1KUIA

Crystal structure of a taiwan habu venom metalloproteinase complexed with peqw.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
QRFPQRYIELAIVVDHGMYTKYSSNFKKIRKRVHQMVSNINEMCRPLNIAITLALLDVWSEKDFITVQADAPTTAGLFGDWRERVLLKKKNHDHAQLLTDTNFARNTIGWAYVGRMCDEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGMEHDDKDKCKCDTCIMSAVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metalloproteinase
publication title Determinants of the inhibition of a Taiwan habu venom metalloproteinase by its endogenous inhibitors revealed by X-ray crystallography and synthetic inhibitor analogues.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 74
structure length 201
sequence length 201
ec nomenclature ec 3.4.24.44: Atrolysin E.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1kuiA00
1I1IP 5D2BA 3TT4A 1WNIA 4GWMA 1SATA 1QJJA 3DWBA 3NX7A 1AKLA 3EDIA 2W13A 3HDBA 2OI0A 3KHIA 3KEJA 5CZMA 3LMCA 4ILWD 2W0DA 2OXWA 1CIZA 2DDYA 1MMBA 4GUYA 5I4OA 1SLNA 1BKCE 4FXYP 1UEAA 4DV8A 2OXZA 1S4BP 4HX3A 2OW1A 4EFSA 1BSWA 2YB9A 3L0TA 4GR0A 4I03A 4XM8A 3UVCA 5CXAA 4PKTA 1CK7A 1RM8A 5LABA 1C7KA 2E2DA 2W15A 1GE6A 2AIGP 2J83A 1G12A 2D1OA 2AYKA 2HU6A 1KUKA 3TVCA 2V4BA 1HOVA 2DW2A 2OVZA 3AYKA 1MMPA 4I35A 3ZVSA 1BUDA 2JNPA 3LUNA 1HY7A 1JIWP 4L19A 4PKWA 830CA 1PWWA 1XUCA 3HY9A 1ZVXA 2O36A 1HTDA 2OW0A 5L79A 2RJQA 1OS9A 1UMTA 3HY7A 3LKAA 1IACA 3KMEA 1H71P 1XFZA 1XUDA 3KECA 4H3XA 4WKIA 4PKRA 1HFSA 1ASTA 3EWJA 4HMAA 5D1SA 3WV3A 1JKYA 1JAQA 1ZTQA 2MZEA 4IN9A 2A8HA 3EDGA 1USNA 1IAGA 3DNGA 4AIGA 4ON1A 1CQRA 4ZR5A 3B2ZA 456CA 3LJGA 5BPAA 1UMSA 3G42A 1G4KA 1KUHA 3F17A 3V96B 1PWVA 3AIGA 3L0VA 4H30A 1BKCI 1A86A 1QIBA 2DW0A 1K7GA 1B3DA 1XURA 1CAQA 3LJTA 5I2ZA 5CUHA 4H84A 1KUGA 3LK8A 3F1AA 1PWPA 4A7BA 2I47A 2XS3A 2WO8A 2X3CA 1IAEA 1JAPA 5B5OA 2Y6CA 1YOUA 2JT6A 1XFYA 3TSKA 1FLSA 2N8RA 3LJZA 1G05A 4G9LA 1J7NA 1A85A 4XM6A 5D7WA 4FXQA 4IUWA 1IADA 2CLTA 1D8FA 1OS2A 4Q1LA 3F16A 1CXVA 1OM8A 4DF9A 3HYGA 1ZXCA 4WZVA 2SRTA 3DPEA 1JANA 1ND1A 4GR8A 3F18A 1G49A 1XFUA 1OM7A 4PKVA 2OZRA 1KUFA 5D1UA 1R1JA 4FVLA 3E8RA 4JPAA 3AYUA 2XS4A 3F19A 2TCLA 2MLRA 2W12A 3DL1A 1JK3A 4WK7A 2X3AA 1D7XA 1C8TA 4J4MA 2K9CA 1QUAA 3LILA 3K7NA 1ZS0A 2Y6DA 4R3VA 3VI1A 1ZXVA 4AYKA 4JP4A 1JH1A 3EHYA 1DMTA 3RTTA 5I12A 1AF0A 3P24A 2W14A 1BZSA 3SHIA 1SMPA 1KUIA 4PKUA 4QKZA 1I73A 1GO8P 1MMQA 3N2UA 1GO7P 3HBVP 3OHOA 3LEAA 3LQ0A 1RMZA 1MNCA 1QJIA 4A3WA 5BOYA 1BKCA 2MZIA 4GR3A 5L7FA 2ERQA 3ZXHA 2YIGA 1R54A 3HDAP 2OW2A 1CGFA 4H49A 2Z2DA 1D8MA 3KMCA 1BUVM 4H1QA 1SU3A 3KEKA 3I7IA 2EROA 1ATLA 1AYKA 1QICA 1UTTA 3DSLA 3B92A 1OM6A 3MA2A 1I76A 1ROSA 1PWUA 2POJA 4AUOA 3O2XA 4H82A 4WKEA 1FM1A 4WF6A 3KRYA 1B8YA 1QIAA 1CGEA 3VTGA 1JJ9A 5I43A 1MMRA 2PJTA 3HB2P 3LE9A 1EAKA 1Z3JA 1C3IA 5D1TA 1R1IA 2O3EA 1SRPA 3P1VA 4H76A 4CTHA 1KBCA 1OMJA 3EDHA 4IJOA 1JIZA 1R1HA 1Y0VA 2CKIA 2MZHA 3ZUKA 1GXDA 1BQQM 3CKIA 2OW9A 4DD8A 3I7GA 3N2VA 1IAAA 3G5CA 2X7MA 1IABA 2JSDA 2L0RA 1YQYA 1FBLA 4JQGA 3EHXA 3TS4A 3LUMA 2RJPA 3LIKA 2WOAA 2OVXA 3LIRA 1SLMA 4PKSA 2D1NA 3ELMA 2FV5A 4XCTA 2USNA 4DPEA 4GF1A 3K7LA 3U1RA 2KRJA 4L63A 2OXUA 2J0TA 1YP1A 3OHLA 1JAOA 1PWQA 4PKQA 1EB6A 1R55A 4GQLA 2WO9A 3HBUP 1HV5A 1O0TA 1CGLA 1GKDA 5B5PA 3O64A 1DTHA 2E3XA 4XM7A 1D5JA 2DW1A 2ERPA 4FU4A 1L6JA 1XFVA 3EDZA 3LQBA 1BM6A 2K2GA 1ZP5A 4JIJA 1G9KA 5I0LA 1YCMA 3USNA 3KWVC 2JIHA 4G0DA 5I3MA 1O0QA 2OY2A 2FV9A 3LGPA 1GE5A 2DDFA 3Q2GA 1GKCA 5BOTA 1XFXA 5D3CA 966CA 4H2EA 4GWNA 3GBOA 1K7IA 3DPFA 1BIWA 2OY4A 1KAPP 1BQOA 3WV1A 1OO9A 4XBHA 1Q3AA 1Y8JA 1HFCA 3B8ZA 2X3BA 5H8XA 2QPJA 3BA0A 3F15A 4L6TA 3WV2A 3Q2HA 3RTSA 2MLSA 4JA1A 1XFWA 1EUBA 1K7QA 4AXQA 5JMYA 1GE7A 1Y93A 2JT5A 1UTZA
chains in the Genus database with same CATH superfamily
1I1IP 5D2BA 3TT4A 1WNIA 4GWMA 1SATA 1QJJA 3DWBA 3NX7A 1AKLA 3EDIA 2W13A 3HDBA 1OZ9A 2OI0A 3KHIA 3KEJA 5CZMA 3LMCA 4ILWD 2W0DA 2OXWA 1CIZA 2DDYA 1MMBA 4GUYA 5I4OA 1SLNA 1BKCE 4FXYP 1UEAA 4DV8A 2OXZA 1S4BP 4HX3A 2OW1A 4EFSA 1BSWA 2YB9A 3L0TA 4GR0A 4I03A 4XM8A 3UVCA 5CXAA 4PKTA 1CK7A 1RM8A 5LABA 3DTIA 1C7KA 2E2DA 2W15A 1GE6A 2AIGP 2J83A 1G12A 2D1OA 2AYKA 2HU6A 1KUKA 3TVCA 2V4BA 1HOVA 2DW2A 2OVZA 3AYKA 1MMPA 4I35A 3ZVSA 1BUDA 2JNPA 3LUNA 1HY7A 1JIWP 4L19A 4PKWA 830CA 1PWWA 1XUCA 3HY9A 1ZVXA 2O36A 1HTDA 2OW0A 5L79A 2RJQA 1OS9A 1UMTA 3HY7A 3LKAA 1IACA 3KMEA 1H71P 1XFZA 1XUDA 3KECA 4H3XA 4WKIA 4PKRA 1HFSA 1ASTA 3EWJA 4HMAA 5D1SA 3WV3A 1JKYA 1JAQA 1ZTQA 2MZEA 4IN9A 2A8HA 3EDGA 1USNA 1IAGA 3DNGA 4AIGA 4ON1A 1CQRA 4ZR5A 3B2ZA 456CA 3LJGA 5BPAA 1UMSA 3G42A 1G4KA 1KUHA 3F17A 3V96B 1PWVA 3AIGA 3L0VA 4L7AA 4H30A 1BKCI 1A86A 1QIBA 2DW0A 1K7GA 1B3DA 1XURA 1CAQA 3LJTA 5I2ZA 5CUHA 4H84A 1KUGA 3LK8A 3F1AA 1PWPA 4A7BA 2I47A 2XS3A 2WO8A 2X3CA 1IAEA 1JAPA 5B5OA 2Y6CA 1YOUA 2JT6A 1XFYA 3TSKA 1FLSA 2N8RA 3LJZA 2YUFA 1G05A 4G9LA 1J7NA 1A85A 4XM6A 5D7WA 4FXQA 4IUWA 1IADA 2CLTA 1D8FA 1OS2A 4Q1LA 3F16A 1CXVA 1OM8A 4DF9A 3HYGA 1ZXCA 4WZVA 2SRTA 3DPEA 1JANA 1ND1A 4GR8A 3F18A 1G49A 1XFUA 1OM7A 4PKVA 2OZRA 1KUFA 5D1UA 1R1JA 4FVLA 3E8RA 4JPAA 3AYUA 2XS4A 3F19A 2TCLA 2MLRA 2W12A 3DL1A 1JK3A 4WK7A 2X3AA 1D7XA 1C8TA 4J4MA 2K9CA 1QUAA 3LILA 3K7NA 1ZS0A 2Y6DA 4R3VA 3VI1A 1ZXVA 4AYKA 4JP4A 1JH1A 3EHYA 1DMTA 3RTTA 5I12A 1AF0A 3P24A 2W14A 1BZSA 3SHIA 1SMPA 1XAXA 1KUIA 4PKUA 4QKZA 1I73A 1GO8P 1MMQA 3N2UA 1GO7P 3HBVP 3OHOA 3LEAA 3LQ0A 1RMZA 1MNCA 1QJIA 4A3WA 5BOYA 1BKCA 2MZIA 4GR3A 5L7FA 2ERQA 3ZXHA 2YIGA 1R54A 3HDAP 2OW2A 1CGFA 4H49A 2Z2DA 1D8MA 1TVIA 3KMCA 1BUVM 4H1QA 1SU3A 3KEKA 3I7IA 2EROA 1ATLA 1AYKA 1QICA 1UTTA 3DSLA 3B92A 1OM6A 3MA2A 1I76A 1ROSA 1PWUA 2POJA 4AUOA 3O2XA 4H82A 4WKEA 1FM1A 4WF6A 3KRYA 1B8YA 1QIAA 1CGEA 3VTGA 1JJ9A 5I43A 1MMRA 2PJTA 3HB2P 3LE9A 1EAKA 1Z3JA 1C3IA 5D1TA 1R1IA 2O3EA 1SRPA 3P1VA 4H76A 4CTHA 1KBCA 1OMJA 3EDHA 4IJOA 1JIZA 1R1HA 1Y0VA 2CKIA 2MZHA 3ZUKA 1GXDA 1BQQM 3CKIA 2OW9A 4DD8A 3I7GA 3N2VA 3DTKA 1IAAA 3G5CA 2X7MA 1IABA 2JSDA 2L0RA 1YQYA 1FBLA 4JQGA 3EHXA 3TS4A 3LUMA 2RJPA 3LIKA 2WOAA 2OVXA 3LIRA 1SLMA 4PKSA 2D1NA 3ELMA 2FV5A 4XCTA 2USNA 4DPEA 4GF1A 3K7LA 3U1RA 2KRJA 4L63A 2OXUA 2J0TA 1YP1A 3OHLA 1JAOA 1PWQA 4PKQA 1EB6A 1R55A 4GQLA 2WO9A 3HBUP 1HV5A 1O0TA 1CGLA 1GKDA 5B5PA 3O64A 1DTHA 2E3XA 4XM7A 1D5JA 2DW1A 2ERPA 4FU4A 1L6JA 1XFVA 3EDZA 3LQBA 1BM6A 2K2GA 1ZP5A 4JIJA 1G9KA 5I0LA 1YCMA 3USNA 3KWVC 2JIHA 4G0DA 5I3MA 1O0QA 2OY2A 2FV9A 3LGPA 1GE5A 2DDFA 3Q2GA 1GKCA 5BOTA 1XFXA 5D3CA 966CA 4H2EA 4GWNA 3GBOA 1K7IA 3DPFA 1BIWA 2OY4A 1KAPP 1BQOA 3WV1A 1OO9A 4XBHA 1XM5A 1Q3AA 3DTEA 1Y8JA 1HFCA 3B8ZA 2X3BA 5H8XA 2QPJA 3BA0A 3F15A 4L6TA 3WV2A 3Q2HA 3RTSA 2MLSA 4JA1A 1XFWA 1EUBA 1K7QA 4AXQA 5JMYA 1GE7A 1Y93A 2JT5A 1UTZA
chains in the Genus database with same CATH topology
1I1IP 5D2BA 3TT4A 1WNIA 4GWMA 1SATA 1QJJA 3DWBA 3NX7A 1AKLA 3EDIA 2W13A 3HDBA 2OI0A 3KHIA 3KEJA 5CZMA 3LMCA 4ILWD 2W0DA 2OXWA 1CIZA 2DDYA 1MMBA 4GUYA 5I4OA 1SLNA 1BKCE 4FXYP 1UEAA 4DV8A 2OXZA 1S4BP 4HX3A 2OW1A 4EFSA 1BSWA 2YB9A 3L0TA 4GR0A 4I03A 4XM8A 3UVCA 5CXAA 4PKTA 1CK7A 1RM8A 5LABA 3DTIA 1C7KA 2E2DA 2W15A 1GE6A 2AIGP 2J83A 1G12A 2D1OA 2AYKA 2HU6A 1KUKA 3TVCA 2V4BA 1HOVA 2DW2A 2OVZA 3AYKA 1MMPA 4I35A 3ZVSA 1BUDA 2JNPA 3LUNA 1HY7A 1JIWP 4L19A 4PKWA 830CA 1PWWA 1XUCA 3HY9A 1ZVXA 2O36A 1HTDA 2OW0A 5L79A 2RJQA 1OS9A 1UMTA 3HY7A 3LKAA 1IACA 3KMEA 1H71P 1XFZA 1XUDA 3KECA 4H3XA 4WKIA 4PKRA 1HFSA 1ASTA 3EWJA 4HMAA 5D1SA 3WV3A 1JKYA 1JAQA 1ZTQA 2MZEA 4IN9A 2A8HA 3EDGA 1USNA 1IAGA 3DNGA 4AIGA 4ON1A 1CQRA 4ZR5A 3B2ZA 456CA 3LJGA 5BPAA 1UMSA 3G42A 1G4KA 1KUHA 3F17A 3V96B 1PWVA 3AIGA 3L0VA 4L7AA 4H30A 1BKCI 1A86A 1QIBA 2DW0A 1K7GA 1B3DA 1XURA 1CAQA 3LJTA 5I2ZA 5CUHA 4H84A 1KUGA 3LK8A 3F1AA 1PWPA 4A7BA 2I47A 2XS3A 2WO8A 2X3CA 1IAEA 1JAPA 5B5OA 2Y6CA 1YOUA 2JT6A 1XFYA 3TSKA 1FLSA 2N8RA 3LJZA 2YUFA 1G05A 4G9LA 1J7NA 1A85A 4XM6A 5D7WA 4FXQA 4IUWA 1IADA 2CLTA 1D8FA 1OS2A 4Q1LA 3F16A 1CXVA 1OM8A 4DF9A 3HYGA 1ZXCA 4WZVA 2SRTA 3DPEA 1JANA 1ND1A 4GR8A 3F18A 1G49A 1XFUA 1OM7A 4PKVA 2OZRA 1KUFA 5D1UA 1R1JA 4FVLA 3E8RA 4JPAA 3AYUA 2XS4A 3F19A 2TCLA 2MLRA 2W12A 3DL1A 1JK3A 4WK7A 2X3AA 1D7XA 1C8TA 4J4MA 2K9CA 1QUAA 3LILA 3K7NA 1ZS0A 2Y6DA 4R3VA 3VI1A 1ZXVA 4AYKA 4JP4A 1JH1A 3EHYA 1DMTA 3RTTA 5I12A 1AF0A 3P24A 2W14A 1BZSA 3SHIA 1SMPA 1KUIA 4PKUA 4QKZA 1I73A 1GO8P 1MMQA 3N2UA 1GO7P 3HBVP 3OHOA 3LEAA 3LQ0A 1RMZA 1MNCA 1QJIA 4A3WA 5BOYA 1BKCA 2MZIA 4GR3A 5L7FA 2ERQA 3ZXHA 2YIGA 1R54A 3HDAP 2OW2A 1CGFA 4H49A 2Z2DA 1D8MA 3KMCA 1BUVM 4H1QA 1SU3A 3KEKA 3I7IA 2EROA 1ATLA 1AYKA 1QICA 1UTTA 3DSLA 3B92A 1OM6A 3MA2A 1I76A 1ROSA 1PWUA 2POJA 4AUOA 3O2XA 4H82A 4WKEA 1FM1A 4WF6A 3KRYA 1B8YA 1QIAA 1CGEA 3VTGA 1JJ9A 5I43A 1MMRA 2PJTA 3HB2P 3LE9A 1EAKA 1Z3JA 1C3IA 5D1TA 1R1IA 2O3EA 1SRPA 3P1VA 4H76A 4CTHA 1KBCA 1OMJA 3EDHA 4IJOA 1JIZA 1R1HA 1Y0VA 2CKIA 2MZHA 3ZUKA 1GXDA 1BQQM 3CKIA 2OW9A 4DD8A 3I7GA 3N2VA 3DTKA 1IAAA 3G5CA 2X7MA 1IABA 2JSDA 2L0RA 1YQYA 1FBLA 4JQGA 3EHXA 3TS4A 3LUMA 2RJPA 3LIKA 2WOAA 2OVXA 3LIRA 1SLMA 4PKSA 2D1NA 3ELMA 2FV5A 4XCTA 2USNA 4DPEA 4GF1A 3K7LA 3U1RA 2KRJA 4L63A 2OXUA 2J0TA 1YP1A 3OHLA 1JAOA 1PWQA 4PKQA 1EB6A 1R55A 4GQLA 2WO9A 3HBUP 1HV5A 1O0TA 1CGLA 1GKDA 5B5PA 3O64A 1DTHA 2E3XA 4XM7A 1D5JA 2DW1A 2ERPA 4FU4A 1L6JA 1XFVA 3EDZA 3LQBA 1BM6A 2K2GA 1ZP5A 4JIJA 1G9KA 5I0LA 1YCMA 3USNA 3KWVC 2JIHA 4G0DA 5I3MA 1O0QA 2OY2A 2FV9A 3LGPA 1GE5A 2DDFA 3Q2GA 1GKCA 5BOTA 1XFXA 5D3CA 966CA 4H2EA 4GWNA 3GBOA 1K7IA 3DPFA 1BIWA 2OY4A 1KAPP 1BQOA 3WV1A 1OO9A 4XBHA 1Q3AA 3DTEA 1Y8JA 1HFCA 3B8ZA 2X3BA 5H8XA 2QPJA 3BA0A 3F15A 4L6TA 3WV2A 3Q2HA 3RTSA 2MLSA 4JA1A 1XFWA 1EUBA 1K7QA 4AXQA 5JMYA 1GE7A 1Y93A 2JT5A 1UTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1I P;  5D2B A;  3TT4 A;  1WNI A;  4GWM A;  1SAT A;  1QJJ A;  3DWB A;  3NX7 A;  1AKL A;  3EDI A;  2W13 A;  3HDB A;  2OI0 A;  3KHI A;  3KEJ A;  5CZM A;  3LMC A;  4ILW D;  2W0D A;  2OXW A;  1CIZ A;  2DDY A;  1MMB A;  4GUY A;  5I4O A;  1SLN A;  1BKC E;  4FXY P;  1UEA A;  4DV8 A;  2OXZ A;  1S4B P;  4HX3 A;  2OW1 A;  4EFS A;  1BSW A;  2YB9 A;  3L0T A;  4GR0 A;  4I03 A;  4XM8 A;  3UVC A;  5CXA A;  4PKT A;  1CK7 A;  1RM8 A;  5LAB A;  1C7K A;  2E2D A;  2W15 A;  1GE6 A;  2AIG P;  2J83 A;  1G12 A;  2D1O A;  2AYK A;  2HU6 A;  1KUK A;  3TVC A;  2V4B A;  1HOV A;  2DW2 A;  2OVZ A;  3AYK A;  1MMP A;  4I35 A;  3ZVS A;  1BUD A;  2JNP A;  3LUN A;  1HY7 A;  1JIW P;  4L19 A;  4PKW A;  830C A;  1PWW A;  1XUC A;  3HY9 A;  1ZVX A;  2O36 A;  1HTD A;  2OW0 A;  5L79 A;  2RJQ A;  1OS9 A;  1UMT A;  3HY7 A;  3LKA A;  1IAC A;  3KME A;  1H71 P;  1XFZ A;  1XUD A;  3KEC A;  4H3X A;  4WKI A;  4PKR A;  1HFS A;  1AST A;  3EWJ A;  4HMA A;  5D1S A;  3WV3 A;  1JKY A;  1JAQ A;  1ZTQ A;  2MZE A;  4IN9 A;  2A8H A;  3EDG A;  1USN A;  1IAG A;  3DNG A;  4AIG A;  4ON1 A;  1CQR A;  4ZR5 A;  3B2Z A;  456C A;  3LJG A;  5BPA A;  1UMS A;  3G42 A;  1G4K A;  1KUH A;  3F17 A;  3V96 B;  1PWV A;  3AIG A;  3L0V A;  4H30 A;  1BKC I;  1A86 A;  1QIB A;  2DW0 A;  1K7G A;  1B3D A;  1XUR A;  1CAQ A;  3LJT A;  5I2Z A;  5CUH A;  4H84 A;  1KUG A;  3LK8 A;  3F1A A;  1PWP A;  4A7B A;  2I47 A;  2XS3 A;  2WO8 A;  2X3C A;  1IAE A;  1JAP A;  5B5O A;  2Y6C A;  1YOU A;  2JT6 A;  1XFY A;  3TSK A;  1FLS A;  2N8R A;  3LJZ A;  1G05 A;  4G9L A;  1J7N A;  1A85 A;  4XM6 A;  5D7W A;  4FXQ A;  4IUW A;  1IAD A;  2CLT A;  1D8F A;  1OS2 A;  4Q1L A;  3F16 A;  1CXV A;  1OM8 A;  4DF9 A;  3HYG A;  1ZXC A;  4WZV A;  2SRT A;  3DPE A;  1JAN A;  1ND1 A;  4GR8 A;  3F18 A;  1G49 A;  1XFU A;  1OM7 A;  4PKV A;  2OZR A;  1KUF A;  5D1U A;  1R1J A;  4FVL A;  3E8R A;  4JPA A;  3AYU A;  2XS4 A;  3F19 A;  2TCL A;  2MLR A;  2W12 A;  3DL1 A;  1JK3 A;  4WK7 A;  2X3A A;  1D7X A;  1C8T A;  4J4M A;  2K9C A;  1QUA A;  3LIL A;  3K7N A;  1ZS0 A;  2Y6D A;  4R3V A;  3VI1 A;  1ZXV A;  4AYK A;  4JP4 A;  1JH1 A;  3EHY A;  1DMT A;  3RTT A;  5I12 A;  1AF0 A;  3P24 A;  2W14 A;  1BZS A;  3SHI A;  1SMP A;  1KUI A;  4PKU A;  4QKZ A;  1I73 A;  1GO8 P;  1MMQ A;  3N2U A;  1GO7 P;  3HBV P;  3OHO A;  3LEA A;  3LQ0 A;  1RMZ A;  1MNC A;  1QJI A;  4A3W A;  5BOY A;  1BKC A;  2MZI A;  4GR3 A;  5L7F A;  2ERQ A;  3ZXH A;  2YIG A;  1R54 A;  3HDA P;  2OW2 A;  1CGF A;  4H49 A;  2Z2D A;  1D8M A;  3KMC A;  1BUV M;  4H1Q A;  1SU3 A;  3KEK A;  3I7I A;  2ERO A;  1ATL A;  1AYK A;  1QIC A;  1UTT A;  3DSL A;  3B92 A;  1OM6 A;  3MA2 A;  1I76 A;  1ROS A;  1PWU A;  2POJ A;  4AUO A;  3O2X A;  4H82 A;  4WKE A;  1FM1 A;  4WF6 A;  3KRY A;  1B8Y A;  1QIA A;  1CGE A;  3VTG A;  1JJ9 A;  5I43 A;  1MMR A;  2PJT A;  3HB2 P;  3LE9 A;  1EAK A;  1Z3J A;  1C3I A;  5D1T A;  1R1I A;  2O3E A;  1SRP A;  3P1V A;  4H76 A;  4CTH A;  1KBC A;  1OMJ A;  3EDH A;  4IJO A;  1JIZ A;  1R1H A;  1Y0V A;  2CKI A;  2MZH A;  3ZUK A;  1GXD A;  1BQQ M;  3CKI A;  2OW9 A;  4DD8 A;  3I7G A;  3N2V A;  1IAA A;  3G5C A;  2X7M A;  1IAB A;  2JSD A;  2L0R A;  1YQY A;  1FBL A;  4JQG A;  3EHX A;  3TS4 A;  3LUM A;  2RJP A;  3LIK A;  2WOA A;  2OVX A;  3LIR A;  1SLM A;  4PKS A;  2D1N A;  3ELM A;  2FV5 A;  4XCT A;  2USN A;  4DPE A;  4GF1 A;  3K7L A;  3U1R A;  2KRJ A;  4L63 A;  2OXU A;  2J0T A;  1YP1 A;  3OHL A;  1JAO A;  1PWQ A;  4PKQ A;  1EB6 A;  1R55 A;  4GQL A;  2WO9 A;  3HBU P;  1HV5 A;  1O0T A;  1CGL A;  1GKD A;  5B5P A;  3O64 A;  1DTH A;  2E3X A;  4XM7 A;  1D5J A;  2DW1 A;  2ERP A;  4FU4 A;  1L6J A;  1XFV A;  3EDZ A;  3LQB A;  1BM6 A;  2K2G A;  1ZP5 A;  4JIJ A;  1G9K A;  5I0L A;  1YCM A;  3USN A;  3KWV C;  2JIH A;  4G0D A;  5I3M A;  1O0Q A;  2OY2 A;  2FV9 A;  3LGP A;  1GE5 A;  2DDF A;  3Q2G A;  1GKC A;  5BOT A;  1XFX A;  5D3C A;  966C A;  4H2E A;  4GWN A;  3GBO A;  1K7I A;  3DPF A;  1BIW A;  2OY4 A;  1KAP P;  1BQO A;  3WV1 A;  1OO9 A;  4XBH A;  1Q3A A;  1Y8J A;  1HFC A;  3B8Z A;  2X3B A;  5H8X A;  2QPJ A;  3BA0 A;  3F15 A;  4L6T A;  3WV2 A;  3Q2H A;  3RTS A;  2MLS A;  4JA1 A;  1XFW A;  1EUB A;  1K7Q A;  4AXQ A;  5JMY A;  1GE7 A;  1Y93 A;  2JT5 A;  1UTZ A; 
#chains in the Genus database with same CATH topology
 1I1I P;  5D2B A;  3TT4 A;  1WNI A;  4GWM A;  1SAT A;  1QJJ A;  3DWB A;  3NX7 A;  1AKL A;  3EDI A;  2W13 A;  3HDB A;  1OZ9 A;  2OI0 A;  3KHI A;  3KEJ A;  5CZM A;  3LMC A;  4ILW D;  2W0D A;  2OXW A;  1CIZ A;  2DDY A;  1MMB A;  4GUY A;  5I4O A;  1SLN A;  1BKC E;  4FXY P;  1UEA A;  4DV8 A;  2OXZ A;  1S4B P;  4HX3 A;  2OW1 A;  4EFS A;  1BSW A;  2YB9 A;  3L0T A;  4GR0 A;  4I03 A;  4XM8 A;  3UVC A;  5CXA A;  4PKT A;  1CK7 A;  1RM8 A;  5LAB A;  3DTI A;  1C7K A;  2E2D A;  2W15 A;  1GE6 A;  2AIG P;  2J83 A;  1G12 A;  2D1O A;  2AYK A;  2HU6 A;  1KUK A;  3TVC A;  2V4B A;  1HOV A;  2DW2 A;  2OVZ A;  3AYK A;  1MMP A;  4I35 A;  3ZVS A;  1BUD A;  2JNP A;  3LUN A;  1HY7 A;  1JIW P;  4L19 A;  4PKW A;  830C A;  1PWW A;  1XUC A;  3HY9 A;  1ZVX A;  2O36 A;  1HTD A;  2OW0 A;  5L79 A;  2RJQ A;  1OS9 A;  1UMT A;  3HY7 A;  3LKA A;  1IAC A;  3KME A;  1H71 P;  1XFZ A;  1XUD A;  3KEC A;  4H3X A;  4WKI A;  4PKR A;  1HFS A;  1AST A;  3EWJ A;  4HMA A;  5D1S A;  3WV3 A;  1JKY A;  1JAQ A;  1ZTQ A;  2MZE A;  4IN9 A;  2A8H A;  3EDG A;  1USN A;  1IAG A;  3DNG A;  4AIG A;  4ON1 A;  1CQR A;  4ZR5 A;  3B2Z A;  456C A;  3LJG A;  5BPA A;  1UMS A;  3G42 A;  1G4K A;  1KUH A;  3F17 A;  3V96 B;  1PWV A;  3AIG A;  3L0V A;  4L7A A;  4H30 A;  1BKC I;  1A86 A;  1QIB A;  2DW0 A;  1K7G A;  1B3D A;  1XUR A;  1CAQ A;  3LJT A;  5I2Z A;  5CUH A;  4H84 A;  1KUG A;  3LK8 A;  3F1A A;  1PWP A;  4A7B A;  2I47 A;  2XS3 A;  2WO8 A;  2X3C A;  1IAE A;  1JAP A;  5B5O A;  2Y6C A;  1YOU A;  2JT6 A;  1XFY A;  3TSK A;  1FLS A;  2N8R A;  3LJZ A;  2YUF A;  1G05 A;  4G9L A;  1J7N A;  1A85 A;  4XM6 A;  5D7W A;  4FXQ A;  4IUW A;  1IAD A;  2CLT A;  1D8F A;  1OS2 A;  4Q1L A;  3F16 A;  1CXV A;  1OM8 A;  4DF9 A;  3HYG A;  1ZXC A;  4WZV A;  2SRT A;  3DPE A;  1JAN A;  1ND1 A;  4GR8 A;  3F18 A;  1G49 A;  1XFU A;  1OM7 A;  4PKV A;  2OZR A;  1KUF A;  5D1U A;  1R1J A;  4FVL A;  3E8R A;  4JPA A;  3AYU A;  2XS4 A;  3F19 A;  2TCL A;  2MLR A;  2W12 A;  3DL1 A;  1JK3 A;  4WK7 A;  2X3A A;  1D7X A;  1C8T A;  4J4M A;  2K9C A;  1QUA A;  3LIL A;  3K7N A;  1ZS0 A;  2Y6D A;  4R3V A;  3VI1 A;  1ZXV A;  4AYK A;  4JP4 A;  1JH1 A;  3EHY A;  1DMT A;  3RTT A;  5I12 A;  1AF0 A;  3P24 A;  2W14 A;  1BZS A;  3SHI A;  1SMP A;  1XAX A;  1KUI A;  4PKU A;  4QKZ A;  1I73 A;  1GO8 P;  1MMQ A;  3N2U A;  1GO7 P;  3HBV P;  3OHO A;  3LEA A;  3LQ0 A;  1RMZ A;  1MNC A;  1QJI A;  4A3W A;  5BOY A;  1BKC A;  2MZI A;  4GR3 A;  5L7F A;  2ERQ A;  3ZXH A;  2YIG A;  1R54 A;  3HDA P;  2OW2 A;  1CGF A;  4H49 A;  2Z2D A;  1D8M A;  1TVI A;  3KMC A;  1BUV M;  4H1Q A;  1SU3 A;  3KEK A;  3I7I A;  2ERO A;  1ATL A;  1AYK A;  1QIC A;  1UTT A;  3DSL A;  3B92 A;  1OM6 A;  3MA2 A;  1I76 A;  1ROS A;  1PWU A;  2POJ A;  4AUO A;  3O2X A;  4H82 A;  4WKE A;  1FM1 A;  4WF6 A;  3KRY A;  1B8Y A;  1QIA A;  1CGE A;  3VTG A;  1JJ9 A;  5I43 A;  1MMR A;  2PJT A;  3HB2 P;  3LE9 A;  1EAK A;  1Z3J A;  1C3I A;  5D1T A;  1R1I A;  2O3E A;  1SRP A;  3P1V A;  4H76 A;  4CTH A;  1KBC A;  1OMJ A;  3EDH A;  4IJO A;  1JIZ A;  1R1H A;  1Y0V A;  2CKI A;  2MZH A;  3ZUK A;  1GXD A;  1BQQ M;  3CKI A;  2OW9 A;  4DD8 A;  3I7G A;  3N2V A;  3DTK A;  1IAA A;  3G5C A;  2X7M A;  1IAB A;  2JSD A;  2L0R A;  1YQY A;  1FBL A;  4JQG A;  3EHX A;  3TS4 A;  3LUM A;  2RJP A;  3LIK A;  2WOA A;  2OVX A;  3LIR A;  1SLM A;  4PKS A;  2D1N A;  3ELM A;  2FV5 A;  4XCT A;  2USN A;  4DPE A;  4GF1 A;  3K7L A;  3U1R A;  2KRJ A;  4L63 A;  2OXU A;  2J0T A;  1YP1 A;  3OHL A;  1JAO A;  1PWQ A;  4PKQ A;  1EB6 A;  1R55 A;  4GQL A;  2WO9 A;  3HBU P;  1HV5 A;  1O0T A;  1CGL A;  1GKD A;  5B5P A;  3O64 A;  1DTH A;  2E3X A;  4XM7 A;  1D5J A;  2DW1 A;  2ERP A;  4FU4 A;  1L6J A;  1XFV A;  3EDZ A;  3LQB A;  1BM6 A;  2K2G A;  1ZP5 A;  4JIJ A;  1G9K A;  5I0L A;  1YCM A;  3USN A;  3KWV C;  2JIH A;  4G0D A;  5I3M A;  1O0Q A;  2OY2 A;  2FV9 A;  3LGP A;  1GE5 A;  2DDF A;  3Q2G A;  1GKC A;  5BOT A;  1XFX A;  5D3C A;  966C A;  4H2E A;  4GWN A;  3GBO A;  1K7I A;  3DPF A;  1BIW A;  2OY4 A;  1KAP P;  1BQO A;  3WV1 A;  1OO9 A;  4XBH A;  1XM5 A;  1Q3A A;  3DTE A;  1Y8J A;  1HFC A;  3B8Z A;  2X3B A;  5H8X A;  2QPJ A;  3BA0 A;  3F15 A;  4L6T A;  3WV2 A;  3Q2H A;  3RTS A;  2MLS A;  4JA1 A;  1XFW A;  1EUB A;  1K7Q A;  4AXQ A;  5JMY A;  1GE7 A;  1Y93 A;  2JT5 A;  1UTZ A; 
#chains in the Genus database with same CATH homology
 1I1I P;  5D2B A;  3TT4 A;  1WNI A;  4GWM A;  1SAT A;  1QJJ A;  3DWB A;  3NX7 A;  1AKL A;  3EDI A;  2W13 A;  3HDB A;  2OI0 A;  3KHI A;  3KEJ A;  5CZM A;  3LMC A;  4ILW D;  2W0D A;  2OXW A;  1CIZ A;  2DDY A;  1MMB A;  4GUY A;  5I4O A;  1SLN A;  1BKC E;  4FXY P;  1UEA A;  4DV8 A;  2OXZ A;  1S4B P;  4HX3 A;  2OW1 A;  4EFS A;  1BSW A;  2YB9 A;  3L0T A;  4GR0 A;  4I03 A;  4XM8 A;  3UVC A;  5CXA A;  4PKT A;  1CK7 A;  1RM8 A;  5LAB A;  3DTI A;  1C7K A;  2E2D A;  2W15 A;  1GE6 A;  2AIG P;  2J83 A;  1G12 A;  2D1O A;  2AYK A;  2HU6 A;  1KUK A;  3TVC A;  2V4B A;  1HOV A;  2DW2 A;  2OVZ A;  3AYK A;  1MMP A;  4I35 A;  3ZVS A;  1BUD A;  2JNP A;  3LUN A;  1HY7 A;  1JIW P;  4L19 A;  4PKW A;  830C A;  1PWW A;  1XUC A;  3HY9 A;  1ZVX A;  2O36 A;  1HTD A;  2OW0 A;  5L79 A;  2RJQ A;  1OS9 A;  1UMT A;  3HY7 A;  3LKA A;  1IAC A;  3KME A;  1H71 P;  1XFZ A;  1XUD A;  3KEC A;  4H3X A;  4WKI A;  4PKR A;  1HFS A;  1AST A;  3EWJ A;  4HMA A;  5D1S A;  3WV3 A;  1JKY A;  1JAQ A;  1ZTQ A;  2MZE A;  4IN9 A;  2A8H A;  3EDG A;  1USN A;  1IAG A;  3DNG A;  4AIG A;  4ON1 A;  1CQR A;  4ZR5 A;  3B2Z A;  456C A;  3LJG A;  5BPA A;  1UMS A;  3G42 A;  1G4K A;  1KUH A;  3F17 A;  3V96 B;  1PWV A;  3AIG A;  3L0V A;  4L7A A;  4H30 A;  1BKC I;  1A86 A;  1QIB A;  2DW0 A;  1K7G A;  1B3D A;  1XUR A;  1CAQ A;  3LJT A;  5I2Z A;  5CUH A;  4H84 A;  1KUG A;  3LK8 A;  3F1A A;  1PWP A;  4A7B A;  2I47 A;  2XS3 A;  2WO8 A;  2X3C A;  1IAE A;  1JAP A;  5B5O A;  2Y6C A;  1YOU A;  2JT6 A;  1XFY A;  3TSK A;  1FLS A;  2N8R A;  3LJZ A;  2YUF A;  1G05 A;  4G9L A;  1J7N A;  1A85 A;  4XM6 A;  5D7W A;  4FXQ A;  4IUW A;  1IAD A;  2CLT A;  1D8F A;  1OS2 A;  4Q1L A;  3F16 A;  1CXV A;  1OM8 A;  4DF9 A;  3HYG A;  1ZXC A;  4WZV A;  2SRT A;  3DPE A;  1JAN A;  1ND1 A;  4GR8 A;  3F18 A;  1G49 A;  1XFU A;  1OM7 A;  4PKV A;  2OZR A;  1KUF A;  5D1U A;  1R1J A;  4FVL A;  3E8R A;  4JPA A;  3AYU A;  2XS4 A;  3F19 A;  2TCL A;  2MLR A;  2W12 A;  3DL1 A;  1JK3 A;  4WK7 A;  2X3A A;  1D7X A;  1C8T A;  4J4M A;  2K9C A;  1QUA A;  3LIL A;  3K7N A;  1ZS0 A;  2Y6D A;  4R3V A;  3VI1 A;  1ZXV A;  4AYK A;  4JP4 A;  1JH1 A;  3EHY A;  1DMT A;  3RTT A;  5I12 A;  1AF0 A;  3P24 A;  2W14 A;  1BZS A;  3SHI A;  1SMP A;  1KUI A;  4PKU A;  4QKZ A;  1I73 A;  1GO8 P;  1MMQ A;  3N2U A;  1GO7 P;  3HBV P;  3OHO A;  3LEA A;  3LQ0 A;  1RMZ A;  1MNC A;  1QJI A;  4A3W A;  5BOY A;  1BKC A;  2MZI A;  4GR3 A;  5L7F A;  2ERQ A;  3ZXH A;  2YIG A;  1R54 A;  3HDA P;  2OW2 A;  1CGF A;  4H49 A;  2Z2D A;  1D8M A;  3KMC A;  1BUV M;  4H1Q A;  1SU3 A;  3KEK A;  3I7I A;  2ERO A;  1ATL A;  1AYK A;  1QIC A;  1UTT A;  3DSL A;  3B92 A;  1OM6 A;  3MA2 A;  1I76 A;  1ROS A;  1PWU A;  2POJ A;  4AUO A;  3O2X A;  4H82 A;  4WKE A;  1FM1 A;  4WF6 A;  3KRY A;  1B8Y A;  1QIA A;  1CGE A;  3VTG A;  1JJ9 A;  5I43 A;  1MMR A;  2PJT A;  3HB2 P;  3LE9 A;  1EAK A;  1Z3J A;  1C3I A;  5D1T A;  1R1I A;  2O3E A;  1SRP A;  3P1V A;  4H76 A;  4CTH A;  1KBC A;  1OMJ A;  3EDH A;  4IJO A;  1JIZ A;  1R1H A;  1Y0V A;  2CKI A;  2MZH A;  3ZUK A;  1GXD A;  1BQQ M;  3CKI A;  2OW9 A;  4DD8 A;  3I7G A;  3N2V A;  3DTK A;  1IAA A;  3G5C A;  2X7M A;  1IAB A;  2JSD A;  2L0R A;  1YQY A;  1FBL A;  4JQG A;  3EHX A;  3TS4 A;  3LUM A;  2RJP A;  3LIK A;  2WOA A;  2OVX A;  3LIR A;  1SLM A;  4PKS A;  2D1N A;  3ELM A;  2FV5 A;  4XCT A;  2USN A;  4DPE A;  4GF1 A;  3K7L A;  3U1R A;  2KRJ A;  4L63 A;  2OXU A;  2J0T A;  1YP1 A;  3OHL A;  1JAO A;  1PWQ A;  4PKQ A;  1EB6 A;  1R55 A;  4GQL A;  2WO9 A;  3HBU P;  1HV5 A;  1O0T A;  1CGL A;  1GKD A;  5B5P A;  3O64 A;  1DTH A;  2E3X A;  4XM7 A;  1D5J A;  2DW1 A;  2ERP A;  4FU4 A;  1L6J A;  1XFV A;  3EDZ A;  3LQB A;  1BM6 A;  2K2G A;  1ZP5 A;  4JIJ A;  1G9K A;  5I0L A;  1YCM A;  3USN A;  3KWV C;  2JIH A;  4G0D A;  5I3M A;  1O0Q A;  2OY2 A;  2FV9 A;  3LGP A;  1GE5 A;  2DDF A;  3Q2G A;  1GKC A;  5BOT A;  1XFX A;  5D3C A;  966C A;  4H2E A;  4GWN A;  3GBO A;  1K7I A;  3DPF A;  1BIW A;  2OY4 A;  1KAP P;  1BQO A;  3WV1 A;  1OO9 A;  4XBH A;  1Q3A A;  3DTE A;  1Y8J A;  1HFC A;  3B8Z A;  2X3B A;  5H8X A;  2QPJ A;  3BA0 A;  3F15 A;  4L6T A;  3WV2 A;  3Q2H A;  3RTS A;  2MLS A;  4JA1 A;  1XFW A;  1EUB A;  1K7Q A;  4AXQ A;  5JMY A;  1GE7 A;  1Y93 A;  2JT5 A;  1UTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...