1KULA

Glucoamylase, granular starch-binding domain, nmr, 5 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
108
structure length
108
Chain Sequence
CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the granular starch binding domain of glucoamylase from Aspergillus niger by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords GLUCOAMYLASE
total genus 8
structure length 108
sequence length 108
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 1996-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00686 CBM_20 Starch binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kulA00
1U8PB 1JN6A 3ULVC 1NFIB 4YPGA 1QBBA 1FP5A 4Y16D 1AGBB 3L6FA 1DQDH 1EFQA 1MIEL 2C5DC 3VGHA 5HGHA 1INDL 3RPIB 3GRWL 4X9BA 4YZFE 4ZAKD 2Z93B 1EH9A 3OWEA 2DQFA 1EMTL 3NCYP 5DMKB 4GRWH 1CXEA 1T80A 2HWZL 1AR1C 4BSWB 2R0KH 2VR9A 3BKYH 3CZFA 4Y5YC 4L9LB 4LVHC 43CAA 1OSPH 4OF7A 1N64L 3DMMA 5JLZB 2FZ3A 2VISB 1INEL 2YPLB 1G6RL 3RJQB 1SJVA 3V6OE 4LSSL 3SDDA 5IV2A 3GMQA 4J23A 1S78D 1ED3A 4RQQB 1RURH 3D0LB 2AJVH 5I2IA 1OW0A 5JOPE 1AKJA 1U42A 3QQNA 4UINH 4JKKA 4MX7A 4R4ND 1TPXC 4D0BB 3NFNB 3SO3C 4ZUWB 4YX2H 4XP4H 1MHPL 2VXTL 4NKIL 1NGZB 4X8XA 5F7MC 2DL2A 3QNXB 1JHKH 4OIIL 1P2CB 2QSCH 4JPWL 5E2WL 1VGEL 2JKXA 2I9TA 1WF5A 5KSUA 5GRJL 4Y4HA 2WWMD 4TTDC 2HN7A 1TITA 2FBJH 3MRMB 5TDNB 4K7FA 2H6PA 5TQ0H 1M6OA 1OB1A 3MRFB 2H32H 4YHPB 3VRIA 4DCQB 5F93C 1MPAH 2VLJA 1FQ9C 1FNAA 4NM8L 5EIVA 4MB4A 4R8WH 3DPBA 2IPTH 2Q86A 1TJGL 2W60A 3KJ4C 3JWNC 3H0TB 4KVNL 2A6JA 1FDLH 4RX4D 2ZCHH 3FONA 4LGPB 3CDGA 9CGTA 3REVA 2JCCA 4NJ9H 4JGUA 2OCFD 4K8RC 5DMGD 4G8IB 3T0XA 4HK3N 3EYUH 3JBG7 1LE9B 2AXFA 1B6DA 1FFRA 2W9DL 4ENEC 5JW4Q 4OM0H 4PJDE 3MBED 4MXQD 4UUJA 2CPCA 1YY8A 4HZLB 1Y18B 4PJEE 4WUUE 5IW1B 2WBWB 4GXUN 3DI2B 4P2QB 4K2UL 1PG7H 2R2BB 2CIIB 5KZCD 1YMHB 1ZHLB 3IJHA 3MQIA 2EDKA 5EZLA 4ZO6A 2IQAB 5E8PB 3SDAC 1AQKL 3ULVE 4AENA 3AAZB 3U83A 1D5BA 4HS8H 4UV4L 5IBUB 2D9CA 3C09C 2E7MA 5KSAC 2VXSH 1EVTC 4BFIB 3VXTB 4CU8A 3FONB 1N4XL 2HP4A 4XWOC 1FH5L 3DIFB 4KI5F 3CU1A 3DGGB 1EFXB 2Z92B 2E9IA 2A9ML 1QFPA 3B8SA 3CX5J 3RVUD 4CDGC 1JZ6A 1X44A 1RIHL 3S36H 3W2DH 2LAGB 3JWDC 3QNZB 5D9SA 4E41D 1CDGA 2IGFL 3F7QA 1NEUA 5C2BL 1I7RA 4TSBH 1HYRC 4R7NA 1AXIB 1WIPA 4PUBH 1CICA 2BCKA 3FT3B 2FEDC 4F7MB 3FAXA 1CQKA 4YBHA 5CJOL 4PIRF 4LLWA 4J1UA 4P4KC 3MZGB 1U8IA 4D9QE 4RGNB 3U0TB 3UAJD 1T6WA 4LSQL 3BZEB 1KUMA 2ADGB 3MA7B 2AXGA 4X98A 3ARYA 3RNKB 2R2CA 5DQJB 1OAZL 3DBXB 1JRHL 2HFFB 2I07A 4PJIA 5DFVC 5C7XL 1YJDL 1Z9OA 3ZTNH 3BUYB 2R29L 3GMRB 4LLYA 2KDGA 1JHTA 4N5EC 1U58A 1IM3B 4LK4A 4XGZB 1LO3H 2V2WA 3IGAA 4XVUC 1TZGL 4N8CH 1QSVA 1CFSA 3S5LG 12E8H 2OSLB 3MO1A 3RU8L 2V5MA 3KPRB 2YD2A 3MLZH 2JJTA 5HHOB 2CSPA 1QFWI 5DRXA 1AD9B 3VGDA 2F74A 3PGCA 4X7SL 3KYOA 3TV3L 4K3GA 3LKRB 4MAYA 3VXSE 3L6FB 4ZYKA 3V0WL 4UNUA 3MFFB 4KPHH 1LEGB 4JGMA 4UB0H 4WY7H 1WBXA 4HCRL 1CF8H 2NY4D 1FSKC 3RWHA 4NT6A 3D0LA 3TEUA 2X4SB 3SE8L 4X9HA 3E0GA 3UYRH 3AMLA 1YECH 4OD3H 5GRVK 2BOBA 4OLUL 2ATKB 2MPAH 5TH2B 1QRNE 3FOMB 5IHUL 4NUGH 1PVHA 2MFNA 3UTSE 3D5OF 5E6ZA 1T0MA 1BD2B 4XH2A 2FNBA 4BFBD 5L7XL 4IS6A 1H3XA 2Z4QA 4NFCA 4QRPB 3MLUH 4WO4B 4HQQH 2A6IB 4NBXB 4NQCB 2XPGA 4OFYD 4JHAL 5ACMA 4FQXC 1BFOB 2B0SL 3PUCA 3BAEH 1Q72L 4GLRI 1VCAA 4XBPB 2MJWA 3ME0A 4FXGB 4Y19E 2LTQB 5CINL 3UJJL 3E6HA 4MZ3A 3MMEB 4LLDB 1GRWA 5KSAA 2EDHA 2EXWC 3NABH 3MGOA 1FCGA 2EYTB 4YGVA 4EVNB 1ZT4B 3FB7A 4RAVB 3NN8A 4M6OH 4EQ3A 2W0FA 3GSOB 3P9WB 4DWHA 3KDMB 5DI8B 1HYSC 1FNSH 4NZTL 4JO1H 1ZHBB 1NGXB 5BJTB 1PBYA 3Q48A 3QUYC 2NY3B 3LZFL 3ULUF 2QADB 4H5SA 4FFYL 3L3HB 2JF1A 1MNUL 1WEJH 3TO2B 4DGYH 4KQ3L 5F6IB 4RBPH 4XPTL 3ARFA 5EUKB 4HX1A 3SE3A 3B3IA 2C3VB 4H25B 2X4TB 5ITBH 4HH8A 4NQCD 4QRSA 3ZKXB 1FGNH 2JCCB 3UEZA 3SKMB 5A2FA 2IG2H 3GKWH 2L0DA 3QDMB 4EQ2A 1MIMH 1CICD 2ITDA 1U9KA 4Z78B 2EDJA 5IOPA 5JORA 4L8BA 5DD1H 5JQ6L 3JV0A 1LP9B 3HNTH 5MEQA 4OBSA 4JFHD 4DEPC 3GJFA 1UWGH 3OAUL 1ND0A 1BVZA 1VPOL 4LKCB 1HNGA 4HXBL 5ICYB 4AH2B 5DEGA 4X99B 5GSRA 2E9BA 4Y5VB 2QQLL 3BYTA 3GNMH 4HFWA 4YH6A 3U0PA 4GMSL 5I17B 4PYHA 5IB1B 1BJ1J 2Y5TA 1NFDB 5HHPA 5I15L 3IDNB 1DP0A 5D72L 4GKNB 4HC1L 4LCWD 4XC3H 4PTTA 5D7LD 2DQGL 3U9PL 4ZFOL 2D0GA 4NQSA 1IAMA 3OKEA 3CIQA 3O8XA 5I18H 3RGVB 2J4WH 3OAYH 4PJEF 5JHDA 5ITFB 3VXQA 1KIUA 2DLHA 4C56D 1DBKL 1DN0A 3IU4H 3K74B 4KKLC 1HHJA 1TIUA 4YDJB 3MGAA 4OGYL 2WZPD 5L2JB 3P0VH 4Y8DC 4UB0L 4WY7L 1D5MA 2DQJL 5FO8B 2MHAA 3V0WH 1N5YL 4PJ9B 3F7YB 4K71C 1S9XA 3SY0B 5TDOA 5AG9A 1GHFH 3GHEL 1E4XH 2X09A 1PJ9A 3L7EA 1JL8A 1I1FB 1JCKA 4XP1H 2BRRH 1U8KA 1U8HB 1W0VA 3HS0A 3RU8H 2D3VA 3UTTB 1NBYB 1AO7B 3C5ZB 5ILTH 1BF2A 3BH9A 1J8HB 2V5RA 3U36B 2WP3O 3W0WB 3DUSB 4AIOA 2R4RL 3CFJA 2NY4C 4TYUA 4X4ZA 4KI5C 2OL3H 4HKXA 4TUJA 4GG6B 2CGRL 3QI9B 1IKNC 4EZMA 3OKLB 2CIIA 4KAQH 2DQCH 5FECA 3CSBA 2B5IC 3NTCL 5LWYL 1CG9B 3GGWA 3C9NA 4YXHL 3C08H 3IDMB 2IMMA 1I7ZA 3WKNA 4OQ1A 4FFZL 1IM9B 5I66B 1AXTH 1U92A 1IC5L 5HGAA 3FCTB 1UM6H 4F7TA 4LNRB 1JGEB 4XVTL 3ULVF 1IGYA 3GRWA 4JCLA 2UZXB 5HDBE 4ODUA 3DLQR 4MXWL 1GOGA 1FO0H 2K7PA 4OGAD 1JV5A 3QXVA 5JIIA 3UPAA 3FAWA 4MA7H 1QPXA 1I8LA 3QULB 3CNKA 2OTWA 3EYOB 4MDJB 1KCUH 2HFEA 3SKJL 1DBAL 1NCCH 3QFJD 4NO0A 3CLEL 2BNQD 4WNQA 5BV7H 1NJ9B 1NPUA 5F97E 2F53B 2OJEA 3Q6FA 5GS2H 3OAZK 4NKDB 1TJHH 2XNAB 1CIUA 4JB9L 4DVBA 3RWGA 4L4VE 4LASH 4PB9L 4GSDH 3CMOL 2NW3B 5IW1A 4HKBB 4WWKD 5ID1A 1JNLL 1EXUB 3O3AB 5EC2B 4Y5YB 3T2NL 1WBXB 2XXCB 5KN5A 3QCUL 4OLWH 4HJ0C 1IJ9A 4ZYKB 5CS7A 5EU3B 4P2QD 5FYLD 3U36A 3QRGH 4LSRH 1F3RB 1HHKA 4HS6B 4RMUA 1NMBH 3HHRB 1Q94B 1CFNA 2I9LB 3DRTB 1ZT1A 5EUOE 2EYSB 2AV1B 1CFSB 5TFSL 3FO1A 4NJ9L 5FA4A 3TNMA 1EO8L 1T0MB 4EDWL 1SBBA 3CSPA 3IJSB 2NY0D 1JPFB 5EBWB 3S88H 5E0QA 2AV7A 2YXFA 3AUVA 1XF5B 3OGCB 4OCXH 1RULL 2C3GA 1DVFB 3MRPA 3HE7A 3EDEA 1DBJL 1T66C 5F1IB 1A1OA 1AQDB 4F3FB 2XWBA 3PQYD 4LBEA 4ZXBA 5DQ9B 3HC4L 1L0YA 1XGYL 4YIQA 3FQUA 2EDOA 5F3BB 2R0WH 2Y5TB 1B0RB 3GMOA 4H8WC 3SDDB 5IV2B 3U0PB 1MFNA 1TTUA 3GSRA 4LSUL 2R9HD 3ZKMD 1DQTA 2CXGA 2NLJA 5EZOH 5IF0A 4YFLF 3L3GB 4Z9KB 1JGLL 1E0OB 4BK4A 1EDQA 4L3EA 1PYWA 4HKJB 2OMNA 4DOHB 3C60C 2BNRB 4PBVC 5D1XA 3S6CA 3U46A 4R90H 4X7DC 1YEHL 4XCNA 4D8PB 1FO0A 2QBWA 1TNNA 4KI1A 1CL7I 3VFGL 1YEFH 1WFOA 3G08A 2XWJB 4JZJB 1I1AD 4YDVB 3LKPA 2VAJA 4I4WB 2LQRA 5GS0C 2FEDD 3QPXH 5D2NB 3S5LB 4JDVB 4N0YH 4YBQC 5HVHC 1QFOA 2XTJB 4WW2A 3X14B 5GS2D 2J8HA 2OL3L 2A2QT 3VA2C 5GZND 3QG7L 3GUTA 5JW5B 2FEEI 3S37X 4PV8B 3GJEA 4NGHH 1S78C 4OUUA 2Z91B 2DQTL 4TUKH 4P2QE 4KXZH 2BY3A 4XCYB 2BCKB 1JE6A 2F58L 5BS0E 5EB9A 4M5ZH 5HHQB 4NKOB 3BKMH 1FZKA 4XP1L 3UXFA 1OWWA 4P5MB 4N9GA 3ZHDA 3ALWA 4XMKL 4QRQA 3S3SA 3HMXA 1HEZA 1HSBB 3GHEH 3MJGX 2VLKB 5I1CL 1S8DA 1J8HA 2B7DT 4KUCD 1T1WB 2DQJH 1TJHL 5KJRH 1LEKA 4OGYH 2BVQA 3G08B 2VC2H 5DO2C 5CGYC 3BXNA 3IDGA 5I9QB 5JW3L 1JYWA 4ZS7L 2ZOKB 1FNGB 3CVHB 3F7YA 3QIUB 1KPUB 4MA7L 4LARL 5K9OA 2DQGH 1OPGL 5E1AB 3GSXB 3NCYS 1FO0L 3OBAA 5I15H 3RX5A 4P2OD 2YN5A 4N1EA 4XVTH 4QEGA 5JQHC 4CUCA 5ETUA 1UM6L 3L5WB 1IC5H 1WFTA 3HR5A 3R1GL 5LGHL 4OZIE 4LHUB 4ODWB 3IAGC 4IRJD 1D5XA 2VQ1B 3QIWC 1K3IA 4UTBL 4Y4HC 3BOVA 4ELKB 1LEGA 3MBEB 3HUJE 1HCVA 4KK5C 4L29A 4L5FL 3CCHB 3X17A 3OGCA 1KNOA 3FTGB 3QDJB 4MDIB 1GC1C 1RZJL 4BK5A 4HWBL 5I30H 4OSUL 3O6FA 3TO4D 1X4ZA 4I18B 3ARGA 3OB8A 1S9YB 2DM3A 1KLGB 4RMSA 2V5TA 1UCTA 5EOQH 2ZOLB 1HHIA 3CFDB 3QUMB 4L8BB 3ZDZF 1HXMA 1QFWL 1CD0A 4LQ1A 4LDLB 2Z31C 4OZHB 3B9KA 1WZKA 4F2MA 5KSUB 5IVXA 1T3FA 4TPRH 4W4OC 1ITCA 5I19H 3SDYH 1N5YH 3VWJB 3GIVB 3QO1A 4LCCB 3O6FD 5I1LA 5DEFA 1YQ2A 2ADGA 3MA7A 5FHBL 1JWSA 5IQ9B 3U0TA 2AK4A 4Z5RA 5CKAA 5F71A 1P84J 1EHNA 3BKCL 4YHKH 3LQAC 5FGSA 3Q2CA 4ZOBA 1FNEB 5IMMB 3N85H 4NNYB 1ZHBA 4GW4B 5EWIH 1QRNB 4P23A 5E1HB 1KACB 4RGND 4N90E 1ROWA 1X5IA 3V6OA 1CDYA 1V7MH 3AREB 1JPST 2H26B 5CD3B 4KTEH 1OGAE 3BXNB 2ZNWA 2B1AL 1LQSR 1S7TB 1LO0L 5CJ8A 5TPWL 3BP5B 4F8QA 4DUWA 3VXNB 2Z8RA 4X6FA 4Q58C 4KZEH 3VFWB 5I1DB 4NO3B 1U8QB 5GJTH 5FYKL 1T20A 4MZ2A 5HI5D 3TO2A 2FSEB 1BLNA 4RNRB 4S1RL 4P4RA 1J0HA 1U41A 5KANI 2VYRE 2X1PA 1MY5A 1WITA 4Q9RH 2MKWA 4LSDA 1A21A 3PP3H 4TPRL 3MX0A 5JA9A 1YUHA 1BQSA 3V4PH 1HXYA 1T04B 2Z31A 1T20B 3GSOA 1J87A 1QLFB 1YEKH 3K46A 5DQ9A 3V7AG 1BFTA 1MAMH 4UT9H 4KJYA 2O5XL 1QBMH 3SCMB 5A3IC 3A6OA 3QQ9D 1S7TA 3V5HB 3EJJX 4NRXB 1T1ZA 2KQMA 4BH8B 2D2OA 3H0TA 4PY8I 5F1NA 2P7TB 4LAQH 2YZ8A 5CEYA 2YR3A 3TPUA 2DYPB 2V7NA 1IC1A 1DQLL 5FO9A 2NZ9D 4M9PA 5H37G 3L3KB 2G5BA 2COQA 1EJOH 4P23B 2ATKA 3OXSA 2RAMA 4TRPH 4LSQH 1IGTB 4S0SD 2J5LB 5C0EB 5E7FA 4IOFD 3NIGE 3VI4E 2FRGP 5EN2A 1SJXA 3ARBD 3C8HA 5F7WC 5D1XD 5T1KB 3HZYA 3KR3H 1FNHA 1AH1A 2EDLA 1KOAA 3IETB 3FQUB 3G04B 1KBGL 4YUEH 5EG6C 2G60L 5I8OL 4FABL 3MRRA 3NCFB 4OD3L 3VXSA 4OQTA 4JANA 2KQNA 4HG4J 1JGDB 1U8JA 3GHBH 2NX5E 5DVLA 4WTZG 2IQ9H 2HJKA 4JRXE 3BP4B 1BM3L 1NCNA 1Q0YH 4JM4L 4Q6IA 4WHYH 4KHXL 2AAVA 3RVVC 3LKQB 1DDHA 1HIMH 4HIHA 1J1PL 1B0GA 3DWTA 3TCXA 2V7NB 5FO9B 2AXHA 3M07A 3HE7D 2CLZA 3QJFA 2Q8AL 2XKUA 1CGYA 5F8RC 2HH0H 1UADC 4XMKH 3DXAD 4FFWD 1CGWA 2VDOH 1FV1B 3BZ4B 3B5HA 2ARJA 4WFFE 5D2LE 2BVPB 1BJ1H 1XZ0A 2K9UA 2H45A 1L6XA 2AJZB 2RFXB 3H9ZA 4GBXD 4I2XE 1NLBH 1P4BH 1NUFA 3IXAA 1ADQL 3F5WB 3ZTJG 2FL5B 3ZTNL 4UBDC 3MRGA 4XCYA 4FNLH 2WINA 3K8LA 4JY5H 4P2QA 5DSCA 1CFBA 5IIEA 1MEXL 4IDJL 2F54D 2ZCHL 5F6HI 1EEQA 2P8PB 5CEZL 5L0QB 1NBQA 3EHBD 3CPLA 2IPTL 4N0RA 5E5UB 3NACL 5FYLL 4Z7OE 4FMFA 5E9DB 1BBJB 3BP6B 3QAZB 1SMAA 1MJ8L 2KZWA 4OB5L 4X5LA 1VFUA 2BDNL 5L2KB 2PW2A 2ICWJ 4JLRB 3ARTA 5E99L 2BY0A 2AKRB 4PY7A 4LSUH 4LVOB 5FCUH 4NWTH 2BNQA 4OF0A 1I9EA 1KT2B 1T0NB 2JIXB 1UJ3B 3UPRA 4AK1A 5SWZD 4F7TB 4FQQA 4S11A 2P24B 2RCSH 5D96B 1YEGH 4PV9B 1G7IB 2BOCA 1O7VA 5F88B 1OARL 2XTLA 1A6WH 4XVSH 3NCEB 3D69B 3KHOA 1XH3A 4XBGB 5DFTA 3ES6B 2EDWA 4FFWC 5EUOA 4Y8AA 3N9GH 2AJVL 2X70A 3VGBA 4AIZB 2DD8H 5JR1H 3O11B 2M1KA 2BFVH 2IH1A 4MMXC 2DI9A 2X4OA 1VENA 1ZA6B 1S3KL 3DETD 1XF4A 5EU5A 3MRQA 4WU7A 4JREC 1PW3A 3SDAD 3ULSB 4BM7A 2O5YH 3Q6GH 5HD8D 5JW4N 4Y7MA 3BKYL 4A2LA 4PJ7F 3WIHA 1CK0L 4BH7A 1JMZA 5CJ5A 3P9LA 1BIHA 3W9DB 4PD4K 3PV6A 4TSAL 3MROA 1IAOA 1A7PH 5T1DH 2IH3B 4P99A 4R7DA 1KN4L 1MRFL 4HJJH 4L9LA 4G43A 43CAB 1UYWL 5E00A 2V2WB 3GIZL 3FN3A 3T04D 5E5RB 4L3EB 2R39A 1CGVA 4MJ5A 3MOBL 2NXYB 2H6PB 3SE9L 4PGBB 4Z7UA 5FUZH 3PV6B 1IGMH 1IC7L 2F54A 5I75C 3U82B 5B4MC 5F8QC 4L29B 1S9WA 1WC7A 3GMOB 4J12A 1FVDB 5CBEB 5CD5D 1MJ7H 4YK4B 4KWUA 1MWAH 4ZFGH 1FYTA 4RMTA 2OZ4H 2H9GA 4LPXA 4LPYA 1I4FB 4JFDA 3QXDB 1EGJH 3P4LA 4EIZC 5HGBA 4ODWA 1EXUA 5DJ2A 4OZFG 3UYPA 2XG4A 5A16A 4QRRE 2GK2A 4LEOA 2RHEA 4NHUB 3O8XD 5DR5L 3FRPA 1R6VA 2EDFA 5EU6E 3H3PL 3C8KB 3PNWA 1KB5H 1PKOA 1M7DA 3IRZA 4PJCF 4JR9H 4MNGE 1I7UA 2W0FB 5FYJD 3DXAA 2KKQA 5DJ0A 1CTNA 3C2SA 1LE5A 4GG8B 4TSCL 3S4SB 1U3HA 1Q9KA 5IGXH 1AXTL 2VTFA 1KJMA 5FDWA 4PY7B 3ARGC 4GRWB 1KYOJ 3MACH 2B1HL 3PWJA 5DK3A 1UEMA 2WIIB 4K23L 1FG9C 5T1MB 3MLWL 3PABB 3WUWA 4HF5H 5EA0L 5LGJB 5DVOA 2IBGA 1I7TB 3V52H 5GJSH 2NXYD 2APWA 3VXSD 3H7BA 4I8DA 1RZIA 1B4JH 1CDIA 3BD4A 1CBVH 4YAQA 2ESVA 1I9IH 1T21B 3X12B 5BO1H 4EXKA 3SHSA 4I77H 1INDH 5CSGA 2R4RH 4PLJC 5GRUL 2EKJA 4NHUA 3ARBA 4Y4KA 5ILTL 5BS0A 5EPMB 4PJDF 3RWHB 2BRRL 4HFUH 2ADJA 4RMQA 2FB4H 1I8KA 1RZ7L 2EC8A 5DD3H 4WO4D 2FECL 4C56E 2LAAA 2JJTC 2F74B 4WUUA 4KRMB 5T1MA 1D6EA 32C2B 1VESA 4OLZL 4PJDB 4F7EA 1R5IB 4POUB 4YHMH 5DMYA 1T6VN 1NSNL 1X5LA 3H8NA 3MFGB 2J4WL 3JUYA 5CP7B 3NPSB 3O4OC 1ORSA 4GAJL 4JDTL 4PG2A 3PHOB 2FECI 4P3CL 3L3GA 3MRMA 1U3YA 1H8OA 4IIQA 5GRWA 3MRDB 3ZL4L 3O3EB 4LIQE 2R4SH 4Y5VC 5BRZD 5EFIA 1MCKA 3JVGA 3PDOB 4X7TB 3O9WB 1RJZB 2BSSB 3GNML 4Y5XA 3RWJB 1PQZA 4WI9A 4O2CA 5JXEC 4LQFH 1P7KB 4Q9CA 3RKPA 1IAKB 2PYEA 3KG5A 3SDDC 4GKNA 1KB5L 2HVKA 3CK0H 2VLLA 1P7QD 4NOFA 3LKRA 4MAYB 1J05B 3LKOA 1G9NC 2Z35B 3VFRB 5IB2A 4LHJB 1FYHB 4F7MA 1A7RL 1NAKL 2IFFL 4K94L 3HZMB 5FEBA 3RL2B 1KB9K 4G6JH 2NY1D 2OZ4L 5C09B 4PGDB 3PP4L 2V2XA 3T4YB 2JE8A 2GQHA 2A83B 4PB0H 4IEFB 4MWFB 3MCKA 1ZWIB 3REWA 1BP3B 5FV2A 3QEQB 1PG7X 1N59B 3UBXG 1E4JA 1S7VB 1C1EH 4XT1C 4XWOD 3P4NB 1G7HA 1P4LB 3NAAL 5ISZD 3SDXB 2ED7A 1U95B 4MCYA 1VSCA 5C0CB 1JGUL 4ZS6D 5I1HL 3WFCL 5TF0A 3TJEH 2AK4D 5IFJA 1YDPB 4OI8A 1IAKA 2PYEB 1XCTB 4KK9C 1FAIL 5C0RL 2FIKB 4JFZL 3FOLB 2HLAA 1LEIB 3VRLE 2CLRB 5DUPL 1IEBA 3VFSB 4Y2DD 4M93B 1Z0MA 4P5KB 1OF2B 1G6VK 3BAEL 3QZWB 4MSWB 4FQHA 3GM8A 1C12B 5IHZA 5IM7A 1HOCB 4HLZG 4UAOB 2BFVL 1BQHB 5TQ2H 3T0WA 3QEQD 4ALAL 3ZKSD 2BVYA 2CKNA 3ARGD 3LS5L 4M3KB 3BVNA 3VXUD 4FXGA 1E28A 2XIDA 3P9MA 1FL3B 3P30L 1F13A 2NY1B 3O4LD 4FG6C 2VDKL 3RNQB 2R69H 1R3LB 5KVFH 4OUOA 3QJFB 4IOFC 3IFNL 3VWJD 4LSVL 3A6CL 2FGWH 4DK3A 4KGJA 3T0ED 2GSIB 4CNIB 3QHZH 3X11A 5EO1B 3L3HA 1U3JA 5IUSA 4GOSA 5MP6H 1BAFH 5F72S 1LEIA 3TV3H 3NACH 5CGTA 1SYVB 1F58H 1NGZA 1CXHA 3SQBA 4AQ1B 1LGVA 4Z7WF 1QNZH 4XWGH 5I1IH 4O02H 3STLA 3IKCB 3VG0L 2H9GB 4UOW0 3T1FB 4Q0XH 2X2YA 3T08A 4DVRH 5DJXA 5I2IB 1TZHB 1YYLL 1X9QA 1LDPL 4LVNC 1JUFA 2GUOB 5CEXA 3QWRA 4FNLL 5F89B 4ZO8A 2VLRD 2F8VA 5IVNA 2DRUA 3N1MC 1D9KB 1U8HA 4HAFA 2I5YL 4IMKC 3U1SL 1NLBL 1P4BL 2IMNA 4BZ1H 1XGRA 4OF6A 2XPGB 4BQBA 4A6YL 2ZJSH 2G2RB 3U4EA 1ZWIA 1J8HD 1NAMA 2YS4A 2DJ4A 4O51A 2ORBL 3ELAT 3R0NA 1DDHB 4XGZA 3BEWB 1XGTB 5I73B 5DD6A 3TNNB 4XNUL 2ZSVB 1NDMB 3MR9B 3WKMH 2R8SH 2NLJB 3RL1A 3CUPA 5TDPB 1VKXA 4M7KH 4LLVA 4K07A 1Z2KA 5FYKD 3T77A 5IBLD 1V7NH 1OCWH 3DBXA 1ODAA 4UBDD 1JGVH 2VAAB 4L4VD 1I8MB 4S1SH 2EXWD 1BWMA 1T2QH 3QWOB 4N0CD 3QJHB 5GS0H 1X5JA 1NBVH 3UO1H 4MX7B 5C2BH 3IXTA 3ZE1E 3IDIB 1UG9A 3MFFA 5D2LA 2CJUL 4C4KT 1T04A 3MJ8B 2J88L 3HR5B 2OQJA 3QWQB 4Y4HD 4P46A 5SWSD 5BS0D 3MRBB 2DWEA 1A6UH 2YSSA 4NNXA 1CICB 1QFWM 1CT8A 2QR0B 4OCYH 1MAJA 4GKZA 1GCFA 2FSEA 4GRWE 2ESVD 4ODTH 3S35L 2YWYA 1BZ9A 2XYCA 3LN5A 5FAAA 3WMSA 4NNPL 4WDIB 4MD4B 2VKWA 4J3OC 5F6IC 5F7FA 2E7BA 3D48R 4DW2H 2ZOKA 4OZGA 4MCZA 3FQTB 3WD5H 3H7LA 3RTQB 3RNQA 15C8H 4ORGA 5A40E 2ITCA 5KAQF 4LSTH 1DQQB 2CO6B 1EBAA 4RBPK 2JJVA 3TBSB 2YPKB 4KZDL 1IGYB 2GUOA 5GZOC 3MNWB 5DD0H 2L7UA 5K9KB 3IFLH 2GJZB 1A22B 2FGZA 4OTXL 4M3JA 2YPVH 2EDYA 1M7IA 4HUWB 2DLFH 5C07A 3QUXD 4UOJA 4WEBH 3V6BR 1AO7D 3AM8C 3C5ZD 5E6YA 5MERA 1KYOK 1RZ8A 4HUMB 3QUYA 4AEIL 5JOEA 2YD5A 4YFLI 2CKBA 4PREA 1EAPA 4R7NB 4Y1AA 4Z5RB 2X4QA 4P59L 5LAXB 3FN9A 1A4KA 1RZGB 4O00A 3DVNB 4QTHA 2DICA 4ETYA 2P5WA 2IAMD 3S5LA 4YDKH 2HJFA 2I60H 2RJMA 1MPAL 3UPRB 4KH2A 1RK0B 4YXKL 4Q9RL 4JZNA 4TULH 2C26A 1OQOA 2ATPA 4CU7A 4ELMA 4LLMB 1A6PA 3WFEH 2R1YB 1X6LA 4EUPG 5ANME 3QHZL 1BF8A 5DRZA 3CFEB 4PJFE 4K94H 3UTSB 5D5MB 1SQ2N 3QZWG 1K3ZA 1FLTX 1Q9KB 2BNQE 2GHWB 1IKNA 2R56H 4IS6B 3AB0B 5BMFL 4DCQA 3SKUD 3MCG1 5KVFL 3PE9A 4EKXA 2VDKH 2YA0A 3QFJE 1ZV5A 4G6MH 4LRNL 2J8UE 1IEAB 4MAYC 1OAXH 5AZ2L 3ROOB 1QO3B 2A6KA 4NNYA 3QXWA 1YA5A 2VL4A 3FB5B 1LK2B 3P0YH 1HWHB 3DX7A 1YY8B 4FQIH 3MODH 4POYA 1G6RA 3QIWB 4PLKC 2A6DB 5JIKA 5EWIL 2ZUYA 5C0CA 1A1OB 1P9MC 4NO0D 4U1MA 3QFJA 5E8EB 3C6SB 5E8DL 4EJ1C 3JV5A 1UCBH 3CAFA 1DJSA 2H2PD 1F4XH 5FKPA 4ZO7A 4DKAA 5B8CB 1ONQB 4G3YL 5KSBA 3N06B 4OLZH 5FHBH 4JO4H 3LB6D 1Q9OB 3MRHA 4K94C 2W0PA 3IJSA 3WFCH 5AUMA 4CMHC 5I1HH 4LPTA 4OKVB 3MJ9H 4JCMA 3SDYL 1T2XA 3CH8A 1G1YA 4RISH 1BIIA 4FTVB 3KYKL 2Y4SA 1QR1A 3V9FA 1ZLWK 1NEZA 2MHAB 3AU1B 5FXCH 5SWZA 3RWFB 2EDQA 4OIBA 4K7FB 5D6CB 3U0WH 5KSBB 1QFWH 5B21A 2FX8H 4KKAD 4Z8FL 1CS6A 3AROA 3RGVA 1DN2A 2C9AA 5CZKA 5I8CB 3PP4H 4ZUWA 2X41A 1DBBH 3IDXL 4MJIA 4L4VA 4N5UA 1ITBB 3RIFK 4J1UB 4JFYB 5L9DL 3MTRA 1UACL 4JG0L 1UB5A 4Z7VA 4YC2C 4Y5VA 3W11D 3D39A 1IEAA 3OKMB 1A6VH 2CDGA 5HJ3A 4UU9A 1KTDB 5F3HA 5HHXH 1VDGA 5KG9B 4F7PB 4PLKD 3QNZA 5D9SB 3KPSB 1FVEA 3HAEA 3E1F1 4HLZH 3DYPA 3TO4C 1GOHA 1QEWB 1S7UB 1E4KA 3ARDD 3ESUF 4ZNCD 3QI9C 3OJVC 5INCA 3UTPD 5C92A 3BT2H 3VGEA 5HI4D 1JV5B 4P3CH 4LCCC 4GRMB 5AYUL 4GW5B 1LVEA 4C56A 3DX8A 3QWRD 3SKMA 4OZGB 1YJDC 1CVRA 4Q2ZA 3GI9H 4WEMB 4RWYL 4C55A 3QIUC 4R4FH 2NR6D 3I3DA 5IM7B 3UJTL 1NEZG 2R1XB 5IHZB 1T22A 3VFMA 5IMLB 4GFTB 2W0KA 2W59A 1YEDB 1G7JB 1T1YA 3AS0A 4YDLB 2Q6WA 1DTUA 4JJHA 2HKFH 3RZCC 4JHWL 3WS3B 5BJTA 2C1OB 1B9ZA 1J1OH 5LXGL 4QXGL 1A0QL 5DJ2B 2H2SD 3UZQA 2FX9L 4CU6A 4D3CH 3F5WA 3JXAA 3QEHB 5EOTB 3T0EA 1T22B 3O81A 3U0WL 5ALCH 4BJLA 4LIQH 4AG4L 3GIZH 3G6AA 2EH8H 2V17L 3MMEA 2X44D 5TE7H 1GGIL 4ODSH 4OZ4A 4NM4L 4YHLL 1MCDA 1WSST 4HBQA 1FORL 1MFDL 4W4OA 4AM0A 5E8OB 3BGMA 1WTGT 3AREA 1CK0H 4C59B 1F4HA 4FQXD 4GRLA 1FL5A 4W6XB 3EO0B 1FE8L 3OG4B 2CDEB 2ICWA 2X1XR 3C6LD 5KS9A 5HYFA 4Y2DA 4DQOH 1F3DJ 4F15B 5J6HB 4JZJC 4PD4J 4NUJB 3VXPA 5JHLL 3O3UN 4IRJC 5B38B 1OAXL 4E41B 3EYVB 4UOW1 3IDIA 5EBLA 2JTDA 4AMKL 5GSVB 4M6AA 4M1DL 2JK5A 4NQVA 1WBZA 4XNMA 4UT6L 3TJHD 3UC0H 3CC5B 4HCRA 4RIRA 1MCSA 3NIDF 3QQ9C 4LKCA 1G7LB 4I5BA 4JDZB 1HH6A 3PWLB 2VXUL 1G7IA 2BOCB 3MRKB 3O6MH 1UJ3A 4IOIB 1JK8B 2IH3A 4O2FA 5F1NB 1IGML 5CSBA 5MHSE 3DHJA 3FB8B 4K8RH 3NCMA 1YC7A 4EDWH 3CH1A 5MEPA 3LAFA 3HR6A 3AS1A 4KTYA 5TFSH 4Q9QH 5C0AD 1HEZB 1KN4H 1GC1H 3CU7A 5IWLC 4WU7B 5EU7E 4OM1H 3AAZA 5DLMH 4QO1A 1ZA6A 5LGKA 4HPOL 3NIFE 2Y07L 4M43L 4HKBA 2OL3B 4P23D 4XMPH 1NBZA 1KGCD 1MJUH 2Q3ZA 3DX9A 4PJCB 4QXTA 3W11C 2WINB 5DFWH 4UAOC 4KZDH 3DJ9A 2DTML 3UBXA 3QCUH 4O9HL 2JB6B 1A6TB 4NKDA 4OLWL 4PJHE 4PJXA 2VNCA 1G7QB 2HT3D 1XCTA 4CL7A 4Z0XA 2X4UA 1H5BB 1AXSA 3U30B 2M2DA 4QRUB 5IWLA 3QDGB 1D5IH 3NMEA 3CDYA 3ZE0E 2DD8L 5JR1L 2XKSA 1RD6A 3RWDA 1H8SA 3REVB 2EXYD 1Q0YL 4N8VA 5CIPA 5J7CC 1S7VA 1PSKH 1AGCA 2HVJB 1NANH 3VXRE 3NIGF 1OARH 4N0FA 2OMBA 4GRLD 4P57B 1YEGL 5FDWB 1AGEB 2IPKB 2CLZB 3VRJB 2VLJB 4OZFH 3O41A 4I48A 5TDOB 1AP2B 5CGMA 4UZGA 3S7GA 4M8QA 3TO4A 1HSAB 2JELH 3L3JA 1FZKB 2IADA 4HW6A 3RWIA 4NCC1 4ODXB 1MJ8H 3FFCB 2ENSA 3OKMA 2QR0A 3VGFA 1LWRA 4PJCE 3RGVC 3HZKA 3MGTA 2DQUH 2JLLA 3D2UB 1PY9A 4R4BA 3GKZA 3HMXL 4G9FB 4U7KA 1RUPL 4OF8A 3DUHA 1AQDA 3D25B 5LWYH 5AAWA 2BSRB 3QCTL 3SDXA 3FO0L 2PCPB 4QRRB 5I74B 3A0OA 3FT4B 5T3XL 3ULVH 3UBXI 1RSFA 1F6FB 4ZFOA 1ACYH 1E4XI 2Y72A 3T0BA 3TM6A 1KIRA 5DD6B 3TNNA 1FO0B 1A7QL 1HCFX 3V4UH 5MEQB 1WFUA 1JFQH 1QBML 4KRPB 4MQXD 4G8GD 1YQVL 1AY1L 3LN5B 3LKQA 5SWZE 1JRHI 3AFLA 3MBXH 1AE6H 3WNKA 4I13B 4XXCC 5CJXC 1CE1L 3SDXE 4ZNEE 2VDQH 1R24A 1NGQL 3PF2A 5DT1H 3LEVH 4FP8H 4IMLB 4AEHL 5FOBB 1KPVA 4JFHE 1NGPH 1SBSH 4G7YL 4JANB 3HPLA 2Z9TA 3ARWA 1UGNA 4Z95H 3D39D 4H8WH 1YNLH 1PKQA 2ZUQB 3LQZA 1W72A 2F53D 2UV3A 1WBYB 2APBA 3ARPA 2IFGA 4X7CC 5DMIL 1NANI 5IKCA 2ILLA 1I1RA 4LLVB 1IGIL 2NZIA 2R69L 1Y0LB 3BHBB 4TNVF 4N9OB 1P6AB 4X99A 1DLHB 2G60H 5ECJE 4Z76B 5B38G 5I8OH 4M6NL 1TQCC 2Y5EA 1EHAA 3I3BA 2PXYC 4NPYA 5DC0A 1P5UA 1T03H 4OFIA 1OTTC 4YLQT 4NO0B 3MGOB 1F3JA 3L3DB 5CP3A 5DVKA 4PRIB 4M4RA 2F5AL 2RB8A 4GW5A 4WFFD 2AGJL 2H1PL 1T4KA 3FFCD 3EBAA 3T3ME 1SMOA 1TVBB 4ZPTB 2Q87A 5DK2B 5DHVH 5DUPH 4L8SC 1JUFB 4KJYB 5CEXB 1CDUA 3VFTB 2YK1H 1WTLA 1HOCA 3B83A 3MLVH 3DXAB 1JN6B 3I2CH 2IANB 3UMTA 5D2LF 3RY4A 2YN3A 3TJEL 3GKWL 4Y1AB 3CVHH 1KIPB 1Y0LA 2VSDA 3T0DA 5DSCB 3MA9H 4DKEH 5D7KD 5E9DE 1OTUD 3NAAH 1OP5H 4XPTH 2OJEB 2PXYB 3Q6FB 4KQ4H 4HKZB 2NXZB 1OVZA 3G9VA 5I71C 2P8MB 3DMMD 3TH2T 4OAWB 2J6EL 3V4PL 3QDHA 4LCUA 6FABH 3VWKD 5EOQL 1QLEH 5IMKB 5ELIA 3KAAA 3LPFA 2HLFC 3O0RH 3V7MA 3DSNA 3BE1H 3N1QC 2AEQL 5I30L 4G6JL 4XBPA 5K59F 4QHKI 4NN7B 1HNFA 5M7QA 3G5XB 4G8FA 1A2YB 1I3VA 4ZAKA 3VD7A 3RTQA 3TN0A 1U3HB 3FL7A 5KSVA 5C6PB 3S9DB 3W5MA 1IM9A 5I66A 1KLFA 4OKVA 5J56B 5TPWH 1LO0H 1URLA 1EUUA 2P1YA 1Q72H 4LQFL 5AD0A 4JHAH 4HWZB 5LGHH 5ITFA 1EEYA 1N6UA 2AK1L 1UWEH 3C6SA 4NOBA 1IRAY 2IAMA 2NR6C 5L7XH 2R4SL 4HKXB 1MAKA 4JPIB 4GBXA 3FB6B 4OLUH 1SYSB 5ADPH 4LARH 1FYTB 5HHPB 2Q1EA 1QA9B 5H37H 3S34H 1IM9D 3HB3C 1ZLVH 4RQQA 3NGBB 1ZGLA 4WWKA 4R3SB 3JWOC 3X3GL 4P23C 3I50L 4ZS7H 2QQKL 4M8VA 4PJ9C 1AO7A 3C5ZA 1A1NA 4NN7C 2XA8L 1MCRA 4HUUA 1JI2A 5C07D 3UCRA 1VKXB 4FG6D 3O3EA 4PRHE 4MS8D 1P6FA 3OXSB 2Z8VC 1QQDA 2IAMC 5CSZA 3T65A 1ND0B 5C0NC 5I19L 3V95A 3K3QA 5FO8A 3VWKA 1P7HL 2BNQB 4GS7B 1CLOL 1T5XB 5FGCB 5K9QI 2ZG2A 1R5IA 1M05A 1CE1H 4G6AD 1N7ML 3VH8G 1QLRA 3W9DA 4M5ZL 2OTUA 5MEND 1MHCB 4MJ6B 5HYQA 2Q76A 3RY5A 1AY1H 1I85C 2IANE 1J12A 1ZK9A 2GCYB 1MF2L 1AJ7H 1RK0A 4XCFH 1A3LH 3HNVH 1LO3L 1A5FH 1FPTL 2Y36L 3VGAC 1A7QH 5HYSG 4OSUH 3QIWA 5E8PA 1C08B 1F4AA 2DIJA 4OD1H 4C83A 1F5WA 3FFDA 1QR4A 2VE6B 4Y5XB 4XB7A 3RWJA 3GSWA 2Y7QA 4CADB 1RZ8B 3RQ3A 1J8KA 4LF3A 4OZFA 4P9HC 3MRGB 1AIFA 3GSUB 3CDCA 3FFCA 3X12A 5JW5A 3ALXA 5EH1A 1HI6B 4S2SA 2E27H 5F88A 4FQJH 3MV9A 3QUKA 2EYTA 4XP5L 2E5EA 3ZDXE 5KSBF 3RHWF 3X13A 5FCSH 3IFOB 4JPKH 3PWVA 1RJLB 3KPRD 2WQ8A 3MV9E 2XY1A 4PJFB 1UVQB 3LKPB 3FMGH 3RZCB 4D9LL 2IALA 4X6BA 5FV1L 3BZDA 4X5WB 4O2FB 4PLOB 5FKAA 3QPQD 1CR9L 5ISZE 1M4KA 4OLEA 5I1AB 5DZOA 1OLLA 2Z31D 4DN3H 2X4UB 1OB1B 1M6OB 3MRFA 2UWEF 1Q0XL 4NKMB 4ZODA 1MVFA 2DIBA 1QKZL 3T3MF 1OGTA 2NY2C 2XT1B 3DSFL 5IB4A 2O5ZH 5ID0B 4KK8C 3QUXC 5C6TL 3KYAA 3PGDB 1E6JL 4QOKA 3OZ9H 4PRDA 5C07B 2EO9A 4FRWA 5JIPA 4NN6B 5F3BA 3BDXA 5FUZL 4QHUA 1F4YL 3D3VA 4KVCH 4WFGE 5FGCE 2QSVA 3EYVA 4LCWA 3BGFB 2DTMH 5D2NA 1FN4A 1H15B 5FB8A 1WIUA 1UA6H 1EV2E 1EHXA 2XZCL 4OV6F 4MAUH 4ELMF 3BZFA 1DQQA 5IT2L 4LKXA 4FN0A 5HYEA 4TSAH 5J1AA 3KPPB 4PGEA 5MENB 3MNZA 4FQCL 3CXDL 4LSRL 4HS3A 5DTFA 1BIIB 5KSBE 4XX1G 2DYPA 1HINH 2O5YL 3LQMA 4PGDA 1ZT1B 1C5CL 2OLDA 1FDLL 3HE7C 3BD5A 5ANMA 1T7VA 3ARDB 4AJ0A 4FTVE 5ACLA 2YKLL 2VXVH 1MCPH 1A1NB 5GGSA 4NYLA 4GSDL 1S7XA 4G8EB 5BRZE 1OGAB 4HWEL 3MLXL 3DSFH 5BQ7B 4E5XB 2W38A 2CD0A 4LRIA 5TQ0L 3T0VA 3WHE1 4MHHI 4ELKA 5HDQL 2YUZA 1BGXL 5E2JA 4KDVA 2XXMB 3D3VE 3QJHA 1MFAH 3VXOB 1L7TL 4WV1C 4WCYH 3KHQA 2IF7A 2GSGB 3KPOB 1NCCL 4M03A 3KYOB 1EEYB 1UZ8A 1RUMH 5H35B 3SJVD 5I75B 3CUPB 1QD0A 2ZUUA 5KS9E 2BDNH 3GK8L 4OB5H 3HC4H 3EIFA 3ZT6A 2GSIA 2K1MA 5J12B 2FWOA 1NGWA 1YN6B 3VFWA 2F8XC 1HHHA 5ISZA 1GSMA 1RULH 2XY2A 5KSAD 3TVMA 2XZZA 4UILH 1G6RH 1Q94A 3RI5F 2GJ6B 4I2XB 4IDJH 5HTSA 2XFXB 4YXHH 2EEDA 3GB7B 2YZ1A 1UC6A 4PJIB 3OHXB 4JO3L 4C57C 5SX5H 4JN1L 3TIDB 1DFBL 2UWEA 4PJGB 2HWZH 3D2UD 2R2EB 3H9HB 1FORH 2PO6B 1WGOA 2NY6C 1NMBL 3Q3GB 4ORZC 2AK4E 4MA1B 4PJAF 2VSCA 5JA8B 1JF6A 3F7PC 2X9YA 2XZCH 5IMMA 1MF2H 4P2OA 4U1IA 4GG6F 2Y25A 3HUJB 1TNMA 1R3JA 2G75B 4P2RE 2VL5A 4AZ8A 3SBWA 3KDMA 3RZWA 1CFTA 2R23A 4QHLB 3ZKMC 1ZA3A 5EOCL 5F7HA 4LPCA 4LCCA 1G9NH 4NQXB 1R3KB 3OZ9L 4H0GA 4G9DB 4U0RC 1N3NA 4Z7UF 1NC4B 2BNUB 3VRJA 4LASL 3OKKB 3L1OL 4JB9H 3KPTA 3H2WA 5KAQG 4P57A 3HAEH 1VFOA 3L3IB 1NBYA 5DJYA 2IBZX 4XC1H 5CJBA 4XB8A 3MRJA 1Q0XH 3MOAL 1GGCL 3C5SB 2IQ9L 3EFFA 1S7UA 4JY4B 2NY1C 3LPGA 4HWNA 1UT9A 1AR1D 4YHOH 2D31A 2XWTB 4O58L 3S34L 5DC4B 5C09E 2BHYA 1I9RL 3CFKB 1CWVA 3T65B 1PFCA 3FMGL 5D72H 4MXWH 4X5XB 1KNOB 3C9NB 1O0VA 3DURB 3ZE2F 1MFBH 4PS4L 5JHDE 3O6FC 3QHFH 2E27L 4DN4H 2B5IB 3IXAB 5HHXL 5IQ9A 1F8TH 3UX9B 1G6RB 3C6LA 5GGSY 1Q9WB 1EA9C 2FIRT 1I85A 5JQ6H 3QUXB 3GBNH 3D18A 5F1SA 2DQCL 1R5VA 1W72L 3ARED 2OI9C 4LCYB 4OT1L 5CUSL 3KWWA 1GGYA 2Y1VA 1WWBX 1M71A 4OD1L 3W39A 3MUZ1 1C7TA 4Y2DB 2CRMA 3EOTL 4PJ7A 4CMMA 1OAQH 1FPTH 5SX4H 1DSFL 3C60B 1FIEA 2D31B 2VLKD 3F8UB 3KJ6L 1XMWA 4NQEB 1AJ7L 3MUJA 1OP9A 3NPSC 1IEHA 3DUUA 5DGQA 5E4EC 3OTTA 3MV8E 5IW3A 2J8UF 4PGEB 4AM0B 4DUVA 2XV6B 4ZAKB 3CFEA 5DA0B 2JCCE 4GS7C 1HQ4B 3QO0A 3VI3E 5DC9B 2GITA 4L4TD 3KPLB 4WUUB 3LS4L 1ZS8B 3GSNL 1AFVH 1U3HD 4NFDA 5DJ8B 1DE4A 1P4IH 4OZHE 3STZB 5EU3A 5I6XC 1FN4B 1H15A 2YWZA 2PTUA 4K7PX 4DFHA 2H3NB 4ZMAT 1Q1JH 3OL2A 2CO7B 4R26H 4G9FA 1XGUB 4M48L 1HXYB 4DZ8B 1IZKA 1XR8B 5GJTL 2XA8H 1R3JB 2G75A 1FRGH 3X3GH 5MI0C 3L95B 5I1EH 4DVBB 2FDBP 2VDLH 5F44A 3TWCL 1I3RB 3FT3A 1KIPA 1M7XA 5ADPL 5DEGB 4L8SB 1K4DA 1UENA 4XC3L 5E56A 4ZG1A 4H26A 1I8IA 4XPGL 2AI0H 3MJ7B 4XTRC 2P24A 4YBLB 1UWEL 5F70A 3UTOA 4KMQA 3F7RA 1VEPA 3OKDA 5CBAB 5HHOD 2WW8A 3O4LE 3M45A 5I1GL 4G6ML 3P9MB 2NY2B 3BVNB 5HGHB 1UKSA 3ZDYF 2QSQA 3HNTL 4JZNB 5D2NC 3SBWC 3H3BC 4PJBA 3ZO0A 5DD1L 4KHTH 5DJAA 2LABA 4DZBB 3JV4A 4R6UA 3MUHL 3A67L 2YRPA 4O5LL 3U4AA 1JYVA 1U0QA 5JW4M 4U1KB 1I1YB 1U8PA 4MJID 4AIXA 5E03A 1CE6A 2IG2L 4P2RB 3MV8B 1KSRA 4PRNA 4I3RH 5D71L 4B50A 2BXZA 1NGPL 2VLMD 4YXKH 1CGXA 4MA8H 5FDYA 2OXGA 5E2VH 4ZSOB 3TYFB 1Y18A 2CUHA 5DT1L 3F65A 4LRIC 4C83B 5HGBB 3OR6A 2XKNA 3UPCA 3KNBA 1I4FA 3K81A 4JFDB 1OT2A 5C0DA 2DS4A 2O61A 12E8L 2DKMA 1OGAA 3LZFH 2VDNL 2DQIL 8CGTA 3SGJC 3GMLA 1FFQA 3VXNA 2Q76B 1F6AB 3CDGB 3I9GH 3FB8A 5FF6A 4ZXBC 3TZVB 1YPZF 3TLRA 4HJGA 4QRTA 2AJ3B 3RIAF 2EXYC 2R29H 4ZFFB 1MCHA 5J9PB 4L5FH 1YJDH 3KPSD 2F15A 3HNSL 3MV7B 5J3HC 3W0WE 4X9IA 3ZT7A 3QCVH 3UJJH 3SDCB 5C0CD 4H1LB 3VXUB 4AY0A 4UTBH 4Z76A 1F8TL 3VMOA 2B2XH 2VIRB 1BFSA 4F9LC 3CZJA 3D39B 3QHFL 3R1GH 4JN2B 3B2UC 3FT4A 3CGTA 3ARZA 3HPJA 5I74C 3WNLA 1X4XA 5CJOH 5KW9L 1CD8A 1S9KC 4D0CB 5FM5O 4PUBL 4NUGL 4TSBL 2MPAL 1X5AA 2PETA 2JELL 4L1HA 3EO1A 3TYGL 2IGFH 3IETA 4MB3A 1U8IB 1T7ZA 4D94A 4E9LA 5F1IA 3WNOA 4X8JA 5BV7C 4XAKD 3C5ZC 2X4PB 2CRYA 4ZQKA 4U05A 4V1DA 2J88H 4OZGE 3FKUS 1SM3H 1GGCH 4UQ2A 3N1PC 4TQEH 2BY1A 1NCBH 3JWDL 1FFOB 5HHOA 1FGVH 1MHHA 1OL0A 2VN4A 4XBEL 3CFKA 5KJRL 4KPHL 4ZOEA 4MD0A 1RJCA 4QLRA 4N90D 3L1OH 3MV7A 1XAUA 3LY6A 4KRLB 1K8IA 2P5WD 5DF0A 2A9NL 3MLSH 1D5IL 4HUKB 3PDGA 1IM3A 1LHZA 4I1NB 2W07A 5EOCH 4HUNB 2A74A 4OGZA 3MLZL 1P1ZB 4XNUH 3CMGA 5HPMB 5AZEL 1UVQA 2YBRA 1ZLWH 4PG2C 4LHUG 3TIEA 3WNMA 1JFQL 1XF2A 5D1ZD 4G9FD 3DNKA 4LU5L 5GGQL 4HPOH 3NZ8A 3V6OC 2M26A 2HYMA 5DLML 1M1SA 3RKDD 2IQAA 2I5YH 3GSNA 2X4OB 4LPVA 4B0MM 3IJHB 4ZSOA 3HLAA 3O11A 1JRHH 1U2CA 4L4TA 4X4ME 4EOWL 4ODVH 5F7DA 4OZHF 4QCIB 5MERB 2KH2B 4K8RL 2OI9B 4X5XA 4TUJB 4GG6A 2X5PA 3TO4B 3KPQA 4G80A 3JTSB 3GSVA 3AS3A 1W8OA 2AXFB 4LCIL 2DJSA 1BVLB 5IROA 1U8OB 4HIIB 3CXHK 2Y6SC 3T4AB 5I0ZA 2WIIA 4NWUH 1FC1A 5DJCB 4LMQE 3WEXA 4K3JH 1Z3GL 2A6IA 4NQCA 4L3CB 4W4NA 1GPOH 5JZ7D 3U9UB 3S36L 1P5VA 3ARFD 4P46D 3SGJA 2L7JA 1I3GH 3F62A 3MLYL 1Z5LB 2A9MH 4K9EH 2OK0H 5KVGH 5FGRA 5IF0B 3BN9D 3SQOH 5EOCJ 1D6VL 5CZVH 1UFUA 4GW4A 3BHBA 1P53A 4L4TB 4OUUB 3QQ4A 3BQUA 3MLTA 3W82A 2VE6A 5AWNH 5GS1B 5JMOC 4ONFH 2QHRH 3E6FB 1KENH 3FZUD 4Y4FB 5DEFB 4D0BA 2LVCA 2DDQH 2VAAA 2CIKB 1DLFL 3O8XC 4WW2C 3EHBC 3SEPA 3TIEB 1MJUL 4KI5E 3Q1SH 4HXAL 5EO0A 3GB7A 4DGIH 1Z9MA 1UB6B 4GW1A 5C0RH 4HPYH 3IRPX 5F21B 4AH2A 4OM0L 3RVWC 3JTTA 1QSEB 4AL8L 4MCZB 7CGTA 1S5HA 4HUVB 5D8JH 4Q9QL 2V17H 1DQDL 4EI5B 3H9SB 4MLIA 1QYGH 3M8OL 1PG7W 5E2UL 5E4EB 1DQJB 1G9EA 3K8KA 4LLYB 4MDIA 5SWQB 5HVWA 2YEZB 3I75A 4X6CA 1JNLH 3EKCA 1BOGB 4PJFF 1IBGH 4C4KO 1Q9LB 4KROB 1WCBB 3K4AA 2AEWA 5E8EA 5F9AC 1VADB 4EBQH 3D6GA 3ZDYE 3MLPA 1YZZA 2FJFA 1MHEA 1XF4B 5EDXA 5JOPD 1D5XB 2VQ1A 3K2UH 3S36X 3VFOB 2DBLL 4D0CA 5GRJH 1ED3B 3S97C 1S7XB 5HHNA 2VQTA 3QNYA 3SKJH 5HD8C 3O4LA 3MRDA 4AMKH 1B90A 2ZSVA 1OHQA 3VXUA 3LQAH 2I25N 1DQMH 2G5BB 4FMKA 4P5TC 4OV5B 2Y23A 3BISA 3BQUC 5CZXC 4F8TA 1XR9A 5J6GB 1T7XA 1NLDH 5MHSD 1A1MB 3BGMB 4YEFA 2DWDA 4HEME 4FFZH 4JJ5A 3WEXB 3B9KD 4F7EB 1J7VR 4QF1B 1FLRL 3KPRE 4LNVA 1T1ZB 1N64H 1A6VL 2FHBA 1QHOA 5INCB 4UMGA 4GAYB 2VZOA 1EVUA 1JTPA 1NMCB 1MJJA 3S35X 3U4BL 3O6KL 2ERJB 5ADOL 2CGRH 8FABA 3S37L 1NH6A 3IKCA 1U36A 1HI6A 2HFGL 5HJ3B 3HG1E 3RHWK 3IDXH 3T8XA 2JJUA 4U3XA 1RMFL 3TBTB 3CXHJ 4V1DE 4JFEA 4P0DA 3BDYL 3WS3A 5HVFB 4H0IA 2C1PB 1N6QH 2Q6WB 2FL5A 4LIQL 4RGNC 1K6QH 3FFDB 1EO7A 4P4RB 4HT1L 1N7MH 3VFVA 2PO6A 2EE3A 3PGFH 4JKLA 3DTXA 4RFOH 5DJAB 1GHFL 1MLBA 2X05A 4RISL 1TTGA 4N0UB 3PWNB 3RVTD 3VH8B 4I4WA 5HI4C 5BO1L 2A6JB 1R24B 4M5YL 3BPNC 4JO4L 3CX2A 1SVCP 1CBVL 5E5MB 1B4JL 1HWGB 1NGYB 5CBAA 1FZOA 5IB3A 3RWFA 1RJLA 3LB6C 3MNVB 1ZANH 4WIQA 2ICEB 3HAEB 4GG8A 4XHJD 2MSPA 4S1DC 1PYWB 4PJIE 4K8RD 2HRPL 3GMMB 3MLWH 3WBDA 1C12A 4FQHB 4K3HA 4RDQG 4BQCA 1T89A 1A6ZA 2HN7B 2ARWA 4YC2B 5IGXL 3CVIL 3RUGF 1MWAA 3D18B 5MEOB 2DLIA 3CDFA 4K7PY 3D25A 3WIHL 3MRCA 2HT4C 3BRGC 2GAZA 2Q8BL 5T5NG 3NCCB 3GM0A 2IBBA 4R0LB 3BJ91 4BSVA 4BZYA 1UACH 1U93A 4LLQB 5T1KA 2R56L 4HFWB 5L9DH 1P4LA 2XRAH 5T5NF 2W65A 2P49B 3B9KB 4H88L 2ADIB 3KPRA 1KTRL 4GT7A 3KLDA 4RRPG 4W6WB 3HUJF 2VERN 2VLJD 5D70H 5JXAL 3O0RL 1RHHA 3MV9D 3OB0H 2APTA 2CUIA 4Z8FH 4MD5A 4NZUL 5IJKA 1AGEA 3JTTB 3KPPA 1OM3H 1U58B 5B3JF 1A2YA 1ZHKB 4GH7B 2WUCH 5F6HJ 1CL7L 4OZ4B 3RAJH 3M8OH 4HLJA 5T3XE 3UJIL 1WQVT 5GHWH 1IKFL 4Z7NF 4U1MB 2X4TA 3MA9L 4Q6YA 4L3ED 1LMKA 3B9EA 3QIWD 4JFFD 5D4QA 3C8DA 5T1DL 4DK6A 3QIUD 5GGSB 1F3DH 4CVZB 5D7JA 4OTXH 2FX7H 4PJ7E 2APXA 2V9TA 1KLUA 4G42B 2IAMB 3VU2A 1SYVA 4Z0BL 3IFLL 4QCIA 3SOBH 2ICWI 1RJZA 4Z7UE 4QXTB 4KY1L 5KOVC 4AIZA 2ZUTA 1IAIM 1IZJA 4YE4L 3NCJH 1N8ZB 3HG1B 4P9MH 2A0LD 5H2BA 2AGJH 1LO5A 2IADB 1KN2H 2J7LA 3BP7A 1S3KH 4ZXBD 2B0SH 4NHCH 3WHE0 2QHRL 3DX6A 5L8LB 4U4BA 1KT2A 5LQBH 1IILE 4ZUUA 5FK9A 3VXRD 3V5KB 4XPBH 1XT5A 1K9TA 5CIPB 4U2YA 2J1KA 4MLSA 3N0PB 2VXQL 4W68A 1ZLVK 3GSQB 4JVPA 1Q38A 3ISWA 3QRFM 5AEAA 1UM4H 4FQLH 4Y16A 2EO1A 4FA8A 3SGDH 1I8KB 5AG8A 1Z3GH 5D96C 4S2SB 1Z6JT 4P5MA 4AENB 1DCLA 1G7QA 3RX7A 5IFAH 2ZCLH 5H35A 4G7YH 1O7SA 4DGVL 5HXMA 1IGCL 1TCMA 3GMPA 1OP5K 1W72B 2OQJB 2DBJA 1U6AH 5IBUG 4XXDA 1VFAB 3TP4A 4P59H 2XWBB 5AAMA 1YN7B 2M8XA 2N1KA 4PRID 3WXVL 2UYLA 1VADA 4PP2A 4W6YB 4JY5L 3TN0D 3STZA 3RTQD 2GI7A 1J0YA 5HYQB 2R0ZL 4WGVB 3KLAB 1NFKA 1RU9H 5IVZB 5C0EA 5FYJU 3BPLB 1RHFA 1WCQA 2VIRA 4HGKC 4Z7UB 5DS8B 4IOIA 1UM5L 4MD5B 4KKBD 5C7XH 1MCWW 1NC4D 3SY0A 4PR5B 1YYLH 1RUKL 2VDRL 1OP3H 3PHQB 5C0AB 4Y2OA 4Q0XL 2ERJC 1QBLH 2XTJD 2GT9B 3IJYA 1MRCL 3HMXH 1G7MB 3W9EB 3DROB 1S7QB 4HULB 1CT8B 5FF6B 5JZ7C 1NFDF 3RKDC 3RPIA 2BVUA 5JHDB 2IJ0C 2HFFA 2I07B 3L5HA 2WM0A 2ZCLL 5DJXB 2A77H 4XNQB 3STLB 3SDXF 5C0GB 4OCYL 1C5BH 1INQB 2NNAA 4J3WA 2X7LB 2FGWL 4QOKB 3A6CH 3I02A 5F7KC 4P2RD 3ZYZA 1S9WB 1WC7B 4E0RB 3HC0B 1AD9A 4JN2A 2X10A 3WNPA 4PP1D 1YYMH 3G5VB 1SJHB 3UTSD 1I1YA 4WWKC 1N4XH 4NP4H 3FJTA 2JCCF 4RZCB 3IAQA 1OCWL 1MFEL 4LDOB 3P40A 4G43B 3ZT5A 2VDPL 3NZHL 1ZSDA 1S5HB 4HUVA 1EUTA 5TF1H 2PTTB 3RVTC 2XG5A 3IDJB 4MQSB 2VLRB 4UDUB 1U8LB 1RK1A 4QWWD 3VXTA 4EEEA 3VH8A 3PWVB 1QEWA 4UQ3B 4S10A 4IRSD 2PF6A 4EI5D 3C6LC 4JFZH 1QFHA 1TMCB 2ZJSL 1LD9B 4LAQL 4UNVA 3DX6B 5DVMA 3IDYC 3FO2B 4LMQI 1YMME 5GIRB 5DD5L 3GSUA 1MLCB 4HSQA 1MELA 3MSPA 5JHDD 2ZP0T 4EIGB 1LDPH 2DM7A 5GHWL 1FBIL 1LILA 2FIKA 1CL7H 3VD5A 4DZ8A 1T21A 2VQUA 1I7RB 3VD9A 3EZ8A 4JY6A 2A73B 4LEXH 4XPAL 4PRPD 4JHBA 4Y19B 1ZT4A 4WEUD 3C2AL 5DYOA 3P77B 4NZUH 1F58L 4MVBD 5FGBA 5I8CA 5I1DA 4F57H 3VFPA 4PJBB 4J4PD 1BAFL 4L8CB 2D0HA 4BQ9A 4L3CA 2G9HB 3TBSA 5MP6L 4YHNB 4XPHH 5D70L 1ZVSB 5ESQB 1JVKA 2GITB 1KCLA 2HJLA 3MYZA 2YXMA 5B39G 5FYKH 4O5LH 1NAKH 3QPQC 1A9EB 5GISL 1NEZB 1H3VA 3AU1A 3WL9B 1HHGB 2XZQL 1KTLA 1RHHB 4F7PA 4HIHB 4K71B 3UTPE 4MQXC 4MQ7B 5CKGA 2XN9D 5F3HB 5C9JB 4ETQA 5B22A 3KLHD 5J0BA 3LHPH 2Q3AA 4NCC2 3BWAB 1I3RA 1I9JL 2JJWA 4XNMB 1VACA 4WGWB 3BFOA 2F53E 2FH6A 2Z35A 1A14H 2X4NA 5GS0D 3OKEB 1PKQB 4X6CE 2CQVA 3FB6A 4XNYH 4E5XA 3GIVA 3QO1B 4YE4H 4XMLL 3HPLB 1MH5B 4O4YH 5EULV 3O45A 5I1EL 5KVDL 3BKCH 4YHKL 3O9WA 3SKOA 3BH9B 4Z0BH 4F7CA 5E94B 3RWEA 2JB5L 1DANU 1A3QA 3DMMB 1G9MC 5J13C 1Q1JL 1H0DA 1FHGA 1JGUH 5SX4I 3WLWD 1JIBA 5KS9F 3IVKB 5DHYB 1AFVL 3GSNH 3U4EB 1QPPA 1K8DA 1ULVA 4QXUL 3WJLA 1FG2A 1PLGL 3G5XA 3WO4B 2IAND 3U79A 4E42B 2EZ0D 4OFYA 4OLYL 3BUYA 4U1SB 4W81A 4YHNA 5DO2D 3WXWL 4X80H 5T1LD 2UYLB 4PP2B 4JRYB 3UAJC 3DTXB 1N3NB 1QSZA 4L8DA 2ZPKH 4ACPA 2QQNL 3HC3H 1ZLUH 4FZEL 3QEGH 3ARBB 4EN3C 2AJSH 3WHXB 4JAMB 1WV7T 4N1CA 3O6LL 3PQYB 4CAGA 1MFCH 4PG9A 4NKMA 3SJVE 1ZVHA 4U1JB 3BT2L 4J4PC 5ERWB 3CZFB 4U6TA 1AP2A 4DKFL 1I7TA 1U3ZA 4JDVA 4O2EB 4PS4H 4F37F 1B88A 5DHVB 4ZUSB 5ALBL 4KKLD 5E8OA 4ZDHA 2OTWB 1RUQL 3EYOA 4MDJA 3TN0C 4JFQB 4PJDA 1TQBC 3B4NA 4OGXL 5E2TH 1B2WL 3ZKNC 3GJFK 3P4MB 1MCOH 1QRKA 2OJZL 4YXLL 1KIQA 2PW1B 4O58H 3ZDXF 1A9BA 4QRPE 4DUXA 2E9JA 3CLFH 4PRAA 5IW6A 1U92B 4OCSL 1JMXA 1WICA 3DVNA 4QTHB 5TE4H 3GSVB 3PWUB 1B4RA 5FYKE 4CJ0A 1KXVC 3PNWB 3C8KA 1WWCA 4ZFGL 2X1OA 1DEEB 1GZQA 2HT2C 5BXFA 4K3DH 1CU4H 3KS0J 2HLAB 4GXVL 4U1LA 4U31A 5HYJB 1VEOA 1KB5A 1U8QA 1LO2L 2H41A 1MCLA 1HE7A 4ZOCA 4G8EA 1RIVH 4FHBD 3OKOA 1MRFH 4MXVF 4I77L 5DRXB 3SGEI 1JTTA 1A7PL 2OZ4A 5HHOE 3WS6A 2IPUK 2IPUG 4JJ5B 2NW2B 5D7IF 1NC2D 3SE4C 1UCBL 3VW3H 1PX4A 4KJPC 4IJ3B 4Z7WA 2E6QA 1F3JB 4WDIA 1D5ZA 4I3GA 3IGAB 1EGJA 5DJ0B 2E6JA 1CZ8H 1QBAA 3KLHC 4HH9B 3PV7A 1KIRB 1FFOA 2NY2D 3EDFA 4IRJA 3F7VB 4FQIL 3CC5A 4RIRB 1OW0C 3A6BH 5CJQL 4GKSB 1I1AB 3KYNB 1WBZB 5IB2B 3P0YL 2ADFH 2P5EA 4IRSB 1JGLH 1OAUH 4OCMC 3T1FA 1GJIA 3OAYK 4GBXB 4XZUA 3H3PH 3NBNA 1PX3A 2B8OT 3L5WA 2YPLE 2NW3A 5IEHB 2VABB 1L0XA 5DXWA 1OGTB 5BW7A 4X6CB 4K3JL 5EO1A 2AV7B 1Y6NR 4RFNB 3B9VA 3ARDA 2VLKE 1J1XL 5C08D 2CDEA 2ICWB 4HDIA 4XPHL 1MJ7L 1JHLH 2I60L 1VA9A 1SY6A 3R8QA 1TLKA 4I18C 3I6KB 4LCIH 3MNVA 4OCXL 5C0CE 2WANA 3QDJD 1CFNB 4U1NA 4MYWB 3S88L 2HJLB 1M71B 1NCTA 5E2UH 4XNZC 3TCLB 2WNGA 1QYGL 5CCKH 5F89A 5IBTH 5EUOF 3PXHA 3OKKA 3U7AA 1FNLA 4HJJL 3QDGA 4XNXL 5IFHH 4Y1AE 3KVQA 5DD5H 1JZ7A 1AXSB 2LFGA 2CR3A 3MV7E 5IT2H 1D3CA 3F58H 3NH7L 3ECBB 4B53A 5T3ZE 4BSJA 3RGVD 4ZPVB 5GGQH 3LD8C 2PKDA 4U1LB 4MNHA 3Q1SL 4HXAH 4MNQE 2R2BA 4JRWA 2VITB 3DV4B 1XIWC 4TOYL 4P2OB 3FB5A 3O2WH 4UDTA 4PRNB 5I16A 3RDTB 1C7SA 2DQDH 3GJFH 2OR9H 3FQWB 4V2CB 1CIDA 4G8GB 5IW6B 4NO3A 5BZWB 3D9AH 1U8NA 1MFEH 2NMSA 5IESL 1T0NA 4Z7WE 5DWUH 4N8PA 2YC1A 4MS8C 2XQYK 1QKZH 3V6FA 5CZVL 3DRQB 4XBEH 4XNZB 5FM8A 3RZCA 1I1FA 1NCBL 4DN3L 4K3EL 1FCCA 1SM3L 5C70A 2DWDB 2MQ3A 2H26A 5CD3A 5J8OA 2BNRA 3B2VH 1CR9H 5C09D 1H3UA 5GGVH 3MJ6A 3BGAA 4NWTL 1NAML 3BPOC 2V2XB 1JPSL 3M1BA 5JNYB 1VFBB 4HDIB 3KPQB 5E99H 2PUQT 4OLVL 3B8YA 3OJDB 4QHLA 4KMTL 3I6LD 4YDJA 1KJ2B 3PQYA 4NWUL 1A6TA 4PJXB 5HYSA 2UUDK 2P4AB 4UDTB 5CD5C 3KYMB 2DJUA 2YHGA 5CILL 3R8BB 2P47B 2WP3T 4M6ML 3RIAK 4R3SA 3OX8A 1KLUB 5C0JA 2VLME 3QI9A 2GSGA 4P5TA 5EORH 5FYJH 5GZNC 3FO2A 3GSNB 1C08A 1B6UA 4U6HA 4HGWB 5FIEA 4MJIB 5KANG 5CEZH 2HRLA 4P4KA 4TVPH 4ISVB 2UWEB 4PJGA 4NCDA 3PXJA 5K9KA 3RFZC 4NJAL 1Q9LA 1ZS8A 5KZCB 1NQBA 3NFPA 4NO5A 4A6YH 5ICZB 2WUBL 3BKJH 4XI5C 2PXYD 5HPMA 5TDPA 1IGTA 4JZJA 1G7MA 3W9EA 3QDJE 4PGBA 2DOCA 3ILPB 2R1WA 4U1HB 3I6KA 4WJ5B 4GAGH 2AERT 4X6EA 3WIFA 1S9XB 4YFDB 5KVMC 1KCVH 3WE6A 2HMID 1KULA 1XGRB 4Y1AD 4HUXA 4XWGL 5I1IL 3FRUB 1ZHNB 3QUYD 4HS6A 2NY5L 4R97C 2YD6A 2IEPA 5EO0B 1CXIA 5FM5M 3PL6A 3QUXA 4PBWD 1C16A 2CUMA 1WZ1L 5HY9B 1ADQA 2X42A 4S1RH 3HI5L 4XXDB 5KTEL 5L0QC 4UTAL 1F4WL 3HTLX 5B38A 1YNTA 4RRPA 4FQLL 2DLEA 4LLUA 4NZRH 4CVXB 1WVZA 3LPWA 2O93L 5SV3A 3MYJA 4NQDA 5HYSB 5AD0B 5DI8A 2YPLA 3TC9A 4Y2DC 2B1AH 3QUML 1KBGH 3D69A 4KJQC 4UT7L 4MQ7A 5HGGS 4XHJC 3HI1B 2NYYC 4WV1B 1E27B 2AK1H 3BWUC 4OCRH 3C5SA 2F9BT 4YNYA 4YR6A 3SCMD 3UZEA 4JLRA 2DQFB 4H20H 3AC0A 4ZUTB 1VPOH 3V5DB 1MCCA 1QSED 5ESQA 4ODUB 5SWSA 3OKOB 4YWGH 3QCVL 5DRWA 3WV0A 3VFNB 1DQLH 4EXPX 3SOBL 1PZ5B 5KN5B 1FAIH 2UY6A 4HGMA 3QZWA 4WHDA 2DKUA 1YC8A 4F33B 1WISA 1NCAL 3BE1L 3OF6D 5EPMA 1V3LA 1O5DT 1BQHG 4Z7VB 3EZJB 4FS0A 4WI7A 2O5XH 4LLUB 1IKFH 4MHHG 3SGKA 4OFKA 3RAJL 3AY4C 3RX8A 3VFOA 2WUCL 4HV8B 1S7SB 1JWSB 1OM3L 5IP4A 3HE6D 2AEPH 1LE9A 2H3NA 5GGVY 4H0HB 3BMVA 3O2VH 1JJUA 4EUPH 4NQED 1JZ3A 4P5TD 2Y6SD 4XI5D 3U48A 2Z8SA 4DKEL 3AXLB 5JXAH 1DSFH 2FO4B 1OAQL 3ZKQD 2WWKO 3RDTD 4EN3A 3BZ4A 3EOTH 2GTZA 3FRPG 2VLRA 4JZOB 2D7QA 1RZJH 1ZHKA 2ZZUT 4JFQA 1OY3B 3W0WD 5CUSH 4OT1H 5ISZB 1OOAA 3L3DA 3PP3K 4ESKA 3EYQD 1MQKH 1RZFL 3G6JF 1ETZB 5CINH 2OBGA 5C09A 4U1GB 5CMAA 2BNRD 1KTDA 1MHHB 2CDGB 1M7DB 2ADIA 1UXWA 3O3BA 4HHAB 4UQ2B 1IEBB 1IQDA 2QL1A 5EIIA 1MFBL 5D5MF 3CVIH 4QYOB 4YGAB 2CIKA 4ZFZA 4XPGH 3ZL4H 3EJZD 4HBCL 2QKIA 1S5IL 3ZE0F 1I9RH 5JIHA 3VWJA 1NDGA 2IH1B 2OP4L 5DMIH 1FFPA 2WQRA 4NUJA 3E2HC 4MJ6A 2QTEA 4H8WL 4KTDL 4Z95L 2HLFD 3SGEH 1J10A 4ODBD 4UTAH 2D7TL 4W70A 5IEKB 1WAAA 3LKNA 5EU4B 1K8DB 3QEQA 4DFIA 5I8EB 1GOFA 4JKMA 4O51B 2ZUWA 2QSTA 3UYOD 2V6HA 4FP8L 4AEHH 4XVJL 5D1QB 2VZ3A 1G9NL 4U3CA 1NGYA 2Z92A 4I3SH 4I9WD 2NY3C 4HMCA 4Z7QE 3G5YB 4Y4KC 1XF3B 1YQVH 4GQ9H 3MXVL 2BSRA 1S8DB 1OSZB 3KJ6H 2DLGA 1LO4L 2AJUL 3MRQB 2EIBA 2YUVA 4IJ3C 2OTPA 4R2GC 4HWBH 1QZ1A 1A3RL 4OLXH 3BKJL 1TJIH 4LHUA 3ULVL 1X6NA 3U7WH 1G1CA 4ZTPL 2DTSA 4QGYA 3FHAA 4F9PA 4D9QD 2AEIT 2YA1A 5EA0H 3WLBB 3E3QC 3GJEB 2VKXA 1TQCB 3C87A 1KJ2A 3T8XB 2HKHH 1OT1A 2R2HA 3LH2H 1FLRH 1FIGH 1YEFL 3O2DH 1EPFA 3VXME 1YEEH 2NYYD 3GMMA 2N7BA 2C4FT 5CZXD 2IBZY 2V9RA 5F96L 2DQUL 4MNQA 5FO7B 4M7JL 3OJ2C 5LGJA 1N2RA 1A9BB 2X40A 3I85A 3ILQC 4UIMA 2XN9B 5C0IB 4LP4A 3ZYIA 2ITCB 4Z18A 4J7RA 1CFVH 3BIKA 2NY7H 3QDGE 3T4AA 2XQBH 5BOPA 4S1QH 3PWNA 2CH8A 4YDIL 5GGVL 1MQ8A 1KJ3H 3OAZH 1P7QA 2OR8A 4ZUSA 35C8H 4PJHB 4R2GB 3TZVC 2PYED 4MD0B 4K3EH 4Y19A 3PWLA 1HH6B 1EGJL 3G6JA 4WU5B 1CLZH 3RRQA 1R0AH 1NC2A 2AS5M 3UZVB 1V05A 1ZHLA 2V9QA 2DMBA 2BK8A 4MAYD 4PP1C 1Y6MR 4FFVC 3DX9B 3FOLA 4PJCA 3I02B 4RMWA 4N0CC 3QIBA 2DAVA 3KPOA 4NT6B 2VXVL 3WFBL 4ZS6C 5DMJB 2DQDL 8FABB 4OZIF 4N8VG 5IJKC 4KI5D 3TIDA 1HINL 4J6RH 3RVVD 2ZUSA 2DF3A 5C2UB 2MNUA 1IL1B 5IVOA 4UV7H 5B3JE 3QA3A 4ZD3H 2J8UA 1RK1B 3PWJB 5J6HA 1OAYH 1T5WB 4PJ8B 2BSTB 5KVEH 3DXAE 1HQ4A 3MR9A 3BSZL 1YMMA 4HPYL 4IRSC 4WO4A 1B0WA 1JWUA 4NIKB 3L7FB 5ESAA 1G7PB 1HHHB 1CLYL 3FQRB 1QUNA 3DHMA 3DYMA 5IR1B 3ZSTA 4WV1A 3M17B 1DLFH 5BVPH 1QSFD 4HEPG 3VJ6A 2BSTA 1GAFH 4Y4KD 3I3EA 4NN5C 3RWEB 4R8WL 1U2HA 1V5JA 3AB0C 3LKOB 1EAJA 2EDDA 4NN6C 5LKNA 3P0GB 2VXUH 3N9GL 1D6VH 1FVCB 3SQOL 1ZGLP 3UROR 1MCIA 5KVGL 4PJ5B 2E8ZA 2FBJL 2Z31B 1A6WL 2ED9A 2BVTA 1I3GL 4E41A 3MV11 4P3WA 5EBMA 3RI5K 1KC5L 3CLEH 2RCSL 1PQZB 3B5GA 2VH5H 25C8L 5FOBA 1DBAH 1VGEH 2QSCL 2R15A 1GPOL 3SGKC 5D5ME 1AGDA 2FHCA 5F7EH 1A6AA 2R0WL 5CGYD 2VXTH 5FYJE 1L7TH 4Q7DA 2NY7L 3FQNB 3P73B 5E6IB 1TFHA 4UINL 2OSLA 4ERSH 3P2TA 3VCLA 4I0CC 4HWEH 1RURL 1NCUA 5IR1A 5JHLH 2VLJE 4U7MA 5FYLH 4LSSH 4BUGA 4U1HA 4JY4A 2YMXH 1MCPL 4FQJL 5B8CC 5CAYB 4P2OC 3QG6A 3NOIA 3GMRA 3DO3A 2HKHL 3ARBC 4EN3B 2VB5A 3V5KA 4NSKB 5F7YC 4ODVL 5F1KC 5E9DA 1JGEA 2UZYB 1CLYH 4GQPH 1TZIA 1EERB 3BW9B 3IYLW 1FYTD 3TA3A 2FHFA 5JXED 3D85B 5EC1B 3MOQA 4JFOB 1N8ZA 1EAPB 4ZSOE 4QHKJ 4ZD3L 1LO4H 4PJAA 4MAUL 3QRGL 2C1OA 3MZTA 4BFEA 4XCFL 1TXKA 3BYYA 5FECB 1MCQA 1VEMA 1ZEAH 4NZJA 4CJ1A 5EUOB 2NX5D 4RX4A 5I9QC 3KXFA 3BIBX 3T2NH 2X1QA 2WAHA 3OR7B 4XVJH 3BH8B 4AT6B 1J1OL 5LXGH 4B7IA 4PB9H 4A6YB 5J57B 4LLDA 5I76B 1IE5A 4XVUD 1JNHA 1GZPA 1F00I 3CH1B 3QULA 2XI9A 3BI9X 1A4JB 3V8CA 1QRND 1BM3H 3EOYG 1B3JA 2D7TH 3QG6B 1R0AL 2AJYH 1IC4L 2V2TA 3JWDH 1FG2B 2R9HC 1GYAA 2CLVB 4OD2A 4KTDH 1KJ2H 4R4FL 4ZDHB 2UWEE 3WN5B 2QQKH 1U8NB 3D0VB 2NY5C 4HKJA 1KCUL 3MJ7A 3CPLB 2X1WL 5CEZE 2OJZH 3VXRB 1I8IB 3O6FB 1S5IH 3P73A 1CXLA 1B2WH 4GKZB 3HZMA 2JB6A 2EDXA 5DDHA 1T66D 1FNEA 3HC0A 4ZQKB 1OTUC 1MCFA 4X8JB 2MTPA 1P2CA 1XCQB 4XP5H 4J4PA 1NFDE 4XXCA 3LMJH 5CJXA 1R3HA 1UQSA 3V0VB 5JPNB 1HYSD 3LH2L 3HI6L 3C08L 1MFCL 1OTSD 4P2YA 4LOUD 1OSZA 1MQKL 1RZFH 5JO5A 4DTGL 1N0XH 4ZTPH 4HHAA 4R9HA 2ZCKH 4XTRD 2D4FA 1AI1L 2EYRA 3WE6B 4IIQC 3GJFB 4NC1E 3SDCA 4GQ9L 3LSOA 3H3KA 3DECA 4I18A 5FUOL 3WXWH 1A47A 1MCBA 1AR2A 2ZG3A 2AEPL 3QEUA 2NW2A 1R5WA 4OLYH 2B20A 5TDNA 4PJ8D 4NFBA 5E5MA 4LSPH 4PJ8A 2A1WL 3QB7C 4EUPA 5HSFA 1HHKB 2KUTA 3IFPB 4L3EE 3RJDA 1CI5A 1U8JB 3TESA 2PTVA 4TN9A 1SYSA 2ADJB 3V0VA 1JI1A 4JQIH 1KB5B 2D9QB 2J8OA 3N50A 4HG4K 1MWAB 2GY7B 5KVDH 2CKBH 4KZEL 5BVJB 3BPCB 3RBSA 1H9VA 4PGZA 5I1KH 3GI8H 4M02A 5FUCC 3AREC 5GIRA 4YEEA 5JMRA 1BHGA 3PWUA 5B39B 4CNIA 1X7QA 3OSKA 1FL5B 1I1CA 3VXMB 3JV4B 1SEQL 4NC2B 2C3WA 4KV5E 1KFAH 3OV6A 4CN6A 4Q2ZB 4RGOH 1PZUB 2VDMH 4KKCD 1R3LA 2QQLH 1IARB 1JP5A 3CFBA 3DX8B 4OD2B 1IGFH 4YDVA 2NTFA 3EDJA 2R1YA 4QF1A 1MI5A 2VWEC 1KELL 2BX5A 3CX5K 3UYRL 1WFNA 3TVMB 5I6XB 3NA4A 5DHXB 2EZ0C 2P5WE 4ZNEA 3UTZA 2O61B 4YPGB 4NQXA 3RUGB 3X3FH 3TFKD 5HI3C 2GYSA 4FTVD 1JTOA 1ACZA 4J3VA 3WN5C 3FQWA 1LO5B 3BP7B 4HIEB 3QEHA 5EOTA 3IDMA 1QRNA 3FQNA 4RAUB 5BS0B 5I1JL 2J2ZA 5E24E 5F7DB 1P4IL 1DEEA 2Y7QB 5SV4A 4LEOB 3T0AA 4CADA 4QRRD 3LEVL 3LS4H 2X7LA 2OL3A 2J6EH 4JFOA 4KQ3H 3MREA 2BVOA 1YEJH 2FH8A 1ZE3C 3IU3A 5I1LB 1KCVL 3NA9L 1II4E 3MRIA 1HDMA 1HZHH 5HGDB 4LAJH 5ESVB 3OHXA 5K9JL 5DK2A 3B6SB 2BMKB 3SO3B 2YEZA 3I75B 1CFQA 3HRPA 4U1NB 5KOMC 1OLZA 4P3DB 5T3XH 4ELME 1YY9D 5DURD 3GBNL 1NGWB 2CDFA 2XZAH 1L9NA 1BD2A 4XH2B 3B9KC 3FQXA 2ZUXA 4MB5A 5GZOD 3PIQA 1AHWB 4TVPL 5E6IA 2H1PH 4KKAC 3MV8D 1HHJB 1Z9LA 5JUEH 4DN4L 5DJZA 3MLUL 3QQ3B 1I1AC 1IQWH 2NY6D 5HHNB 1IL1A 2R0LH 2I9TB 4M6MH 3LRSB 1FFPB 5CILH 4KK6D 1NDGB 3CSYA 1LDSA 1T03L 2Q7YA 3S35H 3MRRB 2GJJA 4UT7H 3D3VB 2AXGB 4X98B 5C0GA 2BP3A 3LVEA 3QFDB 3V2AR 3QIBC 3G04A 4F3FA 1X5FA 1NFDA 1KF9B 4YHOL 4MXVE 2GW5A 2H8PA 3LDBC 3LRSA 4NYLB 3VXPB 1R3IL 4JM2C 3RWGB 5ENWB 1IQDB 4LHQB 4CMHB 3SGDI 4B7LA 3VA6A 4IRJB 1F4WH 3ET9F 5GS0L 5EBWA 1X3DA 1UXSB 1WK0A 3VMNA 1MCWM 3TF7C 2C4FU 1FL6B 1NMCC 4FQ1H 4JFFA 4MNGB 5IHBA 1WT5C 1QVOA 2VDQL 1EFXA 3T0EE 3U7YH 2R8SL 2CK2A 3QDMA 1QBLL 4JFPA 4TUOA 3B6SA 5HHVH 1ZEAL 1ERNA 2IWGA 5FB8B 2W92A 1VERA 3O9WC 3DETC 4X9GA 1UH4A 1UM5H 4ISVA 4LDEB 5T5FH 4PGCB 4F37K 5SX5K 2BJMH 4U6HB 2WUBH 1H3PH 1Z9SA 4JM2F 5I0DA 3QXTA 3MLTB 3K0WA 3MRLB 3QPXL 5EU6D 1DUZA 4X4XA 4JG1L 5L6YH 5IBTL 1NL0H 3BD3A 4JFDE 3NN8B 2GIYA 1U6AL 4KRPD 3IS0X 1YEHH 2APFA 5DVNA 3QIBD 2MMXA 1JHLL 5TGBB 4WW2F 4DGVH 4LVOC 4ZTOH 1XZ0B 4JEGB 5IFAL 4N0FB 3BP5A 4PY8J 2FJGB 3GK8H 4KKNA 4Z77B 3CSGA 3BESR 4OLVH 2EEAA 1ZVSA 3K8MA 1CGUA 4BFIA 1RJYB 1DBMH 5F7EL 1NAMH 3CFCL 1CD9B 5TGBA 25C8H 5FO7A 2BNUA 4OQTH 4M1DH 1LE5B 1E4WL 4X6DA 4QRPD 5ERWA 3ABZA 4XHQA 5I71B 1RVFH 4XP4L