1C A;  1FBQ A;  5D6E A;  4A0Z A;  5L3G A;  2C6Y A;  5HS7 A;  4XOP A;  2M9H A;  1J09 A;  3OS0 A;  2DFE A;  3BR2 A;  4MFE A;  3WTX C;  1WJF A;  1ZRF A;  4BAC A;  1R5G A;  4J19 A;  4UXN A;  1UHW A;  2GA2 A;  3LFK A;  2XHK A;  2EFN A;  2F4I A;  1R58 A;  5E79 C;  1P7J A;  5B1B H;  4BYY A;  4HLX A;  3FXK A;  3T1B A;  2Z1D A;  3DTK A;  5J3L A;  4KIT B;  2JPC A;  3S32 A;  3TW7 A;  1T38 A;  4BY7 J;  2K9N A;  4OOI A;  5JHF A;  2IGN A;  2M8E A;  2KRC A;  2PJR A;  1IZ1 A;  4L9J A;  1MGT A;  2X1D A;  1BW5 A;  3K1N A;  2VBZ A;  2G0E A;  3HSF A;  4G8X A;  4HG2 A;  4HQM A;  3ZMD A;  3OYF A;  1U8B A;  4IRI A;  4LK1 F;  1FP1 D;  3VSK A;  2UUZ A;  3JSP A;  5IY5 H;  1MBJ A;  3I9V 2;  5EZH A;  5IYC J;  1EJ9 A;  2NS8 A;  2KJC A;  2VKD A;  3L09 A;  3KZI C;  3IP4 B;  1J0R A;  3O6B B;  1R71 A;  1J59 A;  4KIB A;  2JA5 J;  2HEO A;  1E3H A;  3QPH A;  2JA6 J;  5CVJ A;  2FA5 A;  2L5Q A;  3ONQ A;  2DLL A;  2MC3 A;  5J47 A;  3DEW A;  5DS9 A;  1ZGW A;  5KAF C;  1MBK A;  4AVP A;  1NG7 A;  3HKZ A;  2HVR A;  1P92 A;  2JSP A;  2VKE A;  3FHN A;  5KAI C;  2BW3 B;  3HL2 A;  2QGU A;  3IRQ A;  1QPI A;  3LOC A;  2K40 A;  3FBI B;  1K78 B;  2CO5 A;  3ZXS A;  1CF7 B;  4N4N B;  2QQ9 A;  5J8C A;  1H9G A;  3ELK A;  5A2Q K;  2XAG A;  4B3A A;  4I76 A;  2K5C A;  4CCJ A;  2VKV A;  4ZDO A;  3IUO A;  1X1D A;  1QVT A;  2BVL A;  2R5Z B;  4B1R A;  4M6X A;  4PJL A;  4Y17 A;  2DA3 A;  4A3K J;  1FIP A;  2WY7 Q;  2KKO A;  2JQ7 A;  3SEZ A;  4HF0 A;  2V1N A;  3GFJ A;  5JR3 A;  1XGN A;  2O3F A;  4OAY A;  1O3R A;  4FE4 A;  1W7P D;  4WF2 A;  5IOZ A;  1RKW A;  4DOZ A;  1R9T J;  2XC7 A;  2P6T A;  2YUS A;  1MBF A;  1V54 H;  1WWX A;  2QEN A;  4G94 A;  4A3M J;  1FY7 A;  2QM3 A;  3K4C A;  1A6Q A;  2CRG A;  3RZO J;  1EV7 A;  1LDK B;  3MQ0 A;  1IAW A;  1YS7 A;  1K83 J;  3KE2 A;  1JUS A;  1RRJ A;  2E5Z A;  3KP2 A;  1HXD A;  3GFL A;  3PUB A;  1XGM A;  2X48 A;  3DQV C;  2CV0 A;  3H9J A;  2EZL A;  3S16 J;  4U87 A;  4HW0 A;  1ORK A;  3BG3 A;  1RNL A;  4DIQ A;  1JKO C;  4HBL A;  2PI0 A;  3DV8 A;  4HV5 A;  3K4M A;  3HXL A;  5H2F C;  3RIR A;  2Z5U A;  2CQQ A;  2PX9 A;  3B6C A;  1BC8 C;  4M6V A;  3KP7 A;  5GPC A;  3ZMV A;  5F64 A;  1X3U A;  2XGE A;  3CLO A;  5J1U A;  4LFU A;  2NVU B;  1PUF B;  2F48 A;  4A3B J;  2X1C A;  2XAH A;  4AWX B;  4Q4Z F;  5DTD A;  2G9W A;  3IL2 A;  2ELH A;  4GO1 A;  2LKX A;  3BWG A;  4G6Q A;  2QA4 I;  4E7L A;  2AQE A;  1EKE A;  3AAF A;  2GIZ A;  3M8J A;  2YU3 A;  4N9I A;  1FEX A;  4GYI A;  2RC4 A;  4B09 A;  4B47 A;  4X0G A;  4XQF A;  3A03 A;  2FE3 A;  3FDY A;  2HOT A;  1B1B A;  3CTA A;  3DKX A;  2FX0 A;  2ELK A;  1JGG A;  4NBQ A;  1MBH A;  1FTT A;  2TCT A;  2DFH A;  5IPA A;  4C30 A;  2QCO A;  1MDM A;  4O3M A;  4KJZ A;  3WU0 A;  4BJ6 C;  3IKV A;  4FAS D;  1TQI A;  4XK4 A;  1GV2 A;  2BYV E;  4L5E A;  4CZC A;  1JXS A;  1U6G A;  4M9X A;  2MLG A;  1JHF A;  1KU7 A;  3D5R C;  3E6M A;  2EV0 A;  3BR0 A;  1J7K A;  2XRN A;  3AG3 H;  4RLQ A;  1VI0 A;  4ZYE A;  3HGY A;  1BJZ A;  1Z91 A;  1WH5 A;  3DLA A;  4IRG A;  5BMZ A;  1S8N A;  1SEU A;  5FB2 A;  1FNN A;  1ZTR A;  2ESN A;  3PNT A;  2ID3 A;  3Q5F A;  4JBA A;  3BT9 A;  3CCY A;  3W2A A;  1K6Y A;  1T39 A;  3R61 A;  4KIS A;  3GZ6 A;  4JP0 A;  2CQX A;  5LRR A;  5J8F A;  2H8W A;  3TOA A;  2B63 J;  2KIM A;  3CUQ B;  5IT9 K;  2UXN A;  4BY1 J;  2HTJ A;  1W4M A;  2HYJ A;  5KVR A;  1IC8 A;  3LA3 A;  2H6C A;  4E7Z A;  1D8K A;  2GQQ A;  3K4J A;  3K4B A;  5EZG A;  2IA0 A;  3HSE A;  1YW9 A;  2VXD A;  1EH6 A;  1U9O A;  4R79 A;  3K1M A;  1K7A A;  1MMG A;  2XV4 S;  3I4N J;  5L3B A;  1FBS A;  3J80 K;  3TQN A;  4A5N A;  3HUG B;  1P4W A;  1ZAR A;  3E3V A;  3GVA A;  3ZQQ A;  3BP8 A;  4BHB A;  3HGG A;  2YPR A;  1D5V A;  1BR1 A;  2X0L A;  5IOY A;  4C2T A;  2DA7 A;  1LDJ A;  2DN0 A;  5JHU A;  4L18 B;  2ZC2 A;  1STZ A;  2X6Y A;  4F91 B;  3L2V A;  5K7F A;  4UV8 A;  5DDG A;  3OS2 A;  1U5T C;  2NVY J;  5ICG A;  3M7G A;  3HJE A;  2VJI A;  3GTJ J;  4I0B A;  2FF4 A;  1S7E A;  2GXG A;  4D5C A;  3CCU I;  2Q0O A;  4KMU X;  1S29 A;  3P9K A;  1PJR A;  5J4V A;  5LEJ A;  2Q2E B;  3HRM A;  2CU7 A;  3OMY A;  3FBN B;  3F72 A;  4OIR F;  2PJR B;  5EGO A;  1MMS A;  3H3V K;  2AHQ A;  4DZP A;  3ERM A;  5BPD A;  3Q0U A;  2F5V A;  3ECO A;  4FET A;  4RB1 A;  1LVK A;  2DA2 A;  1P6R A;  3BCA A;  4E4H A;  3JRH A;  1NTC A;  1RUN A;  4A3I J;  4V2F A;  2Y9Y A;  2DA6 A;  2QYO A;  2BGC A;  1JHH A;  2XSJ C;  2DA1 A;  4F55 A;  1FSH A;  2VKH A;  4DYR A;  2Y75 A;  4ZDL A;  3RQ4 A;  5EJC A;  1D1B A;  1UEL B;  2XUB A;  4CSW A;  3OL3 A;  1XMK A;  3A01 A;  1HW1 A;  4PGG A;  2OF7 A;  1JT0 A;  3LWF A;  1IRX A;  3O8H A;  3LSG A;  3SDB A;  2EIM H;  2YSR A;  5D8L B;  2F5E A;  2KZG A;  1EH7 A;  1LE8 B;  4I0A A;  1WJ5 A;  3HOW J;  3CCJ I;  4C3H J;  3MKL A;  1XDS A;  2ZB9 A;  4DBR A;  1S9H A;  2IGM A;  4EMS A;  1AOY A;  2VON A;  1BBY A;  2PG4 A;  2IS4 A;  5E18 F;  2VIX A;  5K7H A;  5FLX Z;  5LFA A;  4EEF G;  1MNE A;  1Z67 A;  2LOO A;  2M45 A;  3TDZ C;  2M2E A;  4H4K C;  5ILV A;  1AU7 A;  4CDG A;  1Y6I A;  2LKP A;  2PN6 A;  2BEO A;  3J7Z I;  1ODD A;  2H94 A;  4MNU A;  4XRF A;  2O8K A;  2O5R A;  5JI6 A;  3FMS A;  3M8E A;  5CQG A;  3BR6 A;  2V7F A;  1XMA A;  3RYR A;  1WVR A;  3TP0 A;  3CCQ I;  2ELJ A;  3PNV A;  1BL0 A;  5DM6 F;  2P0W A;  4IL6 C;  3D0S A;  2O6G E;  4EQQ A;  3J7A Y;  4ZYH A;  3ZMT A;  1B4A A;  5DD4 A;  2CGP A;  2ZKZ A;  2W84 A;  4M6Y A;  4KN4 X;  1Y56 A;  2RAE A;  1FYK A;  4ZZD A;  1TWC J;  3L2U A;  2DMN A;  2XSD C;  3BTL A;  4OWR B;  4XKW A;  2DQL A;  4BE2 A;  2E1M C;  3GTO J;  1JUP A;  2EFW A;  1J75 A;  2UWM A;  3T0Y A;  4J01 A;  4NUB A;  2F5F A;  3FXL A;  2DDA A;  2ZSI B;  1ZLJ A;  2KHM A;  3M4O J;  2VOP A;  3JCU C;  1FC3 A;  3ZMS A;  3P7N A;  1DQU A;  5FLM J;  3K9T A;  1P4X A;  2AXL A;  3JRD A;  4HX8 A;  2ZO4 A;  1I1G A;  1S5L C;  4IHW A;  1UHM A;  1KU3 A;  3F8B A;  2DMT A;  1WHU A;  3KP3 A;  2O0Y A;  2P7V B;  3MZY A;  4JX4 A;  3HOS A;  1PYV A;  3L2W A;  1HKS A;  3M9A A;  1WZ2 A;  2QZ8 A;  3DEE A;  2DYR H;  3M1E A;  5GTI C;  1FJL A;  1QGP A;  3K10 A;  1SAX A;  2CH0 A;  2NVQ J;  1MH4 A;  5L3F A;  1FWZ A;  4U0W A;  1Z3Y A;  5JLX A;  2VJ5 A;  4WWC A;  2ZJ2 A;  4EJU A;  1DGW Y;  1R5H A;  4WXC A;  1BA5 A;  2D1V A;  3OR2 C;  3HRU A;  1F5T A;  3EUH A;  5D5X B;  2CWE A;  1D3Y A;  2MC4 A;  3FXQ A;  1IJW C;  1WJE A;  1IN6 A;  1KYZ A;  5F0C A;  5E3L A;  5E17 F;  4Q47 A;  2JVH A;  4WX9 A;  1D1A A;  2DTZ A;  1IUF A;  3ECH A;  3OYM A;  3E7L A;  5HS8 A;  1MNM C;  3GO5 A;  2DXI A;  1YS6 A;  2EPF A;  1YX3 A;  4M74 A;  4CCN A;  2VXZ A;  4BE1 A;  4RGX A;  1LFP A;  2LF7 A;  3GCM A;  3FKJ A;  4IOC F;  2WY8 Q;  1FYL A;  1SD7 A;  1UHS A;  1FMW A;  2HKX A;  3PQK A;  2P81 A;  3CDI A;  1O7L A;  4U0V A;  2V6E A;  1TWA J;  3AG1 H;  4OIN F;  2MAB A;  3HUG A;  4EM0 B;  4PZJ A;  2CS3 A;  2STT A;  2XGC A;  1Y0U A;  1DGR M;  1W0U A;  1VF9 A;  2XB5 A;  3V4G A;  3CC2 I;  2CUZ A;  3IH2 A;  2WAQ N;  5J1Y A;  2N8G A;  4F3Q A;  2L2O A;  4EJT A;  4NB5 A;  1PUE E;  4XLN F;  2B0L A;  3I4P A;  4IJA A;  2A5Y B;  1XGS A;  1T98 A;  2LH9 A;  1SVO A;  4LG0 B;  3AL0 B;  3HTS B;  1MSF C;  5M5Y J;  4FT8 A;  2L01 A;  1A04 A;  3MD2 A;  1P4A A;  2XF7 A;  3DKW A;  1NK2 P;  2HOS A;  3Q9V A;  2L9N A;  4JYK A;  2D1H A;  2E1M B;  4NC8 A;  4A3F J;  3OYL A;  1RPW A;  4XOT A;  1KA8 A;  2ZNY A;  3I4M J;  4RB0 A;  3S17 J;  2PMH A;  3GBG A;  3PSI A;  3RI4 A;  4KNY A;  2R7O A;  1R4M B;  4BDY A;  4BDZ A;  2Z99 A;  3VSL A;  5HDG A;  4XLC A;  4IHS A;  2OBP A;  2HFH A;  1PDN C;  3K70 D;  3CO6 C;  1MD0 A;  5DCF A;  4DBQ A;  1IGN A;  2BXZ A;  2L9S A;  2LRD A;  3B6A A;  5GAG J;  2BY3 A;  3FXJ A;  3BJA A;  1XCV A;  2KPM A;  4M3D A;  4HNU A;  5FRN A;  2HVS A;  4U0Y A;  3GME A;  4P5O A;  2ZBK A;  1BIA A;  2EIL H;  3J80 Z;  3KEO A;  4XSZ F;  1FZP B;  4I09 A;  2EFP A;  3WHC A;  1WJA A;  1FMV A;  1HSJ A;  2DO7 A;  2OPT A;  5F27 A;  2LNB A;  1A35 A;  4IHT A;  3I58 A;  4PGH A;  1KU2 A;  4LG3 A;  3VOD A;  1LEB A;  3LST A;  3TO7 A;  2Z3Y A;  3HBL A;  2M4G A;  3OYC A;  2CQN A;  1Z1D A;  2KIQ A;  4M3G A;  3TDU C;  2FU4 A;  2A05 A;  3FIS A;  4RS8 A;  2KZV A;  3S8P A;  4XKV A;  1USS A;  3MZ8 A;  1X2N A;  1YJ9 I;  1M1E B;  4IHY A;  2YR2 A;  1FYM A;  4Q5S F;  1WKM A;  2V1X A;  3H36 A;  5E1X A;  1EF4 A;  2OCC H;  2RRE A;  1ON2 A;  2OV7 A;  1YFH A;  5JVT A;  5FLX K;  5KK1 A;  2W4S A;  5D5U B;  2BY1 A;  3GF2 A;  2W85 A;  3V7S A;  4ENK A;  2DU9 A;  1O57 A;  1MH3 A;  5C4X J;  2EBI A;  1ZEL A;  5C44 J;  3ZN0 A;  2E35 A;  2V6C A;  3E6B A;  5HVQ C;  3A0H C;  1HKQ A;  2DYS H;  5BPI A;  5BNG A;  2UV1 A;  4XR6 A;  1T6S A;  2R3S A;  4UB6 C;  1YYV A;  4BQN A;  2YX4 A;  3QRF F;  4ZTJ A;  3BG5 A;  2QWW A;  5HOD A;  3HDD A;  2FSW A;  1W7P B;  2IVM A;  1QZE A;  4O6J A;  1MJA A;  1QNT A;  4ZDP A;  3HOU J;  2PJP A;  5DD8 A;  5FKO A;  3C3W A;  1L3L A;  4EJV A;  2LRE A;  3W6V A;  1SAU A;  4XRS A;  2J5P A;  1I27 A;  1KYW A;  4D9J A;  2IP2 A;  3G73 A;  2I5U A;  3MFK A;  2AXT C;  3HRT A;  5DUK A;  3OSF A;  1RKT A;  2P7C B;  3NEU A;  4D1Q A;  3GFI A;  1WH7 A;  5F0F A;  5L3C A;  2DFI A;  2VC0 A;  2ZNZ A;  5HLI A;  5KNL A;  2PBI A;  3OYK A;  3OSG A;  1F1Z A;  4R8H A;  4PK4 A;  1X4O A;  3V8L A;  2LKS A;  5J4Y A;  1G3S A;  2EQR A;  2R5Y A;  1P9Q C;  2MFZ A;  4R1H A;  5H20 A;  1IG7 A;  5EG0 B;  2EWN A;  4M73 A;  5EYR A;  3I55 I;  3VYS B;  2VUM J;  4Y13 A;  1D8J A;  3JAM K;  1UAA A;  1MND A;  3WGH A;  1F36 A;  2K9S A;  4KT5 C;  2LD5 A;  3QAH A;  5L3E A;  2W57 A;  4IEJ A;  1RET A;  4RGS A;  4IXA A;  3PIP F;  3A1Y A;  5LHH A;  1YW8 A;  3KYL A;  1RI7 A;  2K9L A;  1TNT A;  3F8M A;  3OY9 A;  1WJD A;  3BG6 A;  2K9M A;  2MH2 A;  3F8C A;  3LSM A;  2HDD A;  4CUG A;  1H89 C;  4RB3 C;  1X19 A;  4IRH A;  1X3Z B;  2NVX J;  1Q1H A;  2BHZ A;  3E97 A;  2K4J A;  2LF8 A;  2HI3 A;  3FXO A;  3PSF A;  4A3L J;  2JVG A;  1MIJ A;  1ZKG A;  3HZJ A;  1IXC A;  1I3A A;  3HOY J;  1GXQ A;  2E19 A;  2DCE A;  2H27 A;  3NQO A;  3PQJ A;  4FE7 A;  4N0B A;  4FHT A;  2LC2 A;  3QPL A;  1Z7L A;  3HHG A;  1U8R A;  4OMZ A;  3ZOB A;  4A0X A;  1SVM A;  1UJ8 A;  2EFQ A;  2DT5 A;  3DBR B;  3HM5 A;  4XIC A;  2NOJ B;  3BG9 A;  3F6V A;  5B5E C;  1XS9 A;  1UG2 A;  2EV5 A;  4CZZ A;  4LB6 B;  2V1U A;  2CUJ A;  4G9Y A;  3H3U A;  1K4T A;  3FXM A;  1IUY A;  2MLK A;  3VEP A;  3ZMZ A;  1AHD P;  3CCS I;  5KHD A;  4C2U A;  1XDU A;  2Q2E A;  5GAE J;  3R0A A;  1HW2 A;  3ABM H;  1YIO A;  3PJR A;  3SYT A;  3EUK L;  1HW5 A;  2ME0 A;  2WAE A;  4CGZ A;  2V1D A;  2E7X A;  2NS7 A;  4BS9 A;  1S7O A;  1VQP I;  3CMY A;  3CCV I;  5LHI A;  4I01 A;  2ISZ A;  3BZC A;  4CYC B;  1XTA A;  4ITV A;  5TGT A;  4Y3O A;  5K5Q A;  3CCE I;  2AS5 F;  3RZD J;  4B43 A;  4NC7 A;  1TW2 A;  2DK8 A;  1F43 A;  2HDC A;  3HKZ N;  2ZXI A;  3TGN A;  2VJ4 A;  4XN3 A;  2OZ6 A;  3DFG A;  5EEH A;  2OQG A;  2ZXW H;  2E2J J;  1TNS A;  2RVC A;  4BUP A;  1TQM A;  1JI8 A;  3CDH A;  1ZN2 A;  4AYB A;  2B9S A;  1JE8 A;  2LYC A;  1GT0 C;  1AKH B;  4U7D A;  5FD6 A;  3D5L A;  4LMY A;  2QSH X;  3IAS 2;  1TT5 B;  2QQ8 A;  2AO9 A;  5IP9 J;  1BI2 A;  1UST A;  2HYG D;  4WXH A;  2PEX A;  3JRC A;  4M72 A;  2QKM B;  2OU2 A;  3TP3 A;  3RKQ A;  3MEX A;  1XB4 A;  2L7F P;  2L7M P;  4RLF A;  2HR3 A;  3LQR A;  4DYC A;  3ASO H;  2KP6 A;  2M1B A;  4XSX F;  2MG4 A;  3OIP A;  5LLQ A;  3GTQ J;  5CVI A;  1P7I A;  9ANT A;  3BLY A;  2CUE A;  2DOF A;  3I53 A;  2CUF A;  2A6E F;  2Y0M A;  4XOR A;  1XMX A;  4MLO A;  4I99 C;  1IXS B;  3WU2 C;  1U9N A;  3CZ6 A;  2R7U A;  4BQQ A;  4AUX A;  3EPZ A;  3Q3S A;  4E7I A;  1N78 A;  2X6X A;  3SJM A;  1GUU A;  4F52 A;  5H6R A;  4G7H F;  2V26 A;  3IAM 2;  4UUS B;  4PFP A;  3RTR A;  1HC8 A;  2KT0 A;  1VQO I;  4M71 A;  2DDB A;  3PFI A;  4MEY F;  2ZME C;  2R7Z J;  1OCZ H;  3F6O A;  5ICC A;  1YTY A;  1HDP A;  2WV1 A;  2E60 A;  2XPW A;  3V42 A;  1YI2 I;  1W36 D;  1Z05 A;  2M87 A;  2JUG A;  2BW3 A;  1TWG J;  1LVA A;  3E0J B;  1X4P A;  4OU0 A;  3HOZ J;  3F23 A;  2Z9O A;  1LQ1 A;  2Y2Z A;  5K7Z A;  2MBF A;  1WJC A;  4I02 A;  2FUG 2;  5E1Z B;  4UUT A;  2CSO A;  2CW0 F;  2FNA A;  2VQL A;  5J1R A;  2ZJR F;  3X2Q H;  1TWH J;  3NWS A;  4HST A;  4RBO A;  4BJT A;  5EEG A;  3CF2 A;  3ERE D;  4HX4 A;  2JSC A;  2W24 A;  1UFM A;  2YS9 A;  1V5E A;  2HNH A;  3OYG A;  3HIF A;  2NVT J;  2MSY A;  5B3S H;  3LL7 A;  2KQR A;  2MH9 A;  2PMZ N;  2HWV A;  3NWT A;  1LKX A;  2RNG A;  4KA4 A;  2O61 A;  3R0J A;  4I7H A;  2GXB A;  1YIJ I;  1ON1 A;  4GGG A;  4BHP A;  5BQT A;  4LIU A;  1TZL A;  2HDW A;  3S1Q J;  1A5J A;  1K6O A;  5AON A;  1SFE A;  4AYB N;  4HYE A;  5LGN A;  1TW3 A;  2HTS A;  1TWF J;  4GXO A;  3SFI A;  4UVA A;  4LB5 A;  3FIW A;  2DTR A;  1UCR A;  4M3B A;  1T8I A;  2V9P A;  5TIS C;  1IRZ A;  3FHZ A;  5AIP A;  2CW7 A;  2ESH A;  2WAF A;  3S1M J;  2GIV A;  2K02 A;  3S1N J;  1XG1 A;  2FEZ A;  2FNP A;  2XB0 X;  2GWR A;  4MIM A;  5F04 A;  2QEX I;  4F92 B;  2VLA A;  1I3Q J;  2M7B A;  1F4K A;  4A69 C;  4DYQ A;  4EM2 A;  1G4D A;  1QU3 A;  5M5X J;  3WTT C;  1DP3 A;  4HOB A;  2DI3 A;  3SZT A;  2VOO A;  3FX3 A;  1X2M A;  1SFX A;  4M9S A;  2A6H F;  5D5V B;  2P4W A;  5LD2 C;  1BN5 A;  4YRV A;  1XSV A;  4G12 A;  3L2Q A;  4XLP F;  2L9V A;  2JA8 J;  4KMF A;  3HHH A;  4LLN A;  1BR4 A;  1ZH5 A;  1FIA A;  3PIO F;  5LGT A;  3GTK J;  3QOD A;  2IS2 A;  2R5Y B;  1L0O C;  2A69 F;  4BGD A;  1Y8R B;  2JRM A;  4E70 A;  1X1A A;  2GZW A;  4OIP F;  2HZD A;  2RKH A;  2GBY A;  3GX4 X;  3ISP A;  1CQT A;  2MGQ A;  2K7L A;  1V3F A;  5E8I A;  2ACJ A;  2LG4 A;  1WI3 A;  1G3T A;  3OYN A;  4HF1 A;  1TTY A;  2VAS A;  3WTY C;  3HOT A;  3SEQ A;  4YIF A;  2VN2 A;  3HB9 A;  3U21 A;  3JAM Z;  1U0J A;  1V5G A;  2FOK A;  3E6D A;  4EM1 A;  3J7Y J;  1YOV B;  3OOP A;  4Y33 A;  1IN4 A;  2VL8 A;  3GW2 A;  1WJB A;  3BG7 A;  3EDP A;  5K5O A;  1ACI A;  2RGV A;  3RCO A;  2FBK A;  2F5C A;  2LLK A;  4YFX F;  1OFC X;  3CME I;  5E3M A;  1RUO A;  1MBE A;  4GYG A;  2LP0 A;  4A5M A;  1SAN A;  2PMU A;  2HU9 A;  2ME6 A;  1Z9C A;  2LK2 A;  3LSK A;  3M3Y J;  3DKY A;  3BR1 A;  2M34 A;  1WGX A;  1OR7 A;  3ABK H;  3JSO A;  4HLY A;  5EEA A;  1B8I A;  3D1N I;  1KGS A;  2LY1 A;  1GVJ A;  1WFX A;  2VBX A;  3KZY A;  2XDV A;  2LBF B;  4PUS A;  1YJW I;  4M3F A;  2DJI A;  2QBY A;  4ANJ A;  2XGD A;  1FOY A;  1ZG5 A;  1AKH A;  3GUD A;  4IF4 A;  1Y1V J;  2OTJ I;  3GFM A;  3IH3 A;  1MMN A;  2XAQ A;  3Q0W A;  5D8K B;  5IP7 J;  2VPL A;  4HF2 A;  3PO2 J;  4CYC A;  3JRE A;  4PCQ A;  3GTP J;  1R1V A;  1UZC A;  2V4J C;  2IBD A;  2KIU A;  1GXP A;  2V79 A;  2W25 A;  1VQ9 I;  4MTD A;  4XRM A;  2FMY A;  4XLA A;  6PAX A;  2KDO A;  2H6B A;  2EFO A;  2W1O A;  2QLZ A;  2XF5 A;  4E7S A;  1HST A;  1N77 A;  3DWL E;  3RSN A;  3QWL A;  3S15 J;  1MZB A;  3GZN B;  1Z21 A;  3FF5 A;  2DMU A;  3EUH C;  3NRV A;  2IJL A;  4A2U A;  1T2K A;  2R7Q A;  4ON0 A;  4A3G J;  3BR3 A;  3HSR A;  1SMY F;  1VQL I;  4LOC A;  2I8D A;  1E17 A;  1YHQ I;  2IA1 A;  4BQO A;  3BTJ A;  5LGU A;  1H8A C;  2EA2 A;  1OQY A;  3A01 B;  3QYE A;  1W7P A;  2O8X A;  3WE3 A;  2R4G A;  2G7H A;  1WCM J;  2Q8K A;  4GDF A;  3S3O A;  3MMY B;  4YEJ A;  3WG7 H;  2H09 A;  3K4L A;  3UNG C;  1D5Y A;  1QPM A;  4CA0 A;  5CVV A;  3ASN H;  3WU1 B;  4DNC A;  5LBQ A;  3VYU B;  1DPU A;  3KLO A;  2PMZ A;  4IVN A;  4KIC A;  3F8F A;  4BXF A;  1KQ0 A;  4C2M J;  2Y0S N;  3E6C C;  1YJN I;  1R1U A;  2LTP A;  1OCR H;  1VQM I;  3BTI A;  1OCT C;  4GCV A;  3IKT A;  1POG A;  2CQK A;  4XLE A;  3VFZ A;  4XN0 A;  4QTR A;  4CCO A;  4XRS G;  1N25 A;  5ICE A;  1O3Q A;  2AQF A;  3VOE A;  3H9Q A;  2HOE A;  3LQQ A;  2BV6 A;  2Y9Z A;  2O7O A;  2VB6 A;  2FBH A;  3FMR A;  4P55 A;  2VJJ A;  2WWY A;  1W5T A;  3OR1 C;  2BY2 A;  5GAH J;  3IC7 A;  2H1K A;  4OIO F;  3KYD B;  3RJP A;  1HA8 A;  3VWB A;  4ABZ A;  1ERD A;  2K4B A;  2KL4 A;  2QSG X;  4PJM A;  5K1Y A;  2HKO A;  5FFZ A;  1G3W A;  1HLV A;  3ZQG A;  3CUO A;  5IYD J;  2M8G X;  1A31 A;  3U1D A;  1JKR C;  5A2Q Z;  1JTX A;  1OCO H;  2R7R A;  3KZZ A;  2KLO A;  3LSI A;  1FBU A;  3WOD F;  3GEZ A;  2COB A;  1QHH D;  1APL C;  4D7M A;  2BBY A;  3W6J B;  1E0E A;  5EF6 A;  4KT6 A;  3TO9 A;  1IN8 A;  2IA2 A;  3BR5 A;  2M5W A;  3WTS C;  2UZK A;  3OV8 A;  1TC3 C;  1W36 C;  1ZYR F;  3ZPL A;  3AG4 H;  4L9N A;  2XRO A;  3REO A;  1I6X A;  1QBJ A;  4NQW B;  4ESF A;  1HKT A;  1QA6 A;  4HAM A;  4HSR A;  1I6H J;  2KRF A;  2Y30 A;  3W2V A;  4NC6 A;  3RKY A;  3SFZ A;  2NNY A;  1B72 B;  4LLG F;  3W2W A;  2CYY A;  1G2H A;  2K9Q A;  4P1W A;  3ML6 A;  3WG9 A;  4PDK A;  4LLL A;  1JJ8 C;  2IS6 A;  3N4M A;  3IV5 A;  3QYF A;  1Q1V A;  1ZAO A;  2A6T A;  3CUQ A;  4II3 A;  4FQG A;  4MHG A;  3H35 A;  2OD5 A;  2NNN A;  3IH4 A;  3SZP A;  1BI0 A;  3S3N A;  5KCM A;  3G71 I;  4L9V A;  3HTU A;  1ZG3 A;  3ZP5 A;  1WSU A;  2IAI A;  1S7A A;  3E5Q A;  1EH8 A;  2M0C A;  2Z33 A;  1PP8 F;  1ULY A;  1HDD C;  1DDN A;  2HQN A;  2X51 A;  4EV0 A;  4ZH4 F;  1U2W A;  3GLX A;  1YX5 A;  3V7R A;  2ADU A;  4B8X A;  1Z6R A;  2Y31 A;  3MZH A;  1H9T A;  4YIR X;  2D2W A;  1AWC A;  3K2A A;  4HNT A;  4PJJ A;  4BH9 A;  2JPB A;  1REP C;  1GVD A;  2R7D A;  3W3C A;  2YX7 A;  3R60 A;  3J81 Z;  3OIO A;  4BKX A;  3MKZ A;  1J9I A;  2E5N A;  2FBI A;  2BZT A;  2K85 A;  3A2K A;  1XN7 A;  3IWZ A;  1VQN I;  2QSF X;  3I59 B;  1IN5 A;  1OLT A;  4V2G A;  3KP6 A;  4Y15 A;  2K3P A;  3BJO A;  1Z6T A;  4IPA A;  1FOX A;  2L02 A;  2IEK A;  5FGM A;  1Z3X A;  2E1O A;  3F8N A;  2XRL A;  4F93 B;  4HV6 A;  4WCG A;  1VQ5 I;  5B1A H;  2DMQ A;  4MEX F;  2A3S A;  4B48 A;  3CD6 I;  2VBY A;  5F0H A;  4AC0 A;  3K2Z A;  4B44 A;  1TQP A;  1JKP C;  3DTI A;  4AIK A;  4RDU A;  3DTE A;  5F6F A;  3CF5 F;  5CLS A;  3KFW X;  1DU0 A;  2CJJ A;  2LFB A;  2HPI A;  2X4H A;  1Y39 A;  1XPX A;  2FOW A;  5JLW A;  2XPV A;  3KPH A;  3SHF A;  4S0H B;  3S1R J;  3DBH B;  4HPQ A;  2MD5 A;  2JN6 A;  3O3K A;  3UR3 C;  3K4N A;  3A4C A;  1SVL A;  3S14 J;  2BOL A;  3LSH A;  4G6D A;  2VC1 A;  3BQY A;  2LY2 A;  1B9N A;  1U3E M;  4EJW A;  1KQ8 A;  1FP2 A;  2WAQ A;  5ERI A;  3F21 A;  4UVC A;  2R7S A;  1B9M A;  4XM3 A;  3HRS A;  3CO7 C;  3O8G A;  4HX7 A;  2RNJ A;  1X58 A;  3LA7 A;  3WGI A;  4IQ4 A;  2XF6 A;  4XLF A;  2XKO A;  4AID A;  4I6Z A;  1W1W E;  4ZZL A;  4LGW A;  3C7J A;  5M3M J;  1HCR A;  3QU6 A;  2V9V A;  4QPO A;  2EZH A;  4S05 A;  1Y1W J;  1PVE A;  3VPR A;  2E7W A;  1E3O C;  4RA2 A;  1K78 A;  2PLY A;  3LNQ A;  4V19 K;  5CQE A;  4EVI A;  1PP7 U;  5EG0 A;  4CIC A;  4BHC A;  1QHG A;  2EK5 A;  3AL0 C;  4ESB A;  1UG0 A;  5D4R A;  2ZFW A;  3RPQ A;  2DJN A;  3G1O A;  4A3J J;  4K2E A;  2LSO A;  1ENH A;  3QPS A;  3S93 A;  2ZFU A;  3BTC A;  2W00 A;  3U1K A;  5FJ8 J;  2F4O B;  2NYX A;  1VQ7 I;  2MYS A;  3QP6 A;  4JX6 A;  4MFD A;  3DPT A;  4O5V A;  4XKB A;  4IO9 F;  4CXF A;  3E5U A;  2VPR A;  5F08 A;  2R0Q C;  1MMA A;  2DBB A;  1V55 H;  5ILS A;  4C3I J;  4HNV A;  4RAG A;  2BVM A;  4A12 A;  3ZQL A;  1OMI A;  4BQA A;  1ETO A;  3ZQ7 A;  3BRO A;  2ECB A;  1D0Y A;  3KP5 A;  4AD9 A;  2A07 F;  3K0L A;  3TO6 A;  4M9Z A;  1E2X A;  1IN7 A;  2OJE D;  3L00 A;  2JTV A;  3LAJ A;  4IQJ A;  1S6L A;  1IV8 A;  1YQA A;  2GAU A;  2EZK A;  3RQI A;  3E1S A;  3ZGK A;  2MD0 A;  2YU9 J;  1T0F A;  4XON A;  3ZQF A;  4UUS A;  3L2R A;  1X1B A;  3CMA I;  5JVG F;  4G6T B;  1T95 A;  1HOM A;  3VYR B;  1I50 J;  2FJ1 A;  3RKW A;  5IYB J;  2HQ5 A;  5LRS A;  2BHY A;  4ZYA A;  3K6G A;  3ZQC A;  4Z6Y A;  1FOK A;  3GTL J;  5IP6 A;  4U88 A;  1B8I B;  2WB1 A;  4L5J A;  3JTG A;  3K69 A;  4YII A;  1NH3 A;  3QU3 A;  4KIF A;  1O3S A;  5HDN A;  1QZY A;  3ZQI A;  4QIW N;  5HLH A;  4A3C J;  2W48 A;  2ZCW A;  4MTE A;  5DM7 F;  4RGU A;  3HPH A;  4BU2 A;  1VTN C;  4MGR A;  1MDM B;  1ZRC A;  1TP4 A;  1R49 A;  4OAZ A;  3CLQ A;  3QOP A;  4DW6 A;  3FXU A;  1JUM A;  1SMT A;  5EGO B;  3EET A;  3LSR A;  2JRT A;  3JRG A;  3JR9 A;  2WAD A;  2DA5 A;  5ED4 A;  1ZQ3 P;  2FRH A;  4DJA A;  2HQR A;  3FK6 A;  1TT0 A;  3LFU A;  3NAU A;  2HGC A;  4QLC U;  3CQZ J;  5IT9 Z;  5F1J A;  2Z16 A;  3C1D A;  2LDU A;  5D5W B;  2R7F A;  2DT7 B;  1JGS A;  1G6N A;  3OIQ A;  3DPL C;  5D4S A;  2JT1 A;  1FT9 A;  3C2G A;  1RR8 C;  2OA4 A;  2MA3 A;  1HF0 A;  4Z2Y A;  4KFC A;  3CES A;  3M8F A;  5DV5 A;  3F0C A;  4D7N A;  3IHU A;  4X1E A;  2IW5 A;  1ONV A;  1IDZ A;  1H88 C;  4W1U A;  1KON A;  2CFX A;  3BDD A;  4IX7 A;  2PQ8 A;  3FWE A;  5J6X A;  1PUF A;  4HA8 A;  4KDP A;  2DT6 A;  3D5S C;  2X6O A;  3T8T A;  1KZH A;  2NAZ A;  1JJ6 C;  2IXS A;  4RGR A;  1MKM A;  1AA7 A;  3ABL H;  5CVR A;  4CCL A;  5FKL A;  4ZJZ A;  4L0Y B;  1GHC A;  1YW7 A;  1U5T B;  3PO3 J;  2FD5 A;  4YEL A;  1WI9 A;  1S72 I;  3BQZ A;  1R5I D;  3FKI J;  2G7U A;  3H3Z A;  4OIQ F;  2HVQ A;  3LAP A;  4I98 B;  2DQR A;  2W82 A;  4N4O B;  2STW A;  2DFF A;  1IRG A;  3HYI A;  4ZYG A;  1OIS A;  4RM2 A;  1DUX C;  2O03 A;  2VQH A;  2GOM A;  4B4C A;  3T5X A;  4F7Z A;  3BC8 A;  3PUF A;  4HDU A;  1GV5 A;  2DOA A;  2WTE A;  2R7W A;  2XPU A;  3RDI A;  3MN2 A;  5F1R A;  3L1P A;  2DPU A;  2BXY A;  3EYY A;  4AU7 A;  1SFK A;  3MWM A;  2L4A A;  3LMM A;  1W5C C;  2JJ7 A;  2Y0S A;  4A0Y A;  5TRD A;  4UUV A;  3OWT A;  4QSH A;  1FLI A;  2VBW A;  2FML A;  4XID A;  3OOU A;  5HNF A;  4BEH B;  1LFU P;  4ASN A;  2M7A A;  3ABT A;  4JQF A;  3CCL I;  2RN7 A;  4RAF A;  2DW4 A;  3HPG A;  3HEF A;  3TKY A;  1I5Z A;  2GA1 A;  3OYJ A;  1D0X A;  5GPA A;  4JK1 X;  1BW6 A;  4PFO A;  2E36 A;  4BAY A;  1ZRE A;  2KIS A;  2ISY A;  4M3E A;  4BBR J;  1YIT I;  3O2P E;  3CP8 A;  1ZK8 A;  3KP4 A;  4BJ5 C;  1CGP A;  1UMQ A;  2HQA A;  2JK3 A;  3BY6 A;  3DU5 A;  4YG2 F;  2RQQ A;  4ENM A;  1OYI A;  5TJJ A;  3CC4 I;  1U78 A;  5FKK A;  2OZU A;  4BBS J;  4RB2 C;  2HS5 A;  5HLG A;  4FTH A;  1MJ9 A;  2IRF G;  3SDG A;  4HQE A;  1T33 A;  3G3Z A;  1XSX A;  1NHA A;  3J7A O;  4FX0 A;  2HPM A;  3WGG A;  4G7O F;  3IRR A;  3CJR B;  1TBX A;  3TBI A;  4BL0 B;  4YFN F;  3GYH X;  2K86 A;  3F3X A;  4RAZ A;  2Y48 A;  4LK0 F;  1YRN A;  4CCM A;  4YFK F;  2XIG A;  2X1E A;  3FM5 A;  5JFR A;  2LVS A;  4MO7 A;  3LSP A;  2ZJP F;  1SD4 A;  1W0T A;  3DPU A;  1MSE C;  2CQ7 A;  3GZ5 A;  2EV6 A;  4J00 A;  2F2E A;  1T0F C;  5L3D A;  3KET A;  4ESJ A;  4Q48 A;  1FOW A;  4MQ9 F;  3KYC B;  5DUI A;  4EGZ A;  1LB2 A;  3U9G A;  3H5N A;  1QZZ A;  1W5S A;  3I59 A;  5E8G A;  3ROU A;  5M3F J;  3KX2 A;  1JKQ C;  3W6K B;  4A6E A;  3CCM I;  3ABU A;  2QBY B;  1XC5 A;  4QWQ A;  2HZT A;  2OAZ A;  1Z77 A;  1XGO A;  1VQ4 I;  4E6K G;  2HYF A;  1GLN A;  3QYB A;  2FXA A;  3F22 A;  2IGK A;  2JWT A;  3M1C A;  2XAF A;  1D0Z A;  2WB1 N;  3KEQ A;  1LEA A;  2B7E A;  1IW7 F;  1MMD A;  1XD7 A;  4E7K A;  4CYD A;  1A36 A;  3CJT B;  1IO2 A;  1IXR C;  2ICW G;  1R1T A;  3MVP A;  2OUM A;  2Z2S B;  5CKT A;  2P5K A;  2A5W A;  4IHX A;  3RPU A;  2VT2 A;  1O7F A;  1R4N B;  1UB9 A;  2BE5 F;  3G1L A;  1MBG A;  1T56 A;  1VFC A;  3VYT B;  3FMQ A;  1I1S A;  2JA2 A;  3DP7 A;  2WV0 A;  2L54 A;  5ICF A;  2HOA A;  4XL9 A;  1YO5 C;  1IV6 A;  5FKM A;  3H5A A;  4JOM A;  1WRJ A;  2NRA C;  3ZR8 X;  1ETW A;  2COM A;  3S3M A;  3PFY A;  1FPQ A;  2F6C A;  3JRA A;  4Y7N J;  3GXO A;  4BNC A;  2EIN H;  4L5I A;  5HLT A;  1O3T A;  4D5F A;  3L9F A;  1OKR A;  5FRO A;  3CDL A;  3EUA A;  4A93 J;  2L0K A;  2KRH A;  3AFH A;  1BOA A;  2CV1 A;  1XCB A;  3QQA A;  1QVU A;  3DBL B;  3QP5 A;  2DPD A;  3QPT A;  1ETX A;  1RR7 A;  3BZ6 A;  3A02 A;  3C2H A;  1P2F A;  1R22 A;  5DCM A;  1MW7 A;  4P96 A;  5DYM A;  1RC9 A;  5FRM A;  2EIK H;  5B66 C;  3P9I A;  1A6I A;  4Y4R A;  2L3D A;  1R7J A;  4XLH A;  1DPR A;  2QKL B;  4LIV A;  5HS9 A;  1ZR4 A;  4GRI A;  2CG4 A;  4RMN A;  3HOX J;  1VQ6 I;  4XMY A;  1ETY A;  5FO5 A;  4AVZ A;  2W7N A;  1OYY A;  3BZK A;  2QUF A;  1NK3 P;  1GDT A;  2L7Z A;  1I39 A;  3BCB A;  2L4M A;  2XAJ A;  1X3W B;  3B73 A;  3BJ6 A;  2VT3 A;  2DOD A;  2X6W A;  3R4K A;  2ZME A;  3ZN1 A; 
#chains in the Genus database with same CATH homology
 3IWF A;  5H6Q A;  2F5D A;  3ZMU A;  2ZXJ A;  2DK5 A;  3JW4 A;  3FZV A;  5CJ9 A;  5IT3 A;  3WTW C;  1KQ9 A;  1V4R A;  1J5Y A;  1SD5 A;  2XKP A;  4KUM A;  3CJN A;  3EYI A;  2ETH A;  3SXY A;  1SD6 A;  1BM9 A;  3FM3 A;  1H0M A;  3COA C;  3I0T A;  4WXD A;  2WC2 A;  4CO8 A;  3WTV C;  1HQC A;  2UXX A;  4I2O A;  3GWZ A;  3S2W A;  1YLF A;  2QVO A;  1XSD A;  1RIO H;  1R36 A;  4L0Z B;  1MJB A;  4EJO A;  3BPX A;  4P9F A;  3Q9S A;  1J2X A;  3LA2 A;  4G7Z F;  2ZME B;  1LDD A;  3L7W A;  4DQ2 A;  3CUQ C;  3MAJ A;  2OQR A;  4TV7 A;  2VE8 A;  2EA4 A;  3V8K A;  1BIB A;  1CF7 A;  1BJA A;  4FX4 A;  3P9C A;  1QQI A;  4UVB A;  4KYW A;  1C0W A;  3I54 A;  2VOD A;  4UNO A;  4ETS A;  3R6S A;  4N9H A;  5FFX A;  1QO0 D;  1DP7 P;  5CYV A;  5LHG A;  2RV8 A;  1S3J A;  1WQ2 A;  3N97 A;  2VE9 A;  1BI3 A;  2K27 A;  2DAO A;  4ENN A;  2M30 A;  4NQW A;  4U7B A;  1ZG1 A;  3ULQ B;  3V7C A;  1RZ4 A;  4KN7 X;  1OPC A;  5FD5 A;  3H92 A;  5CVU A;  1ZRD A;  3E5X A;  3RKX A;  3RYP A;  2KJB A;  3VB2 A;  3DF8 A;  1LJ9 A;  4D0P A;  3TOB A;  4OMY A;  4CHU A;  4L9T A;  2J5O A;  3WTZ A;  1IF1 A;  3C18 A;  5BS6 A;  4AIH A;  4ENJ A;  2P8T A;  5D6F A;  4RAY A;  1ZGJ A;  2EB7 A;  2QQB A;  1G3Y A;  1SFU A;  4UHT A;  4LG0 A;  5K5R A;  4H0E A;  2TDX A;  1B6A A;  4HZF A;  5DCM B;  1KU9 A;  1B59 A;  2KIF A;  4XBF A;  2P6S A;  1U5T A;  3K1P A;  2IT0 A;  5HOO A;  3L2C A;  4WK8 F;  5HDK A;  1K79 A;  3DXJ F;  5BOX A;  3BOQ A;  1ZGA A;  1IRF A;  5AIQ A;  3I5U A;  3KCC A;  2QQA A;  2NS0 A;  1FX7 A;  3B02 A;  3T8R A;  1F9N A;  1YG2 A;  5E20 A;  4AIJ A;  2RDP A;  5LEK A;  2A68 F;  1HBX G;  2PFB A;  3SQN A;  4P9U A;  2E1N A;  3I64 A;  2JZY A;  3MCZ A;  2RQP A;  4BXU A;  1OYW A;  4EGY A;  3FXR A;  1BI1 A;  2E1C A;  5ILU A;  4KIG A;  2FQ3 A;  5DEQ A;  3KLN A;  1LNW A;  4ZYD A;  3WTU C;  4UV9 A;  4A6D A;  1TLH B;  2A61 A;  2P5V A;  3JTH A;  3BPV A;  2EJR A;  4HDV A;  1FSE A;  3I71 A;  2XVC A;  2IPQ X;  5E1W A;  1R00 A;  2D45 A;  4LD5 A;  2XAS A;  3U2R A;  1R23 A;  3WE2 A;  4MQV A;  2XGX A;  4NHJ A;  3DEU A;  3J81 K;  4S04 A;  3V8J A;  1ZLK A;  4LJZ F;  3EQL F;  1Z7U A;  2P5L C;  1ZHF A;  1BC7 C;  1FBQ A;  5D6E A;  4A0Z A;  5L3G A;  2C6Y A;  5HS7 A;  3WTX C;  1ZRF A;  1R5G A;  4UXN A;  1UHW A;  2GA2 A;  3LFK A;  2XHK A;  2EFN A;  1R58 A;  4BYY A;  4HLX A;  3T1B A;  2JPC A;  1T38 A;  4OOI A;  2M8E A;  1IZ1 A;  4L9J A;  1MGT A;  3K1N A;  2VBZ A;  3HSF A;  4G8X A;  4IRI A;  4HQM A;  3ZMD A;  4LK1 F;  1FP1 D;  3JSP A;  2KJC A;  3L09 A;  1J0R A;  3O6B B;  1J59 A;  4KIB A;  2HEO A;  3QPH A;  5CVJ A;  2FA5 A;  2DLL A;  2MC3 A;  4AVP A;  1P92 A;  3IRQ A;  1K78 B;  2CO5 A;  1CF7 B;  2QQ9 A;  5J8C A;  1H9G A;  3ELK A;  5A2Q K;  2XAG A;  4M6X A;  4Y17 A;  2KKO A;  4HF0 A;  3GFJ A;  5JR3 A;  1XGN A;  2O3F A;  1O3R A;  1W7P D;  4WF2 A;  2P6T A;  2QEN A;  1WWX A;  4G94 A;  1FY7 A;  2QM3 A;  1EV7 A;  1LDK B;  3MQ0 A;  1IAW A;  1YS7 A;  3KE2 A;  3KP2 A;  1HXD A;  3GFL A;  1XGM A;  3DQV C;  4HW0 A;  1RNL A;  4HBL A;  2PI0 A;  3DV8 A;  4HV5 A;  3RIR A;  2Z5U A;  1BC8 C;  3KP7 A;  3ZMV A;  5F64 A;  1X3U A;  3CLO A;  4LFU A;  2XAH A;  4AWX B;  4Q4Z F;  2G9W A;  3IL2 A;  2ELH A;  4GO1 A;  3BWG A;  4G6Q A;  3AAF A;  2YU3 A;  4N9I A;  4GYI A;  2RC4 A;  4B09 A;  2FE3 A;  1B1B A;  3CTA A;  4O3M A;  1MDM A;  3WU0 A;  3IKV A;  1TQI A;  2BYV E;  1JXS A;  1U6G A;  4M9X A;  2MLG A;  1JHF A;  1KU7 A;  3E6M A;  2EV0 A;  1J7K A;  2XRN A;  4ZYE A;  1Z91 A;  4IRG A;  5BMZ A;  1S8N A;  5FB2 A;  1FNN A;  2ESN A;  3Q5F A;  4JBA A;  1T39 A;  3R61 A;  3GZ6 A;  5LRR A;  5J8F A;  3TOA A;  2KIM A;  3CUQ B;  5IT9 K;  2UXN A;  2HTJ A;  1W4M A;  5KVR A;  3LA3 A;  2H6C A;  1D8K A;  2GQQ A;  2IA0 A;  3HSE A;  1YW9 A;  1EH6 A;  4R79 A;  3K1M A;  1K7A A;  2XV4 S;  5L3B A;  1FBS A;  3J80 K;  3TQN A;  4A5N A;  1P4W A;  1ZAR A;  3E3V A;  3GVA A;  3BP8 A;  4BHB A;  2YPR A;  1D5V A;  2X0L A;  1LDJ A;  5JHU A;  4L18 B;  1STZ A;  4UV8 A;  5DDG A;  1U5T C;  5ICG A;  3M7G A;  4I0B A;  2FF4 A;  2GXG A;  2Q0O A;  4KMU X;  1S29 A;  3P9K A;  5LEJ A;  3HRM A;  3F72 A;  4OIR F;  5BPD A;  3ECO A;  4RB1 A;  1P6R A;  1RUN A;  2QYO A;  2BGC A;  1JHH A;  1FSH A;  2Y75 A;  2XUB A;  1XMK A;  1HW1 A;  4PGG A;  3LWF A;  5D8L B;  2YSR A;  2F5E A;  1EH7 A;  4I0A A;  1XDS A;  1AOY A;  4EMS A;  2VON A;  1BBY A;  2PG4 A;  5E18 F;  5FLX Z;  2M45 A;  3TDZ C;  5ILV A;  4CDG A;  2LKP A;  2PN6 A;  2BEO A;  1ODD A;  2H94 A;  4MNU A;  4XRF A;  5JI6 A;  3FMS A;  3M8E A;  1XMA A;  3RYR A;  2O6G E;  3D0S A;  4EQQ A;  4ZYH A;  3ZMT A;  1B4A A;  5DD4 A;  2CGP A;  2ZKZ A;  2W84 A;  4M6Y A;  4KN4 X;  1FYK A;  4ZZD A;  2DQL A;  2EFW A;  1J75 A;  2UWM A;  3T0Y A;  2F5F A;  1ZLJ A;  2VOP A;  1FC3 A;  3ZMS A;  3P7N A;  3K9T A;  1P4X A;  2AXL A;  4HX8 A;  2ZO4 A;  1I1G A;  1UHM A;  1KU3 A;  3F8B A;  3KP3 A;  2O0Y A;  2P7V B;  3MZY A;  3HOS A;  1HKS A;  3M9A A;  2QZ8 A;  3M1E A;  1QGP A;  1SAX A;  5L3F A;  1FWZ A;  4U0W A;  4WWC A;  2ZJ2 A;  4EJU A;  1R5H A;  4WXC A;  2D1V A;  3HRU A;  1F5T A;  3EUH A;  5D5X B;  2CWE A;  1D3Y A;  3FXQ A;  1IN6 A;  1KYZ A;  5E17 F;  4Q47 A;  4WX9 A;  3ECH A;  5HS8 A;  3GO5 A;  1YS6 A;  4M74 A;  2VXZ A;  4RGX A;  2LF7 A;  1FYL A;  1SD7 A;  3PQK A;  2HKX A;  4U0V A;  1O7L A;  4OIN F;  3HUG A;  4EM0 B;  4PZJ A;  2STT A;  1Y0U A;  3V4G A;  4EJT A;  4NB5 A;  1PUE E;  4XLN F;  2B0L A;  3I4P A;  4IJA A;  2A5Y B;  1XGS A;  1T98 A;  4LG0 B;  3HTS B;  4FT8 A;  2L01 A;  1A04 A;  1P4A A;  3DKW A;  3Q9V A;  2D1H A;  1KA8 A;  2ZNY A;  4RB0 A;  2PMH A;  3RI4 A;  4KNY A;  2Z99 A;  5HDG A;  4IHS A;  1PDN C;  2HFH A;  2OBP A;  3CO6 C;  1MD0 A;  5DCF A;  3BJA A;  1XCV A;  4U0Y A;  4P5O A;  2ZBK A;  1BIA A;  3J80 Z;  3KEO A;  4XSZ F;  1FZP B;  4I09 A;  2EFP A;  1HSJ A;  2DO7 A;  2LNB A;  4IHT A;  3I58 A;  4PGH A;  1KU2 A;  3VOD A;  1LEB A;  3LST A;  3TO7 A;  2Z3Y A;  1Z1D A;  3TDU C;  2FU4 A;  4RS8 A;  1USS A;  2YR2 A;  1FYM A;  4Q5S F;  1WKM A;  2V1X A;  5E1X A;  1ON2 A;  1YFH A;  5JVT A;  5FLX K;  5KK1 A;  5D5U B;  3GF2 A;  2W85 A;  3V7S A;  4ENK A;  2DU9 A;  1O57 A;  3ZN0 A;  3E6B A;  2V6C A;  5HVQ C;  1HKQ A;  5BPI A;  1T6S A;  2R3S A;  1YYV A;  2YX4 A;  3QRF F;  2QWW A;  2FSW A;  1W7P B;  2IVM A;  4O6J A;  1MJA A;  1QNT A;  2PJP A;  5DD8 A;  3C3W A;  1L3L A;  4EJV A;  2J5P A;  1I27 A;  1KYW A;  2IP2 A;  3G73 A;  3MFK A;  3HRT A;  5DUK A;  2P7C B;  3NEU A;  3GFI A;  5L3C A;  2DFI A;  2VC0 A;  2ZNZ A;  5HLI A;  2PBI A;  1F1Z A;  4R8H A;  3V8L A;  1G3S A;  4R1H A;  5H20 A;  2EWN A;  4M73 A;  4Y13 A;  1D8J A;  3JAM K;  3WGH A;  4KT5 C;  3QAH A;  5L3E A;  2W57 A;  4RGS A;  4IXA A;  5LHH A;  1YW8 A;  1RI7 A;  1TNT A;  3F8M A;  2MH2 A;  3F8C A;  4RB3 C;  4IRH A;  1Q1H A;  3E97 A;  2K4J A;  2LF8 A;  1IXC A;  1GXQ A;  2H27 A;  3NQO A;  3PQJ A;  4N0B A;  4FHT A;  3HHG A;  1U8R A;  4OMZ A;  4A0X A;  2EFQ A;  2DT5 A;  3F6V A;  2EV5 A;  4CZZ A;  4LB6 B;  2V1U A;  4G9Y A;  3H3U A;  1IUY A;  2MLK A;  3VEP A;  3ZMZ A;  1XDU A;  2Q2E A;  3R0A A;  1HW2 A;  1YIO A;  1HW5 A;  4CGZ A;  2V1D A;  2E7X A;  1S7O A;  5LHI A;  4I01 A;  2ISZ A;  5K5Q A;  2AS5 F;  1TW2 A;  2DK8 A;  2HDC A;  3TGN A;  2OZ6 A;  3DFG A;  5EEH A;  2OQG A;  1TNS A;  2RVC A;  1TQM A;  3CDH A;  1ZN2 A;  1JE8 A;  4U7D A;  5FD6 A;  3D5L A;  4LMY A;  1BI2 A;  1UST A;  2HYG D;  4WXH A;  2PEX A;  4M72 A;  2OU2 A;  3MEX A;  1XB4 A;  2HR3 A;  3LQR A;  2M1B A;  4XSX F;  5LLQ A;  5CVI A;  3I53 A;  2A6E F;  2Y0M A;  1IXS B;  5H6R A;  4G7H F;  3RTR A;  4M71 A;  3PFI A;  4MEY F;  3F6O A;  5ICC A;  1YTY A;  1Z05 A;  2M87 A;  1LVA A;  4OU0 A;  3F23 A;  2Z9O A;  1LQ1 A;  2MBF A;  4I02 A;  5E1Z B;  2CSO A;  2CW0 F;  2FNA A;  5EEG A;  3ERE D;  4HX4 A;  2JSC A;  2W24 A;  1UFM A;  3HIF A;  2MH9 A;  2HWV A;  2O61 A;  4KA4 A;  3R0J A;  4I7H A;  2GXB A;  5BQT A;  1ON1 A;  4GGG A;  4BHP A;  1K6O A;  5AON A;  1SFE A;  4HYE A;  5LGN A;  1TW3 A;  2HTS A;  4GXO A;  4LB5 A;  4UVA A;  2DTR A;  1UCR A;  3FHZ A;  5AIP A;  2ESH A;  2GIV A;  2K02 A;  2FEZ A;  2FNP A;  2GWR A;  1F4K A;  4EM2 A;  1G4D A;  3WTT C;  4HOB A;  2DI3 A;  3SZT A;  2VOO A;  3FX3 A;  1SFX A;  4M9S A;  2A6H F;  5D5V B;  2P4W A;  1BN5 A;  1XSV A;  4XLP F;  4KMF A;  3HHH A;  4LLN A;  1ZH5 A;  5LGT A;  1L0O C;  2A69 F;  4E70 A;  2GZW A;  4OIP F;  2RKH A;  3GX4 X;  3ISP A;  2K7L A;  1V3F A;  2ACJ A;  5E8I A;  1G3T A;  4HF1 A;  1TTY A;  3WTY C;  3HOT A;  4YIF A;  2VN2 A;  3JAM Z;  2FOK A;  3E6D A;  4EM1 A;  3OOP A;  1IN4 A;  3GW2 A;  3EDP A;  5K5O A;  2RGV A;  2FBK A;  2F5C A;  4YFX F;  1RUO A;  4GYG A;  4A5M A;  2PMU A;  1Z9C A;  1OR7 A;  3JSO A;  4HLY A;  1KGS A;  1GVJ A;  2VBX A;  3KZY A;  2QBY A;  1ZG5 A;  3GUD A;  4IF4 A;  3GFM A;  2XAQ A;  5D8K B;  4HF2 A;  4PCQ A;  1R1V A;  2KIU A;  1GXP A;  2V79 A;  2W25 A;  4MTD A;  2FMY A;  6PAX A;  2H6B A;  2EFO A;  2QLZ A;  1HST A;  1MZB A;  3FF5 A;  3NRV A;  2IJL A;  4A2U A;  1T2K A;  4ON0 A;  3HSR A;  1SMY F;  1E17 A;  2IA1 A;  5LGU A;  2EA2 A;  1W7P A;  2O8X A;  3WE3 A;  2G7H A;  2Q8K A;  2H09 A;  1QPM A;  5CVV A;  3WU1 B;  4DNC A;  5LBQ A;  1DPU A;  3KLO A;  4IVN A;  4KIC A;  3F8F A;  1KQ0 A;  3E6C C;  1R1U A;  4GCV A;  3IKT A;  2CQK A;  3VFZ A;  5ICE A;  1O3Q A;  3VOE A;  2HOE A;  3LQQ A;  2BV6 A;  2FBH A;  3FMR A;  4P55 A;  2WWY A;  1W5T A;  3IC7 A;  4OIO F;  3RJP A;  2K4B A;  5K1Y A;  2HKO A;  5FFZ A;  1G3W A;  3CUO A;  3U1D A;  5A2Q Z;  3KZZ A;  1FBU A;  3WOD F;  3GEZ A;  2BBY A;  3W6J B;  3TO9 A;  1IN8 A;  2IA2 A;  2M5W A;  3WTS C;  2UZK A;  3OV8 A;  1ZYR F;  3ZPL A;  4L9N A;  2XRO A;  3REO A;  1I6X A;  1QBJ A;  4ESF A;  1HKT A;  4HAM A;  2KRF A;  3RKY A;  3SFZ A;  2NNY A;  4LLG F;  2CYY A;  3WG9 A;  3ML6 A;  4PDK A;  4LLL A;  3N4M A;  1ZAO A;  3CUQ A;  4MHG A;  2OD5 A;  2NNN A;  3SZP A;  1BI0 A;  4L9V A;  3HTU A;  1ZG3 A;  3ZP5 A;  1WSU A;  1S7A A;  3E5Q A;  1EH8 A;  2Z33 A;  1PP8 F;  1ULY A;  1DDN A;  2HQN A;  4EV0 A;  4ZH4 F;  1U2W A;  3GLX A;  3V7R A;  2ADU A;  4B8X A;  1Z6R A;  3MZH A;  1H9T A;  2D2W A;  1AWC A;  4BH9 A;  2JPB A;  1REP C;  2R7D A;  2YX7 A;  3R60 A;  3J81 Z;  1J9I A;  2FBI A;  1XN7 A;  3IWZ A;  3I59 B;  1IN5 A;  3KP6 A;  4Y15 A;  3BJO A;  1Z6T A;  4IPA A;  2L02 A;  5FGM A;  3F8N A;  4WCG A;  4HV6 A;  4MEX F;  2A3S A;  2VBY A;  3K2Z A;  1TQP A;  4AIK A;  5F6F A;  5CLS A;  3KFW X;  2X4H A;  3SHF A;  2MD5 A;  3O3K A;  4G6D A;  2VC1 A;  1U3E M;  1B9N A;  4EJW A;  1KQ8 A;  1FP2 A;  5ERI A;  3F21 A;  4UVC A;  3CO7 C;  1B9M A;  3HRS A;  4HX7 A;  2RNJ A;  3LA7 A;  3WGI A;  2XKO A;  4ZZL A;  4LGW A;  3C7J A;  3QU6 A;  2V9V A;  4S05 A;  2E7W A;  1K78 A;  2PLY A;  4EVI A;  1PP7 U;  4CIC A;  4BHC A;  2EK5 A;  4ESB A;  5D4R A;  2ZFW A;  3RPQ A;  4K2E A;  2LSO A;  2NYX A;  3QP6 A;  3DPT A;  4O5V A;  4CXF A;  3E5U A;  5ILS A;  2DBB A;  4A12 A;  1OMI A;  4BQA A;  3ZQ7 A;  3BRO A;  4AD9 A;  3KP5 A;  2A07 F;  3K0L A;  3TO6 A;  4M9Z A;  1E2X A;  1IN7 A;  3L00 A;  2JTV A;  3LAJ A;  1S6L A;  1YQA A;  2GAU A;  1T0F A;  3RKW A;  5LRS A;  1FOK A;  4U88 A;  4L5J A;  3JTG A;  3K69 A;  4YII A;  3QU3 A;  4KIF A;  1O3S A;  5HDN A;  1QZY A;  5HLH A;  2ZCW A;  4MTE A;  4RGU A;  1VTN C;  4MGR A;  1MDM B;  1ZRC A;  3QOP A;  3FXU A;  1SMT A;  3EET A;  2JRT A;  5ED4 A;  2FRH A;  2HQR A;  2HGC A;  4QLC U;  5IT9 Z;  3C1D A;  2LDU A;  5D5W B;  2R7F A;  1JGS A;  1G6N A;  3DPL C;  5D4S A;  2JT1 A;  1FT9 A;  2OA4 A;  2MA3 A;  4Z2Y A;  4KFC A;  3M8F A;  5DV5 A;  3IHU A;  2IW5 A;  1ONV A;  2CFX A;  3BDD A;  2PQ8 A;  3FWE A;  5J6X A;  4HA8 A;  4KDP A;  3T8T A;  2NAZ A;  4RGR A;  1MKM A;  5CVR A;  4L0Y B;  1GHC A;  1YW7 A;  1U5T B;  1WI9 A;  2G7U A;  3H3Z A;  4OIQ F;  3LAP A;  4I98 B;  2DQR A;  2STW A;  1IRG A;  3HYI A;  4ZYG A;  1DUX C;  2O03 A;  3T5X A;  4F7Z A;  4HDU A;  2WTE A;  3RDI A;  5F1R A;  2DPU A;  3EYY A;  3MWM A;  2L4A A;  4A0Y A;  5TRD A;  4UUV A;  1FLI A;  2VBW A;  2FML A;  4ASN A;  4JQF A;  3ABT A;  2RN7 A;  2DW4 A;  3TKY A;  1I5Z A;  2GA1 A;  4JK1 X;  4BAY A;  1ZRE A;  2ISY A;  3O2P E;  3KP4 A;  1CGP A;  3BY6 A;  4YG2 F;  4ENM A;  1OYI A;  5TJJ A;  1U78 A;  2OZU A;  4RB2 C;  2HS5 A;  5HLG A;  1MJ9 A;  2IRF G;  4HQE A;  3G3Z A;  1XSX A;  1NHA A;  3J7A O;  4FX0 A;  3WGG A;  4G7O F;  3IRR A;  1TBX A;  4YFN F;  3GYH X;  2K86 A;  3F3X A;  4RAZ A;  2Y48 A;  4LK0 F;  4YFK F;  2XIG A;  3FM5 A;  5JFR A;  1SD4 A;  3GZ5 A;  2EV6 A;  2F2E A;  5L3D A;  3KET A;  4ESJ A;  4Q48 A;  4MQ9 F;  5DUI A;  1LB2 A;  4EGZ A;  3U9G A;  3ROU A;  1QZZ A;  1W5S A;  3I59 A;  5E8G A;  3W6K B;  4A6E A;  3ABU A;  2QBY B;  4QWQ A;  2HZT A;  2OAZ A;  1XGO A;  2HYF A;  2FXA A;  3F22 A;  2XAF A;  3KEQ A;  1LEA A;  1IW7 F;  1XD7 A;  4CYD A;  1IXR C;  1R1T A;  2P5K A;  3RPU A;  2VT2 A;  1O7F A;  1UB9 A;  2BE5 F;  1I1S A;  3FMQ A;  2WV0 A;  3DP7 A;  2L54 A;  5ICF A;  1YO5 C;  1WRJ A;  2NRA C;  2COM A;  1FPQ A;  3GXO A;  4BNC A;  4L5I A;  1O3T A;  3L9F A;  1OKR A;  1BOA A;  1XCB A;  2DPD A;  3QP5 A;  3QPT A;  3BZ6 A;  1P2F A;  1R22 A;  5DCM A;  4P96 A;  5DYM A;  3P9I A;  2L3D A;  1R7J A;  1DPR A;  5HS9 A;  2CG4 A;  5FO5 A;  1OYY A;  2QUF A;  2L4M A;  2XAJ A;  3B73 A;  3BJ6 A;  2VT3 A;  3R4K A;  2ZME A;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...