1KUTA

Structural genomics, protein tm1243, (saicar synthetase)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
213
Chain Sequence
b'TKIVKVTGDYALLEFKDDLTGKGSICAETTAILMKYLSEKGIKTHLVEYIPPRTLKVIPLKMFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPMVCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANFELWDIKYEFGLDKDGNVVLGDEISPDTFRLRKKGEIFDKDVYRRDLGDPLKKYREVLELCRSLNSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Structure of SAICAR synthase from Thermotoga maritima at 2.2 angstroms reveals an unusual covalent dimer.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, ligase
total genus 58
structure length 213
sequence length 224
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1kutA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1kutA02
2ITYA 4OBQA 1JKLA 4YLJA 2PWLA 3G6GA 4BI0A 5AUZA 4V05A 4ZIMA 5TKDA 3U6HA 3HBLA 1DV1A 3ZLWA 4L42A 4EHEA 2R7KA 3KU2A 4XOZA 3ZLXA 1MRVA 5E1SA 3IG7A 4ASXA 2WU7A 1YHWA 2CPKE 4IQ6A 1EH4A 2FB8A 2R64A 1U46A 3QQUA 3GCVA 2BPMA 3DQWA 3LJ0A 3WZEA 1PK8A 2YM8A 3ORPA 3BLRA 5EDQA 1U54B 5TF9A 4HVHA 3CCNA 3K2LA 4Y5HA 1WR2A 3A8XA 1SVHA 3DCVA 3FY2A 3C5IA 4OR5A 3VBQA 1XH8A 1OBGA 1PXMA 2PK9A 2X6DA 3CQEA 3KA0A 3LCKA 4ZTHA 3V5WA 1H01A 4MCVA 4A9RA 5HNIX 3QTRA 3ALNA 5FGKA 3V3VA 5JFWA 2WMXA 3S00A 3VBVA 5HCXA 1QPDA 5C4LA 3KB7A 5IA2A 2YZLA 2W6OA 3DS6A 3ORZA 4EOOA 4AT3A 2B7AA 2VTNA 3EN5A 3O51A 4IVDA 3EMGA 5DHJA 4FT0A 4G34A 4QYYA 2W4OA 3AGMA 3BGPA 5FXQA 3VUGA 4A9YA 4YUQA 5B2MA 3HMMA 4B7TA 3SRVB 1H25A 3QTSA 5AV0A 4E26A 4FKIA 2W6QA 4NCTC 4O86A 3FMKA 3MPAA 4NZWB 4UZHA 1CQIB 4GL9A 2C0TA 4PQNA 3OW4A 4EK4A 3JVRA 2E9NA 4Y8DA 2GHGA 1W7HA 2J2IB 2HWOA 1GNGA 2J0LA 4X2JA 4UN0C 5JH6A 1EUDB 1PW2A 3TXOA 1IAJA 4QQJA 2C1BA 3GXLA 2XEYA 3IKAA 1YQJA 4LOOA 4ZZMA 4HNVA 1DV2A 3GOPA 3HUBA 2VWZA 5DBXA 2RG6A 1JDEA 5AJQA 4R3PA 4ITJA 4TYEA 4BIDA 2P0AA 2FO0A 3CTQA 2OICA 3P1AA 4JLCA 2X4FA 3EKNA 3RTPA 3HB9A 3DTWA 4C35A 3Q4CA 3MSSA 2PUNA 4BBFA 1ZZ2A 3ACKA 4X6QC 3OXTA 5EM7A 5H8EA 2ERZE 3OFMA 4MF1A 4BF2A 3QTXA 3R6XA 2XEZA 3OBJA 4LRKA 4CMTA 5KKNB 1KV2A 4AN2A 3D5XA 4EOKA 3UYSA 3W2PA 5JN2A 4NJDA 2OU7A 3UOKA 4FA2A 5D12A 1U5RA 4LV8A 1BKXA 3NLBA 2EB3A 4TYHB 4WG4A 3W10A 4E1ZA 3KKVA 3EN6A 5CAUA 5GHVA 5C01A 5BNJA 2B52A 5EFQA 4RJ5A 3ZFXA 4MEDA 2YEXA 2YAKA 1WZYA 3C4CA 3LFFA 4M69B 3OROA 4UZDA 4G16A 4J96A 4ZZNA 2QOOA 5FXRA 1LEWA 3TTIA 2IJMA 2WELA 5E8TA 4E5AX 2J51A 3HAVA 5I9XA 3A60A 3QRJA 2GQSA 2UVZA 2WFYA 2OH4A 2CN5A 4WRGA 4MBJA 4X2FA 2VAGA 4W4XA 5DLSA 3DFCB 5FG8A 5HGIA 2FVDA 4D55A 2F9GA 4AACA 2C68A 3HVCA 3OUNB 4QP8A 2CLQA 5AAGA 5L6OA 3RINA 3AMYA 4AW1A 2YZGA 5J1VA 2NUAB 1FINA 3UOJA 4R5SA 5FEDA 4OTFA 2HIWA 3AC4A 4QQCA 3R01A 3A7FA 3PFQA 3W2OA 2X39A 3EN9A 3F9NA 4EZ3A 4FODA 3VPBA 4G1WA 1PKGA 2IZRA 2W6ZA 3TDWA 2BKKA 3MVMA 3ITZA 4FV7A 4IZYA 3TCPA 4PP7A 3DXQA 5JQGF 2FSOX 3TV4A 3DXPA 2VR1A 4M3QA 1FGIA 3CJGA 3ZONA 3GU7A 2C6OA 5LCJA 4FZFB 2RFSA 3MY0A 1YWVA 3WF9A 4O0YA 2R3KA 2FPGB 2JC6A 3BHHA 3EOCA 4PTGA 4YHFA 1YOMA 4F64A 1P5EA 2C00A 4QSHA 4DFNA 1CKPA 1GY3A 1R78A 3ORNA 1J3HA 4BDGA 3U9CA 3M42A 4AXAA 2I1MA 4YNEA 2UW5A 1FGKA 4FK6A 3F69A 4HYIA 3VS7A 2QOKA 2XBAA 4LMNA 4F6SA 4RQVA 4ZMFA 2YIQA 4QNYA 3QBNA 3UBDA 1P4OA 2BILB 2C0IA 2J7TA 5CQUA 4USDA 2BIYA 3FLYA 4ANQA 3CC6A 3K54A 4WD5A 1PXNA 1ZYJA 2OF4A 4B6LA 2C0OA 2G01A 4C02A 3BLQA 2E2BA 4XG8A 4AZFA 4BDCA 4FG7A 2ITNA 3EFLA 5EM5A 4YBKA 5K3YA 5LQFA 1YOLA 4MWHA 5TOZA 3VBWA 3ETJA 2Z60A 2CGUA 3NUUA 4RVKA 1VYZA 3L1SA 5LYJF 5EW8A 5HTBA 3RNIA 4BYIA 4ACGA 3NAXA 4M14A 4RWIA 2CGXA 2J50A 1OVEA 4DEIA 4EOLA 5BX0A 4FUYA 5K9IA 2PYWA 1R0EA 1HCLA 4FVQA 2V58A 2PL0A 4FL1A 5HVYA 1TQIA 2NRUA 2VGPA 1XH6A 3AGLA 2XMYA 4L6QA 3MH1A 3PJ2A 3PXZA 2JFMA 3PA4A 4Y5QA 5E7RA 3A2CA 3SLSA 3UQFA 4TN6A 4EWHA 4PMPA 1IRKA 5BVNA 2HZ4A 4BGGA 3TWJA 2QHNA 3NYXA 1BL7A 5KMJA 3UMXA 2XKCA 2GPHA 4RRVA 4ZTQA 3QGWA 3U4WA 4UXLA 4AN9A 5IUHA 5C1OA 4GCJA 2YIWA 2UZBA 3WE8A 3BBWA 1EZ1A 4OTGA 3C1XA 3ETHA 2W99B 2CGVA 3I1AA 3SW4A 5HU3A 3A8WA 4F0GA 5F20A 4PX6A 2VTTA 3VQHA 5KHXA 1OL1A 5IUIA 5C8NA 3FKLA 4YPDA 4E6AA 4F9BA 5KCVA 2R82A 1EHIA 5KBQA 5DNRA 4GVAA 3ZBFA 3TT0A 4HOKA 3LCSA 1JKSA 4BTMA 4D4RA 2VTSA 4WG5A 2PVNA 4OTQA 5AX9A 3FMDA 4D4SA 4R7IA 2W0JA 4M13A 5L8LA 4XG3A 4PNIA 2QI8A 3W33A 4EK5A 2CNUA 4YO4A 5HIEA 3DK3A 4DFBA 3GT8A 5ANKA 5BYYA 4F1OA 4RBLA 3MW1A 4GU6A 5AP0A 1TVOA 2WEIA 4EOPA 5M4UA 2WMSA 5C27A 4AA5A 2XD4A 2YL2A 2EXMA 4ITHA 4BGQA 3IGGA 3D14A 3ZSGA 4RJ7A 3U9TA 5AUUA 3CIKA 3RHXA 3UP7A 2R3PA 1KWPA 5BPFA 1T36A 2YRXA 5HI2A 2XJ1A 4PNKA 1KC7A 3MIAA 4UV0A 2CDZA 4QMOA 5HE3A 3VUMA 3MWDA 5IQIA 5KMNA 2YJRA 3DJ5A 4OT5A 5CEQA 4YPSA 3QTQA 3TJDA 2JDTA 3QWKA 4YJSA 5CAPA 5A3XA 3PA5A 2OIDA 3ZRLA 4B8MA 2W17A 3P79A 2BZHB 5DE2A 3I5ZA 4S32A 3VF9A 3ZEPA 1PHKA 3GB2A 4EHGA 4UX9A 4QP4A 5CNNA 3GFEA 3RHKA 3LFAA 5KX8A 2UZNA 4M67A 2XRWA 4WT6A 4IZAA 4CFFA 2PBZA 3W2QA 2VPQA 2ZM1A 1M2QA 1YDRE 2C4GA 3HV5A 3R2YA 4N0SA 3SHEA 2F2UA 1RE8A 3MS9A 2IVSA 3LXNA 1Z2PX 2HELA 3FL5A 1JLUE 1UVRA 3HECA 3NVMB 4HVIA 1F5QA 1FMKA 3R21A 4IC7A 1MRUA 1G8SA 4FZ6A 4L52A 5E8XA 4GIHA 5TR6A 3VRZA 3B2WA 4U45A 3ZC6A 3A4PA 1IOWA 4CD0A 3ANQA 4O83A 2HZIA 3RMFA 3I12A 4E4XA 4FVPA 2YS7A 1OUYA 3HMOA 5DR9A 5DR2A 1KOAA 3AMAA 3FSKA 2W1EA 4C0TA 3FLQA 4L68A 4CMUA 4CTCA 5AP3A 4YR8A 5AP4A 4EKKA 4JNWA 3I60A 3R1SA 3DNEA 4X7QA 2P55A 3G5DA 3DLSA 3CD3A 3LW0A 1Q3WA 1ZY5A 4CRLA 4IM0A 5T3QA 3PY0A 5AV3A 2HW6A 1GSAA 4FSQA 4IX4A 2R7LA 4TL0A 3NNVA 3PPKA 3NNXA 3VS6A 3DQXA 4J98A 2J5FA 4L00A 3R7OA 4Q9SA 5M57A 1PXPA 1IEPA 3V4SA 4HVDA 3FMJA 4JBPA 5E8SA 5EQEA 3U9NA 2VTJA 3F88A 4MKCA 4FIGA 1ND4A 1ULZA 4O7SA 2ONLC 3UYTA 3HA6A 4L3JA 5AAEA 5JH7F 1JDBB 3FYJX 5BMSA 1PX2A 3EQIA 4ZZOA 4MTAA 3ENMA 3V8SA 5CAVA 1K9AA 2QOHA 1H08A 3HV4A 2R9SA 3R00A 1JNKA 1J91A 1U5QA 4ARKA 3KXXA 1M2PA 2O5KA 3FZSA 4FKRA 4C4GA 3FZTA 3IO7A 4ALVA 2B9FA 3ACJA 2UVYA 3AD6A 2WMQA 3EZRA 3GUBA 4RWKA 4XG7A 3ULZA 3WYXA 3H30A 4F08A 2BUJA 5L8KA 1RQQA 3WF7A 4QMPA 4TKSA 3SXSA 5B7VA 5HE1A 3FXXA 1E1VA 4FSTA 2PMOX 4TZRA 2V5AA 2VN9A 3EIDA 4DEEA 3RAKA 4GT4A 1YI3A 4IB0A 4WNMA 1Y6AA 3EFJA 3KXNA 3PVWA 3LM5A 3OUUA 3WO1A 3OUZA 2WTVA 3DPKA 3N6RA 3PY1A 3GU4A 4H05A 4EH5A 5C8MA 3R9HA 2OJGA 3LVPA 3HMIA 4K11A 4XUFA 3T3VA 4IH8A 4BBEA 5CF6A 3TN8A 1H1RA 2DUVA 2X9FA 2XCHA 3G51A 4EJNA 3JY0A 3TIYA 4FTIA 3TIIA 2FSMX 3V4ZA 2JDRA 2QNJA 4ZTNA 4I5CA 3ZMMA 2WMUA 2UZEA 5G1XA 1VBHA 4M0YA 3DK6A 2WO6A 1ATPE 4HQ6A 4OT6A 1PRYA 4YJ3F 5KBRA 3D15A 4FIFA 5BYLA 2I0HA 1V0PA 4QMVA 3VNTA 4CG8A 5M56A 1GSOA 5DT3A 4LL0A 3IW7A 3HV6A 3FUPA 3GCPA 4H3PA 1YDTE 4G2FA 1W0XC 4V0GB 4BCMA 4HVSA 4PTCA 4EOJA 3ZYAA 4FTRA 3OC1A 3R9OA 3VBYA 5HIDA 4K33A 3BU3A 3R8ZA 3DF7A 1Q8ZA 4ZSLA 3NSZA 4O0SA 3R1YA 3OW3A 4O7VA 2ZMCA 4S2ZA 5LVLA 3NYOA 5TO8A 5FBOA 1W93A 5CTPA 4R77A 4BCOA 2XBJA 3OCTA 4RT7A 5AIRA 5JQWA 2WMTA 3P08A 4JQEA 2HOGA 5ANOA 4DCAA 4R78A 5FXSA 1XJDA 3RV3A 2A19B 2V22A 2VX1A 4OGRA 4FIJA 1WAKA 4RJ3A 2XNOA 2B9IA 3UZPA 4ZTSA 4MBLA 2WMVA 2RL5A 3TZ8A 4K2RA 4ACDA 4C36A 5AV2A 1GLVA 2UZLA 4Q5HA 2I87A 2W5HA 4FFNA 3NUXA 4MNEA 3VMMA 3HMPA 5ANGA 3PIZA 3K5HA 3QZHA 4BCQA 1F3MC 4O2ZA 5EK7A 1ZMVA 3BHUA 1XR1A 1VYWA 3NR9A 4NSTA 4R3CA 3VS2A 1CDKA 1I44A 1UA2A 4XG2A 3A7GA 2R0IA 4L53A 3LJ1A 3WOWA 3CS9A 4C4HA 3V8WA 3TNQB 3EN7A 4O21A 2B4SB 4HYUA 5DMXA 4XP3A 2VWVA 3KF4A 2YITA 4X2KA 1E4EA 3RAWA 4N6YA 4FEWA 4MBIA 4ZI7F 4EZ5A 4Q5EA 5EI6A 3WZJA 4DC2A 1G8AA 5C4KA 3H9FA 3R73A 3G2FA 2X0GA 2QO9A 3RVGA 1Q8WA 4BCFA 3V6RA 1WBSA 4ZLYA 4XRJA 2GQGA 4I4TF 1QPEA 3MA6A 3ET7A 4YO6A 3VIDA 4D28A 4F4PA 4RX9A 4C62A 1QMZA 4LGGA 2C6EA 4E4LA 2YWVA 1Z5MA 1YHSA 4FNXA 4EOIA 4YLKA 5CQWA 3R8LA 4KAOA 3E63A 4E4TA 5DPVA 4FR4A 2ZMDA 3KN6A 1LUFA 5E8VA 4IM2A 5H8BA 3CD8A 3WO0A 5LARA 4KBKA 3AX6A 4O0XA 3TNWA 4YTCA 4EYMA 3OTVA 2ERKA 3PVBA 1UU9A 5GINE 2ZB1A 4QP2A 3NYNA 2NPQA 1T45A 3QAME 4X3FA 5HNGA 4MV6A 5FBNC 5KMOA 3V5LA 5HBJA 4IX6A 5IA1A 2EU9A 3L8XA 5E91A 2HZ0A 5F9EA 3DBCA 3UTOA 5IYZF 4EORA 5H2UA 4ACCA 2Q83A 4FNYA 2C5XA 4YZNA 4HCVA 4M68A 4J97A 3MH0A 4M0ZA 3P78A 3PSBA 3WARA 2JLDA 3MJ1A 1PMEA 2UZUE 5GJDA 3OXIA 4BDHA 1FVTA 2FPIB 2C3IB 5IUGA 5HD7A 4A7CA 5BUIA 2HZNA 3GFWA 4FT3A 5DIAA 3GCQA 5EHLA 3ZSIA 3O2MA 1E1XA 3U54A 1J7LA 5EYDA 3S0OA 5IPJA 3OWJA 4B4LA 3A99A 4NUSA 5AWMA 2QG7A 3TG1A 2ZDUA 5IA3A 2WOUA 3CPBA 3ZBXA 4BGHA 4QTEA 3DGKA 3ORTA 4FV3A 4JIAA 3U4UA 5AIKA 5ACBC 3U8WA 2Z7QA 4BICA 3Q6WA 3D94A 5HVKA 2G1TA 4QMYA 2I80A 3WNZA 5K4JA 1TKIA 5EOLA 3RPSA 2FYSA 3I79A 3R9RA 2YHVA 3UDBA 3HLLA 4PRJA 3I81A 5IDNA 2YIRA 4I93A 2QOIA 1KSWA 1WVYA 2X4ZA 4BI1A 1QPJA 2XIXA 4RC3A 2C6TA 5EOBA 3VRYA 3DB8A 3CJFA 4IHJF 4L8MA 3EQDA 5A54A 3W18A 1I7LA 4IC8A 5IQFA 1I09A 2ZJWA 5A14A 4C3RA 3ANRA 4FEUA 4JXFA 4XEYA 4JVGA 4YNOA 1MRYA 2J5EA 2RF9A 2WU6A 5AUWA 4GUBA 3R02A 4HJOA 2IW8A 4E4MA 3V5JA 4EQMA 5KKRC 2VX3A 3KMWA 5LA6F 5E1EA 4O2PA 4JS8A 3TINA 3KCFA 3C4XA 5HKMA 2B9HA 4FSWA 4LFIA 3QC9A 4IX3A 1OGUA 2JDVA 4GUEA 3VW6A 3F2RA 3JYAA 3DKOA 5BMMA 4ERWA 4CCBA 2YJSA 3FKNA 4BBMA 1Q5KA 5LOHA 4FFMA 3ROYA 3L9LA 1B39A 2BRGA 3O8PA 3O7LD 5L3AA 3RJCA 4FFRA 4IADA 4RG0A 5C8KA 1VKZA 4V04A 2SCUB 4XG4A 2J0IA 3WE4A 1AUVA 3QHRA 3FKOA 2JEDA 3RUPA 1OL7A 3E5AA 5CAQA 1Z9XA 4S33A 2IZSA 4Z7HA 3GU5A 2VTLA 3QC4A 5DG5A 1OKVA 4BCJA 2ZV7A 3RPVA 1MP8A 2J0KA 4TNDA 1H4LA 5KUPA 4DFYA 4GS6A 2X8DA 3ZO3A 3ETAA 4WG3A 1DAWA 3JXWA 4G17A 2EB2A 4AW0A 4ZLOA 3CXWA 4IW0A 3Q4UA 4ZTLA 4A06A 2WYOA 3C0HA 2QOQA 2ITZA 3B8QA 3UQCA 4HGTA 1OPKA 3JRXA 3G33A 2GCDA 3MVHA 4B9DA 3AC8A 1ZYCA 3RFCA 3A7HA 3FI8A 2QVSE 4XBUA 4ACHA 1ZYSA 2PVMA 3COIA 3D83A 3LOKA 3PP1A 4CKIA 2VWWA 4DEDA 4YAJB 3PWYA 3ZH8A 4DLKA 3V01A 5KE0A 1H28A 3NUNA 4J95A 3FPMA 4K9YA 2GSFA 4QMNA 3E93A 4ORKA 5EM8A 2C6IA 4FV6A 4O7TA 3C4FA 2BDWA 4FEXA 3VC4A 1W98A 1UWJA 4JG7A 3AC3A 4O0VA 2VNYA 4CT1A 3HRBA 3L9PA 4OTHA 5CYIA 2YW2A 2XM9A 3CBLA 5IEVA 4N70A 5KZIA 3I5NA 2OH0E 5FRIA 1YOJA 4ZMEA 4EJ7A 1OECA 2CN8A 2W9ZB 1FBNA 4HNIA 4CFNA 4GSBA 3WF6A 5IG1A 4FOCA 2XH5A 3W32A 4EHZA 3MH3A 3OCBA 4FE2A 5JVLA 3RZBA 1OPJA 2X7FA 3BE2A 3Q2JA 3BPRA 3R5HA 4W4WA 2PE2A 2PMIA 4FZDB 4AZSA 2OLCA 4M15A 5BMVF 5KMIA 3RAHA 3NUAA 4QMMA 4ZHQF 1JBPE 4IAYA 2BRMA 2CKPA 2OFUA 4PP9A 1H24A 3E88A 3IDCA 3IQ7A 4L7SA 3V8TA 3BKBA 4DCEA 3K5UA 5CF5A 3DBFA 1VJYA 5KKRB 4FV4A 4QP6A 3TTJA 4BRXA 5L8JA 5GIOE 2DLNA 4LUEA 3PA3A 3UIBA 4BR3A 3NCGA 2VZ6A 1WBTA 4EK8A 2X2KA 2I0YA 4G5PA 2QU6A 3KVWA 4PWNA 4E5WA 3MESA 4FKJA 3MY1A 4XJ0A 3DBEA 3R8PA 1PMNA 4CKJA 4MA5A 3UJGA 3IDPA 3PPJA 3E62A 3OF0A 2DQ7X 4QO9A 4RFYA 2GNJA 4UWBA 4YLLA 4IACA 2XK4A 5EYKA 5IH4A 1GAGA 2ITVA 3D5WA 2ITOA 3LFBA 3UODA 2IG7A 2PVPA 3TQTA 5ETFA 2XJ2A 2BFXA 3FMMA 2QC6A 4K8AA 4NTSA 3WIGA 3OMVA 3K3PA 4DIMA 4QP1A 4E20A 4FKVA 1R39A 4DH3A 4DEGA 4XRLA 2HXLA 2XS0A 3W8LA 4FYNA 5EM6A 3T9TA 5FNVF 4I5HA 1ZLTA 3EYHA 3LFEA 3QCYA 2OK1A 1HOWA 4EH6A 1KEEA 4NT4A 2ETKA 3ZUTA 4C4EA 4ENYA 1B6SA 3D2KA 4U43A 2B53A 2LGCA 4DAWA 1CQJB 4U97A 4IIJF 4RZVA 4O2BF 2QLQA 4E6CA 3W2SA 3MN3A 4NFMA 4BY9E 4F63A 3QD4A 4M84A 4ZK5A 3ULIA 4FKSA 5CS6A 3AT4A 5D8DA 4I24A 3UIXA 3SDJA 4BI2A 1BNCA 4HGLA 2ZV9A 1IA8A 1S9JA 5CT0A 3COMA 3R7UA 2OJ9A 4GG7A 4LQMA 4QYHA 3IW8A 5J95A 2YCRA 3QD0A 4AQCA 4FSUA 4TWNA 1AQ1A 2Y7JA 3MTLA 3OY3A 4YSJA 3ID6C 5KHWA 3MVLA 4RIWA 4AP7A 2BAKA 4RWJA 4RX5A 3PSDA 2FP4B 2NU7B 2F7EE 2X7GA 5JT2A 4XLIA 5F94A 3ZLSA 2UW7A 4PY1A 4BCKA 4O4JF 3CE3A 1FOTA 3GQLA 4U80A 2J4ZA 3BBTB 5CSWA 4MV1A 4CKRA 3BYVA 5CI6A 2GTNA 4KKHA 3UFXB 1PYEA 2CMWA 4P5ZA 3VVHA 4FV8A 1WVWA 2OZAA 2X2LA 3QX2A 3TI1A 5HESA 3DB6A 3GLKA 5A4CA 3ORMA 5I4NA 4EHVA 2ZVAA 4R6VA 3VS3A 2GHLA 3D7ZA 5BVKA 4USEA 2H8HA 4QMTA 5ITAA 1GIJA 4FNWA 2GLTA 2FB9A 1GZOA 1YDSE 4JG8A 4BCNA 3LKMA 5KMMA 2QODA 2GHMA 3MPTA 3PE1A 4B8LA 4MV3A 4G6OA 5G6VA 3QD3A 2VWXA 4I4EA 3II5A 2CCHA 1SCUB 2QK4A 4E6QA 1LR4A 4X0MA 5CAEB 2W05A 4J53A 3ZRKA 4WOVA 4DTBA 5JFVA 3EZVA 5KZ0A 4MAOA 3R2BA 2UW4A 2W1GA 4EH2A 4D2RA 1ZYDA 3S2PA 3VBXA 4JRNA 4GMYA 5EYCA 4IAAA 3M11A 3O8TA 3NW7A 1R3CA 4P4CA 3I7CA 3COKA 5CZHA 5I9UA 4IBMA 2XZSA 3IOPA 2PPQA 4LM5A 2OG8A 2QHMA 3DK7A 3KXHA 4IVBA 5L2SA 1URCA 1RW8A 3TV7A 4BKJA 2YDIA 3LCDA 3AT2A 3UC3A 3ZLYA 3F2AA 1KE6A 3HP2A 4XCUA 5HX8A 4YMJA 3SX9A 4LRMA 1WCCA 2XA4A 3G15A 1OUKA 3PWDA 2JITA 2F57A 1CKIA 2OKRA 3BV2A 4FV1A 5AA9A 2VTIA 4O7NA 4Q2AA 3A62A 1UV5A 4CNHA 3AC2A 4DEBA 4IHPA 3TUBA 4AZWA 1OKYA 3JY9A 1FVRA 4BZOA 3R83A 5FTGA 4M8TA 2IVVA 3HP5A 2C5OA 3UO4A 4EBVA 1XO2B 4U44A 4EH8A 2BZJA 2IPXA 3RGFA 1W8CA 5JEBA 3Q2MA 4BZDA 4YJNA 2NRYA 3NIEA 4MNFA 3PVGA 2JBOA 4IZ5A 1JSUA 1A48A 3KALA 4FL2A 4ALWA 3AT3A 1SVEA 2XIKA 3DXNA 4GFMA 5DN3A 3LLAA 2C6KA 3QKLA 5IQGA 2OSCA 3KK9A 3GCUA 2JDOA 2Z8CA 3AMBA 3FC2A 4KA3A 4J99A 5CSVA 3TDVA 3GGFA 4FYOA 4ZP5A 3MJFA 1XKKA 4NFNA 2P0CA 4F09A 4BCIA 5I9WA 2W4KA 3FQSA 4X2NA 2QOLA 4WHZA 2OGVA 2UVXA 3PE2A 2X1NA 3L9MA 3CTHA 2PZPA 3UZRA 1SVGA 5J9LA 3PIYA 4BIBA 2CKQA 4X3FC 3VS5A 2Y6OA 4MWIA 3SE7A 3EQPA 3R7YA 4UBAA 4AT4A 4JDJA 1JKTA 4Q9ZA 5F1ZA 3FQEA 2YACA 2C3LA 3NIZA 5DA3A 4O4IF 3O8UA 4MXZA 4UWCA 5ANJA 5K5XA 2PZ5A 4HNFA 3RM6A 4YP8A 3UGCA 2PVKA 4ENXA 4F9CA 5CENA 4XLVA 1PXKA 2VU3A 2Z7SA 3LMIA 4MD8E 4RIXA 3UC4A 4FU0A 4GW8A 5J9ZA 4YJRA 1SZMA 2GFSA 3QHWA 4L67A 2VX0A 2XYUA 5CXHA 3ZM9A 3A61A 1CTPE 2W4JA 3R0TA 4DT9A 4DGNA 2GPWA 1JPAA 1M6VA 2UZTA 3UVQA 3PXFA 3KAJA 4RVMA 2WMRA 5AV1A 1OBDA 4CCUA 1CKJA 2E9UA 3F3ZA 4TNBA 4G31A 4U6RA 3WYYA 4YZMA 4Y83A 2IN6A 2CGWA 4O7WA 1NVSA 2HYYA 4NK9A 3QA0A 5LCKA 4GU9A 2F49A 5CASA 2OF2A 5H3QA 2QG5A 1KV1A 3OTUA 3FLZA 4FEVA 4MNEB 4F0IA 1JWHA 4FT9A 4YZCA 5EDRA 2UUEA 3EB0A 4L45A 3TV6A 4BDDA 1YW2A 4FIHA 4PMSA 4C61A 2OJIA 5LJJA 2UV2A 1U54A 2XK7A 1C3OA 3QUDA 4R7BA 1XWSA 4TWCA 2YAAA 2AUHA 3AD4A 3IS5A 4BCPA 4K77A 1V0BA 3QYZA 4F9AA 3RPRA 5K4IA 4WNPA 2V59A 1QPCA 3KAKA 2CKEA 3LM0A 3H0YA 5HX6A 1E4EB 2GQRA 3PZHA 4M7IA 4K0YA 5C8YF 3MYGA 2UZVA 3IW4A 2R3HA 2PHKA 3B2TA 4EOSA 1XBBA 3QFVA 2ITWA 1KOBA 2AC5A 2C47A 1XH9A 1KJJA 1Z2OX 4FOBA 4YHJA 3SRVA 3OG7A 4FG9A 3JZIA 4FEQA 4AZEA 1IOVA 2BIKB 3NVKI 1J1CA 3F7WA 4G5JA 2F7ZE 5ACKA 5I9YA 1H8FA 4LMUA 4PDSA 3VULA 5HO7A 5IISA 4AF3A 3W8QA 1WBVA 4AZTA 4IVAA 4CV9A 5BQ0A 4QYEA 3QRUA 3DAEA 3UIUA 4RVLA 4DG3E 3PTGA 1OL2A 3VUKA 3C0GA 4NKSA 3QUPA 4D4VA 3BGQA 2PZRA 4L01A 2PVHA 1B6CB 4FKTA 2BMCA 2GNFA 2YZMA 3U6IA 3BX5A 4DFZE 4W4YA 3NWWA 2ZDQA 3PDTA 3JRWA 3PJCA 2JDSA 5IQEA 3K5VA 3WF5A 5EI2A 4C4JA 4OTDA 2VD5A 4F1MA 1L8TA 5HG7A 1KE5A 1NVQA 3T9IA 4I0RA 4P90A 2HENA 1ZARA 4E93A 4X3FB 4FI1A 3BV3A 4DTAA 4AA4A 3C4EA 1OI9A 2BKZA 2I40A 3ZOSA 2QU5A 3C4WA 2W5BA 5T68A 4ZLZA 3GC7A 3HRFA 3ORKA 4HR7A 3E7OA 3R7EA 1V1KA 4AS0A 4XS2A 2JKOA 2OWBA 4ZJIA 1B38A 2G15A 2E9PA 2RFEA 2GS2A 4IDTA 4NJ3A 3TACA 4CZTA 2R3JA 5AMNA 1J7UA 4CZUA 2QKRA 3CQUA 5M07A 2B54A 5CWZA 5AUTA 3R7IA 3GCSA 1UU3A 5AFVA 4WBNF 2Z02A 4ZSEA 3PG1A 4WNOA 3WZDA 4FTMA 1PXJA 3E8NA 4FKGA 4QTBA 3FL4A 5GJFA 3Q3BA 3Q96A 3BWFA 4ANSA 4XNEA 3R63A 3HZTA 4L1KA 2JIUA 3EKKA 3NNWA 3QZFA 2OIQA 4O91A 3WZKA 4FSNA 4NYEA 4EKLA 2H34A 4FTUA 3NX8A 4JRVA 3WZUA 1Q8TA 2QR7A 3EQRA 3POOA 4XH6A 4CFMA 1DAYA 3BQRA 3QQHA 4IM3A 4BB4A 3VS0A 4DLJA 3LMHA 5CEPA 2CHLA 4XX0B 1M17A 5LVPA 3FMHA 3NNUA 2XF0A 3Q4ZA 5K5NA 2R87A 4WRSA 4AN3A 4UWYA 4EH7A 5E8UA 5JRQA 3AC5A 5GIPE 4CSVA 2ITPA 3MTFA 2PSQA 2W1HA 3ATTA 4LL5A 4BCGA 3SG9A 5JK3A 1C30A 1H1WA 3LFDA 2C1AA 3PZEA 4FSMA 4CTBA 2YYAA 2AC3A 1GIHA 3BGZA 3Q9ZA 4L9IA 4I1ZA 2FSLX 1FVVA 1DS5A 5FTOA 4BN1A 4N57A 3B8RA 5KX5F 4U79A 2V5QA 2ZM3A 3E8CA 4JQ7A 3GOKA 4AT5A 3R5XA 4B99A 4YBJA 4G9CA 4IB5A 1VR2A 4MVFA 4DGLC 2BVAA 1O6LA 1CE8A 4F99A 3GC0A 5DRBA 1L3RE 3DA6A 4O0WA 4MQ1A 5D11A 2UW6A 4XOYA 5HZNA 3TZMA 5IQHA 3WI6A 5M51A 4D1SA 5IZFA 3IOKA 2ACXA 4FVRA 3RCJA 5A9UA 1YXTA 4CMOA 5M53A 2PULA 4KBCA 4NM0A 1PMUA 4PMTA 5H80A 3UPZA 5IEXA 3DBQA 3UPXA 3ZC5A 4FKPA 1Y57A 3H9RA 4Z55A 3KN5A 1KJIA 2PUIA 4O6EA 3RK9A 5E8ZA 3GI3A 4I3ZA 4K1BA 3FQHA 3E8DA 2QOBA 4TWOA 5C26A 3PG3A 3HYHA 4AFJA 4KS8A 4CLIA 4JI9A 1O9UA 3QX4A 3KY2A 2RGPA 2VTHA 5CXZA 4ITIA 3F2NA 3MH2A 3CTJA 3BHTA 4C3PA 3SKCA 1UNLA 3PXKA 2ZDGA 4MXOA 4GJ3A 1V0OA 4YJPA 5HNBA 3JR1A 4L7FA 1GJOA 4OTWA 1M0TA 2R3OA 3ZZEA 1H00A 1Q4LA 2QQ7A 2WIPA 5BPHA 5KMKA 4AAAA 5FP5A 3QTZA 3RAIA 3TNHA 3ZCLA 2XKFA 5AM6A 4ZS0A 5CY3A 4WSYA 4FFPA 2PZIA 1BI8A 3NAYA 3K5IA 2R86A 1WBNA 3HA8A 1OM1A 3G9LX 4DG2E 5LOVF 4WA9A 2NU6B 4FV9A 3KXMA 4ZOLF 2PTKA 2WMAA 4C4IA 3RV4A 2YCFA 3FJQE 4H1MA 3F5GA 1BXRA 4KD1A 1TQMA 5M09A 5FQDC 3MFTA 1ZZLA 3GU8A 3V5TA 3VOTA 4IJPA 2P2HA 4F6UA 4WUNA 4YU2A 5EZYF 2XNBA 2W1ZA 3EQHA 2CCIA 4J1RA 4RZQA 4QQ5A 2G9XA 4TYGA 2I0EA 4AOJA 4YTIA 2F4JA 2G2IA 4G3CA 1DIKA 3PUPA 1OIQA 4FTQA 4OLIA 4C58A 4Y85A 5JKGA 4AE9A 4EWQA 3LFSA 1SNXA 4UY9A 1OL5A 5L6PA 4KKEA 1PJKA 5D7VA 3ZUVA 5JMSA 3VPCA 4QPAA 4OW8A 4QTAA 4H3BA 3BRBA 1XH7A 3IPHA 4E4NA 4QP7A 3OBGA 3HAMA 4DINA 2A0CX 4TUYF 5HBRB 3PJ8A 3MIYA 4I6FA 3N8DA 4GRBA 3UP2A 1FMOE 4KKGA 1R0PA 1Q24A 5IMXA 5ETCA 3C5UA 5FP6A 1BX6A 4I6HA 3ERKA 5EW3A 3C9WA 2WTWA 3QLFA 4GFOA 2J90A 4RIOA 1QL6A 4QP9A 4XP2A 1H0WA 3UG2A 1W96A 1H1PA 3RK7A 4PL4A 3RCDA 4ZSJA 2QKWB 4A9TA 1NY3A 4IWQA 4GT5A 3LFNA 1REKA 3G90X 4EL9A 3Q53A 5HQ0A 5FTQA 3VJOA 1CMKE 5E9EA 3LMGA 3HNGA 5HLPA 3GBZA 4C5CA 2WMBA 3D7TA 3PRFA 4G6NA 2ITUA 2QOFA 3Q52A 3RALA 2E9VA 3EL8A 4O38A 4AE6A 1IAHA 4J8MA 2WMWA 3TKUA 2ZB0A 4MQ2A 3UIMA 2XKEA 4IAFA 3OT3A 4O84A 3G8CA 5BUEA 5CU4A 1OIYA 1VBGA 2DWCA 4U42A 4FZAB 3FZPA 2YISA 3VS1A 4YZ9A 2YZNA 3FBVA 1MQ4A 2X0SA 3SAYA 3ENHA 3EHAA 4XX9A 4CFXA 5J8IA 2PE1A 3PJ1A 2WQOA 1BL6A 2QO7A 1YI4A 3A7JA 2H9VA 2PVLA 4KSQA 4ASEA 4KRCA 4RA4A 4ZY4A 2P4IA 1YRPA 4F9YA 4EG0A 4A07A 4ZY6A 5J7HA 1KE8A 4L43A 3TIZA 5IF1A 4I0SA 5KNJA 3QGYA 4ME6A 3DAJA 4RIWB 3KGAA 4IB1A 3PYYA 5ICPA 2ZM4A 3EFWA 3NS9A 4F7SA 5C9CA 1GZKA 3VJNA 1GSHA 1OZ1A 1E9HA 1PXOA 1LPUA 3TUDA 3RI1A 4PDOA 2Q0BA 4DGOA 1EYZA 2Z2WA 4QT1A 4MV7A 4X21A 3V5PA 4WUAA 3UQGA 1YXVA 5B0XA 3CSVA 3G0EA 2OZAB 4DFXE 3W16A 2YM5A 3BYUA 4GKIA 4DH5A 3VS4A 3D2IA 4BCHA 2KTYA 3ZUUA 2XKDA 1NA7A 3I7BA 4RVTA 4EQCA 5DWRA 4Z7GA 4KINA 3KFAA 5F95A 3O23A 2XNNA 3QRIA 2R2PA 2Z7RA 3LQ3A 5CU3A 3A7IA 2HAKA 2YCQA 2V0DA 4EOMA 5CVHA 4RX8A 3OWLA 4DBXA 1OB3A 3Q1KA 4DE4A 2BROA 3ZDUA 2ETRA 3PRIA 4U5JA 5EHOA 1VEBA 3OWPA 5IH6A 4C5BA 2H96A 2B55A 3GC8A 3N9XA 4S34A 5CEOA 3QLGA 2O63A 4MH7A 4YTFA 2WGJA 4QMXA 4ZTRA 4I0TA 3VUHA 5LXTF 4CEGA 3EWHA 5L6WL 3GENA 2P33A 2PMNX 4Y95A 3G8DA 3CKWA 1Q3DA 4O7RA 4FFLA 3Q5IA 1NT2A 3KULA 4E73A 2OIBA 4YSMA 2ZV2A 5BPYA 4RFMA 4FTKA 3OOGA 4JIKA 2Y8OA 3FI2A 1PKDA 2QURA 3ZHPC 5LWNA 1ZRZA 2PUPA 4CRSA 3OHTA 2ITTA 3R04A 4P7EA 3W2CA 4I6QA 4IWDA 3DZQA 4KNBA 4NM3A 2C30A 4LG4A 5EI8A 3UE4A 2KULA 1MQBA 4ZY5A 2YERA 4YJUA 4O27B 2GPSA 2WXVA 1H0VA 3BE9A 3TJCA 3BG5A 2OXYA 3KXGA 3QALE 5IMEA 3HGKA 4BDFA 3P7AA 5BUJA 4JBOA 4PL5A 4WBBB 3ATSA 4I4FA 3DTCA 3KCKA 2NO3A 5HBHA 1FPUA 3R8VA 4C37A 3MWEA 4CXAA 3SVVA 1VZOA 2C6LA 3DOGA 4I92A 5AUYA 4FG8A 4DEHA 4PMMA 2WTKC 4BHZA 4CT2A 4RWLA 2OO8X 2C5NA 3F82A 3PY3A 5DYJA 2ZV8A 4USFA 4OBOA 1JLLB 3HV7A 2PVFA 3P9JA 4DH8A 3E3PA 3BWJA 2WQNA 3LFQA 4FICA 2VQDA 2R7MA 5LMKA 4QPSA 3OZ6A 4FT7A 2JBPA 3D5UA 2GMXA 2WNTA 3OP5A 3OEFX 3QCSA 4L44A 3W1FA 1DI8A 5JRSA 4ANMA 2XCLA 4CFWA 1H26A 1J7IA 4AA0A 3Q6UA 3AQVA 4QTCA 5CANA 2UW8A 4D1ZA 5IQCA 4C38A 3VQUA 3NCZA 3WBLA 4MXAA 4YZBA 3FC1X 3MVJA 3RWPA 1XBAA 4ID7A 4F70A 5JVDF 1OMWA 1ZOGA 1T46A 3QA8A 2JKQA 3D4QA 4BDAA 3BYMA 2RIOA 3A4OX 1HCKA 2F2CB 3FDNA 3N4TA 4A9SA 2WIHA 4EOQA 2BRBA 4D1XA 3EL7A 4RIXB 2ETMA 3EQBA 4P5QA 2NU9B 2UZDA 1M7NA 3VHKA 2XNEA 2I6LA 3OCGA 5EG3A 5CF4A 2IVTA 2ZOQA 1GOLA 4ZS4A 2XRUA 2Y0AA 3F3WA 1WFCA 3OEZA 5ANEA 4LV5A 4N4SA 1PY5A 5I9VA 3CP9A 3EJ1A 5HORA 3R28A 1XH5A 3I4BA 4G6LA 1Q99A 4H39A 3MFSA 4TY1A 3NUPA 3GVUA 2REIA 4WBOA 5LWMA 2J0MB 4HCUA 2VTAA 4TW9A 1QCFA 2ZYBA 2R3GA 5EH0A 3E92A 2XNMA 3ORXA 4YGAA 4FC0A 1W83A 2QO2A 4YC6A 2V55A 5LP6F 4IMYA 3HX4A 3FV8A 2BHHA 2JFLA 3QRKA 4O7LA 4IWPA 5L2WA 5AA8A 1Q62A 3I0QA 4JDIA 4ZXTA 4HCTA 4DEAA 1OITA 3OD6X 3OT8A 5FUTA 5AV4A 1OKWA 3CKXA 2PMLX 5HICA 4YHTA 4XV2A 3VWAA 4JBVA 4ZTMA 3BELA 3CLYA 1AD5A 1JSTA 3F61A 3KVXA 3O96A 3PLSA 4IAZA 4IE9A 2BFYA 4BHNA 5DT4A 3GEQA 2GFCA 3IONA 3C0IA 4QMLA 4RA5A 3PP0A 2DIKA 4E8AA 4YAKB 3CGFA 3H4JA 4BDBA 4BZNA 4NW5A 3DBDA 3RM7A 5HU9A 3FYKX 1TQPA 4I21A 1UNGA 4XG9A 4RSSA 1CSNA 1P14A 2VWBA 4AGUA 3G9NA 4A4LA 3PJ3A 3G0FA 4XV3A 4IVCA 3M1SA 5BVFA 3L8SA 2R7BA 2PUUA 4EH3A 5CF8A 1OIUA 3KEXA 3N4UA 3VA7A 4MHAA 4AG8A 2R4BA 2OW3A 3EFKA 2FUMA 2BZIB 3MB6A 4KRDA 4IJ9A 3KRRA 2XYNA 1WBWA 5A4TA 1IA9A 5I5ZA 2WTKB 5HV6A 3DU8A 3SD0A 2GNHA 2WZJA 5FM3A 1KJ9A 5I0BA 2JAVA 3FSFA 4LUDA 1URWA 5CU2A 1UU7A 2R3QA 1IASA 1JSVA 5L2IA 5AP5A 4PDYA 4BDJA 2YCSA 3MJ2A 5CLPA 1ZOHA 5E90A 4YBZB 4UYAA 3KMUA 4F7NA 3U9SA 3LLTA 1KJ8A 3V6SA 4C5AA 4E7WA 2ESMA 2QONA 3REPA 5CA0F 1ZXEA 3LCOA 2WTCA 4YTHA 1BYGA 3HL7A 4KSPA 4D58A 5LVMA 4GVJA 2OBJA 2W6MA 4FKOA 3R5FA 4AU8A 2R3LA 4FTAA 4FTNA 3UO6A 4MX9A 3R23A 3LAUA 2XVDA 5M44A 4H58A 1JVPP 4XZ3B 3QWJA 5T6KA 1BUHA 2EWAA 2X7OA 3N4VA 4FBXA 4UALA 5EKNA 1FQ1B 4NL0A 5HVJA 5DEWA 4QYGA 2J0JA 2XM8A 4RX7A 2QD9A 3SG8A 5M06A 2C69A 5M55A 1DM2A 3HMNA 3QRTA 4ZSGA 3QZGA 5JQ5A 3R71A 4CQEA 2A1AB 4DFUA 3UMWA 1GZNA 5D10A 1A9UA 2YN8A 3F7ZA 4RIYA 4ASDA 4HNTA 2ZDTA 3BYOA 4H3QA 2VTQA 1UU8A 5CNOA 4Y8VB 1M52A 4NW6A 5BYZA 5IH5A 4DH1A 3GQIA 3N51A 5AP7A 2FGIA 4FSZA 4D9TA 5HLWA 2H6DA 3FE3A 3KK8A 2I7QA 3ROCA 2BDJA 4HPTE 3LP8A 4EC8A 1H1SA 1PYXA 4GK4A 3F5UA 3FMLA 2R3FA 3BYSA 4FKUA 5CZIA 3LWBA 1XQZA 1X8BA 2O3PA 5E8WA 4U3ZA 3QL8A 1P4FA 3RPYA 3E3BX 3TZ9A 3DKCA 4EZ7A 1YI6A 5CEMA 4IZ7A 4LRJA 1Q61A 3BI6A 1H07A 2V62A 1YWRA 3QQJA 3QTWA 2R7NA 3R8UA 1SM2A 4QYFA 4S30A 3OWKA 4JJRA 4U7ZA 5EHYA 4O4LF 3FLWA 4HZRA 1P2AA 3ZO2A 2C3JA 3UVRA 1Y8GA 1J1BA 3QF9A 4R5YA 4EC9A 3EQGA 4FK3A 5AAFA 2YIXA 4U40A 4CLJA 3C51A 4ONAA 5FEQA 3ZZWA 4TPTA 4MYGA 3NDMA 4FMQA 4F7JA 4MXYA 4GV1A 2X8IA 4D5KA 4RC2A 5CAOA 3W2RA 1IR3A 2E9OA 3R7VA 4IIRA 5A4LA 4IZOA 3LQ8A 5D1JA 3KMMA 4I23A 4GH2A 5H9BA 4RPVA 3DT1A 3S4QA 3ZXZA 2W70A 5CVGA 4MXCA 4YC8A 4FTCA 4RJ6A 4QMZA 2IZTA 2R3RA 2XIRA 2EUFB 5AP6A 2VO6A 1OIRA 3SXFA 4EUUA 4OTRA 2WOTA 4U81A 3TM0A 2P3GX 3OXZA 3KRWA 1BLXA 3VAPA 4ZSAA 5IA5A 4FT5A 1NVRA 3JVSA 3KRXA 4ZJJA 5DR6A 1IG1A 3AD5A 3FXZA 4DLIA 2B0QA 2FSTX 2QR8A 3LQ5A 3E8EA 4NWMA 5IA4A 2IW6A 4QMWA 3NPCA 2WTJA 4QMUA 1XHAA 4TT7A 5F4NA 2CNVA 2JKKA 2BHEA 1YVJA 2OXDA 3HDNA 3QFFA 2ITXA 4OUCA 2OI4X 2UW9A 3LPBA 4GK2A 4WNKA 3DDQA 2BAJA 3VBTA 4F1TA 5J2UF 4QMSA 3EN4A 2B1PA 2W7XA 2R3MA 3VN9A 4AGWA 4C34A 2W1FA 3Q04A 4O4HF 3CR0A 2OLSA 2W6PA 3KF7A 1M2RA 1UKIA 2F7XE 2WB8A 4J71A 3ZDIA 2HK5A 4NM7A 1WBOA 2V7AA 1SNUA 3LFCA 4HGEA 3R1NA 4R1VA 4E6DA 2XUUA 4O0RA 4PL3A 4YURA 1YXXA 4JDHA 3V5QA 2VO3A 3AG9A 3FI3A 5JQ8A 3TNIA 4MD7E 3NUSA 3QUEA 4DGMA 3BIZA 5LVNA 3W55A 2BRNA 2W1IA 3E87A 3PPZA 3UOLA 4MAMA 3C13A 2WTDA 1O6YA 5JFSA 1Q8YA 3KXZA 2C6DA 5M08A 4FZ7A 5GONF 2UW3A 2YIYA 3FMEA 4FGRA 5DRDA 4CGAA 4Y46A 2J9GA 1F0QA 4P2KA 5EQYA 3P86A 2R3NA 1Q97A 3BZ3A 3O0GA 5HCZA 3FY0A 2VTOA 1Y91A 4G9RA 4IX5A 1WMKA 2I0VA 3MFUA 4WO5A 4GK3A 4FNZA 3MWUA 3O71A 4TYJA 4C59A 1Q8UA 2ITQA 4KIOA 1ZMWA 2VTMA 5E92A 5A46A 4IDVA 5ETAA 4EH4A 3QD2B 3QTIA 5JFXA 2XCKA 4XV9A 4DITA 1OKZA 2UZOA 2O8YA 3TZ7A 3Q9YA 3OCSA 4FKQA 3Q5ZA 2GS6A 2YABA 3HRCA 4W8DA 4XG6A 3ORQA 2NNWB 2BTRA 2C6MA 1G3NA 2PZYA 1S9IA 3LJ2A 3GNIB 5ANIA 3QQGA 4HPUE 3DJ6A 5CU6A 3P4KA 3UVPA 4F0FA 5M4IA 3TW6A 3BEAA 3F5XA 3QKKA 2BTSA 2EVAA 2JKMA 3M2WA 1R1WA 3C7QA 4I94A 4BVUA 1UKHA 1OL6A 3QQLA 4TRLA 4U9AA 4AZVA 1KJQA 2CZGA 3DAKA 1K3AA 2VV9A 4Y72A 1KE7A 3VHEA 5HE2A 4ANBA 3F3VA 3RWQA 3OS3A 3UNZA 4EBWA 5HTCA 4XBRA 2YA9A 3RP9A 3MFRA 3QQKA 4FFOA 2YWPA 4GJ2A 4C2WA 4MV4A 1GZ8A 3NZ0A 5IQBA 4OTIA 2YM6A 3T8OA 3E5NA 3FXWA 5I9ZA 5DGZA 4IAIA 4KB8A 2X6EA 4AW5A 3Q9XA 1WVXA 3FLNC 3C50A 3DY7A 4JQ8A 2PY3A 3KC3A 5DEYA 5ETIA 2XJ0A 3LXLA 3O7LB 4X6RA 2XK6A 4UXQA 4YJTA 4U41A 2GNGA 3D7TB 3Q4TA 4KABA 2BALA 2XIZA 1U4DA 5AX3A 4TYHA 3WIKA 5CSHA 5FD2A 3GU6A 4A9UA 4DTKA 1AUXA 4YC3A 2CNQA 4JDKA 1LP4A 4ZEGA 5A6NA 3IK3A 4LOPA 4FSRA 5LXMA 2WTIA 4PV0A 4O81A 4LOQA 4BIEA 2Z04A 1M0WA 3R30A 3MY5A 4O7ZA 1ZMUA 4O6LA 4UB7A 2R0UA 5JGDA 1GIIA 2QCSA 4YJOA 2VWYA 1B6RA 4C2VA 5FEEA 5CB4F 4OBPA 4QMQA 2PE0A 3MV5A 3ZFYA 2R84A 4O7YA 4GFGA 5FDXA 3P23A 2YM7A 4EH9A 3O17A 5LMKC 2Y9QA 1Z57A 2CJMA 3FHIA 3OOMA 4O82A 2JD5A 3KQ7A 4O96A 5DVRA 4ALUA 4DHFA 4MV8A 4DBNA 4E5BA 4D9UA 2FPPB 4I22A 3PXQA 4QP3A 3SOCA 3THBA 5L2TA 3D9VA 3P0MA 2NU8B 2BRHA 5CT7A 4MXXA 5EDPA 5DFPA 4F65A 1I7NA 3GP0A 4J8NA 2GU8A 5BVWA 5AADA 3R9NA 2QLUA 4H36A 5ANDA 3MPMA 3EQFA 4R3RA 5D9HA 4B0GA 4BYJA 3IDBA 2VNWA 2IO6A 3S1HA 4EI4A 5EW9A 3R8MA 3V51A 3FZRA 2HY81 5HD4A 2HWPA 3HV3A 3KREA 1RJBA 2JAMA 5A4QA 5HCYA 4GEOA 4FTOA 4DG0E 4TV9F 3DNDA 3CPCA 4NH1A 2X9EA 2CSNA 2Q0NA 3QXOA 5IU2A 4FV5A 2W6NA 2X2MA 4ANLA 3WF8A 2EXCX 4MV9A 5E8YA 4M97A 5FLFA 2IP4A 4NCTA 1ZWSA 4ACMA 1JOWB 3P7BA 3KL8A 4PTEA 2W1DA 3LXKA 4U0IA 4AW2A 2HXQA 4DH7A 4RJ8A 2XB7A 3R1QA 2YS6A 2SRCA 5J9YA 5AM7A 4TYIA 3ORRA 1A06A 2BZKB 3L9NA 3RK5A 4JR3A 4Y73A 2ZDHA 5CA1F 4M9UA 4LI5A 3QXPA 2GNLA 3TUCA 3T3UA 3CY3A 4KS7A 3IECA 3OVVA 5CEIA 4DFLA 3KULB 3F66A 3NRMA 2W1CA 4A4OA 1H1QA 3NGAA 3F3TA 4FSYA 2X8EA 4BTKA 1UNHA 4BDEA 3Q60A 3HKOA 4MK0A 5J2TF 4RLKA 2XNGA 3R22A 3I6UA 4XHKB 4EQUA 4IFCA 1ZAOA 4DGGA 2IW9A 3BQCA 5IEYA 3CY2A 3H0ZA 3QTUA 5A4EA 2YRWA 4I5PA 1MUOA 5AEPA 3UOHA 4CG9A 1M7QA 5BVDA 2UW0A 4JOAA 3ZFMA 4YJQA 3TIGA 3VW8A 4D2SA 2YZAA 5JGBA 3DDPA 5JZJA 4EGQA 3FAAA 4I20A 3BCEA 4HYSA 5CVFA 3WILA 4ZQIA 3NW5A 1REJA 4LYNA 3SA0A 2CLXA 4RLLA 2A2AA 3JPVA 4RMZA 3EH9A 4XYFA 4PUZA 2LAVA 3LIJA 4JAJA 4D0WA 5A6OA 2VGOA 4XP0A 3AW8A 4JT3A 5HO8A 4AWIA 1XBCA 3UNKA 1BI7A 2OJFE 3FZOA 5HG8A 4MA0A 3I6WA 1ERKA 2C3KA 5H8GA 2OXXA 1NXKA 3BHVA 1YWNA 3CQWA 5EQPA 4IB3A 4KWPA 2DWBA 4G3DA 4RC4A 4RQKA 4U8ZA 4Z3VA 1YXUA 2DS1A 3S3IA 4HZSA 3JZFA 3Q9WA 4G3FA 3DFAA 1JQHA 2A4LA 3E7VA 2RFNA 4AOTA 3FEGA 1KE9A 4AX8A 2NP8A 3NMUF 3HEGA 5E4HA 3ZSHA 2JIVA 3CEKA 4K18A 3U6JA 3U51A 2AYPA 4PDPA 4TWPA 4X2GA 5CX9A 5GNKA 3ZTXA 4NTTA 1A9XA 2W9FB 2WEVA 3D0EA 3QQFA 5DT0A 3ELJA 1WBPA 3E64A 3CGOA 3F5PA 3K3IA 3MGYA 4I5MA 5C1PA 3MA3A 4DYMA 1AGWA 4EK6A 5DI1A 4QQTA 3OUKA 2W06A 4EUTA 3LXPA 4HVGA 2OFVA 5EYMA 4DN5A 4UEUA 4XMOA 4ZJVA 5HEZA 2RFDA 4FUXA 2WAJA 4GYGA 3SC1A 3NYVA 2WQBA 3TNPC 4CVAA 4I55F 5J5SA 4PF4A 5KO1A 3AC1A 3P5KA 4AOIA 1RDQE 2GDOA 2O2UA 4NM5A 2CKOA 4APPA 3LHJA 4BDIA 4D4YA 4J52A 3SQQA 3U55A 3MBLA 3ZM4A 5EKOA 1PMVA 3ALOA 4KIQA 2PVYA 3IW6A 4BDKA 2DYLA 2I8CA 3FLSA 3PXRA 2JGZA 4NKAA 3SOAA 3ORLA 2BCJA 2A27A 2VO0A 3HUCA 3VO3A 4CFUA 2R3IA 4JX3A 4ZOGA 2W71A 1KUTA 3SGCA 4I50F 4O0TA 3LE6A 3S95A 4LGHA 3ZO1A 4W4VA 1W84A 3TL8A 5CEKA 5M4CA 3AOXA 4G3GA 3DKFA 4FGBA 4NIFB 4YZDA 2O0UA 3F3UA 4EK3A 3TEIA 5B2KA 5TT7A 3UZTA 3QCQA 1SMHA 4Z9LA 4FKWA 3LCTA 2V7OA 4EONA 5IA0A 2RG5A 1DI9A 2JIIA 3MDYA 2UZWE 3RKBA 3ODYX 4O0UA 5FM2A 4D5HA 2O64A 3ZEWA 2G2FA 1Y8YA 3ZS5A 5IQDA 2YDKA 5AUXA 4IAKA 2BDFA 4IANA 1KBLA 3BU5A 4MD9E 2Y6MA 2XNPA 3DKGA 2PN1A 4TV8F 4DF3A 3H9OA 1APME 1LEZA 4F9WA 1M14A 3I0OA 2WQMA 4I41A 2GNIA 3OY1A 4R1YA 3PXYA 1H27A 4HGSA 4W8EA 4C4FA 4RFZA 4IEBA 1G5SA 3UG1A 4BC6A 2R5TA 4R7HA 1PXIA 3MI9A 5AUVA 3RPOA 1XH4A 4DT8A 5IDPA 2Y4IC 4C33A 4XV1A 5BVOA 2FH9A 2WD1A 1ZY4A 2XK9A 4KBAA 3BHYA 4DA5A 4A4XA 1EUCB 4U3YA 2VUWA 4IWOA 3D5VA 4EEVA 3IGOA 5D41A 4FTTA 3VF8A 1YXSA 4Z16A 3BU6A 1YHVA 3H10A 5J1WA 3R9DA 4GKHA 1BMKA 3NW6A 4JL9A 5AP1A 4HYHA 2HW7A 4K6ZA 5HG9A 3FPQA 4CFVA 3FI4A 2IVUA 4QNAA 5HBEA 3G6HA 2WQEA 3DV3A 5CU0A 3K3JA 2C5YA 2XK8A 3POZA 3AXWA 4L3LA 4FIEA 5CI7A 3SW7A 1YKRA 3GIDA 4L3PA 2G2HA 3VUIA 2OZOA 4AGDA 4AUAA 3FMNA 3QYWA 4RIYB 4D0XA 2VWUA 4FV2A 5CSXA 2DZDA 5D7AA 4FTJA 5HIBA 2WKMA 3MB7A 2BAQA 3KRLA 4XYLB 2HY0A 4WKQA 5B2LA 2W96B 2Z7LA 3DLZA 3QZIA 4RZWA 2VO7A 5JGAA 4EGJA 2OJJA 5J87A 3DJ7A 4YB8B 2IWIA 5LMAA 1STCE 4ZAUA 3GC9A 4GIIA 4NU1A 4EYJA 1Y6BA 5LVOA 2B9JA 5DOSA 4AFEA 4UYNA 4F6WA 4RGJA 5CALA 5JSMA 2HGSA 3TKHA 4N6ZA 4FKLA 3PIXA 1ZOEA 4I6BA 4L46A 4BTJA 4FV0A 1CS0A 1CM8A 4TTHB 3EQCA 4AGCA 3ZXTA 3UNJA 4X3JA 4G3EA 3C4ZA 5M4FA 2J6MA 4HW7A 2WHBA 3SV0A 4JG6A 2IZUA 3O50A 3Q2OA 3PSCA 5IQAA 3BLHA 3U87A 5HHWA 2VTPA 3FZ1A 2XK3A 3JUHA 2R85A 4KIPA 2PVJA 2YDJA 3HDMA 1PXLA 2HCKA 2C5VA 3H3CA 3QKMA 3EYGA 4GYIA 4TXCA 4O2AF 4HNUA 4JR7A 3PVUA 3QU0A 5FDPA 2YM4A 4J7BA 2GTMA 1W82A 5BVEA 5C1QB 3UO5A 4V0GA 2PU8A 4FTLA 4JAIA 5KMLA 3TKIA 2VWIA 5HG5A 3Q32A 3V04A 5HLNA 4C3FA 1JAMA 3NUYA 1U59A 2PVRA 3F6XA 4O22A 2VRXA 3COHA 4F7LA 4APCA 3VUDA 2XIYA 1JKKA 4H1JA 4V01A 1SYKA 3LZBA 2P2IA 2J9MA 4S31A 4XYMB 5DH3A 3KRJA 4QOXA 3ZRMA 5LMBA 4YJVA 3FHRA 3ORIA 3L8VA 3IW5A 2ZAZA 1OPLA 3ODZX 3QCXA 4WIHA 4QTDA 1GGOA 5C03A 2Y4IB 4ASZA 4M12A 2YFXA 4JX7A 3DZOA 3JS2A 4C7TA 3ZO4A 1JKJB 1PF8A 5CSPA 3BEGA 4ERKA 3NEWA 2HJWA 4QRCA 5AP2A 3SXRA 3HO8A 2GS7A 2Y4PA 3P7CA 2VTRA 1Z2NX 4YJ2F 3FWQA 4FX3A 2BR1A 4BTFA 1K2PA 3L8PA 2X81A 2WPAA 2YM3A 2W5AA 4CV8A 2ONLA 2XP2A 3PLAE 1NW1A 2RKUA 3ZU7A 4JBQA 1UWHA 4KUJA 1Q41A 5HE0A 5GJGA 4GT3A 4FIIA 2R7IA 2QOCA 5JZNA 4IFGA 4II5A 2QF7A 2FA2A 2O65A 4FL3A 4GG5A 4RJ4A 1O6KA
chains in the Genus database with same CATH superfamily
2ITYA 4OBQA 1JKLA 4YLJA 2PWLA 3G6GA 4BI0A 5AUZA 4V05A 4ZIMA 5TKDA 3U6HA 2COGA 1DV1A 3ZLWA 3HBLA 4EFEA 4L42A 4EHEA 2R7KA 3KU2A 4XOZA 3ZLXA 1MRVA 5E1SA 3IG7A 4ASXA 2WU7A 1YHWA 2CPKE 4IQ6A 1EH4A 2FB8A 2R64A 1U46A 3QQUA 3GCVA 2BPMA 3DQWA 3LJ0A 3WZEA 1PK8A 2YM8A 3ORPA 3BLRA 3JSNA 5EDQA 1U54B 5TF9A 4HVHA 3CCNA 3K2LA 4Y5HA 1WR2A 3A8XA 1SVHA 3DCVA 3FY2A 3C5IA 4OR5A 3VBQA 1XH8A 1OBGA 1PXMA 2PK9A 2X6DA 3CQEA 3KA0A 3LCKA 4ZTHA 3V5WA 1H01A 4MCVA 4A9RA 5HNIX 3QTRA 3ALNA 5FGKA 3V3VA 5JFWA 2WMXA 3S00A 3VBVA 5HCXA 1QPDA 5C4LA 3KB7A 5IA2A 2YZLA 2W6OA 3DS6A 3ORZA 4EOOA 4AT3A 2B7AA 2VTNA 1ZYLA 3EN5A 3O51A 3EMGA 4IVDA 5DHJA 3DTFA 4FT0A 4G34A 4QYYA 2W4OA 3AGMA 3BGPA 5FXQA 3VUGA 4A9YA 4YUQA 5B2MA 3HMMA 4B7TA 3SRVB 1H25A 3QTSA 5AV0A 4AXEA 4FKIA 4E26A 4NCTC 4O86A 3FMKA 3MPAA 4NZWB 4UZHA 1CQIB 4GL9A 2C0TA 4PQNA 3OW4A 4EK4A 3JVRA 2E9NA 4Y8DA 2GHGA 1W7HA 2J2IB 2HWOA 1GNGA 1ST0A 2J0LA 4X2JA 4UN0C 5JH6A 1PW2A 1EUDB 3TXOA 1IAJA 4QQJA 2C1BA 3GXLA 2XEYA 3IKAA 1YQJA 1EKPA 4LOOA 4ZZMA 4HNVA 1DV2A 2XAOA 3GOPA 3HUBA 2VWZA 5DBXA 2RG6A 1JDEA 5AJQA 4R3PA 4ITJA 4TYEA 4BIDA 2P0AA 4CE5A 2FO0A 3CTQA 2OICA 3P1AA 4JLCA 2X4FA 2Y4RA 3EKNA 3RTPA 3HB9A 3DTWA 4C35A 3Q4CA 3MSSA 2PUNA 4BBFA 1ZZ2A 3ACKA 4X6QC 3OXTA 5EM7A 5H8EA 4NZMA 2ERZE 3OFMA 4MF1A 4BF2A 3QTXA 3R6XA 2XEZA 3OBJA 4LRKA 4CMTA 5KKNB 1KV2A 4AN2A 3D5XA 4EOKA 3UYSA 3W2PA 2AEGA 4NJDA 2OU7A 3UOKA 4FA2A 5JN2A 4TVIA 5D12A 3BA8A 1U5RA 4LV8A 2HGWA 1BKXA 3NLBA 2EB3A 4TYHB 4WG4A 3W10A 4E1ZA 3KKVA 3EN6A 5CAUA 4K6NA 5GHVA 5C01A 5BNJA 2B52A 5EFQA 4RJ5A 3ZFXA 4MEDA 2YEXA 2YAKA 1WZYA 3C4CA 3LFFA 4M69B 3OROA 4UZDA 4G16A 4J96A 4ZZNA 2QOOA 5FXRA 5CM0A 1LEWA 3TTIA 4PZ7A 2IJMA 2WELA 5E8TA 4AXDA 4E5AX 2J51A 3HAVA 5I9XA 3A60A 3QRJA 2GQSA 2UVZA 2WFYA 2OH4A 2CN5A 4WRGA 4MBJA 4X2FA 2VAGA 4W4XA 5I47A 5DLSA 3DFCB 5FG8A 5HGIA 2FVDA 4D55A 2F9GA 4AACA 2C68A 3HVCA 3OUNB 4QP8A 2CLQA 5AAGA 5L6OA 3RINA 3AMYA 4AW1A 2YZGA 5J1VA 2NUAB 1FINA 3UOJA 4R5SA 5FEDA 4OTFA 2HIWA 3CEBA 3AC4A 4QQCA 3R01A 3A7FA 3PFQA 3W2OA 2X39A 3EN9A 3UZOA 3F9NA 4EZ3A 4FODA 3VPBA 4G1WA 1PKGA 2IZRA 2W6ZA 4CKCA 3TDWA 2BKKA 3MVMA 3ITZA 4FV7A 4IZYA 3TCPA 4PP7A 3DXQA 5JQGF 2FSOX 3TV4A 3DXPA 2VR1A 4M3QA 1FGIA 3CJGA 3ZONA 3GU7A 2C6OA 5LCJA 4FZFB 2RFSA 3MY0A 1YWVA 3WF9A 4DIMA 4O0YA 2COJA 2R3KA 2FPGB 2JC6A 3BHHA 3EOCA 4PTGA 4YHFA 1YOMA 4F64A 1P5EA 2C00A 4QSHA 4DFNA 1CKPA 1GY3A 1R78A 3ORNA 1J3HA 1I2LA 4BDGA 3U9CA 3M42A 4AXAA 2I1MA 4YNEA 2UW5A 1FGKA 4FK6A 3F69A 4HYIA 3VS7A 2QOKA 2XBAA 4LMNA 4F6SA 4EFBA 4RQVA 4ZMFA 2YIQA 4QNYA 3QBNA 3UBDA 1P4OA 2BILB 2C0IA 2J7TA 5CQUA 4USDA 2BIYA 3FLYA 4ANQA 3CC6A 3K54A 4WD5A 1PXNA 1ZYJA 2OF4A 4AXCA 2C0OA 2G01A 4B6LA 3BLQA 4C02A 2E2BA 4XG8A 4AZFA 4BDCA 4FG7A 2ITNA 3EFLA 5EM5A 4YBKA 5K3YA 5LQFA 1YOLA 4MWHA 5TOZA 3VBWA 3ETJA 2Z60A 2CGUA 3NUUA 4RVKA 1VYZA 3L1SA 1I1KA 5LYJF 5EW8A 5HTBA 3RNIA 4BYIA 4ACGA 3NAXA 4M14A 4RWIA 2CGXA 2J50A 1OVEA 4DEIA 4EOLA 5BX0A 4FUYA 5K9IA 2PYWA 1R0EA 1HCLA 4FVQA 2A1HA 2V58A 2PL0A 4FL1A 5HVYA 1TQIA 2NRUA 3BL7A 2VGPA 1XH6A 3AGLA 2XMYA 4L6QA 3MH1A 3PJ2A 3PXZA 2JFMA 3PA4A 4Y5QA 5E7RA 3A2CA 3SLSA 3UQFA 4TN6A 4RCNA 4EWHA 4PMPA 1IRKA 5K2MA 5BVNA 2HZ4A 4BGGA 3TWJA 2QHNA 3NYXA 3T9EA 1BL7A 5KMJA 3UMXA 2XKCA 1DAAA 2GPHA 4RRVA 4ZTQA 3QGWA 3U4WA 4UXLA 4AN9A 5IUHA 5C1OA 4GCJA 2YIWA 2UZBA 3WE8A 3BBWA 1EZ1A 4OTGA 3C1XA 3ETHA 2W99B 2CGVA 3I1AA 3SW4A 5HU3A 3A8WA 4F0GA 1UC9A 5F20A 4PX6A 2VTTA 3VQHA 5KHXA 1OL1A 5IUIA 5C8NA 3FKLA 4YPDA 4E6AA 4F9BA 5KCVA 2R82A 1EHIA 5KBQA 2CFMA 5DNRA 4GVAA 3ZBFA 3TT0A 4HOKA 3LCSA 1JKSA 4BTMA 4D4RA 2VTSA 4WG5A 2PVNA 4OTQA 5AX9A 3FMDA 4D4SA 4R7IA 2W0JA 4M13A 5L8LA 4XG3A 4PNIA 2QI8A 3W33A 4EK5A 2CNUA 4YO4A 5HIEA 3DK3A 4DFBA 3GT8A 5ANKA 5BYYA 4F1OA 4RBLA 3MW1A 4GU6A 5AP0A 1TVOA 2WEIA 4EOPA 5M4UA 2WMSA 5C27A 4AA5A 2XD4A 2YL2A 2EXMA 4ITHA 4BGQA 3IGGA 3D14A 3ZSGA 4RJ7A 3U9TA 5AUUA 3CIKA 3RHXA 3UP7A 2R3PA 1KWPA 5BPFA 1T36A 2YRXA 5HI2A 2XJ1A 4PNKA 1TA8A 1KC7A 3MIAA 4UV0A 2CDZA 4QMOA 5HE3A 3VUMA 3MWDA 3TMOA 5IQIA 5KMNA 2YJRA 3DJ5A 4OT5A 5CEQA 4YPSA 3QTQA 3TJDA 2JDTA 3QWKA 2HVQA 4YJSA 5CAPA 5A3XA 3PA5A 2OIDA 3ZRLA 4B8MA 2W17A 3P79A 2BZHB 5DE2A 3I5ZA 4S32A 3VF9A 3ZEPA 1PHKA 3GB2A 4EHGA 4UX9A 4QP4A 5CNNA 3GFEA 3RHKA 3LFAA 5KX8A 2UZNA 4M67A 2XRWA 4WT6A 4IZAA 4CFFA 2PBZA 3W2QA 2VPQA 2ZM1A 1M2QA 1YDRE 2C4GA 3HV5A 3R2YA 4N0SA 3SHEA 2F2UA 1RE8A 3MS9A 2IVSA 3LXNA 1Z2PX 2HELA 3FL5A 1JLUE 1UVRA 3HECA 3NVMB 4HVIA 1F5QA 1FMKA 3R21A 4IC7A 1MRUA 1G8SA 4FZ6A 4L52A 5E8XA 4GIHA 5TR6A 3VRZA 3B2WA 4U45A 3ZC6A 3A4PA 1IOWA 4CD0A 3ANQA 4O83A 2HZIA 3RMFA 3I12A 4E4XA 3T9AA 4FVPA 2YS7A 1OUYA 3HMOA 5DR9A 5DR2A 4CC6A 1KOAA 3AMAA 3FSKA 2W1EA 4C0TA 3FLQA 4L68A 4CMUA 4CTCA 5AP3A 4YR8A 5AP4A 4EKKA 4JNWA 3I60A 3R1SA 3DNEA 4X7QA 2P55A 3G5DA 3DLSA 3CD3A 3LW0A 1Q3WA 1ZY5A 4CRLA 4IM0A 5E25A 5T3QA 3PY0A 5AV3A 2HW6A 1GSAA 4FSQA 4IX4A 2R7LA 4TL0A 3NNVA 3PPKA 3NNXA 3VS6A 3DQXA 4UCRA 4J98A 2J5FA 4L00A 3R7OA 4Q9SA 5M57A 1PXPA 1IEPA 3V4SA 4HVDA 3FMJA 4JBPA 5E8SA 5EQEA 3U9NA 2VTJA 3F88A 4MKCA 4FIGA 1ND4A 1ULZA 4O7SA 2ONLC 3UYTA 3HA6A 4L3JA 5AAEA 5JH7F 1JDBB 3FYJX 5BMSA 1PX2A 3EQIA 4ZZOA 4MTAA 3ENMA 3V8SA 5CAVA 1K9AA 2QOHA 1H08A 3HV4A 2R9SA 3R00A 4JXUA 1JNKA 4F78A 1J91A 1U5QA 4ARKA 3KXXA 1M2PA 2O5KA 3FZSA 4FKRA 4C4GA 3FZTA 3IO7A 3T99A 4ALVA 2B9FA 3ACJA 2UVYA 3AD6A 2WMQA 3EZRA 3GUBA 4RWKA 4XG7A 3ULZA 3WYXA 3H30A 4F08A 2BUJA 5L8KA 1RQQA 3WF7A 4QMPA 4TKSA 3SXSA 5B7VA 5HE1A 3FXXA 1E1VA 4FSTA 2PMOX 4TZRA 2V5AA 2VN9A 3EIDA 4DEEA 4DDIA 3RAKA 4GT4A 1YI3A 4IB0A 4WNMA 1Y6AA 3EFJA 3KXNA 3PVWA 3LM5A 3OUUA 3WO1A 3OUZA 2WTVA 3DPKA 3N6RA 3PY1A 3GU4A 4H05A 4EH5A 5C8MA 3R9HA 2OJGA 3KYHC 3LVPA 3HMIA 4K11A 4XUFA 3T3VA 4IH8A 4BBEA 5CF6A 3TN8A 1H1RA 2DUVA 2X9FA 2XCHA 3G51A 4EJNA 3JY0A 3TIYA 4FTIA 3TIIA 2FSMX 3V4ZA 2JDRA 2QNJA 4ZTNA 4I5CA 3ZMMA 2WMUA 2UZEA 5G1XA 1VBHA 4M0YA 3DK6A 2WO6A 1ATPE 4HQ6A 4OT6A 1PRYA 4AQKA 5KBRA 3D15A 4FIFA 4YJ3F 5BYLA 2I0HA 1V0PA 4QMVA 3VNTA 4CG8A 5M56A 1GSOA 5DT3A 4LL0A 3IW7A 3HV6A 3FUPA 3GCPA 4H3PA 1YDTE 4G2FA 1W0XC 4V0GB 4BCMA 4HVSA 4PTCA 4EOJA 3ZYAA 4FTRA 3OC1A 3R9OA 3VBYA 5HIDA 4K33A 3BU3A 3R8ZA 3DF7A 1Q8ZA 4ZSLA 3NSZA 4O0SA 3R1YA 3OW3A 4O7VA 2ZMCA 4S2ZA 5LVLA 3NYOA 5TO8A 5FBOA 1W93A 5CTPA 4R77A 4BCOA 2XBJA 4DHJA 3OCTA 4RT7A 5AIRA 5JQWA 2WMTA 3P08A 4JQEA 2HOGA 5ANOA 4DCAA 3PN1A 4R78A 5FXSA 1XJDA 3RV3A 2A19B 2V22A 2VX1A 4OGRA 4FIJA 1WAKA 4RJ3A 2XNOA 2B9IA 3UZPA 4ZTSA 4MBLA 2WMVA 2RL5A 3TZ8A 4K2RA 4ACDA 4C36A 5AV2A 1GLVA 2UZLA 4Q5HA 2I87A 2W5HA 4FFNA 3NUXA 4MNEA 3VMMA 3HMPA 5ANGA 3PIZA 3K5HA 3QZHA 3UDSA 1F3MC 4O2ZA 4BCQA 5EK7A 1ZMVA 3BHUA 1XR1A 1VYWA 3NR9A 4NSTA 4R3CA 3VS2A 1CDKA 1P16A 1I44A 1UA2A 4XG2A 3A7GA 2R0IA 4L53A 3LJ1A 3WOWA 3CS9A 4C4HA 3V8WA 3TNQB 3EN7A 4O21A 2B4SB 4HYUA 5DMXA 4XP3A 2VWVA 4LH7A 3KF4A 5I5TA 2YITA 4X2KA 1E4EA 3RAWA 4N6YA 4FEWA 4MBIA 4ZI7F 4EZ5A 4Q5EA 5EI6A 3WZJA 4DC2A 1G8AA 4CC5A 5C4KA 3H9FA 3R73A 3G2FA 2X0GA 2QO9A 3RVGA 1Q8WA 4BCFA 3V6RA 1WBSA 4ZLYA 4XRJA 2GQGA 3W1BA 4I4TF 1QPEA 3MA6A 3ET7A 4YO6A 3VIDA 4D28A 4F4PA 4RX9A 4C62A 3NBZB 1QMZA 4LGGA 2C6EA 4E4LA 3RTXA 2YWVA 1Z5MA 1YHSA 4FNXA 4EOIA 4YLKA 5CQWA 3R8LA 4KAOA 3E63A 2HHFA 4PZ6A 4E4TA 5DPVA 4FR4A 2ZMDA 3KN6A 1LUFA 5E8VA 4IM2A 5H8BA 3CD8A 3WO0A 5LARA 4KBKA 3AX6A 4O0XA 3TNWA 4YTCA 4EYMA 3OTVA 2ERKA 3PVBA 1UU9A 5GINE 2ZB1A 4QP2A 3NYNA 2NPQA 1T45A 3QAME 4X3FA 5HNGA 4MV6A 5FBNC 5KMOA 3V5LA 5HBJA 4IX6A 5IA1A 2EU9A 3L8XA 5E91A 2HZ0A 2HIXA 5F9EA 3DBCA 3UTOA 5IYZF 4EORA 5H2UA 4ACCA 2Q83A 4FNYA 2C5XA 5I60A 4YZNA 4HCVA 4M68A 4J97A 3MH0A 4M0ZA 3P78A 3PSBA 3WARA 2JLDA 3MJ1A 1PMEA 2UZUE 5GJDA 3OXIA 4BDHA 1FVTA 2FPIB 2C3IB 5IUGA 5HD7A 4A7CA 5BUIA 2HZNA 3GFWA 4FT3A 5DIAA 3GCQA 5EHLA 3ZSIA 3O2MA 1E1XA 3U54A 1J7LA 5EYDA 3S0OA 5IPJA 1CKNA 3OWJA 4B4LA 3A99A 4NUSA 5AWMA 2QG7A 3TG1A 2ZDUA 5IA3A 2WOUA 3CPBA 3ZBXA 4BGHA 4QTEA 3DGKA 3ORTA 4FV3A 4JIAA 3U4UA 5AIKA 5ACBC 3U8WA 2Z7QA 4BICA 3Q6WA 3D94A 5HVKA 2G1TA 4QMYA 2I80A 3WNZA 5K4JA 1TKIA 5EOLA 3RPSA 5DGHA 2FYSA 3I79A 3R9RA 2YHVA 3UDBA 3HLLA 4PRJA 3I81A 5IDNA 2YIRA 4I93A 2QOIA 1KSWA 1WVYA 2X4ZA 4BI1A 1QPJA 2XIXA 4RC3A 2C6TA 5EOBA 3VRYA 3DB8A 3CJFA 4IHJF 4L8MA 3EQDA 5A54A 3W18A 1I7LA 4IC8A 5IQFA 1EKVA 1I09A 2ZJWA 5A14A 4C3RA 3ANRA 4FEUA 4JXFA 4XEYA 4JVGA 4YNOA 5BWWA 1MRYA 2J5EA 2RF9A 2WU6A 5AUWA 4GUBA 3R02A 4HJOA 2IW8A 4E4MA 3V5JA 4EQMA 5KKRC 2VX3A 3KMWA 5LA6F 5E1EA 4O2PA 4JS8A 3TINA 3KCFA 3C4XA 5HKMA 2B9HA 4FSWA 4LFIA 3QC9A 4IX3A 1OGUA 2JDVA 4GUEA 3VW6A 3F2RA 3JYAA 3DKOA 5BMMA 4ERWA 5D1PA 4CCBA 2YJSA 3FKNA 4BBMA 1Q5KA 5LOHA 4FFMA 3ROYA 3W0QA 3L9LA 1B39A 2BRGA 3O8PA 3O7LD 5L3AA 3RJCA 4FFRA 4IADA 4RG0A 5C8KA 1VKZA 4V04A 2SCUB 4XG4A 2J0IA 3WE4A 3VONA 1AUVA 3QHRA 3FKOA 2JEDA 3RUPA 1OL7A 3E5AA 5CAQA 1Z9XA 4S33A 2IZSA 4DRFA 4Z7HA 3GU5A 2VTLA 3QC4A 5DG5A 1OKVA 4BCJA 1XDNA 2ZV7A 3RPVA 1MP8A 2J0KA 4TNDA 1H4LA 5KUPA 3NFFB 4GS6A 4DFYA 3T9BA 2X8DA 3ZO3A 3ETAA 4WG3A 1DAWA 3JXWA 4G17A 2EB2A 4AW0A 4ZLOA 3CXWA 4IW0A 3Q4UA 4ZTLA 4A06A 2WYOA 3C0HA 2QOQA 2ITZA 3B8QA 3UQCA 4HGTA 1OPKA 3JRXA 3G33A 2GCDA 3MVHA 4B9DA 3AC8A 1ZYCA 3RFCA 3A7HA 3FI8A 2QVSE 4XBUA 4ACHA 1ZYSA 2PVMA 3COIA 3D83A 3LOKA 3PP1A 4CKIA 2VWWA 4DEDA 4YAJB 3PWYA 3ZH8A 4DLKA 2HVSA 3V01A 5KE0A 1H28A 4IWXA 3T9FA 3NUNA 4J95A 3FPMA 4K9YA 2GSFA 4QMNA 3E93A 4ORKA 4UUGA 5EM8A 2C6IA 4FV6A 4O7TA 3C4FA 2BDWA 4FEXA 3VC4A 1G8KA 1W98A 1UWJA 4JG7A 3AC3A 4O0VA 2VNYA 4CT1A 3HRBA 3L9PA 4UCSA 4UCUA 4OTHA 5CYIA 2YW2A 2XM9A 3CBLA 5IEVA 4N70A 5KZIA 3I5NA 2OH0E 5FRIA 1YOJA 1A0GA 4ZMEA 4EJ7A 1OECA 2CN8A 2W9ZB 1FBNA 4HNIA 4CFNA 4GSBA 3WF6A 5IG1A 4FOCA 2XH5A 3W32A 4EHZA 3MH3A 3OCBA 4FE2A 5JVLA 3RZBA 1OPJA 2X7FA 3BE2A 3Q2JA 3BPRA 3R5HA 4W4WA 2PE2A 2PMIA 4FZDB 4AZSA 5BWRA 2OLCA 4M15A 5BMVF 5KMIA 3RAHA 3NUAA 4QMMA 4ZHQF 1JBPE 4IAYA 2BRMA 2CKPA 2OFUA 4PP9A 1H24A 3E88A 3IDCA 3IQ7A 4L7SA 3V8TA 3BKBA 4DCEA 3K5UA 5CF5A 3DBFA 1VJYA 5KKRB 4FV4A 4QP6A 3TTJA 4BRXA 5L8JA 5GIOE 2DLNA 4LUEA 3PA3A 3UIBA 4BR3A 3NCGA 2VZ6A 1WBTA 4EK8A 2X2KA 2I0YA 4G5PA 2QU6A 3KVWA 4PWNA 4E5WA 3MESA 4FKJA 3MY1A 4XJ0A 3DBEA 3R8PA 1PMNA 4CKJA 4MA5A 3UJGA 3IDPA 3PPJA 3E62A 3OF0A 2DQ7X 4QO9A 4RFYA 2GNJA 4UWBA 4YLLA 4IACA 2XK4A 5EYKA 5IH4A 1GAGA 2ITVA 3D5WA 2ITOA 3LFBA 3UODA 2IG7A 2PVPA 5DISC 5ETFA 3TQTA 1XK5A 2XJ2A 2BFXA 3FMMA 2QC6A 4K8AA 4NTSA 3WIGA 3OMVA 1VS0A 3K3PA 4QP1A 5FPOA 4E20A 4FKVA 1R39A 4DH3A 4DEGA 4XRLA 2HXLA 2XS0A 3W8LA 4FYNA 5EM6A 3T9TA 5FNVF 4I5HA 1ZLTA 3EYHA 3LFEA 3QCYA 2OK1A 1HOWA 4EH6A 1KEEA 4NT4A 2ETKA 3ZUTA 4C4EA 4ENYA 1B6SA 1IYDA 3D2KA 4U43A 2B53A 2LGCA 4DAWA 1CQJB 4U97A 4IIJF 4RZVA 4O2BF 2QLQA 4E6CA 3W2SA 3MN3A 4NFMA 5BWUA 4BY9E 4F63A 3QD4A 4M84A 4ZK5A 3ULIA 4FKSA 5CS6A 3AT4A 5D8DA 4I24A 3UIXA 3SDJA 4BI2A 1BNCA 4HGLA 2ZV9A 1IA8A 1S9JA 5CT0A 3COMA 3R7UA 2OJ9A 4GG7A 4LQMA 4QYHA 3IW8A 5J95A 2YCRA 3QD0A 4AQCA 4FSUA 4TWNA 1AQ1A 2Y7JA 3MTLA 3OY3A 4YSJA 3ID6C 5KHWA 3MVLA 4RIWA 4AP7A 2BAKA 4RWJA 4RX5A 3PSDA 2FP4B 2NU7B 3T9DA 2F7EE 2X7GA 5JT2A 4XLIA 5F94A 3ZLSA 2UW7A 4PY1A 4BCKA 4O4JF 3CE3A 1FOTA 3GQLA 4U80A 2J4ZA 3BBTB 5CSWA 4MV1A 4CKRA 3BYVA 5CI6A 2GTNA 4KKHA 3UFXB 1PYEA 2CMWA 4P5ZA 3VVHA 4FV8A 1WVWA 2OZAA 1ST4A 2X2LA 3QX2A 5HESA 3DB6A 3TI1A 3GLKA 5A4CA 3ORMA 2ZGIA 3AKJA 5I4NA 4AXFA 4EHVA 2ZVAA 4R6VA 3VS3A 2GHLA 3D7ZA 5BVKA 4USEA 2H8HA 4QMTA 5ITAA 1GIJA 4FNWA 2GLTA 2FB9A 1GZOA 1YDSE 4JG8A 4BCNA 3LKMA 5KMMA 2QODA 2GHMA 3MPTA 3PE1A 4B8LA 1I1LA 4MV3A 4G6OA 5G6VA 3QD3A 2VWXA 4I4EA 3II5A 2CCHA 1SCUB 2QK4A 5I5YA 4E6QA 1LR4A 4X0MA 5CAEB 2W05A 4J53A 3ZRKA 4WOVA 4DTBA 5JFVA 3EZVA 5KZ0A 4MAOA 3R2BA 2UW4A 2W1GA 4EH2A 4D2RA 1ZYDA 3S2PA 3VBXA 4JRNA 4GMYA 5EYCA 4IAAA 3M11A 3O8TA 3NW7A 1R3CA 4P4CA 3I7CA 3COKA 5CZHA 5I9UA 1P8LA 4IBMA 2XZSA 3IOPA 2PPQA 4LM5A 2OG8A 2QHMA 3DK7A 3KXHA 4IVBA 5L2SA 1URCA 1RW8A 3TV7A 4BKJA 2YDIA 3LCDA 3AT2A 3UC3A 3ZLYA 3F2AA 1KE6A 3HP2A 4XCUA 5HX8A 4YMJA 3DAAA 3SX9A 4LRMA 1WCCA 2XA4A 3G15A 1OUKA 1EKFA 2XARA 2JITA 3PWDA 3WWJA 2F57A 1CKIA 2OKRA 3BV2A 4FV1A 5AA9A 2VTIA 4O7NA 4Q2AA 3A62A 1UV5A 4CNHA 3AC2A 4DEBA 4IHPA 3TUBA 4AZWA 4PBCA 1OKYA 3JY9A 1FVRA 4BZOA 3R83A 3WWHA 5FTGA 4M8TA 2IVVA 3HP5A 2C5OA 3UO4A 4EBVA 1XO2B 4U44A 4EH8A 2BZJA 2IPXA 3ML1A 3RGFA 1W8CA 5JEBA 3Q2MA 4BZDA 4YJNA 2NRYA 3NIEA 4MNFA 3PVGA 2JBOA 4IZ5A 1JSUA 4UCTA 1A48A 3KALA 4FL2A 4ALWA 3AT3A 1SVEA 2XIKA 3DXNA 4GFMA 5DN3A 3LLAA 2C6KA 3QKLA 5IQGA 4CKBA 2OSCA 3KK9A 3GCUA 2JDOA 2Z8CA