1KVAA

E. coli ribonuclease hi d134a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCAELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvaA00
1WNSA 4CEDA 1WN7A 2GBZA 3VQ7A 1BCMA 2DFEA 4FJ9A 3VQPA 3AA2A 4C8OA 4DQSA 4F8RA 3U6FA 3SQ1A 1LAVA 1SL2A 4FYDA 1RDDA 1CXQA 4DSKA 3VA0A 3L2QA 1JLQA 4DQRA 4DS5A 4FJ7A 3MECA 4IBNA 3QEIA 1HPZA 5CYQA 3D45A 1GOAA 3HJFA 1LAWA 3OYKA 1X1PA 3NE6A 3VQDA 4IDKA 1JLFA 1WSEA 3AVHA 1KVAA 4KHNA 4M42A 4IG0A 4CGGA 3MEEA 3O3HA 2Z1GA 3OYHA 3RRGA 2YHBA 4FZZA 1WSIA 2QKKA 2IGIA 2RKIA 3PUFA 4FLWA 4DLEA 1Q8IA 4B8CA 3LP2A 1IKWA 2VG5A 1YVUA 1RDAA 4I9QA 3LDSA 2FBVA 4Y1CA 4ELTA 2XY8A 4E0DA 4FJIA 4M3ZA 3ITHA 2HMIA 4EZ9A 5KI6A 1HJRA 3AVMA 5DMRA 3RR8A 3KKRA 1JLCA 1EP4A 3DOKA 1TV6A 4FM2A 1EX4A 3KD1E 1TAQA 4O5BA 3M8QA 3K5NA 4FLVA 4B9LA 4K8XA 4M3XA 1T03A 4E1MA 3VQAA 1B92A 4MFBA 3JSMA 1BHLA 4BE1A 4KHYA 1JLEA 3V9UA 4EZ6A 4W5NA 3VQ8A 4KTWA 4CJLA 4CE9A 1NK4A 4DTXA 3SYZA 2A1SA 3OYDA 3O4NA 4CIEA 4F2RA 4IKFA 4I7FA 2WONA 2KW4A 1ZBHA 1BI4B 1FXXA 4CFAA 2PYJA 5T7BA 4BE2A 4DTSA 3ZSRA 1RT3A 1QTMA 4FJNA 2FBTA 4RW9A 1BISA 1F21A 3VQCA 4AHUA 3M8RA 3SQ4A 3SQ2A 3BDPA 4C8NA 2O4IA 2KFNA 4CHZA 2HNYA 4RG8A 3RTVA 3CFRA 4FZYA 3K5OA 4B9TA 4ELUA 1J9AA 3SV4A 3C6TA 4N47A 3U3GA 3ZSWA 1RCHA 4M3WA 3AV9A 2BGGA 4GVMA 4FLXA 1HNIA 1ASVA 3OYCA 1BQMA 1WSJA 1WSFA 4FJHA 3DMJA 4M3YA 2B5JA 1HMVA 1S9GA 2WOMA 5JS2A 3ZSZA 3F73A 4I2PA 1KFDA 4O4GA 2E4LA 4CEOA 4DSFA 3SPYA 1ZBIA 4QOZB 1C1AA 3DOLA 1WLJA 4B08A 1C0TA 2R7YA 1NK5A 1REVA 4DSJA 4FXDA 4HVJA 1Q9YA 4GW6A 5HRSA 4QAGA 3TANA 1U45A 4CFDA 1Z26A 3NF7A 1Y97A 3I0RA 4FLTA 3NH1A 1DLOA 3DYAA 1A5VA 3RMBA 2JGUA 2QXFA 3DRPA 4FK4A 1BGXT 5SWMA 2KTQA 1C0MA 1LWEA 3OYBA 2HW3A 2NUBA 2OA8A 3QIOA 1BI4A 3NDKA 4FCYA 3TAFA 4OPJA 4Z4FA 1IH7A 3NF6A 1RNHA 4W5RA 4CHPA 4OPKA 4BDPA 4CK3A 3VQBA 2YHAA 5FRNA 4FJMA 3AVNA 2IOCA 1B9FA 4CF8A 4Q0BA 4KTQA 1LWFA 3MXIA 1DTQA 3O3FA 2XY5A 1SKSA 4N76A 4HUGA 3O3GA 1NK9A 4CJ5A 3OS1A 3ZSXA 4CERA 4CCHA 1UWBA 2D0AA 3ULDA 2HHTA 3UIQA 2Q3SA 4FJXA 2ZD1A 1KCFA 1RBUA 5CYMA 1HYVA 3I8DA 2A1RA 2PYLA 4KV8A 4NCBA 3KIOA 1TL1A 1KLNA 1EKEA 3VQ6A 4JS5A 1SKRA 4NCAA 1VSDA 2HVIA 2D0BA 3C6UA 2IDOA 5DK5A 4AH9A 3O4QA 4KB1A 2FBYA 3QNNA 1CZ9A 1QS4A 3V1OA 3NCIA 4KREA 4FLZA 2BE2A 2OPRA 3MXMA 2HHSA 1D5AA 4CFBA 4NCGA 1RT1A 3V4IA 4CIFA 1QSYA 1XWLA 4DSLA 3MXJA 4CGIA 3IG1A 4DTOA 3RMDA 1Q9XA 1VSFA 1J5OA 5HRPA 2F8TA 3OS2A 2XY7A 3QEWA 3NGZA 3SZ2A 3FFIA 1K6YA 1NK8A 3G10A 3LPUA 4N56A 2F8SA 1MU2A 4OVLA 4EP5A 4M3UA 2YNHA 2YV0X 1JL1A 4LH4A 4LH5A 1X9SA 4KI6A 3TAPA 4F3TA 2PY5A 1L3VA 3HK2A 1C1BA 4DQPA 1ASWA 3L3VA 1LW0A 4E7KA 4FJKA 3NF8A 4DFKA 3F9KA 1NK7A 3AO1A 3L2UA 1IG9A 4DQQA 3S3OA 3OYIA 2P5OA 1A5WA 3AVIA 3AO2A 1ITGA 3RRHA 1NKCA 2FBXA 1W9HA 3KK3A 5KRSA 3ZSVA 3L8BA 4DLGA 3ZT4A 4FJ8A 3KLIA 1VK0A 1I39A 4Z4CA 3AVAA 1J54A 1BIUA 3HPHA 3NBPA 4OGCA 3KLGA 2X74A 3AA4A 1RT2A 4BE0A 4F3OA 4R5PA 4CEQA 1S9EA 4DSIA 3K58A 2B6AA 5CY4A 3DI6A 3VQ5A 3DLRA 3V9XA 3T3FA 1IKYA 1NOZA 1D8YA 4F4KA 2YKNA 3QERA 3S3NA 5FROA 4W5TA 4B9UA 3PX6A 1EXQA 4BWMA 4AHVA 2ZQBA 1VRTA 4Z4IA 3CG7A 1S5JA 1ZBUA 2VG7A 3K2PA 2X6SA 4CGJA 3H08A 4CEFA 1NK0A 4E7IA 1S6QA 4AHSA 3D0PA 4DF4A 3P1GA 3QESA 1RBTA 3G0ZA 1YT3A 4KTZA 1JKHA 1VSEA 2JLEA 1U4BA 3DLGA 2KQ2A 3ZT2A 4Z4EA 4E89A 1WSHA 1KRPA 3OJUA 3PX0A 4PUOA 3MAQA 1NJZA 1L3UA 4KHSA 3HL8A 4DTMA 3SUQA 4M41A 1RTIA 2B4JA 3LP0A 1L3TA 3ZT0A 4CGDA 1TVRA 4BWJA 1VRUA 3DLHA 3CQ8A 1FKPA 1J53A 1RT6A 2P1JA 3ZT1A 2OYQA 1KSPA 4LSLA 1S6PA 4LY7A 3OYMA 4DWIA 1HNVA 4O0JA 4DG1A 4KPYA 3TAGA 3S3MA 2Z1HA 4OKJA 1RBVA 3V1QA 3MEGA 3M8SA 2HNDA 2KZMA 1S1TA 4DF8A 3EY1A 4Z4HA 1SL0A 3LWLA 1A5XA 3HO1A 3CYMA 3ALYA 1JLBA 4CJ4A 1QE1A 2RPIA 2OZSA 1HRHA 4ID1A 3ZSYA 3KLHA 3HXMA 4CECA 3TARA 2X6NA 1L3SA 4FVMA 4B9MA 4W5QA 2YNIA 1X9WA 1HYSA 4N41A 1WAFA 4CK2A 3KLEA 1BQNA 2GUIA 4PQUA 3V9SA 1KVBA 3WNGA 2G8IA 4YNQA 3NHGA 3P83D 2YKMA 3V9WA 3ZT3A 4J2BA 1RILA 3LP1A 2XHBA 2EHGA 2YNGA 3VQQA 1RT7A 2OPQA 3WNEA 2DFHA 1TL3A 4CGHA 4KHUA 3QO9A 2Z1IA 3HT3A 3VN5A 3TAEA 1NJXA 1QSLA 4DMNA 1ASUA 4Q5VA 1ZBLA 1I3AA 3OVNA 3A2FA 2RN2A 4CJTA 1NK6A 1U47A 2G8FA 4C8LA 4FJJA 4OLAA 1XHZA 1QSSA 2XY6A 3E01A 5HP1A 4IG3A 3THVA 4H4MA 2ATQA 2OPPA 3LAMA 4CHNA 4KI4A 4HUFA 4Z0UA 3AVCA 3OYEA 1KFSA 3VQ4A 4B9VA 5K14A 4CF1A 4LSNA 1SL1A 2AJQA 3AVJA 4CJ3A 4PA1A 5J1EA 3I0SA 3NH0A 2KZZA 3WNHA 3V6DA 4HHTA 5J2MA 1TKXA 4KKOA 1TK8A 3HSTB 3ZSOA 2HVHA 1NOYA 4CEEA 1BL3A 1VSJA 2OPSA 4K8ZA 4M3TA 1JLGA 2E6LA 2IAJA 3NF9A 5HRRA 4DU4A 2IC3A 4ZTFA 1RTDA 5HLFA 3WNFA 1RTHA 4FW2A 4G1QA 3KJVA 3TWHA 3QEXA 1X9MA 3SI6A 3LZIA 1TKDA 3RWUA 4J2DA 3K59A 1RT4A 2PZSA 3HPGA 3NAEA 1N5YA 3QETA 3T19A 4M45A 4RW8A 2QKBA 1CXUA 4KFBA 1L5UA 3KLFA 1BIZA 4O44A 5C25A 3B6PA 4DU1A 3IRXA 5FDLA 3C95A 2W42A 1VSHA 4HTUA 3V1RA 1YTUA 1WSGA 3RR7A 4TSXA 3SUNA 4W5OA 3L2VA 4Z4GA 3SPZA 4KRFA 1T8EA 4CJPA 3PX4A 1S1VA 4CHOA 1LV5A 1S1WA 1HYZA 5HRNA 4CJEA 3CM6A 3SQ0A 1D9FA 1UA0A 3VQ9A 2VG6A 2KFZA 3DLBA 4OKKA 3IS9A 2G8KA 1SV5A 4J2AA 1T05A 4O0IA 1QHTA 5KGWA 1VSIA 4DS4A 1UAXA 4CEBA 4CESA 4AILC 3RMCA 1TK5A 2P5GA 3L3UA 4ID5A 2HHWA 1U48A 3DRRA 3TR8A 4CJFA 4MQ3A 4LD0A 1C1CA 1CZBA 3KK1A 5EU7A 1IKXA 4UQGA 3V9ZA 2Y1IA 4CIGA 4KHQA 4RW4A 4CJKA 4FLYA 2HNZA 3OS0A 4FM0A 1ZYQA 1RT5A 4CF0A 2O4GA 4JRQA 4J2EA 3OJSA 4B8AB 3QLHA 1TKZA 4H4OA 3AVFA 1VSMA 1TKTA 5FRMA 5C24A 3AO3A 4XIUA 3EZ5A 2XRIA 1IKVA 4DQIA 2G8UA 4FLUA 1VSLA 2HHVA 4DU3A 2D5RA 3LWMA 5E41A 3HPOA 5JS1A 5SZTA 3KK2A 3LAKA 4OKEA 4RW6A 3OYAA 3OYNA 3MEDA 2BANA 1BCOA 5J2QA 5I3UA 1IO2A 3OYLA 4IFYA 3PO5A 4C8MA 4HCCA 3BGRA 1EETA 1YTAA 3HP9A 3HYFA 4CF2A 4CJRA 3NH2A 4AHTA 4BACA 3QNOA 2XO7A 3KTQA 3AA3A 2IS3A 4CJUA 1W0HA 3OYGA 4DFMA 2OZMA 3CFOA 4ELVA 4FM1A 4FK0A 1C6VA 3B6OA 2RF2A 3CFPA 1NKEA 3DLEA 1S1UA 2D0CA 4WE1A 4DTRA 3TABA 1RTJA 3ASMA 5I42A 4FJGA 1ZBFA 3VA3A 4CJQA 4E19A 4KHWA 4DSEA 1HQEA 3KD5E 4OLBA 4KO0A 3CM5A 4DTPA 1Z25A 4CFCA 4E7LA 2FC0A 2GV9A 2Z1JA 3HVRA 5D3GA 3PY8A 4CHYA 4FZXC 1WAJA 3TAMA 3SJJA 3ZSQA 2HHUA 2X78A 3V81A 1C0UA 1KLMA 4HUEA 4E7HA 3S9HA 2BDPA 3HP6A 1GOBA 2DTUA 1G15A 4GMJB 2HB5A 3SUOA 4CK1A 1T7PA 4CHQA 4JS4A 3AO5A 5KTQA 2Y1JA 3PO4A 4CEAA 3NFAA 1XI1A 1XC9A 3K57A 5CZ1A 4PY5A 1QQCA 4DTUA 1LWCA 1KVCA 4OJRA 4NYFA 4M3RA 5C42A 3PV8A 3IAYA 4Y1DA 3P5JA 2YNFA 2G8WA 1VSKA 3AVBA 4EP4A 1RDCA 3TI0A 4QCLA 2VWJA 5J2PA 3L2WA 3NGIA 3LPTA 4E1NA 4F2SA 3DRSA 4PWDA 4B9NA 3LANA 4CJSA 3SCXA 2G8HA 4I9LA 1RBSA 3DLKA 2I5JA 4FJ5A 4C8KA 3ZCMA 1NJWA 4IFVA 1TK0A 1HQUA 3EYZA 2ITGA 3HM9A 4BDZA 3AVGA 1LW2A 1B9DA 4FK2A 4B9SA 1D9DA 1DTTA 1U49A 1CLQA 1JXEA 3SV3A 2HHQA 4NYNA 2F96A 1O1WA 5HBMA 4AHRA 2ZE2A 4L8RB 3T1AA 1SUQA 1KTQA 2LSNA 1GOCA 1U04A 2E6MA 4CEZA 1FKOA 5KGXA 3OYFA 5HROA 1UA1A 1NJYA 1JL2A 3L2RA 3AVLA 1JLAA 3OY9A 3AO4A 4CJVA 4ICLA 1SKWA 3K5LA 3QEPA 4CF9A 3QIPA 3SUPA 2ETJA 1N6QA 1NKBA 2QK9A 3LALA 4DFJA 2DFFA 1RDBA 3QINA 4CJWA 3C94A 2EX3A 3LZJA 4DFPA 1RBRA 4YFUA 3NGYA 4AHCA 4FW1A 3OYJA 4FJLA 2HHXA 3RMAA 4BDYA 4H8KA 4DTNA 4CGFA 3AA5X 3K5MA 2DY4A 1TAUA 5KRTA 4ZTJA 4RW7A 4ZHRA 4I2QA 3U3YA 1TGOA 3SNNA 3M8PA 4KB0A 1FK9A 4DTJA 1XHXA 4N5SA 4JRPA 5CZ2A 3LP3A 3KKSA 3AVKA 4OGEA 4HCBA 4O55A 4E7JA 3HVTA 1R0AA 2VWKA 3QEVA 4KAZA 4E3SA 3ISNC 3JYTA 1S1XA 1UOCA 4JLHA 1JXBA 5J2NA 3VQEA 3DM2A 2G8VA 2P51A 4B3OA 3TAQA
chains in the Genus database with same CATH superfamily
1WNSA 4YOYA 4H5TA 3IKMA 3VQ7A 4DV6K 4FJ9A 1NGDA 3VQPA 4F8RA 1SL2A 1RDDA 3T1HK 4DSKA 3VEXA 4DS5A 4FJ7A 3QEIA 4H0YB 1HPZA 3D45A 1FW6A 1LAWA 3NE6A 1X1PA 4H5WA 3U4LA 2VQEK 3VQDA 4IDKA 5GAEP 3T7ZA 4CGGA 2Z1GA 4IEEA 5AZIA 4M7XA 5BR8K 3TTDA 4DKWA 1QQNA 1QHAA 4I9QA 2FBVA 3CCMN 3A5MC 4ILHA 3CCSN 3OA9A 1TV6A 3CC2N 3KD1E 3MN6A 1QQMA 3BZCA 3VENA 5ADXH 1B92A 3V9UA 2P9LA 4W5NA 4KTWA 4YDUC 3HI0A 1VQ6N 1NK4A 2YJEA 1IJJA 3SAFA 4IKFA 2WONA 1ZBHA 4CFAA 1HLUA 2I7NA 4BE2A 3ZSRA 1RT3A 1QTMA 2HBLA 1YI2N 4FJNA 3VQCA 1BISA 3M8RA 2KFNA 3PIOL 4LF9K 4CHZA 4DR2K 3K9JA 3HRGA 3C6TA 4GNIA 4N47A 2BGGA 4H0TB 3AV9A 2RHKA 4GVMA 3VF4A 4FLXA 3OYCA 3DMJA 1HMVA 5JLHA 2W40A 4CEOA 4O4GA 4DSFA 4FO0A 3DOLA 1WLJA 1NK5A 3VTHA 1T6CA 2V52B 4HVJA 1ESVA 4QAGA 3NF7A 4B1WB 1VHXA 4XH1A 4C23A 4JKFA 1BGXT 5M1OA 4B1YB 5LMUK 1NWKA 1K8AO 1IH7A 1RNHA 4CHPA 4CK3A 2YHAA 5KPRA 2P9KA 4EIAA 3KWGA 1B9FA 3CIPA 1LWFA 4BROA 4WQ4A 1SKSA 3VTIA 4CJ5A 4RCHA 2GELA 3OBWA 3ULDA 3GOIA 3K9KA 1RBUA 1HYVA 3HOTA 1QVGM 1KLNA 2ZF5O 2IDOA 5DK5A 4AH9A 3QMLA 1T44A 4KREA 1E3MA 1OKJA 3NCIA 5IWAK 1WBBA 2AP1A 4FOIA 2UUAK 3MK6A 2OPRA 2HHSA 4B1XB 3ZLJA 1D5AA 1NM1A 2HMPA 4DTOA 3RMDA 2F8SA 1NK8A 3ULEB 1MU2A 2E8AA 3K0SA 1JL1A 4KI6A 4CW7B 3HK2A 1VQLN 4DQPA 2AA4A 1M90O 1LW0A 4FJKA 3F9KA 1IG9A 3S3OA 3WQUA 4C1NK 3ZX0A 4I6MB 3UKUB 4FJ8A 1VK0A 1GLAG 3IFRA 4O5FA 1BIUA 4OGCA 2X74A 1RT2A 4BE0A 1S9EA 3GL1A 3O4WA 3O9UA 2IVNA 3VQ5A 2HBMA 3J81O 1IKYA 2YKNA 3QERA 4NLCA 3PX6A 1VRTA 4Z4IA 2O8DA 4RTFD 3W3DA 1IBMK 1BA0A 3P1GA 3QESA 1RBTA 4BR7A 1VSEA 3DLGA 3UKRA 1WSHA 2IVOA 1J5EK 2QM1A 3OJUA 3O9RA 3PX0A 3MAQA 1NJZA 4DTMA 2WC9A 1L3TA 3ZT0A 1NG9A 5CE3A 1QVFM 4IO8A 5AQXA 1VRUA 5BPNA 2A41A 2O8EB 1U2VB 4PKHA 4LY7A 4DWIA 3P38A 4O0JA 3AGKA 4KPYA 4X64K 3S3MA 3L4QA 2Z1HA 4WYBA 3V1QA 2P9NB 3MEGA 3M8SA 1YITN 3EY1A 3T1YK 3SMPA 4Z4HA 1SL0A 5KPTA 3QFPA 3HO1A 1A5XA 5A2QO 5AQNA 3CYMA 3ALYA 1HRHA 3ZSYA 1NLVA 3TARA 4FVMA 2YNIA 1X9WA 4BR4A 4CK2A 3KLEA 1BQNA 4PQUA 3V9SA 1KVBA 1TYQB 3P83D 4J2BA 3WNEA 2NLXA 3D7EO 3FLCO 3TAEA 4BG9A 4DR7K 4B1VA 5HL7L 5M1KA 3OVNA 3TPQA 1DT9A 4OLAA 1U47A 1XHZA 3E01A 5HP1A 2E5LK 2FSKA 3PIPL 2ATQA 2D0PA 1IBLK 3LAMA 2Q97A 1J6ZA 4HUFA 3SBTA 4Y0WA 4B9VA 1XQSC 1K8KB 4PA1A 2KZZA 3CF5L 4B3MK 1TKXA 1TK8A 3HSTB 4HTLA 3ZSOA 4BRAA 4CEEA 4CJ7A 3PSIA 1VSJA 4FWKA 3NF9A 5HRRA 4PHTX 4DU4A 3M1FA 3THWA 3TWHA 1KAZA 3RWUA 3LZIA 1RT4A 3HPGA 1N5YA 4DR5K 4GV3A 1L5UA 4G9ZA 2H3GX 3FZMA 3RSEA 4DU1A 4BRMA 3IRXA 5FDLA 2W42A 5I9EB 3SUNA 3ZEUB 4W5OA 1NBWA 3CM6A 1D9FA 1KAYA 1YUWA 2G8KA 1S3XA 1SV5A 1T05A 4O0IA 4DS4A 1VSIA 1TK5A 3S41A 5KQ8A 2HHWA 1VQ9N 3V9ZA 4CZLA 4XEIA 4FLYA 2HNZA 3OS0A 5AQIA 1KC8O 3OJSA 3AVFA 5FRMA 1TKTA 3C0BA 4XH4A 4XIUA 1BUPA 3EZ5A 4BC4A 3VETA 5HOOA 3MCPA 1VSLA 2D5RA 5JVHL 4O8KA 3WXLA 1OH7A 3CCEN 3KK7A 3LAKA 1BCOA 1IO2A 1WB9A 4HCCA 3NMUA 4C8MA 3SBGA 4PL8A 5BN8A 1YTAA 4CJRA 5LY3A 3NH2A 3D2FA 4BRFA 2NRVA 3AA3A 5AFUH 4FK0A 4FM1A 5M1FA 3HTVA 3VA3A 3D2EA 4JKDA 5LMNK 4E19A 3KD5E 1Z25A 4CFCA 2QW9A 2Z1JA 3HVRA 3PY8A 4FWNA 3SJJA 2HHUA 3V81A 1C0UA 1KLMA 3S9HA 4GMJB 2HB5A 1E4FT 2F7TA 5CZ1A 1LWCA 4Y1DA 3P5JA 2YNFA 5H1SQ 1DEJA 1VSKA 1W2BM 1JCGA 3BY5A 5J2PA 4E1NA 4CI6A 4PWDA 4I9LA 4CVNE 4BRHA 3AVGA 3M6GA 4FK2A 4B9SA 2Q2RA 1OVYA 1CLQA 1U2VA 1JXEA 2HHQA 1O1WA 5HBMA 2ZE2A 3WXKA 2W6LA 1KTQA 4M3ZA 1GOCA 5EOYA 4BR5A 3VEZA 5EX5A 1NJYA 1NGHA 1JLAA 4CJVA 2ITMA 4H0XB 2FF3B 1SKWA 3QIPA 3SUPA 2ETJA 3CCUN 3QINA 3C94A 2EX3A 3OYJA 4FJLA 3I56N 4H8KA 3JS6A 4CGFA 3K5MA 2DY4A 1TAUA 5FPDA 3N4QA 3P4IA 1TGOA 3MCAB 3Q7BA 4N5SA 4EHUA 4HCBA 3B8AX 3QEVA 3JYTA 1UOCA 5J2NA 5LJWA 2P51A 2HF4A 2GBZA 1NJIO 2OTJN 4JI3K 1JCEA 4H0PA 2FXUA 5JLFA 4C8OA 1CXQA 1RDUA 3VA0A 1JLQA 4IBNA 4CD3A 1VQ7N 2NRXA 3OYKA 1KD1O 4JI5K 3OYHA 2YHBA 1SZ2A 1OH6A 4B1ZA 4DLEA 3LP2A 4B3RK 1IKWA 2VG5A 1YVUA 2EWSA 4JKEA 1NGIA 1RDAA 3SAHA 3LDSA 4ELTA 4E0DA 5KI6A 3QICA 3AVMA 5DMRA 1QQOA 3MX2A 1JLCA 4H5RA 1OH8A 4NO7A 4FM2A 1EX4A 1TAQA 4FLVA 4B9LA 4E1MA 3VQAA 4BC2A 1BHLA 3O9QA 2Q1NA 4CE9A 4DTXA 4JD2B 3G4SN 5GAGP 4F2RA 4WQ5A 2KW4A 1FXXA 3ZETB 4DTSA 3NVMA 2D1KA 3EKUA 4IEIA 2QWRA 5GINA 2HNYA 3CQXA 4RG8A 3RTVA 4JI4K 3CJBA 4ELUA 1BDGA 2QWQA 4DQ8A 3U9ZA 1BO5O 4FJHA 3VEVA 4M3YA 2ZM6K 1JCFA 2WOMA 3CMEN 5JS2A 3ZSZA 2ASMA 2E4LA 3EZWA 5LJVA 1VQPN 4AQYK 4GKJK 2UUBK 4GW6A 3TANA 1S22A 1N36K 3TSPA 4CFDA 1Y97A 3HSCA 3DYAA 3ID8A 1A5VA 2QWNA 4NXMK 2JGUA 5BRDA 4IWVA 3C6HA 1N32K 3WXJA 1LWEA 4EHTA 3OYBA 4BRCA 2HW3A 2NUBA 3QIOA 3NDKA 3LDLA 3O08A 4O8UA 4OPJA 3PLAA 3QB0A 3BP8A 3VQBA 5FRNA 3AVNA 2WTUA 1HKBA 3BUZB 4KTQA 5FPEA 1DTQA 3O3FA 2XY5A 3O3GA 1NK9A 3R8EA 4DV1K 4CCHA 2ZWHA 4FJXA 2A1RA 1TL1A 2GX9A 3VQ6A 3L6QA 4C1NI 4ISEA 4MDBA 1VQNN 1RGIA 1CZ9A 3V1OA 3AAPA 3MXMA 3V4IA 4K43A 1XWLA 3RSEB 3IG1A 5M1PA 4CZGA 1VSFA 1J5OA 5HRPA 3THYB 3UB5A 4BRGA 3LPUA 4N56A 4KHPK 1N33K 2YNHA 2YV0X 4LH4A 3EL2A 4LH5A 1X9SA 4NXNK 3TAPA 4F3TA 5TKWA 4QS8A 1ASWA 4E7KA 4YOXA 3L2UA 1XUPO 4DQQA 2P9UB 1KXPA 3THXA 1ITGA 3RRHA 3KK3A 3ZT4A 3KLIA 4Z4CA 3AVAA 4BR9A 4M7YA 3KLGA 3CPWM 2RE2A 3AA4A 4YY3K 5BRHA 4CEQA 1NGJA 4DSIA 5CY4A 3V9XA 3T3FA 4U7BA 2FF6A 3R6MA 2O8FA 1D8YA 2I7PA 4F4KA 3S3NA 4B9UA 3J7AP 3K2PA 1S5JA 1ZBUA 4ILJA 4JAXA 2X6SA 3H08A 5IT9O 2E2NA 4KTZA 1YT3A 3G0ZA 4JKGB 3E9LA 2UUCK 3ZT2A 3BEXA 4FWOA 1KRPA 4KHSA 1L3UA 4WQ4C 3SUQA 2B4JA 4BQZA 3C7NA 3QBWA 1RT6A 2P1JA 3I8BA 3ZT1A 3LDOA 1KSPA 1HNVA 5AQTA 2NZTA 4IZ9A 2OANA 3T69A 1Q81O 1YVNA 2HNDA 4YOTA 3TSUA 1XC3A 1GLBG 1JLBA 3G6EN 2RPIA 1YHQN 3KLHA 2VGMA 4W5QA 4YDUA 1HYSA 1WAFA 1HKGA 2GUIA 4BVOA 3WNGA 2G8IA 2KLAA 3NHGA 1N8RO 5C0YA 3IUCA 2F4VK 3UKRB 2JWKA 3HT3A 1NJXA 3VN5A 5KQDA 2NNWA 1QSLA 2P9PB 1MDUB 5C2DA 1X3NA 1ZBLA 2Q36A 4FJJA 3MWTA 1WOQA 1ATRA 3LDQA 2XY6A 2OPPA 4JHDB 4CHNA 2JWLA 2HSTA 3OYEA 4BGBA 2GEMA 5BRFA 1SL1A 3AVJA 4CJ3A 3NH0A 3CCLN 1NGCA 4HHTA 1S72N 4KKOA 3JAMO 4JYAK 3CHWA 4V19S 5B8HA 2E6LA 4PKGA 2VYPA 1HKCA 4JK8A 5E26A 2IC3A 5HLFA 3WNFA 4G1QA 3SI6A 1TKDA 3K59A 2PZSA 4BR0A 1SS6A 1CXUA 3IDHA 3KLFA 4LF4K 1BIZA 3DWLA 3R3LA 3B6PA 5FPMA 1YTUA 4YORA 3V1RA 1WSGA 3RR7A 4TSXA 2UXDK 3L2VA 3J7ZO 1S1VA 1LV5A 1S1WA 3DXKB 1RFQA 4GY2B 4BREA 4CJEA 3SQ0A 3VQ9A 3DXKA 5C12A 3DLBA 3AY9A 1QHTA 5KGWA 1UAXA 1G99A 2P5GA 4ID5A 3DRRA 3CETA 3FFKB 1TUUA 4CJFA 4LD0A 1C1CA 3KK1A 1JJ2M 5EU7A 4K41A 4UQGA 4KHQA 4RW4A 1ZYQA 1FJGK 2O4GA 4BRDA 4AM7A 5AQGA 5AZJA 4B8AB 1TKZA 4DCHA 5C24A 3AO3A 2XRIA 5ADXA 3CD6N 5AQVA 1MWMA 1EO1A 2HHVA 4FWLA 3HPOA 1T6DA 4ILGB 3FE1A 3A0IX 4OKEA 3LDPA 3OYAA 3MEDA 4A5BA 3BGRA 1EETA 2D0OA 4CF2A 5GIPA 4XH5A 3SMSA 4AHTA 3QBXA 3KTQA 3CFOA 2Q0UA 1W7AA 3B6OA 2CH5A 3CCQN 1S1UA 3TABA 4DV2K 5I42A 4FJGA 4CJQA 4KHWA 4DV5K 1HQEA 4JK9A 3CM5A 1XMQK 2P9PA 4E7LA 3ENBA 2QWMA 2GV9A 1WUAA 3CJ9A 3GG4A 4FZXC 2CGJA 4E7HA 1X3MA 3HOSA 3SUOA 4CHQA 2Y1JA 1XC9A 3K57A 5ELZA 4E1JA 5C42A 1EQYA 3IAYA 2UU9K 2A5XA 1GLLO 3DJCA 5F1XA 3SAGA 1RDCA 3TI0A 2P9LB 3TSQA 4YOWA 2VWJA 3LPTA 5AQWA 1IV0A 4F2SA 3DRSA 4B3OA 2HHHK 4B9NA 1VQ5N 4FXDA 3QFUA 3ZYYX 1NJWA 3I33A 4IFVA 3EYZA 4BDZA 1NMDA 3L4IA 1D9DA 2QA4N 4AHRA 4L8RB 5TKYA 1SUQA 2LSNA 1U04A 1UA1A 4CEZA 5C15A 3L2RA 3CC7N 5DM6L 4ICLA 2P9IA 3J7YP 3K5LA 1Q86O 3MN9A 4CF9A 1N6QA 1YIJN 3LZJA 4DFPA 1RBRA 2HHXA 4YOVA 3U8XA 3EE8A 3RMAA 3AA5X 1C0FA 4AF1A 5M1NA 4ZTJA 1QZ6A 4RW7A 3O8MA 2VQFK 4ZHRA 3SNNA 3U3YA 4F9OA 3M8PA 3CPEA 4QS7A 3H46O 4WFAL 1Q82O 1K73O 5CZ2A 3RVCA 3KKSA 4WFNL 3AVKA 4O55A 4E7JA 3HVTA 4KAZA 1S1XA 3DM2A 1S6QA 3THXB 1GLCG 4CEDA 1WN7A 3CMAN 1VQKN 1QZ5A 3U6FA 4FVUA 3O9TA 3EKSA 3L2QA 3MECA 2NRTA 5CYQA 3THYA 4IOXA 1WSEA 3MDQA 3AVHA 1KVAA 4IG0A 2P9IB 2A6AA 3RRGA 4FZZA 1WSIA 4FOEA 2IGIA 2PBDA 2RKIA 4FLWA 1Q8IA 4NLBA 4B8CA 2NRRA 4BC5A 4FJIA 1W97L 4MO5A 3ITHA 2HBKA 2HMIA 4EZ9A 3DOKA 4A61A 4GV9A 3AARA 3K5NA 4MFBA 4BE1A 4KHYA 1JLEA 4EZ6A 3LL3A 3VQ8A 4CJLA 5FPNA 2A1SA 3OYDA 3O4NA 1C0GA 2YHWA 4I7FA 1BI4B 1Z6RA 5BN9A 2F9TA 3VGKA 3E9PA 3WQTA 4RW9A 3BDPA 1F21A 4AHUA 5AQSA 3SQ2A 2O4IA 1ZBSA 4BQLA 4FZYA 3K5OA 1J9AA 3SV4A 3ZSWA 3A5LC 2KHOA 3F2KA 1S9GA 4BR2A 3F73A 3SK3A 3CC4N 1KFDA 1ZBIA 3ZX3A 4B08A 2R7YA 3KVGA 1REVA 1Q9YA 2ZJQL 1VAZA 5HRSA 1U45A 2WFBA 4FLTA 3I0RA 3NH1A 4DV0K 1DLOA 4FK4A 3DRPA 4IFEA 3U9DA 4JKCA 2E2OA 3TAFA 3NF6A 4W5RA 4KBOA 4JD2A 4BDPA 1M1KO 4FJMA 3WXIA 5AZJB 1EWRA 4Q0BA 3MXIA 4JV5K 4N76A 4CBXA 3OS1A 3ZSXA 1UWBA 2HHTA 4BRQA 3KZBA 2PYLA 3I8DA 1GLFO 3KIOA 1NGFA 2BTFA 4GV6A 4JS5A 1BOTO 1SKRA 4NCAA 2HVIA 1YJ9N 4KB1A 2FLOA 3QNNA 3GBTA 2P9SA 2BE2A 1P90A 4CBWA 1RT1A 4CIFA 3MXJA 4CGIA 2F8TA 3VPZA 3OS2A 2GWJA 3NGZA 3SZ2A 3FFIA 1BA1A 1K6YA 2D4WA 3F9MA 4GKKK 2CGLA 4M3UA 3A5OC 4OX9K 2PY5A 5BPMA 1L3VA 4LFAK 2PAVA 5JICA 1BG3A 3L3VA 4DFKA 3AO1A 4FPAA 1A5WA 4LF5K 1LCUA 4DR6K 2FBXA 4IO9L 4DLGA 5AQZA 3HPHA 1MA9B 3NBPA 4OPHA 4F3OA 4R5PA 3OTOK 4JHDA 5GIOA 2B6AA 2HBJA 3DLRA 3H1QA 1MWKA 1NOZA 2W41A 4BWMA 1VQ8N 4CGJA 2O8CA 4PKIA 3OBYA 4E7IA 4AHSA 3D0PA 3R1XA 1JKHA 2JLEA 4DUZK 5EY4A 4Z4EA 3M3ZA 3HL8A 2E20A 5AQOA 4CGDA 1YAGA 3SJHA 1XNRK 3DLHA 3CQ8A 1FKPA 1J53A 2NRZA 3IMXA 1BWFO 2OYQA 1S6PA 4YHHK 4DG1A 4KH6A 3DXMA 1OH5A 4OKJA 1RBVA 3VEOA 4Z94A 2E2QA 2KZMA 4DF8A 4NB4A 2O8BB 5M1QA 2FSJA 4CJ4A 4WQ5C 1QE1A 2OZSA 4CECA 2X6NA 5BR9A 4B9MA 4MDAA 4KH5A 3JXUA 4ISFA 4N41A 5F0XA 1N34K 3ZT3A 1RILA 3LP1A 4FWRA 2EHGA 1DKGD 3VQQA 1RT7A 1TL3A 4CGHA 4KHUA 4JKGA 2Z1IA 4U67L 3O9SA 2UYTA 1HX1A 1D4XA 4BC3A 2RN2A 2G8FA 2CH6A 1NGEA 3J80O 4IG3A 4H4MA 4CBUA 2O8FB 4JI7K 4Z0UA 1KFSA 4CF1A 4LSNA 3WNHA 3V6DA 3HBTA 5J2MA 1HJOA 3WEEB 1NOYA 1BL3A 2OPSA 4M3TA 2IAJA 4JI8K 2ASPA 4ZTFA 4FW2A 1X9MA 4J2DA 3BF3A 3T19A 2QKBA 4KFBA 2OTLN 4LFBK 4LF7K 3EO3A 3OHRA 4LF8K 1H1VA 3C95A 4M63C 1VSHA 4HTUA 3SLCA 3VMFB 4DR3K 3AGRA 3FZFA 1HNZK 3SPZA 4KRFA 4BGAA 4CJPA 3PX4A 1HYZA 5HRNA 1UA0A 4J2AA 4OKKA 3IS9A 2DPNA 2YCHA 3ZEUA 4CEBA 4CESA 3L3UA 2VGNA 4FWQA 1U48A 4BVPA 1CZBA 1NMNA 1IKXA 3NVKA 4CIGA 2UXCK 1GLJO 2VCPA 4H5NA 4WF9L 5AQHA 4J2EA 4IOCL 3QLHA 4EAHD 1VSMA 4X62K 3THWB 3LM9A 4FLUA 4IJAA 1X9JA 4DU3A 5E41A 5SZTA 3WUHA 3CJCA 3ZX2A 4FWSA 1IBKK 3KK2A 4RW6A 2BANA 5J2QA 3CERA 3M5RA 4IFYA 1K8KA 3HP9A 3HYFA 2XO7A 2IS3A 4CJUA 1W0HA 4DFMA 4ELVA 4B3TK 2PFUA 3CXCM 4H0VB 1NKEA 3DLEA 1RTJA 3ASMA 3QDKA 1ZBFA 4HWIA 1V4SA 1ATSA 5E84A 4DTPA 2FC0A 2YI1A 3O1BA 5D3GA 1WAJA 3TAMA 3ZSQA 2X78A 3FGUA 4HUEA 3VESA 4IXCA 1G15A 1KQSM 4JS4A 1LOTB 5KTQA 3PO4A 2E1ZA 3ZETA 1NGAA 2ZJPL 2NRHA 4QCLA 4JI6K 2O8BA 4CZFA 2ZGZA 2A40A 3OW2M 2P9NA 3DLKA 2I5JA 1TK0A 3DXMB 3HM9A 2QI2A 1TUYA 4B9QA 3VF2A 4K42A 1DTTA 1U49A 4DB3A 3EEQA 2O8EA 4NYNA 1Y64A 2E6MA 1FKOA 1NNEA 1OVQA 2IIRA 1IG8A 3AO4A 4FSVA 4GVEA 3GE1A 2QK9A 4DFJA 4CJWA 4YFUA 3NGYA 4AHCA 4L3QA 2O8DB 3HZ6A 2A42A 4DTNA 1U6ZA 4I2QA 3Q7CA 4KB0A 4CZHA 1FK9A 4K0KK 4JKBA 3H6EA 3O80A 3UE5A 1GLDG 1R0AA 2VWKA 3FZKA 5JVGL 5AFUA 1BU6O 2GUPA 3ISNC 3UKUA 1JXBA 3VQEA 4IOAL 1Q7YO 2ZJRL 1BCMA 2DFEA 3AA2A 4DR4K 4DQSA 3SQ1A 1LAVA 5BPLA 4FYDA 4DQRA 3ULEA 4BRNA 1GOAA 3HJFA 1JLFA 4YOUA 4JN4A 4KHNA 4M42A 3P31A 4BG8A 3E1YA 5C10A 3CQYA 3MEEA 4BRLA 3O3HA 2QKKA 3PUFA 4FPBA 4OPAA 1K9MO 2Q0RA 4Y1CA 2XY8A 1NGGA 3BF1A 2UXBK 2CGKA 1HJRA 3RR8A 1V4TA 3KKRA 1EP4A 3WT0A 4JI1K 3WXMB 4O5BA 3M8QA 2QTDA 3N4PA 4K8XA 4M3XA 1T03A 3JSMA 4JI0K 5AQQA 2P9KB 3SYZA 3CCVN 4CIEA 2J4RA 2PYJA 5T7BA 3C65A 2FBTA 3SQ4A 1VQ4N 4C8NA 3O6WA 4PL7A 3CFRA 4B9TA 4CZMA 3R9PA 3U3GA 4M3WA 1RCHA 1HNIA 1ASVA 1BQMA 1WSJA 1WSFA 1YF5L 2F9WA 2B5JA 3D2EB 4I2PA 1YJWN 4QOZB 3SPYA 1C1AA 4DSJA 1C0TA 2OCEA 3E9OA 1Z26A 1RDWX 3D2FB 1NU0A 5CR4A 3RMBA 4H5VA 2QXFA 2KTQA 5SWMA 1C0MA 5GAHP 5AQJA 4IDHA 1Q18A 2OA8A 1BI4A 3VERA 5BREA 4FCYA 3O5BA 3CJ7A 4Z4FA 4OPKA 5F2RA 2HOEA 3GDQA 4CZKA 2IOCA 4CF8A 4JEPA 1VQMN 3CJAA 4X65K 4HUGA 3MN5A 2E2PA 4CERA 3LDNA 3VOVA 2D0AA 3UIQA 2Q3SA 2FSNA 2ZD1A 1KCFA 5CYMA 4NCBA 4KV8A 3FZLA 1EKEA 4ISGA 1VSDA 3C6AA 4A57A 2D0BA 3C6UA 3O4QA 4EFHA 4B3SK 2FBYA 4K25A 1QS4A 4FLZA 4JNEA 5AZIB 2NRWA 1GLEG 4CFBA 4NCGA 1QSYA 3LM2A 4DSLA 1Q9XA 2XY7A 3QEWA 3G10A 4OVLA 4RWTA 4EP5A 3AAQA 4H0OA 5AQLA 2GWKA 1C1BA 3NF8A 1NK7A 1VQON 3OYIA 2P5OA 1EWQA 3AVIA 3AO2A 3WEEA 1NKCA 1W9HA 4A62A 5KRSA 3ZSVA 3L8BA 2V51B 1I39A 1J54A 2QWLA 3K58A 3DI6A 5DM7L 5FROA 4W5TA 1EXQA 2BUPA 2V7ZA 4AHVA 2ZQBA 2QWOA 3VGMA 2VG7A 3CG7A 2GTDA 4CEFA 1NK0A 4DF4A 1WBDA 3TU5A 4FL9A 3EE9A 1U4BA 2KQ2A 5FLXO 2Q31A 4E89A 1ATNA 3D6RA 4PUOA 5AQPA 4X66K 1TYQA 2HF3A 3MWPA 2WBNA 3O1WA 1RTIA 3LP0A 4M41A 1P8ZA 1TVRA 4BWJA 2YHXA 1SAZA 4H03B 4LSLA 3OYMA 1Z05A 4CZJA 3TAGA 4QS9A 2E1YA 4CD1A 3ENOA 4CZIA 5AR0A 1S1TA 5EXWA 4WFBL 3LWLA 4LC9B 4JKAA 4ID1A 3HXMA 1L3SA 5AQKA 3H3NO 5C2FA 4DHYA 2ZGYA 1XNQK 5CHIA 4YNQA 3BZKA 3E66A 4DV7K 2YKMA 3V9WA 2XHBA 2YNGA 1HNWK 5AQFA 1O13A 1ZXOA 2OPQA 2DFHA 3HM8A 3QO9A 3ID6A 3MX5A 4DMNA 1ASUA 2A3ZA 3VF6A 4Q5VA 1DGKN 1I3AA 2O8CB 3A2FA 3H1VX 4IJNA 4A59A 4CJTA 1NK6A 4C8LA 4UY8O 3H3OB 1QSSA 4A2AA 3THVA 3CCJN 2YHYA 5MLCQ 4DV4K 4KH4A 4KI4A 4JKHA 3AVCA 2AJQA 3VQ4A 3VEYA 5K14A 5J1EA 3I0SA 5KPZA 4I6MA 2HVHA 4K8ZA 1JLGA 3FZHA 3I55N 3ATUA 3KWIA 1RTDA 1RTHA 3KJVA 3QEXA 3H45C 3NAEA 3QETA 4M45A 5AQRA 4RW8A 3F5TA 1ZC6A 4O44A 5C25A 2WUSA 5EVZA 4OO1J 4A2BA 2VWBA 3TTCA 4Z4GA 2BH1A 3MMVA 1T8EA 4CHOA 2P9SB 4MLHA 3CI5A 2VG6A 2KFZA 2W6KA 1T7PA 3RMCA 4AILC 1YXQA 3MN7A 3TR8A 1I94K 4MQ3A 5AQUA 5LL6Z 2Y1IA 1T3VA 4CJKA 4FM0A 1RT5A 4CF0A 4JRQA 4H4OA 1IKVA 4DQIA 2G8UA 2QEXN 4LFCK 3LWMA 2KKZA 5JS1A 3ENHA 1ILYA 3OYNA 4JI2K 5I3UA 3OYLA 3PO5A 1KAXA 4BACA 3QNOA 3OYGA 2OZMA 4AM6A 4BRIA 1C6VA 3J8AA 2RF2A 3CFPA 4BY9C 4DTRA 2D0CA 4WE1A 5AQMA 4CZEA 4LF6K 2QWPA 4MO4A 4DSEA 3A8YA 4OLBA 4KO0A 3KHYA 4CHYA 4DV3K 1SQKA 4FWPA 2BDPA 3W0LA 3HP6A 1GOBA 2DTUA 4J8FA 2IVPA 4CK1A 3AO5A 5JMVA 4CEAA 3NFAA 1XI1A 4A5AA 4PY5A 1QQCA 1HUXA 3FR0A 4DTUA 4DUYK 1KVCA 4OJRA 4NYFA 4M3RA 3PV8A 4FWMA 5AJ3K 2G8WA 3AVBA 4EP4A 2YJFA 3L0QA 3DLLL 3L2WA 3NGIA 3A5NC 3VGLA 4B1UB 3LANA 4CJSA 3TTFA 3SCXA 2G8HA 1RBSA 1XMOK 2E88A 3ZCMA 4C8KA 4FJ5A 1HQUA 2ITGA 1LW2A 1B9DA 1HNXK 1R59O 1YJNN 3SV3A 2F96A 1CZAN 5AQYA 2YX6A 3C7NB 3T1AA 5KGXA 3OYFA 5HROA 1JL2A 3PSFA 3AVLA 3DAWA 3OY9A 4JK7A 1NGBA 2QXLA 3QEPA 3CCRN 1NKBA 5GADP 3LALA 2DFFA 1RDBA 3P39A 4FW1A 1E4GT 4BRKA 4BDYA 3EN9A 3G71N 3VEWA 5KRTA 4WCEL 4MLEA 4DTJA 1XHXA 2V7YA 4JRPA 4DR1K 3LP3A 3CJ1A 4R79A 2ASOA 3ATVA 4OGEA 1HR0K 1HPMA 4E3SA 4BRPA 4JLHA 3G25A 2G8VA 2P9UA 3TAQA
chains in the Genus database with same CATH topology
1WNSA 4CEDA 1WN7A 2GBZA 3VQ7A 1BCMA 2DFEA 4FJ9A 3VQPA 3AA2A 4C8OA 4DQSA 4F8RA 3U6FA 3SQ1A 1LAVA 1SL2A 4FYDA 1RDDA 1CXQA 4DSKA 3VA0A 3L2QA 1JLQA 4DQRA 4DS5A 4FJ7A 3MECA 4IBNA 3QEIA 1HPZA 5CYQA 3D45A 1GOAA 3HJFA 1LAWA 3OYKA 1X1PA 3NE6A 3VQDA 4IDKA 1JLFA 1WSEA 3AVHA 1KVAA 4KHNA 4M42A 4IG0A 4CGGA 3MEEA 3O3HA 2Z1GA 3OYHA 3RRGA 2YHBA 4FZZA 1WSIA 2QKKA 2IGIA 2RKIA 3PUFA 4FLWA 4DLEA 1Q8IA 4B8CA 3LP2A 1IKWA 2VG5A 1YVUA 1RDAA 4I9QA 3LDSA 2FBVA 4Y1CA 4ELTA 2XY8A 4E0DA 4FJIA 4M3ZA 3ITHA 2HMIA 4EZ9A 5KI6A 1HJRA 3AVMA 5DMRA 3RR8A 3KKRA 1JLCA 1EP4A 3DOKA 1TV6A 4FM2A 1EX4A 3KD1E 1TAQA 4O5BA 3M8QA 3K5NA 4FLVA 4B9LA 4K8XA 4M3XA 1T03A 4E1MA 3VQAA 1B92A 4MFBA 3JSMA 1BHLA 4BE1A 4KHYA 1JLEA 3V9UA 4EZ6A 4W5NA 3VQ8A 4KTWA 4CJLA 4CE9A 1NK4A 4DTXA 3SYZA 2A1SA 3OYDA 3O4NA 4CIEA 4F2RA 4IKFA 4I7FA 2WONA 2KW4A 1ZBHA 1BI4B 1FXXA 4CFAA 2PYJA 5T7BA 4BE2A 4DTSA 3ZSRA 1RT3A 1QTMA 4FJNA 2FBTA 4RW9A 1BISA 1F21A 3VQCA 4AHUA 3M8RA 3SQ4A 3SQ2A 3BDPA 4C8NA 2O4IA 2KFNA 4CHZA 2HNYA 4RG8A 3RTVA 3CFRA 4FZYA 3K5OA 4B9TA 4ELUA 1J9AA 3SV4A 3C6TA 4N47A 3U3GA 3ZSWA 1RCHA 4M3WA 3AV9A 2BGGA 4GVMA 4FLXA 1HNIA 1ASVA 3OYCA 1BQMA 1WSJA 1WSFA 4FJHA 3DMJA 4M3YA 2B5JA 1HMVA 1S9GA 2WOMA 5JS2A 3ZSZA 3F73A 4I2PA 1KFDA 4O4GA 2E4LA 4CEOA 4DSFA 3SPYA 1ZBIA 4QOZB 1C1AA 3DOLA 1WLJA 4B08A 1C0TA 2R7YA 1NK5A 1REVA 4DSJA 4FXDA 4HVJA 1Q9YA 4GW6A 5HRSA 4QAGA 3TANA 1U45A 4CFDA 1Z26A 3NF7A 1Y97A 3I0RA 4FLTA 3NH1A 1DLOA 3DYAA 1A5VA 3RMBA 2JGUA 2QXFA 3DRPA 4FK4A 1BGXT 5SWMA 2KTQA 1C0MA 1LWEA 3OYBA 2HW3A 2NUBA 2OA8A 3QIOA 1BI4A 3NDKA 4FCYA 3TAFA 4OPJA 4Z4FA 1IH7A 3NF6A 1RNHA 4W5RA 4CHPA 4OPKA 4BDPA 4CK3A 3VQBA 2YHAA 5FRNA 4FJMA 3AVNA 2IOCA 1B9FA 4CF8A 4Q0BA 4KTQA 1LWFA 3MXIA 1DTQA 3O3FA 2XY5A 1SKSA 4N76A 4HUGA 3O3GA 1NK9A 4CJ5A 3OS1A 3ZSXA 4CERA 4CCHA 1UWBA 2D0AA 3ULDA 2HHTA 3UIQA 2Q3SA 4FJXA 2ZD1A 1KCFA 1RBUA 5CYMA 1HYVA 3I8DA 2A1RA 2PYLA 4KV8A 4NCBA 3KIOA 1TL1A 1KLNA 1EKEA 3VQ6A 4JS5A 1SKRA 4NCAA 1VSDA 2HVIA 2D0BA 3C6UA 2IDOA 5DK5A 4AH9A 3O4QA 4KB1A 2FBYA 3QNNA 1CZ9A 1QS4A 3V1OA 3NCIA 4KREA 4FLZA 2BE2A 2OPRA 3MXMA 2HHSA 1D5AA 4CFBA 4NCGA 1RT1A 3V4IA 4CIFA 1QSYA 1XWLA 4DSLA 3MXJA 4CGIA 3IG1A 4DTOA 3RMDA 1Q9XA 1VSFA 1J5OA 5HRPA 2F8TA 3OS2A 2XY7A 3QEWA 3NGZA 3SZ2A 3FFIA 1K6YA 1NK8A 3G10A 3LPUA 4N56A 2F8SA 1MU2A 4OVLA 4EP5A 4M3UA 2YNHA 2YV0X 1JL1A 4LH4A 4LH5A 1X9SA 4KI6A 3TAPA 4F3TA 2PY5A 1L3VA 3HK2A 1C1BA 4DQPA 1ASWA 3L3VA 1LW0A 4E7KA 4FJKA 3NF8A 4DFKA 3F9KA 1NK7A 3AO1A 3L2UA 1IG9A 4DQQA 3S3OA 3OYIA 2P5OA 1A5WA 3AVIA 3AO2A 1ITGA 3RRHA 1NKCA 2FBXA 1W9HA 3KK3A 5KRSA 3ZSVA 3L8BA 4DLGA 3ZT4A 4FJ8A 3KLIA 1VK0A 1I39A 4Z4CA 3AVAA 1J54A 1BIUA 3HPHA 3NBPA 4OGCA 3KLGA 2X74A 3AA4A 1RT2A 4BE0A 4F3OA 4R5PA 4CEQA 1S9EA 4DSIA 3K58A 2B6AA 5CY4A 3DI6A 3VQ5A 3DLRA 3V9XA 3T3FA 1IKYA 1NOZA 1D8YA 4F4KA 2YKNA 3QERA 3S3NA 5FROA 4W5TA 4B9UA 3PX6A 1EXQA 4BWMA 4AHVA 2ZQBA 1VRTA 4Z4IA 3CG7A 1S5JA 1ZBUA 2VG7A 3K2PA 2X6SA 4CGJA 3H08A 4CEFA 1NK0A 4E7IA 1S6QA 4AHSA 3D0PA 4DF4A 3P1GA 3QESA 1RBTA 3G0ZA 1YT3A 4KTZA 1JKHA 1VSEA 2JLEA 1U4BA 3DLGA 2KQ2A 3ZT2A 4Z4EA 4E89A 1WSHA 1KRPA 3OJUA 3PX0A 4PUOA 3MAQA 1NJZA 1L3UA 4KHSA 3HL8A 4DTMA 3SUQA 4M41A 1RTIA 2B4JA 3LP0A 1L3TA 3ZT0A 4CGDA 1TVRA 4BWJA 1VRUA 3DLHA 3CQ8A 1FKPA 1J53A 1RT6A 2P1JA 3ZT1A 2OYQA 1KSPA 4LSLA 1S6PA 4LY7A 3OYMA 4DWIA 1HNVA 4O0JA 4DG1A 4KPYA 3TAGA 3S3MA 2Z1HA 4OKJA 1RBVA 3V1QA 3MEGA 3M8SA 2HNDA 2KZMA 1S1TA 4DF8A 3EY1A 4Z4HA 1SL0A 3LWLA 1A5XA 3HO1A 3CYMA 3ALYA 1JLBA 4CJ4A 1QE1A 2RPIA 2OZSA 1HRHA 4ID1A 3ZSYA 3KLHA 3HXMA 4CECA 3TARA 2X6NA 1L3SA 4FVMA 4B9MA 4W5QA 2YNIA 1X9WA 1HYSA 4N41A 1WAFA 4CK2A 3KLEA 1BQNA 2GUIA 4PQUA 3V9SA 1KVBA 3WNGA 2G8IA 4YNQA 3NHGA 3P83D 2YKMA 3V9WA 3ZT3A 4J2BA 1RILA 3LP1A 2XHBA 2EHGA 2YNGA 3VQQA 1RT7A 2OPQA 3WNEA 2DFHA 1TL3A 4CGHA 4KHUA 3QO9A 2Z1IA 3HT3A 3VN5A 3TAEA 1NJXA 1QSLA 4DMNA 1ASUA 4Q5VA 1ZBLA 1I3AA 3OVNA 3A2FA 2RN2A 4CJTA 1NK6A 1U47A 2G8FA 4C8LA 4FJJA 4OLAA 1XHZA 1QSSA 2XY6A 3E01A 5HP1A 4IG3A 3THVA 4H4MA 2ATQA 2OPPA 3LAMA 4CHNA 4KI4A 4HUFA 4Z0UA 3AVCA 3OYEA 1KFSA 3VQ4A 4B9VA 5K14A 4CF1A 4LSNA 1SL1A 2AJQA 3AVJA 4CJ3A 4PA1A 5J1EA 3I0SA 3NH0A 2KZZA 3WNHA 3V6DA 4HHTA 5J2MA 1TKXA 4KKOA 1TK8A 3HSTB 3ZSOA 2HVHA 1NOYA 4CEEA 1BL3A 1VSJA 2OPSA 4K8ZA 4M3TA 1JLGA 2E6LA 2IAJA 3NF9A 5HRRA 4DU4A 2IC3A 4ZTFA 1RTDA 5HLFA 3WNFA 1RTHA 4FW2A 4G1QA 3KJVA 3TWHA 3QEXA 1X9MA 3SI6A 3LZIA 1TKDA 3RWUA 4J2DA 3K59A 1RT4A 2PZSA 3HPGA 3NAEA 1N5YA 3QETA 3T19A 4M45A 4RW8A 2QKBA 1CXUA 4KFBA 1L5UA 3KLFA 1BIZA 4O44A 5C25A 3B6PA 4DU1A 3IRXA 5FDLA 3C95A 2W42A 1VSHA 4HTUA 3V1RA 1YTUA 1WSGA 3RR7A 4TSXA 3SUNA 4W5OA 3L2VA 4Z4GA 3SPZA 4KRFA 1T8EA 4CJPA 3PX4A 1S1VA 4CHOA 1LV5A 1S1WA 1HYZA 5HRNA 4CJEA 3CM6A 3SQ0A 1D9FA 1UA0A 3VQ9A 2VG6A 2KFZA 3DLBA 4OKKA 3IS9A 2G8KA 1SV5A 4J2AA 1T05A 4O0IA 1QHTA 5KGWA 1VSIA 4DS4A 1UAXA 4CEBA 4CESA 4AILC 3RMCA 1TK5A 2P5GA 3L3UA 4ID5A 2HHWA 1U48A 3DRRA 3TR8A 4CJFA 4MQ3A 4LD0A 1C1CA 1CZBA 3KK1A 5EU7A 1IKXA 4UQGA 3V9ZA 2Y1IA 4CIGA 4KHQA 4RW4A 4CJKA 4FLYA 2HNZA 3OS0A 4FM0A 1ZYQA 1RT5A 4CF0A 2O4GA 4JRQA 4J2EA 3OJSA 4B8AB 3QLHA 1TKZA 4H4OA 3AVFA 1VSMA 1TKTA 5FRMA 5C24A 3AO3A 4XIUA 3EZ5A 2XRIA 1IKVA 4DQIA 2G8UA 4FLUA 1VSLA 2HHVA 4DU3A 2D5RA 3LWMA 5E41A 3HPOA 5JS1A 5SZTA 3KK2A 3LAKA 4OKEA 4RW6A 3OYAA 3OYNA 3MEDA 2BANA 1BCOA 5J2QA 5I3UA 1IO2A 3OYLA 4IFYA 3PO5A 4C8MA 4HCCA 3BGRA 1EETA 1YTAA 3HP9A 3HYFA 4CF2A 4CJRA 3NH2A 4AHTA 4BACA 3QNOA 2XO7A 3KTQA 3AA3A 2IS3A 4CJUA 1W0HA 3OYGA 4DFMA 2OZMA 3CFOA 4ELVA 4FM1A 4FK0A 1C6VA 3B6OA 2RF2A 3CFPA 1NKEA 3DLEA 1S1UA 2D0CA 4WE1A 4DTRA 3TABA 1RTJA 3ASMA 5I42A 4FJGA 1ZBFA 3VA3A 4CJQA 4E19A 4KHWA 4DSEA 1HQEA 3KD5E 4OLBA 4KO0A 3CM5A 4DTPA 1Z25A 4CFCA 4E7LA 2FC0A 2GV9A 2Z1JA 3HVRA 5D3GA 3PY8A 4CHYA 4FZXC 1WAJA 3TAMA 3SJJA 3ZSQA 2HHUA 2X78A 3V81A 1C0UA 1KLMA 4HUEA 4E7HA 3S9HA 2BDPA 3HP6A 1GOBA 2DTUA 1G15A 4GMJB 2HB5A 3SUOA 4CK1A 1T7PA 4CHQA 4JS4A 3AO5A 5KTQA 2Y1JA 3PO4A 4CEAA 3NFAA 1XI1A 1XC9A 3K57A 5CZ1A 4PY5A 1QQCA 4DTUA 1LWCA 1KVCA 4OJRA 4NYFA 4M3RA 5C42A 3PV8A 3IAYA 4Y1DA 3P5JA 2YNFA 2G8WA 1VSKA 3AVBA 4EP4A 1RDCA 3TI0A 4QCLA 2VWJA 5J2PA 3L2WA 3NGIA 3LPTA 4E1NA 4F2SA 3DRSA 4PWDA 4B9NA 3LANA 4CJSA 3SCXA 2G8HA 4I9LA 1RBSA 3DLKA 2I5JA 4FJ5A 4C8KA 3ZCMA 1NJWA 4IFVA 1TK0A 1HQUA 3EYZA 2ITGA 3HM9A 4BDZA 3AVGA 1LW2A 1B9DA 4FK2A 4B9SA 1D9DA 1DTTA 1U49A 1CLQA 1JXEA 3SV3A 2HHQA 4NYNA 2F96A 1O1WA 5HBMA 4AHRA 2ZE2A 4L8RB 3T1AA 1SUQA 1KTQA 2LSNA 1GOCA 1U04A 2E6MA 4CEZA 1FKOA 5KGXA 3OYFA 5HROA 1UA1A 1NJYA 1JL2A 3L2RA 3AVLA 1JLAA 3OY9A 3AO4A 4CJVA 4ICLA 1SKWA 3K5LA 3QEPA 4CF9A 3QIPA 3SUPA 2ETJA 1N6QA 1NKBA 2QK9A 3LALA 4DFJA 2DFFA 1RDBA 3QINA 4CJWA 3C94A 2EX3A 3LZJA 4DFPA 1RBRA 4YFUA 3NGYA 4AHCA 4FW1A 3OYJA 4FJLA 2HHXA 3RMAA 4BDYA 4H8KA 4DTNA 4CGFA 3AA5X 3K5MA 2DY4A 1TAUA 5KRTA 4ZTJA 4RW7A 4ZHRA 4I2QA 3U3YA 1TGOA 3SNNA 3M8PA 4KB0A 1FK9A 4DTJA 1XHXA 4N5SA 4JRPA 5CZ2A 3LP3A 3KKSA 3AVKA 4OGEA 4HCBA 4O55A 4E7JA 3HVTA 1R0AA 2VWKA 3QEVA 4KAZA 4E3SA 3ISNC 3JYTA 1S1XA 1UOCA 4JLHA 1JXBA 5J2NA 3VQEA 3DM2A 2G8VA 2P51A 4B3OA 3TAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNS A;  4CED A;  1WN7 A;  2GBZ A;  3VQ7 A;  1BCM A;  2DFE A;  4FJ9 A;  3VQP A;  3AA2 A;  4C8O A;  4DQS A;  4F8R A;  3U6F A;  3SQ1 A;  1LAV A;  1SL2 A;  4FYD A;  1RDD A;  1CXQ A;  4DSK A;  3VA0 A;  3L2Q A;  1JLQ A;  4DQR A;  4DS5 A;  4FJ7 A;  3MEC A;  4IBN A;  3QEI A;  1HPZ A;  5CYQ A;  3D45 A;  1GOA A;  3HJF A;  1LAW A;  3OYK A;  1X1P A;  3NE6 A;  3VQD A;  4IDK A;  1JLF A;  1WSE A;  3AVH A;  1KVA A;  4KHN A;  4M42 A;  4IG0 A;  4CGG A;  3MEE A;  3O3H A;  2Z1G A;  3OYH A;  3RRG A;  2YHB A;  4FZZ A;  1WSI A;  2QKK A;  2IGI A;  2RKI A;  3PUF A;  4FLW A;  4DLE A;  1Q8I A;  4B8C A;  3LP2 A;  1IKW A;  2VG5 A;  1YVU A;  1RDA A;  4I9Q A;  3LDS A;  2FBV A;  4Y1C A;  4ELT A;  2XY8 A;  4E0D A;  4FJI A;  4M3Z A;  3ITH A;  2HMI A;  4EZ9 A;  5KI6 A;  1HJR A;  3AVM A;  5DMR A;  3RR8 A;  3KKR A;  1JLC A;  1EP4 A;  3DOK A;  1TV6 A;  4FM2 A;  1EX4 A;  3KD1 E;  1TAQ A;  4O5B A;  3M8Q A;  3K5N A;  4FLV A;  4B9L A;  4K8X A;  4M3X A;  1T03 A;  4E1M A;  3VQA A;  1B92 A;  4MFB A;  3JSM A;  1BHL A;  4BE1 A;  4KHY A;  1JLE A;  3V9U A;  4EZ6 A;  4W5N A;  3VQ8 A;  4KTW A;  4CJL A;  4CE9 A;  1NK4 A;  4DTX A;  3SYZ A;  2A1S A;  3OYD A;  3O4N A;  4CIE A;  4F2R A;  4IKF A;  4I7F A;  2WON A;  2KW4 A;  1ZBH A;  1BI4 B;  1FXX A;  4CFA A;  2PYJ A;  5T7B A;  4BE2 A;  4DTS A;  3ZSR A;  1RT3 A;  1QTM A;  4FJN A;  2FBT A;  4RW9 A;  1BIS A;  1F21 A;  3VQC A;  4AHU A;  3M8R A;  3SQ4 A;  3SQ2 A;  3BDP A;  4C8N A;  2O4I A;  2KFN A;  4CHZ A;  2HNY A;  4RG8 A;  3RTV A;  3CFR A;  4FZY A;  3K5O A;  4B9T A;  4ELU A;  1J9A A;  3SV4 A;  3C6T A;  4N47 A;  3U3G A;  3ZSW A;  1RCH A;  4M3W A;  3AV9 A;  2BGG A;  4GVM A;  4FLX A;  1HNI A;  1ASV A;  3OYC A;  1BQM A;  1WSJ A;  1WSF A;  4FJH A;  3DMJ A;  4M3Y A;  2B5J A;  1HMV A;  1S9G A;  2WOM A;  5JS2 A;  3ZSZ A;  3F73 A;  4I2P A;  1KFD A;  4O4G A;  2E4L A;  4CEO A;  4DSF A;  3SPY A;  1ZBI A;  4QOZ B;  1C1A A;  3DOL A;  1WLJ A;  4B08 A;  1C0T A;  2R7Y A;  1NK5 A;  1REV A;  4DSJ A;  4FXD A;  4HVJ A;  1Q9Y A;  4GW6 A;  5HRS A;  4QAG A;  3TAN A;  1U45 A;  4CFD A;  1Z26 A;  3NF7 A;  1Y97 A;  3I0R A;  4FLT A;  3NH1 A;  1DLO A;  3DYA A;  1A5V A;  3RMB A;  2JGU A;  2QXF A;  3DRP A;  4FK4 A;  1BGX T;  5SWM A;  2KTQ A;  1C0M A;  1LWE A;  3OYB A;  2HW3 A;  2NUB A;  2OA8 A;  3QIO A;  1BI4 A;  3NDK A;  4FCY A;  3TAF A;  4OPJ A;  4Z4F A;  1IH7 A;  3NF6 A;  1RNH A;  4W5R A;  4CHP A;  4OPK A;  4BDP A;  4CK3 A;  3VQB A;  2YHA A;  5FRN A;  4FJM A;  3AVN A;  2IOC A;  1B9F A;  4CF8 A;  4Q0B A;  4KTQ A;  1LWF A;  3MXI A;  1DTQ A;  3O3F A;  2XY5 A;  1SKS A;  4N76 A;  4HUG A;  3O3G A;  1NK9 A;  4CJ5 A;  3OS1 A;  3ZSX A;  4CER A;  4CCH A;  1UWB A;  2D0A A;  3ULD A;  2HHT A;  3UIQ A;  2Q3S A;  4FJX A;  2ZD1 A;  1KCF A;  1RBU A;  5CYM A;  1HYV A;  3I8D A;  2A1R A;  2PYL A;  4KV8 A;  4NCB A;  3KIO A;  1TL1 A;  1KLN A;  1EKE A;  3VQ6 A;  4JS5 A;  1SKR A;  4NCA A;  1VSD A;  2HVI A;  2D0B A;  3C6U A;  2IDO A;  5DK5 A;  4AH9 A;  3O4Q A;  4KB1 A;  2FBY A;  3QNN A;  1CZ9 A;  1QS4 A;  3V1O A;  3NCI A;  4KRE A;  4FLZ A;  2BE2 A;  2OPR A;  3MXM A;  2HHS A;  1D5A A;  4CFB A;  4NCG A;  1RT1 A;  3V4I A;  4CIF A;  1QSY A;  1XWL A;  4DSL A;  3MXJ A;  4CGI A;  3IG1 A;  4DTO A;  3RMD A;  1Q9X A;  1VSF A;  1J5O A;  5HRP A;  2F8T A;  3OS2 A;  2XY7 A;  3QEW A;  3NGZ A;  3SZ2 A;  3FFI A;  1K6Y A;  1NK8 A;  3G10 A;  3LPU A;  4N56 A;  2F8S A;  1MU2 A;  4OVL A;  4EP5 A;  4M3U A;  2YNH A;  2YV0 X;  1JL1 A;  4LH4 A;  4LH5 A;  1X9S A;  4KI6 A;  3TAP A;  4F3T A;  2PY5 A;  1L3V A;  3HK2 A;  1C1B A;  4DQP A;  1ASW A;  3L3V A;  1LW0 A;  4E7K A;  4FJK A;  3NF8 A;  4DFK A;  3F9K A;  1NK7 A;  3AO1 A;  3L2U A;  1IG9 A;  4DQQ A;  3S3O A;  3OYI A;  2P5O A;  1A5W A;  3AVI A;  3AO2 A;  1ITG A;  3RRH A;  1NKC A;  2FBX A;  1W9H A;  3KK3 A;  5KRS A;  3ZSV A;  3L8B A;  4DLG A;  3ZT4 A;  4FJ8 A;  3KLI A;  1VK0 A;  1I39 A;  4Z4C A;  3AVA A;  1J54 A;  1BIU A;  3HPH A;  3NBP A;  4OGC A;  3KLG A;  2X74 A;  3AA4 A;  1RT2 A;  4BE0 A;  4F3O A;  4R5P A;  4CEQ A;  1S9E A;  4DSI A;  3K58 A;  2B6A A;  5CY4 A;  3DI6 A;  3VQ5 A;  3DLR A;  3V9X A;  3T3F A;  1IKY A;  1NOZ A;  1D8Y A;  4F4K A;  2YKN A;  3QER A;  3S3N A;  5FRO A;  4W5T A;  4B9U A;  3PX6 A;  1EXQ A;  4BWM A;  4AHV A;  2ZQB A;  1VRT A;  4Z4I A;  3CG7 A;  1S5J A;  1ZBU A;  2VG7 A;  3K2P A;  2X6S A;  4CGJ A;  3H08 A;  4CEF A;  1NK0 A;  4E7I A;  1S6Q A;  4AHS A;  3D0P A;  4DF4 A;  3P1G A;  3QES A;  1RBT A;  3G0Z A;  1YT3 A;  4KTZ A;  1JKH A;  1VSE A;  2JLE A;  1U4B A;  3DLG A;  2KQ2 A;  3ZT2 A;  4Z4E A;  4E89 A;  1WSH A;  1KRP A;  3OJU A;  3PX0 A;  4PUO A;  3MAQ A;  1NJZ A;  1L3U A;  4KHS A;  3HL8 A;  4DTM A;  3SUQ A;  4M41 A;  1RTI A;  2B4J A;  3LP0 A;  1L3T A;  3ZT0 A;  4CGD A;  1TVR A;  4BWJ A;  1VRU A;  3DLH A;  3CQ8 A;  1FKP A;  1J53 A;  1RT6 A;  2P1J A;  3ZT1 A;  2OYQ A;  1KSP A;  4LSL A;  1S6P A;  4LY7 A;  3OYM A;  4DWI A;  1HNV A;  4O0J A;  4DG1 A;  4KPY A;  3TAG A;  3S3M A;  2Z1H A;  4OKJ A;  1RBV A;  3V1Q A;  3MEG A;  3M8S A;  2HND A;  2KZM A;  1S1T A;  4DF8 A;  3EY1 A;  4Z4H A;  1SL0 A;  3LWL A;  1A5X A;  3HO1 A;  3CYM A;  3ALY A;  1JLB A;  4CJ4 A;  1QE1 A;  2RPI A;  2OZS A;  1HRH A;  4ID1 A;  3ZSY A;  3KLH A;  3HXM A;  4CEC A;  3TAR A;  2X6N A;  1L3S A;  4FVM A;  4B9M A;  4W5Q A;  2YNI A;  1X9W A;  1HYS A;  4N41 A;  1WAF A;  4CK2 A;  3KLE A;  1BQN A;  2GUI A;  4PQU A;  3V9S A;  1KVB A;  3WNG A;  2G8I A;  4YNQ A;  3NHG A;  3P83 D;  2YKM A;  3V9W A;  3ZT3 A;  4J2B A;  1RIL A;  3LP1 A;  2XHB A;  2EHG A;  2YNG A;  3VQQ A;  1RT7 A;  2OPQ A;  3WNE A;  2DFH A;  1TL3 A;  4CGH A;  4KHU A;  3QO9 A;  2Z1I A;  3HT3 A;  3VN5 A;  3TAE A;  1NJX A;  1QSL A;  4DMN A;  1ASU A;  4Q5V A;  1ZBL A;  1I3A A;  3OVN A;  3A2F A;  2RN2 A;  4CJT A;  1NK6 A;  1U47 A;  2G8F A;  4C8L A;  4FJJ A;  4OLA A;  1XHZ A;  1QSS A;  2XY6 A;  3E01 A;  5HP1 A;  4IG3 A;  3THV A;  4H4M A;  2ATQ A;  2OPP A;  3LAM A;  4CHN A;  4KI4 A;  4HUF A;  4Z0U A;  3AVC A;  3OYE A;  1KFS A;  3VQ4 A;  4B9V A;  5K14 A;  4CF1 A;  4LSN A;  1SL1 A;  2AJQ A;  3AVJ A;  4CJ3 A;  4PA1 A;  5J1E A;  3I0S A;  3NH0 A;  2KZZ A;  3WNH A;  3V6D A;  4HHT A;  5J2M A;  1TKX A;  4KKO A;  1TK8 A;  3HST B;  3ZSO A;  2HVH A;  1NOY A;  4CEE A;  1BL3 A;  1VSJ A;  2OPS A;  4K8Z A;  4M3T A;  1JLG A;  2E6L A;  2IAJ A;  3NF9 A;  5HRR A;  4DU4 A;  2IC3 A;  4ZTF A;  1RTD A;  5HLF A;  3WNF A;  1RTH A;  4FW2 A;  4G1Q A;  3KJV A;  3TWH A;  3QEX A;  1X9M A;  3SI6 A;  3LZI A;  1TKD A;  3RWU A;  4J2D A;  3K59 A;  1RT4 A;  2PZS A;  3HPG A;  3NAE A;  1N5Y A;  3QET A;  3T19 A;  4M45 A;  4RW8 A;  2QKB A;  1CXU A;  4KFB A;  1L5U A;  3KLF A;  1BIZ A;  4O44 A;  5C25 A;  3B6P A;  4DU1 A;  3IRX A;  5FDL A;  3C95 A;  2W42 A;  1VSH A;  4HTU A;  3V1R A;  1YTU A;  1WSG A;  3RR7 A;  4TSX A;  3SUN A;  4W5O A;  3L2V A;  4Z4G A;  3SPZ A;  4KRF A;  1T8E A;  4CJP A;  3PX4 A;  1S1V A;  4CHO A;  1LV5 A;  1S1W A;  1HYZ A;  5HRN A;  4CJE A;  3CM6 A;  3SQ0 A;  1D9F A;  1UA0 A;  3VQ9 A;  2VG6 A;  2KFZ A;  3DLB A;  4OKK A;  3IS9 A;  2G8K A;  1SV5 A;  4J2A A;  1T05 A;  4O0I A;  1QHT A;  5KGW A;  1VSI A;  4DS4 A;  1UAX A;  4CEB A;  4CES A;  4AIL C;  3RMC A;  1TK5 A;  2P5G A;  3L3U A;  4ID5 A;  2HHW A;  1U48 A;  3DRR A;  3TR8 A;  4CJF A;  4MQ3 A;  4LD0 A;  1C1C A;  1CZB A;  3KK1 A;  5EU7 A;  1IKX A;  4UQG A;  3V9Z A;  2Y1I A;  4CIG A;  4KHQ A;  4RW4 A;  4CJK A;  4FLY A;  2HNZ A;  3OS0 A;  4FM0 A;  1ZYQ A;  1RT5 A;  4CF0 A;  2O4G A;  4JRQ A;  4J2E A;  3OJS A;  4B8A B;  3QLH A;  1TKZ A;  4H4O A;  3AVF A;  1VSM A;  1TKT A;  5FRM A;  5C24 A;  3AO3 A;  4XIU A;  3EZ5 A;  2XRI A;  1IKV A;  4DQI A;  2G8U A;  4FLU A;  1VSL A;  2HHV A;  4DU3 A;  2D5R A;  3LWM A;  5E41 A;  3HPO A;  5JS1 A;  5SZT A;  3KK2 A;  3LAK A;  4OKE A;  4RW6 A;  3OYA A;  3OYN A;  3MED A;  2BAN A;  1BCO A;  5J2Q A;  5I3U A;  1IO2 A;  3OYL A;  4IFY A;  3PO5 A;  4C8M A;  4HCC A;  3BGR A;  1EET A;  1YTA A;  3HP9 A;  3HYF A;  4CF2 A;  4CJR A;  3NH2 A;  4AHT A;  4BAC A;  3QNO A;  2XO7 A;  3KTQ A;  3AA3 A;  2IS3 A;  4CJU A;  1W0H A;  3OYG A;  4DFM A;  2OZM A;  3CFO A;  4ELV A;  4FM1 A;  4FK0 A;  1C6V A;  3B6O A;  2RF2 A;  3CFP A;  1NKE A;  3DLE A;  1S1U A;  2D0C A;  4WE1 A;  4DTR A;  3TAB A;  1RTJ A;  3ASM A;  5I42 A;  4FJG A;  1ZBF A;  3VA3 A;  4CJQ A;  4E19 A;  4KHW A;  4DSE A;  1HQE A;  3KD5 E;  4OLB A;  4KO0 A;  3CM5 A;  4DTP A;  1Z25 A;  4CFC A;  4E7L A;  2FC0 A;  2GV9 A;  2Z1J A;  3HVR A;  5D3G A;  3PY8 A;  4CHY A;  4FZX C;  1WAJ A;  3TAM A;  3SJJ A;  3ZSQ A;  2HHU A;  2X78 A;  3V81 A;  1C0U A;  1KLM A;  4HUE A;  4E7H A;  3S9H A;  2BDP A;  3HP6 A;  1GOB A;  2DTU A;  1G15 A;  4GMJ B;  2HB5 A;  3SUO A;  4CK1 A;  1T7P A;  4CHQ A;  4JS4 A;  3AO5 A;  5KTQ A;  2Y1J A;  3PO4 A;  4CEA A;  3NFA A;  1XI1 A;  1XC9 A;  3K57 A;  5CZ1 A;  4PY5 A;  1QQC A;  4DTU A;  1LWC A;  1KVC A;  4OJR A;  4NYF A;  4M3R A;  5C42 A;  3PV8 A;  3IAY A;  4Y1D A;  3P5J A;  2YNF A;  2G8W A;  1VSK A;  3AVB A;  4EP4 A;  1RDC A;  3TI0 A;  4QCL A;  2VWJ A;  5J2P A;  3L2W A;  3NGI A;  3LPT A;  4E1N A;  4F2S A;  3DRS A;  4PWD A;  4B9N A;  3LAN A;  4CJS A;  3SCX A;  2G8H A;  4I9L A;  1RBS A;  3DLK A;  2I5J A;  4FJ5 A;  4C8K A;  3ZCM A;  1NJW A;  4IFV A;  1TK0 A;  1HQU A;  3EYZ A;  2ITG A;  3HM9 A;  4BDZ A;  3AVG A;  1LW2 A;  1B9D A;  4FK2 A;  4B9S A;  1D9D A;  1DTT A;  1U49 A;  1CLQ A;  1JXE A;  3SV3 A;  2HHQ A;  4NYN A;  2F96 A;  1O1W A;  5HBM A;  4AHR A;  2ZE2 A;  4L8R B;  3T1A A;  1SUQ A;  1KTQ A;  2LSN A;  1GOC A;  1U04 A;  2E6M A;  4CEZ A;  1FKO A;  5KGX A;  3OYF A;  5HRO A;  1UA1 A;  1NJY A;  1JL2 A;  3L2R A;  3AVL A;  1JLA A;  3OY9 A;  3AO4 A;  4CJV A;  4ICL A;  1SKW A;  3K5L A;  3QEP A;  4CF9 A;  3QIP A;  3SUP A;  2ETJ A;  1N6Q A;  1NKB A;  2QK9 A;  3LAL A;  4DFJ A;  2DFF A;  1RDB A;  3QIN A;  4CJW A;  3C94 A;  2EX3 A;  3LZJ A;  4DFP A;  1RBR A;  4YFU A;  3NGY A;  4AHC A;  4FW1 A;  3OYJ A;  4FJL A;  2HHX A;  3RMA A;  4BDY A;  4H8K A;  4DTN A;  4CGF A;  3AA5 X;  3K5M A;  2DY4 A;  1TAU A;  5KRT A;  4ZTJ A;  4RW7 A;  4ZHR A;  4I2Q A;  3U3Y A;  1TGO A;  3SNN A;  3M8P A;  4KB0 A;  1FK9 A;  4DTJ A;  1XHX A;  4N5S A;  4JRP A;  5CZ2 A;  3LP3 A;  3KKS A;  3AVK A;  4OGE A;  4HCB A;  4O55 A;  4E7J A;  3HVT A;  1R0A A;  2VWK A;  3QEV A;  4KAZ A;  4E3S A;  3ISN C;  3JYT A;  1S1X A;  1UOC A;  4JLH A;  1JXB A;  5J2N A;  3VQE A;  3DM2 A;  2G8V A;  2P51 A;  4B3O A;  3TAQ A; 
#chains in the Genus database with same CATH topology
 1WNS A;  4YOY A;  4H5T A;  3IKM A;  3VQ7 A;  4DV6 K;  4FJ9 A;  1NGD A;  3VQP A;  4F8R A;  1SL2 A;  1RDD A;  3T1H K;  4DSK A;  3VEX A;  4DS5 A;  4FJ7 A;  3QEI A;  4H0Y B;  1HPZ A;  3D45 A;  1FW6 A;  1LAW A;  3NE6 A;  1X1P A;  4H5W A;  3U4L A;  2VQE K;  3VQD A;  4IDK A;  5GAE P;  3T7Z A;  4CGG A;  2Z1G A;  4IEE A;  5AZI A;  4M7X A;  5BR8 K;  3TTD A;  4DKW A;  1QQN A;  1QHA A;  4I9Q A;  2FBV A;  3CCM N;  3A5M C;  4ILH A;  3CCS N;  3OA9 A;  1TV6 A;  3CC2 N;  3KD1 E;  3MN6 A;  1QQM A;  3BZC A;  3VEN A;  5ADX H;  1B92 A;  3V9U A;  2P9L A;  4W5N A;  4KTW A;  4YDU C;  3HI0 A;  1VQ6 N;  1NK4 A;  2YJE A;  1IJJ A;  3SAF A;  4IKF A;  2WON A;  1ZBH A;  4CFA A;  1HLU A;  2I7N A;  4BE2 A;  3ZSR A;  1RT3 A;  1QTM A;  2HBL A;  1YI2 N;  4FJN A;  3VQC A;  1BIS A;  3M8R A;  2KFN A;  3PIO L;  4LF9 K;  4CHZ A;  4DR2 K;  3K9J A;  3HRG A;  3C6T A;  4GNI A;  4N47 A;  2BGG A;  4H0T B;  3AV9 A;  2RHK A;  4GVM A;  3VF4 A;  4FLX A;  3OYC A;  3DMJ A;  1HMV A;  5JLH A;  2W40 A;  4CEO A;  4O4G A;  4DSF A;  4FO0 A;  3DOL A;  1WLJ A;  1NK5 A;  3VTH A;  1T6C A;  2V52 B;  4HVJ A;  1ESV A;  4QAG A;  3NF7 A;  4B1W B;  1VHX A;  4XH1 A;  4C23 A;  4JKF A;  1BGX T;  5M1O A;  4B1Y B;  5LMU K;  1NWK A;  1K8A O;  1IH7 A;  1RNH A;  4CHP A;  4CK3 A;  2YHA A;  5KPR A;  2P9K A;  4EIA A;  3KWG A;  1B9F A;  3CIP A;  1LWF A;  4BRO A;  4WQ4 A;  1SKS A;  3VTI A;  4CJ5 A;  4RCH A;  2GEL A;  3OBW A;  3ULD A;  3GOI A;  3K9K A;  1RBU A;  1HYV A;  3HOT A;  1QVG M;  1KLN A;  2ZF5 O;  2IDO A;  5DK5 A;  4AH9 A;  3QML A;  1T44 A;  4KRE A;  1E3M A;  1OKJ A;  3NCI A;  5IWA K;  1WBB A;  2AP1 A;  4FOI A;  2UUA K;  3MK6 A;  2OPR A;  2HHS A;  4B1X B;  3ZLJ A;  1D5A A;  1NM1 A;  2HMP A;  4DTO A;  3RMD A;  2F8S A;  1NK8 A;  3ULE B;  1MU2 A;  2E8A A;  3K0S A;  1JL1 A;  4KI6 A;  4CW7 B;  3HK2 A;  1VQL N;  4DQP A;  2AA4 A;  1M90 O;  1LW0 A;  4FJK A;  3F9K A;  1IG9 A;  3S3O A;  3WQU A;  4C1N K;  3ZX0 A;  4I6M B;  3UKU B;  4FJ8 A;  1VK0 A;  1GLA G;  3IFR A;  4O5F A;  1BIU A;  4OGC A;  2X74 A;  1RT2 A;  4BE0 A;  1S9E A;  3GL1 A;  3O4W A;  3O9U A;  2IVN A;  3VQ5 A;  2HBM A;  3J81 O;  1IKY A;  2YKN A;  3QER A;  4NLC A;  3PX6 A;  1VRT A;  4Z4I A;  2O8D A;  4RTF D;  3W3D A;  1IBM K;  1BA0 A;  3P1G A;  3QES A;  1RBT A;  4BR7 A;  1VSE A;  3DLG A;  3UKR A;  1WSH A;  2IVO A;  1J5E K;  2QM1 A;  3OJU A;  3O9R A;  3PX0 A;  3MAQ A;  1NJZ A;  4DTM A;  2WC9 A;  1L3T A;  3ZT0 A;  1NG9 A;  5CE3 A;  1QVF M;  4IO8 A;  5AQX A;  1VRU A;  5BPN A;  2A41 A;  2O8E B;  1U2V B;  4PKH A;  4LY7 A;  4DWI A;  3P38 A;  4O0J A;  3AGK A;  4KPY A;  4X64 K;  3S3M A;  3L4Q A;  2Z1H A;  4WYB A;  3V1Q A;  2P9N B;  3MEG A;  3M8S A;  1YIT N;  3EY1 A;  3T1Y K;  3SMP A;  4Z4H A;  1SL0 A;  5KPT A;  3QFP A;  3HO1 A;  1A5X A;  5A2Q O;  5AQN A;  3CYM A;  3ALY A;  1HRH A;  3ZSY A;  1NLV A;  3TAR A;  4FVM A;  2YNI A;  1X9W A;  4BR4 A;  4CK2 A;  3KLE A;  1BQN A;  4PQU A;  3V9S A;  1KVB A;  1TYQ B;  3P83 D;  4J2B A;  3WNE A;  2NLX A;  3D7E O;  3FLC O;  3TAE A;  4BG9 A;  4DR7 K;  4B1V A;  5HL7 L;  5M1K A;  3OVN A;  3TPQ A;  1DT9 A;  4OLA A;  1U47 A;  1XHZ A;  3E01 A;  5HP1 A;  2E5L K;  2FSK A;  3PIP L;  2ATQ A;  2D0P A;  1IBL K;  3LAM A;  2Q97 A;  1J6Z A;  4HUF A;  3SBT A;  4Y0W A;  4B9V A;  1XQS C;  1K8K B;  4PA1 A;  2KZZ A;  3CF5 L;  4B3M K;  1TKX A;  1TK8 A;  3HST B;  4HTL A;  3ZSO A;  4BRA A;  4CEE A;  4CJ7 A;  3PSI A;  1VSJ A;  4FWK A;  3NF9 A;  5HRR A;  4PHT X;  4DU4 A;  3M1F A;  3THW A;  3TWH A;  1KAZ A;  3RWU A;  3LZI A;  1RT4 A;  3HPG A;  1N5Y A;  4DR5 K;  4GV3 A;  1L5U A;  4G9Z A;  2H3G X;  3FZM A;  3RSE A;  4DU1 A;  4BRM A;  3IRX A;  5FDL A;  2W42 A;  5I9E B;  3SUN A;  3ZEU B;  4W5O A;  1NBW A;  3CM6 A;  1D9F A;  1KAY A;  1YUW A;  2G8K A;  1S3X A;  1SV5 A;  1T05 A;  4O0I A;  4DS4 A;  1VSI A;  1TK5 A;  3S41 A;  5KQ8 A;  2HHW A;  1VQ9 N;  3V9Z A;  4CZL A;  4XEI A;  4FLY A;  2HNZ A;  3OS0 A;  5AQI A;  1KC8 O;  3OJS A;  3AVF A;  5FRM A;  1TKT A;  3C0B A;  4XH4 A;  4XIU A;  1BUP A;  3EZ5 A;  4BC4 A;  3VET A;  5HOO A;  3MCP A;  1VSL A;  2D5R A;  5JVH L;  4O8K A;  3WXL A;  1OH7 A;  3CCE N;  3KK7 A;  3LAK A;  1BCO A;  1IO2 A;  1WB9 A;  4HCC A;  3NMU A;  4C8M A;  3SBG A;  4PL8 A;  5BN8 A;  1YTA A;  4CJR A;  5LY3 A;  3NH2 A;  3D2F A;  4BRF A;  2NRV A;  3AA3 A;  5AFU H;  4FK0 A;  4FM1 A;  5M1F A;  3HTV A;  3VA3 A;  3D2E A;  4JKD A;  5LMN K;  4E19 A;  3KD5 E;  1Z25 A;  4CFC A;  2QW9 A;  2Z1J A;  3HVR A;  3PY8 A;  4FWN A;  3SJJ A;  2HHU A;  3V81 A;  1C0U A;  1KLM A;  3S9H A;  4GMJ B;  2HB5 A;  1E4F T;  2F7T A;  5CZ1 A;  1LWC A;  4Y1D A;  3P5J A;  2YNF A;  5H1S Q;  1DEJ A;  1VSK A;  1W2B M;  1JCG A;  3BY5 A;  5J2P A;  4E1N A;  4CI6 A;  4PWD A;  4I9L A;  4CVN E;  4BRH A;  3AVG A;  3M6G A;  4FK2 A;  4B9S A;  2Q2R A;  1OVY A;  1CLQ A;  1U2V A;  1JXE A;  2HHQ A;  1O1W A;  5HBM A;  2ZE2 A;  3WXK A;  2W6L A;  1KTQ A;  4M3Z A;  1GOC A;  5EOY A;  4BR5 A;  3VEZ A;  5EX5 A;  1NJY A;  1NGH A;  1JLA A;  4CJV A;  2ITM A;  4H0X B;  2FF3 B;  1SKW A;  3QIP A;  3SUP A;  2ETJ A;  3CCU N;  3QIN A;  3C94 A;  2EX3 A;  3OYJ A;  4FJL A;  3I56 N;  4H8K A;  3JS6 A;  4CGF A;  3K5M A;  2DY4 A;  1TAU A;  5FPD A;  3N4Q A;  3P4I A;  1TGO A;  3MCA B;  3Q7B A;  4N5S A;  4EHU A;  4HCB A;  3B8A X;  3QEV A;  3JYT A;  1UOC A;  5J2N A;  5LJW A;  2P51 A;  2HF4 A;  2GBZ A;  1NJI O;  2OTJ N;  4JI3 K;  1JCE A;  4H0P A;  2FXU A;  5JLF A;  4C8O A;  1CXQ A;  1RDU A;  3VA0 A;  1JLQ A;  4IBN A;  4CD3 A;  1VQ7 N;  2NRX A;  3OYK A;  1KD1 O;  4JI5 K;  3OYH A;  2YHB A;  1SZ2 A;  1OH6 A;  4B1Z A;  4DLE A;  3LP2 A;  4B3R K;  1IKW A;  2VG5 A;  1YVU A;  2EWS A;  4JKE A;  1NGI A;  1RDA A;  3SAH A;  3LDS A;  4ELT A;  4E0D A;  5KI6 A;  3QIC A;  3AVM A;  5DMR A;  1QQO A;  3MX2 A;  1JLC A;  4H5R A;  1OH8 A;  4NO7 A;  4FM2 A;  1EX4 A;  1TAQ A;  4FLV A;  4B9L A;  4E1M A;  3VQA A;  4BC2 A;  1BHL A;  3O9Q A;  2Q1N A;  4CE9 A;  4DTX A;  4JD2 B;  3G4S N;  5GAG P;  4F2R A;  4WQ5 A;  2KW4 A;  1FXX A;  3ZET B;  4DTS A;  3NVM A;  2D1K A;  3EKU A;  4IEI A;  2QWR A;  5GIN A;  2HNY A;  3CQX A;  4RG8 A;  3RTV A;  4JI4 K;  3CJB A;  4ELU A;  1BDG A;  2QWQ A;  4DQ8 A;  3U9Z A;  1BO5 O;  4FJH A;  3VEV A;  4M3Y A;  2ZM6 K;  1JCF A;  2WOM A;  3CME N;  5JS2 A;  3ZSZ A;  2ASM A;  2E4L A;  3EZW A;  5LJV A;  1VQP N;  4AQY K;  4GKJ K;  2UUB K;  4GW6 A;  3TAN A;  1S22 A;  1N36 K;  3TSP A;  4CFD A;  1Y97 A;  3HSC A;  3DYA A;  3ID8 A;  1A5V A;  2QWN A;  4NXM K;  2JGU A;  5BRD A;  4IWV A;  3C6H A;  1N32 K;  3WXJ A;  1LWE A;  4EHT A;  3OYB A;  4BRC A;  2HW3 A;  2NUB A;  3QIO A;  3NDK A;  3LDL A;  3O08 A;  4O8U A;  4OPJ A;  3PLA A;  3QB0 A;  3BP8 A;  3VQB A;  5FRN A;  3AVN A;  2WTU A;  1HKB A;  3BUZ B;  4KTQ A;  5FPE A;  1DTQ A;  3O3F A;  2XY5 A;  3O3G A;  1NK9 A;  3R8E A;  4DV1 K;  4CCH A;  2ZWH A;  4FJX A;  2A1R A;  1TL1 A;  2GX9 A;  3VQ6 A;  3L6Q A;  4C1N I;  4ISE A;  4MDB A;  1VQN N;  1RGI A;  1CZ9 A;  3V1O A;  3AAP A;  3MXM A;  3V4I A;  4K43 A;  1XWL A;  3RSE B;  3IG1 A;  5M1P A;  4CZG A;  1VSF A;  1J5O A;  5HRP A;  3THY B;  3UB5 A;  4BRG A;  3LPU A;  4N56 A;  4KHP K;  1N33 K;  2YNH A;  2YV0 X;  4LH4 A;  3EL2 A;  4LH5 A;  1X9S A;  4NXN K;  3TAP A;  4F3T A;  5TKW A;  4QS8 A;  1ASW A;  4E7K A;  4YOX A;  3L2U A;  1XUP O;  4DQQ A;  2P9U B;  1KXP A;  3THX A;  1ITG A;  3RRH A;  3KK3 A;  3ZT4 A;  3KLI A;  4Z4C A;  3AVA A;  4BR9 A;  4M7Y A;  3KLG A;  3CPW M;  2RE2 A;  3AA4 A;  4YY3 K;  5BRH A;  4CEQ A;  1NGJ A;  4DSI A;  5CY4 A;  3V9X A;  3T3F A;  4U7B A;  2FF6 A;  3R6M A;  2O8F A;  1D8Y A;  2I7P A;  4F4K A;  3S3N A;  4B9U A;  3J7A P;  3K2P A;  1S5J A;  1ZBU A;  4ILJ A;  4JAX A;  2X6S A;  3H08 A;  5IT9 O;  2E2N A;  4KTZ A;  1YT3 A;  3G0Z A;  4JKG B;  3E9L A;  2UUC K;  3ZT2 A;  3BEX A;  4FWO A;  1KRP A;  4KHS A;  1L3U A;  4WQ4 C;  3SUQ A;  2B4J A;  4BQZ A;  3C7N A;  3QBW A;  1RT6 A;  2P1J A;  3I8B A;  3ZT1 A;  3LDO A;  1KSP A;  1HNV A;  5AQT A;  2NZT A;  4IZ9 A;  2OAN A;  3T69 A;  1Q81 O;  1YVN A;  2HND A;  4YOT A;  3TSU A;  1XC3 A;  1GLB G;  1JLB A;  3G6E N;  2RPI A;  1YHQ N;  3KLH A;  2VGM A;  4W5Q A;  4YDU A;  1HYS A;  1WAF A;  1HKG A;  2GUI A;  4BVO A;  3WNG A;  2G8I A;  2KLA A;  3NHG A;  1N8R O;  5C0Y A;  3IUC A;  2F4V K;  3UKR B;  2JWK A;  3HT3 A;  1NJX A;  3VN5 A;  5KQD A;  2NNW A;  1QSL A;  2P9P B;  1MDU B;  5C2D A;  1X3N A;  1ZBL A;  2Q36 A;  4FJJ A;  3MWT A;  1WOQ A;  1ATR A;  3LDQ A;  2XY6 A;  2OPP A;  4JHD B;  4CHN A;  2JWL A;  2HST A;  3OYE A;  4BGB A;  2GEM A;  5BRF A;  1SL1 A;  3AVJ A;  4CJ3 A;  3NH0 A;  3CCL N;  1NGC A;  4HHT A;  1S72 N;  4KKO A;  3JAM O;  4JYA K;  3CHW A;  4V19 S;  5B8H A;  2E6L A;  4PKG A;  2VYP A;  1HKC A;  4JK8 A;  5E26 A;  2IC3 A;  5HLF A;  3WNF A;  4G1Q A;  3SI6 A;  1TKD A;  3K59 A;  2PZS A;  4BR0 A;  1SS6 A;  1CXU A;  3IDH A;  3KLF A;  4LF4 K;  1BIZ A;  3DWL A;  3R3L A;  3B6P A;  5FPM A;  1YTU A;  4YOR A;  3V1R A;  1WSG A;  3RR7 A;  4TSX A;  2UXD K;  3L2V A;  3J7Z O;  1S1V A;  1LV5 A;  1S1W A;  3DXK B;  1RFQ A;  4GY2 B;  4BRE A;  4CJE A;  3SQ0 A;  3VQ9 A;  3DXK A;  5C12 A;  3DLB A;  3AY9 A;  1QHT A;  5KGW A;  1UAX A;  1G99 A;  2P5G A;  4ID5 A;  3DRR A;  3CET A;  3FFK B;  1TUU A;  4CJF A;  4LD0 A;  1C1C A;  3KK1 A;  1JJ2 M;  5EU7 A;  4K41 A;  4UQG A;  4KHQ A;  4RW4 A;  1ZYQ A;  1FJG K;  2O4G A;  4BRD A;  4AM7 A;  5AQG A;  5AZJ A;  4B8A B;  1TKZ A;  4DCH A;  5C24 A;  3AO3 A;  2XRI A;  5ADX A;  3CD6 N;  5AQV A;  1MWM A;  1EO1 A;  2HHV A;  4FWL A;  3HPO A;  1T6D A;  4ILG B;  3FE1 A;  3A0I X;  4OKE A;  3LDP A;  3OYA A;  3MED A;  4A5B A;  3BGR A;  1EET A;  2D0O A;  4CF2 A;  5GIP A;  4XH5 A;  3SMS A;  4AHT A;  3QBX A;  3KTQ A;  3CFO A;  2Q0U A;  1W7A A;  3B6O A;  2CH5 A;  3CCQ N;  1S1U A;  3TAB A;  4DV2 K;  5I42 A;  4FJG A;  4CJQ A;  4KHW A;  4DV5 K;  1HQE A;  4JK9 A;  3CM5 A;  1XMQ K;  2P9P A;  4E7L A;  3ENB A;  2QWM A;  2GV9 A;  1WUA A;  3CJ9 A;  3GG4 A;  4FZX C;  2CGJ A;  4E7H A;  1X3M A;  3HOS A;  3SUO A;  4CHQ A;  2Y1J A;  1XC9 A;  3K57 A;  5ELZ A;  4E1J A;  5C42 A;  1EQY A;  3IAY A;  2UU9 K;  2A5X A;  1GLL O;  3DJC A;  5F1X A;  3SAG A;  1RDC A;  3TI0 A;  2P9L B;  3TSQ A;  4YOW A;  2VWJ A;  3LPT A;  5AQW A;  1IV0 A;  4F2S A;  3DRS A;  4B3O A;  2HHH K;  4B9N A;  1VQ5 N;  4FXD A;  3QFU A;  3ZYY X;  1NJW A;  3I33 A;  4IFV A;  3EYZ A;  4BDZ A;  1NMD A;  3L4I A;  1D9D A;  2QA4 N;  4AHR A;  4L8R B;  5TKY A;  1SUQ A;  2LSN A;  1U04 A;  1UA1 A;  4CEZ A;  5C15 A;  3L2R A;  3CC7 N;  5DM6 L;  4ICL A;  2P9I A;  3J7Y P;  3K5L A;  1Q86 O;  3MN9 A;  4CF9 A;  1N6Q A;  1YIJ N;  3LZJ A;  4DFP A;  1RBR A;  2HHX A;  4YOV A;  3U8X A;  3EE8 A;  3RMA A;  3AA5 X;  1C0F A;  4AF1 A;  5M1N A;  4ZTJ A;  1QZ6 A;  4RW7 A;  3O8M A;  2VQF K;  4ZHR A;  3SNN A;  3U3Y A;  4F9O A;  3M8P A;  3CPE A;  4QS7 A;  3H46 O;  4WFA L;  1Q82 O;  1K73 O;  5CZ2 A;  3RVC A;  3KKS A;  4WFN L;  3AVK A;  4O55 A;  4E7J A;  3HVT A;  4KAZ A;  1S1X A;  3DM2 A;  1S6Q A;  3THX B;  1GLC G;  4CED A;  1WN7 A;  3CMA N;  1VQK N;  1QZ5 A;  3U6F A;  4FVU A;  3O9T A;  3EKS A;  3L2Q A;  3MEC A;  2NRT A;  5CYQ A;  3THY A;  4IOX A;  1WSE A;  3MDQ A;  3AVH A;  1KVA A;  4IG0 A;  2P9I B;  2A6A A;  3RRG A;  4FZZ A;  1WSI A;  4FOE A;  2IGI A;  2PBD A;  2RKI A;  4FLW A;  1Q8I A;  4NLB A;  4B8C A;  2NRR A;  4BC5 A;  4FJI A;  1W97 L;  4MO5 A;  3ITH A;  2HBK A;  2HMI A;  4EZ9 A;  3DOK A;  4A61 A;  4GV9 A;  3AAR A;  3K5N A;  4MFB A;  4BE1 A;  4KHY A;  1JLE A;  4EZ6 A;  3LL3 A;  3VQ8 A;  4CJL A;  5FPN A;  2A1S A;  3OYD A;  3O4N A;  1C0G A;  2YHW A;  4I7F A;  1BI4 B;  1Z6R A;  5BN9 A;  2F9T A;  3VGK A;  3E9P A;  3WQT A;  4RW9 A;  3BDP A;  1F21 A;  4AHU A;  5AQS A;  3SQ2 A;  2O4I A;  1ZBS A;  4BQL A;  4FZY A;  3K5O A;  1J9A A;  3SV4 A;  3ZSW A;  3A5L C;  2KHO A;  3F2K A;  1S9G A;  4BR2 A;  3F73 A;  3SK3 A;  3CC4 N;  1KFD A;  1ZBI A;  3ZX3 A;  4B08 A;  2R7Y A;  3KVG A;  1REV A;  1Q9Y A;  2ZJQ L;  1VAZ A;  5HRS A;  1U45 A;  2WFB A;  4FLT A;  3I0R A;  3NH1 A;  4DV0 K;  1DLO A;  4FK4 A;  3DRP A;  4IFE A;  3U9D A;  4JKC A;  2E2O A;  3TAF A;  3NF6 A;  4W5R A;  4KBO A;  4JD2 A;  4BDP A;  1M1K O;  4FJM A;  3WXI A;  5AZJ B;  1EWR A;  4Q0B A;  3MXI A;  4JV5 K;  4N76 A;  4CBX A;  3OS1 A;  3ZSX A;  1UWB A;  2HHT A;  4BRQ A;  3KZB A;  2PYL A;  3I8D A;  1GLF O;  3KIO A;  1NGF A;  2BTF A;  4GV6 A;  4JS5 A;  1BOT O;  1SKR A;  4NCA A;  2HVI A;  1YJ9 N;  4KB1 A;  2FLO A;  3QNN A;  3GBT A;  2P9S A;  2BE2 A;  1P90 A;  4CBW A;  1RT1 A;  4CIF A;  3MXJ A;  4CGI A;  2F8T A;  3VPZ A;  3OS2 A;  2GWJ A;  3NGZ A;  3SZ2 A;  3FFI A;  1BA1 A;  1K6Y A;  2D4W A;  3F9M A;  4GKK K;  2CGL A;  4M3U A;  3A5O C;  4OX9 K;  2PY5 A;  5BPM A;  1L3V A;  4LFA K;  2PAV A;  5JIC A;  1BG3 A;  3L3V A;  4DFK A;  3AO1 A;  4FPA A;  1A5W A;  4LF5 K;  1LCU A;  4DR6 K;  2FBX A;  4IO9 L;  4DLG A;  5AQZ A;  3HPH A;  1MA9 B;  3NBP A;  4OPH A;  4F3O A;  4R5P A;  3OTO K;  4JHD A;  5GIO A;  2B6A A;  2HBJ A;  3DLR A;  3H1Q A;  1MWK A;  1NOZ A;  2W41 A;  4BWM A;  1VQ8 N;  4CGJ A;  2O8C A;  4PKI A;  3OBY A;  4E7I A;  4AHS A;  3D0P A;  3R1X A;  1JKH A;  2JLE A;  4DUZ K;  5EY4 A;  4Z4E A;  3M3Z A;  3HL8 A;  2E20 A;  5AQO A;  4CGD A;  1YAG A;  3SJH A;  1XNR K;  3DLH A;  3CQ8 A;  1FKP A;  1J53 A;  2NRZ A;  3IMX A;  1BWF O;  2OYQ A;  1S6P A;  4YHH K;  4DG1 A;  4KH6 A;  3DXM A;  1OH5 A;  4OKJ A;  1RBV A;  3VEO A;  4Z94 A;  2E2Q A;  2KZM A;  4DF8 A;  4NB4 A;  2O8B B;  5M1Q A;  2FSJ A;  4CJ4 A;  4WQ5 C;  1QE1 A;  2OZS A;  4CEC A;  2X6N A;  5BR9 A;  4B9M A;  4MDA A;  4KH5 A;  3JXU A;  4ISF A;  4N41 A;  5F0X A;  1N34 K;  3ZT3 A;  1RIL A;  3LP1 A;  4FWR A;  2EHG A;  1DKG D;  3VQQ A;  1RT7 A;  1TL3 A;  4CGH A;  4KHU A;  4JKG A;  2Z1I A;  4U67 L;  3O9S A;  2UYT A;  1HX1 A;  1D4X A;  4BC3 A;  2RN2 A;  2G8F A;  2CH6 A;  1NGE A;  3J80 O;  4IG3 A;  4H4M A;  4CBU A;  2O8F B;  4JI7 K;  4Z0U A;  1KFS A;  4CF1 A;  4LSN A;  3WNH A;  3V6D A;  3HBT A;  5J2M A;  1HJO A;  3WEE B;  1NOY A;  1BL3 A;  2OPS A;  4M3T A;  2IAJ A;  4JI8 K;  2ASP A;  4ZTF A;  4FW2 A;  1X9M A;  4J2D A;  3BF3 A;  3T19 A;  2QKB A;  4KFB A;  2OTL N;  4LFB K;  4LF7 K;  3EO3 A;  3OHR A;  4LF8 K;  1H1V A;  3C95 A;  4M63 C;  1VSH A;  4HTU A;  3SLC A;  3VMF B;  4DR3 K;  3AGR A;  3FZF A;  1HNZ K;  3SPZ A;  4KRF A;  4BGA A;  4CJP A;  3PX4 A;  1HYZ A;  5HRN A;  1UA0 A;  4J2A A;  4OKK A;  3IS9 A;  2DPN A;  2YCH A;  3ZEU A;  4CEB A;  4CES A;  3L3U A;  2VGN A;  4FWQ A;  1U48 A;  4BVP A;  1CZB A;  1NMN A;  1IKX A;  3NVK A;  4CIG A;  2UXC K;  1GLJ O;  2VCP A;  4H5N A;  4WF9 L;  5AQH A;  4J2E A;  4IOC L;  3QLH A;  4EAH D;  1VSM A;  4X62 K;  3THW B;  3LM9 A;  4FLU A;  4IJA A;  1X9J A;  4DU3 A;  5E41 A;  5SZT A;  3WUH A;  3CJC A;  3ZX2 A;  4FWS A;  1IBK K;  3KK2 A;  4RW6 A;  2BAN A;  5J2Q A;  3CER A;  3M5R A;  4IFY A;  1K8K A;  3HP9 A;  3HYF A;  2XO7 A;  2IS3 A;  4CJU A;  1W0H A;  4DFM A;  4ELV A;  4B3T K;  2PFU A;  3CXC M;  4H0V B;  1NKE A;  3DLE A;  1RTJ A;  3ASM A;  3QDK A;  1ZBF A;  4HWI A;  1V4S A;  1ATS A;  5E84 A;  4DTP A;  2FC0 A;  2YI1 A;  3O1B A;  5D3G A;  1WAJ A;  3TAM A;  3ZSQ A;  2X78 A;  3FGU A;  4HUE A;  3VES A;  4IXC A;  1G15 A;  1KQS M;  4JS4 A;  1LOT B;  5KTQ A;  3PO4 A;  2E1Z A;  3ZET A;  1NGA A;  2ZJP L;  2NRH A;  4QCL A;  4JI6 K;  2O8B A;  4CZF A;  2ZGZ A;  2A40 A;  3OW2 M;  2P9N A;  3DLK A;  2I5J A;  1TK0 A;  3DXM B;  3HM9 A;  2QI2 A;  1TUY A;  4B9Q A;  3VF2 A;  4K42 A;  1DTT A;  1U49 A;  4DB3 A;  3EEQ A;  2O8E A;  4NYN A;  1Y64 A;  2E6M A;  1FKO A;  1NNE A;  1OVQ A;  2IIR A;  1IG8 A;  3AO4 A;  4FSV A;  4GVE A;  3GE1 A;  2QK9 A;  4DFJ A;  4CJW A;  4YFU A;  3NGY A;  4AHC A;  4L3Q A;  2O8D B;  3HZ6 A;  2A42 A;  4DTN A;  1U6Z A;  4I2Q A;  3Q7C A;  4KB0 A;  4CZH A;  1FK9 A;  4K0K K;  4JKB A;  3H6E A;  3O80 A;  3UE5 A;  1GLD G;  1R0A A;  2VWK A;  3FZK A;  5JVG L;  5AFU A;  1BU6 O;  2GUP A;  3ISN C;  3UKU A;  1JXB A;  3VQE A;  4IOA L;  1Q7Y O;  2ZJR L;  1BCM A;  2DFE A;  3AA2 A;  4DR4 K;  4DQS A;  3SQ1 A;  1LAV A;  5BPL A;  4FYD A;  4DQR A;  3ULE A;  4BRN A;  1GOA A;  3HJF A;  1JLF A;  4YOU A;  4JN4 A;  4KHN A;  4M42 A;  3P31 A;  4BG8 A;  3E1Y A;  5C10 A;  3CQY A;  3MEE A;  4BRL A;  3O3H A;  2QKK A;  3PUF A;  4FPB A;  4OPA A;  1K9M O;  2Q0R A;  4Y1C A;  2XY8 A;  1NGG A;  3BF1 A;  2UXB K;  2CGK A;  1HJR A;  3RR8 A;  1V4T A;  3KKR A;  1EP4 A;  3WT0 A;  4JI1 K;  3WXM B;  4O5B A;  3M8Q A;  2QTD A;  3N4P A;  4K8X A;  4M3X A;  1T03 A;  3JSM A;  4JI0 K;  5AQQ A;  2P9K B;  3SYZ A;  3CCV N;  4CIE A;  2J4R A;  2PYJ A;  5T7B A;  3C65 A;  2FBT A;  3SQ4 A;  1VQ4 N;  4C8N A;  3O6W A;  4PL7 A;  3CFR A;  4B9T A;  4CZM A;  3R9P A;  3U3G A;  4M3W A;  1RCH A;  1HNI A;  1ASV A;  1BQM A;  1WSJ A;  1WSF A;  1YF5 L;  2F9W A;  2B5J A;  3D2E B;  4I2P A;  1YJW N;  4QOZ B;  3SPY A;  1C1A A;  4DSJ A;  1C0T A;  2OCE A;  3E9O A;  1Z26 A;  1RDW X;  3D2F B;  1NU0 A;  5CR4 A;  3RMB A;  4H5V A;  2QXF A;  2KTQ A;  5SWM A;  1C0M A;  5GAH P;  5AQJ A;  4IDH A;  1Q18 A;  2OA8 A;  1BI4 A;  3VER A;  5BRE A;  4FCY A;  3O5B A;  3CJ7 A;  4Z4F A;  4OPK A;  5F2R A;  2HOE A;  3GDQ A;  4CZK A;  2IOC A;  4CF8 A;  4JEP A;  1VQM N;  3CJA A;  4X65 K;  4HUG A;  3MN5 A;  2E2P A;  4CER A;  3LDN A;  3VOV A;  2D0A A;  3UIQ A;  2Q3S A;  2FSN A;  2ZD1 A;  1KCF A;  5CYM A;  4NCB A;  4KV8 A;  3FZL A;  1EKE A;  4ISG A;  1VSD A;  3C6A A;  4A57 A;  2D0B A;  3C6U A;  3O4Q A;  4EFH A;  4B3S K;  2FBY A;  4K25 A;  1QS4 A;  4FLZ A;  4JNE A;  5AZI B;  2NRW A;  1GLE G;  4CFB A;  4NCG A;  1QSY A;  3LM2 A;  4DSL A;  1Q9X A;  2XY7 A;  3QEW A;  3G10 A;  4OVL A;  4RWT A;  4EP5 A;  3AAQ A;  4H0O A;  5AQL A;  2GWK A;  1C1B A;  3NF8 A;  1NK7 A;  1VQO N;  3OYI A;  2P5O A;  1EWQ A;  3AVI A;  3AO2 A;  3WEE A;  1NKC A;  1W9H A;  4A62 A;  5KRS A;  3ZSV A;  3L8B A;  2V51 B;  1I39 A;  1J54 A;  2QWL A;  3K58 A;  3DI6 A;  5DM7 L;  5FRO A;  4W5T A;  1EXQ A;  2BUP A;  2V7Z A;  4AHV A;  2ZQB A;  2QWO A;  3VGM A;  2VG7 A;  3CG7 A;  2GTD A;  4CEF A;  1NK0 A;  4DF4 A;  1WBD A;  3TU5 A;  4FL9 A;  3EE9 A;  1U4B A;  2KQ2 A;  5FLX O;  2Q31 A;  4E89 A;  1ATN A;  3D6R A;  4PUO A;  5AQP A;  4X66 K;  1TYQ A;  2HF3 A;  3MWP A;  2WBN A;  3O1W A;  1RTI A;  3LP0 A;  4M41 A;  1P8Z A;  1TVR A;  4BWJ A;  2YHX A;  1SAZ A;  4H03 B;  4LSL A;  3OYM A;  1Z05 A;  4CZJ A;  3TAG A;  4QS9 A;  2E1Y A;  4CD1 A;  3ENO A;  4CZI A;  5AR0 A;  1S1T A;  5EXW A;  4WFB L;  3LWL A;  4LC9 B;  4JKA A;  4ID1 A;  3HXM A;  1L3S A;  5AQK A;  3H3N O;  5C2F A;  4DHY A;  2ZGY A;  1XNQ K;  5CHI A;  4YNQ A;  3BZK A;  3E66 A;  4DV7 K;  2YKM A;  3V9W A;  2XHB A;  2YNG A;  1HNW K;  5AQF A;  1O13 A;  1ZXO A;  2OPQ A;  2DFH A;  3HM8 A;  3QO9 A;  3ID6 A;  3MX5 A;  4DMN A;  1ASU A;  2A3Z A;  3VF6 A;  4Q5V A;  1DGK N;  1I3A A;  2O8C B;  3A2F A;  3H1V X;  4IJN A;  4A59 A;  4CJT A;  1NK6 A;  4C8L A;  4UY8 O;  3H3O B;  1QSS A;  4A2A A;  3THV A;  3CCJ N;  2YHY A;  5MLC Q;  4DV4 K;  4KH4 A;  4KI4 A;  4JKH A;  3AVC A;  2AJQ A;  3VQ4 A;  3VEY A;  5K14 A;  5J1E A;  3I0S A;  5KPZ A;  4I6M A;  2HVH A;  4K8Z A;  1JLG A;  3FZH A;  3I55 N;  3ATU A;  3KWI A;  1RTD A;  1RTH A;  3KJV A;  3QEX A;  3H45 C;  3NAE A;  3QET A;  4M45 A;  5AQR A;  4RW8 A;  3F5T A;  1ZC6 A;  4O44 A;  5C25 A;  2WUS A;  5EVZ A;  4OO1 J;  4A2B A;  2VWB A;  3TTC A;  4Z4G A;  2BH1 A;  3MMV A;  1T8E A;  4CHO A;  2P9S B;  4MLH A;  3CI5 A;  2VG6 A;  2KFZ A;  2W6K A;  1T7P A;  3RMC A;  4AIL C;  1YXQ A;  3MN7 A;  3TR8 A;  1I94 K;  4MQ3 A;  5AQU A;  5LL6 Z;  2Y1I A;  1T3V A;  4CJK A;  4FM0 A;  1RT5 A;  4CF0 A;  4JRQ A;  4H4O A;  1IKV A;  4DQI A;  2G8U A;  2QEX N;  4LFC K;  3LWM A;  2KKZ A;  5JS1 A;  3ENH A;  1ILY A;  3OYN A;  4JI2 K;  5I3U A;  3OYL A;  3PO5 A;  1KAX A;  4BAC A;  3QNO A;  3OYG A;  2OZM A;  4AM6 A;  4BRI A;  1C6V A;  3J8A A;  2RF2 A;  3CFP A;  4BY9 C;  4DTR A;  2D0C A;  4WE1 A;  5AQM A;  4CZE A;  4LF6 K;  2QWP A;  4MO4 A;  4DSE A;  3A8Y A;  4OLB A;  4KO0 A;  3KHY A;  4CHY A;  4DV3 K;  1SQK A;  4FWP A;  2BDP A;  3W0L A;  3HP6 A;  1GOB A;  2DTU A;  4J8F A;  2IVP A;  4CK1 A;  3AO5 A;  5JMV A;  4CEA A;  3NFA A;  1XI1 A;  4A5A A;  4PY5 A;  1QQC A;  1HUX A;  3FR0 A;  4DTU A;  4DUY K;  1KVC A;  4OJR A;  4NYF A;  4M3R A;  3PV8 A;  4FWM A;  5AJ3 K;  2G8W A;  3AVB A;  4EP4 A;  2YJF A;  3L0Q A;  3DLL L;  3L2W A;  3NGI A;  3A5N C;  3VGL A;  4B1U B;  3LAN A;  4CJS A;  3TTF A;  3SCX A;  2G8H A;  1RBS A;  1XMO K;  2E88 A;  3ZCM A;  4C8K A;  4FJ5 A;  1HQU A;  2ITG A;  1LW2 A;  1B9D A;  1HNX K;  1R59 O;  1YJN N;  3SV3 A;  2F96 A;  1CZA N;  5AQY A;  2YX6 A;  3C7N B;  3T1A A;  5KGX A;  3OYF A;  5HRO A;  1JL2 A;  3PSF A;  3AVL A;  3DAW A;  3OY9 A;  4JK7 A;  1NGB A;  2QXL A;  3QEP A;  3CCR N;  1NKB A;  5GAD P;  3LAL A;  2DFF A;  1RDB A;  3P39 A;  4FW1 A;  1E4G T;  4BRK A;  4BDY A;  3EN9 A;  3G71 N;  3VEW A;  5KRT A;  4WCE L;  4MLE A;  4DTJ A;  1XHX A;  2V7Y A;  4JRP A;  4DR1 K;  3LP3 A;  3CJ1 A;  4R79 A;  2ASO A;  3ATV A;  4OGE A;  1HR0 K;  1HPM A;  4E3S A;  4BRP A;  4JLH A;  3G25 A;  2G8V A;  2P9U A;  3TAQ A; 
#chains in the Genus database with same CATH homology
 1WNS A;  4CED A;  1WN7 A;  2GBZ A;  3VQ7 A;  1BCM A;  2DFE A;  4FJ9 A;  3VQP A;  3AA2 A;  4C8O A;  4DQS A;  4F8R A;  3U6F A;  3SQ1 A;  1LAV A;  1SL2 A;  4FYD A;  1RDD A;  1CXQ A;  4DSK A;  3VA0 A;  3L2Q A;  1JLQ A;  4DQR A;  4DS5 A;  4FJ7 A;  3MEC A;  4IBN A;  3QEI A;  1HPZ A;  5CYQ A;  3D45 A;  1GOA A;  3HJF A;  1LAW A;  3OYK A;  1X1P A;  3NE6 A;  3VQD A;  4IDK A;  1JLF A;  1WSE A;  3AVH A;  1KVA A;  4KHN A;  4M42 A;  4IG0 A;  4CGG A;  3MEE A;  3O3H A;  2Z1G A;  3OYH A;  3RRG A;  2YHB A;  4FZZ A;  1WSI A;  2QKK A;  2IGI A;  2RKI A;  3PUF A;  4FLW A;  4DLE A;  1Q8I A;  4B8C A;  3LP2 A;  1IKW A;  2VG5 A;  1YVU A;  1RDA A;  4I9Q A;  3LDS A;  2FBV A;  4Y1C A;  4ELT A;  2XY8 A;  4E0D A;  4FJI A;  4M3Z A;  3ITH A;  2HMI A;  4EZ9 A;  5KI6 A;  1HJR A;  3AVM A;  5DMR A;  3RR8 A;  3KKR A;  1JLC A;  1EP4 A;  3DOK A;  1TV6 A;  4FM2 A;  1EX4 A;  3KD1 E;  1TAQ A;  4O5B A;  3M8Q A;  3K5N A;  4FLV A;  4B9L A;  4K8X A;  4M3X A;  1T03 A;  4E1M A;  3VQA A;  1B92 A;  4MFB A;  3JSM A;  1BHL A;  4BE1 A;  4KHY A;  1JLE A;  3V9U A;  4EZ6 A;  4W5N A;  3VQ8 A;  4KTW A;  4CJL A;  4CE9 A;  1NK4 A;  4DTX A;  3SYZ A;  2A1S A;  3OYD A;  3O4N A;  4CIE A;  4F2R A;  4IKF A;  4I7F A;  2WON A;  2KW4 A;  1ZBH A;  1BI4 B;  1FXX A;  4CFA A;  2PYJ A;  5T7B A;  4BE2 A;  4DTS A;  3ZSR A;  1RT3 A;  1QTM A;  4FJN A;  2FBT A;  4RW9 A;  1BIS A;  1F21 A;  3VQC A;  4AHU A;  3M8R A;  3SQ4 A;  3SQ2 A;  3BDP A;  4C8N A;  2O4I A;  2KFN A;  4CHZ A;  2HNY A;  4RG8 A;  3RTV A;  3CFR A;  4FZY A;  3K5O A;  4B9T A;  4ELU A;  1J9A A;  3SV4 A;  3C6T A;  4N47 A;  3U3G A;  3ZSW A;  1RCH A;  4M3W A;  3AV9 A;  2BGG A;  4GVM A;  4FLX A;  1HNI A;  1ASV A;  3OYC A;  1BQM A;  1WSJ A;  1WSF A;  4FJH A;  3DMJ A;  4M3Y A;  2B5J A;  1HMV A;  1S9G A;  2WOM A;  5JS2 A;  3ZSZ A;  3F73 A;  4I2P A;  1KFD A;  4O4G A;  2E4L A;  4CEO A;  4DSF A;  3SPY A;  1ZBI A;  4QOZ B;  1C1A A;  3DOL A;  1WLJ A;  4B08 A;  1C0T A;  2R7Y A;  1NK5 A;  1REV A;  4DSJ A;  4FXD A;  4HVJ A;  1Q9Y A;  4GW6 A;  5HRS A;  4QAG A;  3TAN A;  1U45 A;  4CFD A;  1Z26 A;  3NF7 A;  1Y97 A;  3I0R A;  4FLT A;  3NH1 A;  1DLO A;  3DYA A;  1A5V A;  3RMB A;  2JGU A;  2QXF A;  3DRP A;  4FK4 A;  1BGX T;  5SWM A;  2KTQ A;  1C0M A;  1LWE A;  3OYB A;  2HW3 A;  2NUB A;  2OA8 A;  3QIO A;  1BI4 A;  3NDK A;  4FCY A;  3TAF A;  4OPJ A;  4Z4F A;  1IH7 A;  3NF6 A;  1RNH A;  4W5R A;  4CHP A;  4OPK A;  4BDP A;  4CK3 A;  3VQB A;  2YHA A;  5FRN A;  4FJM A;  3AVN A;  2IOC A;  1B9F A;  4CF8 A;  4Q0B A;  4KTQ A;  1LWF A;  3MXI A;  1DTQ A;  3O3F A;  2XY5 A;  1SKS A;  4N76 A;  4HUG A;  3O3G A;  1NK9 A;  4CJ5 A;  3OS1 A;  3ZSX A;  4CER A;  4CCH A;  1UWB A;  2D0A A;  3ULD A;  2HHT A;  3UIQ A;  2Q3S A;  4FJX A;  2ZD1 A;  1KCF A;  1RBU A;  5CYM A;  1HYV A;  3I8D A;  2A1R A;  2PYL A;  4KV8 A;  4NCB A;  3KIO A;  1TL1 A;  1KLN A;  1EKE A;  3VQ6 A;  4JS5 A;  1SKR A;  4NCA A;  1VSD A;  2HVI A;  2D0B A;  3C6U A;  2IDO A;  5DK5 A;  4AH9 A;  3O4Q A;  4KB1 A;  2FBY A;  3QNN A;  1CZ9 A;  1QS4 A;  3V1O A;  3NCI A;  4KRE A;  4FLZ A;  2BE2 A;  2OPR A;  3MXM A;  2HHS A;  1D5A A;  4CFB A;  4NCG A;  1RT1 A;  3V4I A;  4CIF A;  1QSY A;  1XWL A;  4DSL A;  3MXJ A;  4CGI A;  3IG1 A;  4DTO A;  3RMD A;  1Q9X A;  1VSF A;  1J5O A;  5HRP A;  2F8T A;  3OS2 A;  2XY7 A;  3QEW A;  3NGZ A;  3SZ2 A;  3FFI A;  1K6Y A;  1NK8 A;  3G10 A;  3LPU A;  4N56 A;  2F8S A;  1MU2 A;  4OVL A;  4EP5 A;  4M3U A;  2YNH A;  2YV0 X;  1JL1 A;  4LH4 A;  4LH5 A;  1X9S A;  4KI6 A;  3TAP A;  4F3T A;  2PY5 A;  1L3V A;  3HK2 A;  1C1B A;  4DQP A;  1ASW A;  3L3V A;  1LW0 A;  4E7K A;  4FJK A;  3NF8 A;  4DFK A;  3F9K A;  1NK7 A;  3AO1 A;  3L2U A;  1IG9 A;  4DQQ A;  3S3O A;  3OYI A;  2P5O A;  1A5W A;  3AVI A;  3AO2 A;  1ITG A;  3RRH A;  1NKC A;  2FBX A;  1W9H A;  3KK3 A;  5KRS A;  3ZSV A;  3L8B A;  4DLG A;  3ZT4 A;  4FJ8 A;  3KLI A;  1VK0 A;  1I39 A;  4Z4C A;  3AVA A;  1J54 A;  1BIU A;  3HPH A;  3NBP A;  4OGC A;  3KLG A;  2X74 A;  3AA4 A;  1RT2 A;  4BE0 A;  4F3O A;  4R5P A;  4CEQ A;  1S9E A;  4DSI A;  3K58 A;  2B6A A;  5CY4 A;  3DI6 A;  3VQ5 A;  3DLR A;  3V9X A;  3T3F A;  1IKY A;  1NOZ A;  1D8Y A;  4F4K A;  2YKN A;  3QER A;  3S3N A;  5FRO A;  4W5T A;  4B9U A;  3PX6 A;  1EXQ A;  4BWM A;  4AHV A;  2ZQB A;  1VRT A;  4Z4I A;  3CG7 A;  1S5J A;  1ZBU A;  2VG7 A;  3K2P A;  2X6S A;  4CGJ A;  3H08 A;  4CEF A;  1NK0 A;  4E7I A;  1S6Q A;  4AHS A;  3D0P A;  4DF4 A;  3P1G A;  3QES A;  1RBT A;  3G0Z A;  1YT3 A;  4KTZ A;  1JKH A;  1VSE A;  2JLE A;  1U4B A;  3DLG A;  2KQ2 A;  3ZT2 A;  4Z4E A;  4E89 A;  1WSH A;  1KRP A;  3OJU A;  3PX0 A;  4PUO A;  3MAQ A;  1NJZ A;  1L3U A;  4KHS A;  3HL8 A;  4DTM A;  3SUQ A;  4M41 A;  1RTI A;  2B4J A;  3LP0 A;  1L3T A;  3ZT0 A;  4CGD A;  1TVR A;  4BWJ A;  1VRU A;  3DLH A;  3CQ8 A;  1FKP A;  1J53 A;  1RT6 A;  2P1J A;  3ZT1 A;  2OYQ A;  1KSP A;  4LSL A;  1S6P A;  4LY7 A;  3OYM A;  4DWI A;  1HNV A;  4O0J A;  4DG1 A;  4KPY A;  3TAG A;  3S3M A;  2Z1H A;  4OKJ A;  1RBV A;  3V1Q A;  3MEG A;  3M8S A;  2HND A;  2KZM A;  1S1T A;  4DF8 A;  3EY1 A;  4Z4H A;  1SL0 A;  3LWL A;  1A5X A;  3HO1 A;  3CYM A;  3ALY A;  1JLB A;  4CJ4 A;  1QE1 A;  2RPI A;  2OZS A;  1HRH A;  4ID1 A;  3ZSY A;  3KLH A;  3HXM A;  4CEC A;  3TAR A;  2X6N A;  1L3S A;  4FVM A;  4B9M A;  4W5Q A;  2YNI A;  1X9W A;  1HYS A;  4N41 A;  1WAF A;  4CK2 A;  3KLE A;  1BQN A;  2GUI A;  4PQU A;  3V9S A;  1KVB A;  3WNG A;  2G8I A;  4YNQ A;  3NHG A;  3P83 D;  2YKM A;  3V9W A;  3ZT3 A;  4J2B A;  1RIL A;  3LP1 A;  2XHB A;  2EHG A;  2YNG A;  3VQQ A;  1RT7 A;  2OPQ A;  3WNE A;  2DFH A;  1TL3 A;  4CGH A;  4KHU A;  3QO9 A;  2Z1I A;  3HT3 A;  3VN5 A;  3TAE A;  1NJX A;  1QSL A;  4DMN A;  1ASU A;  4Q5V A;  1ZBL A;  1I3A A;  3OVN A;  3A2F A;  2RN2 A;  4CJT A;  1NK6 A;  1U47 A;  2G8F A;  4C8L A;  4FJJ A;  4OLA A;  1XHZ A;  1QSS A;  2XY6 A;  3E01 A;  5HP1 A;  4IG3 A;  3THV A;  4H4M A;  2ATQ A;  2OPP A;  3LAM A;  4CHN A;  4KI4 A;  4HUF A;  4Z0U A;  3AVC A;  3OYE A;  1KFS A;  3VQ4 A;  4B9V A;  5K14 A;  4CF1 A;  4LSN A;  1SL1 A;  2AJQ A;  3AVJ A;  4CJ3 A;  4PA1 A;  5J1E A;  3I0S A;  3NH0 A;  2KZZ A;  3WNH A;  3V6D A;  4HHT A;  5J2M A;  1TKX A;  4KKO A;  1TK8 A;  3HST B;  3ZSO A;  2HVH A;  1NOY A;  4CEE A;  1BL3 A;  1VSJ A;  2OPS A;  4K8Z A;  4M3T A;  1JLG A;  2E6L A;  2IAJ A;  3NF9 A;  5HRR A;  4DU4 A;  2IC3 A;  4ZTF A;  1RTD A;  5HLF A;  3WNF A;  1RTH A;  4FW2 A;  4G1Q A;  3KJV A;  3TWH A;  3QEX A;  1X9M A;  3SI6 A;  3LZI A;  1TKD A;  3RWU A;  4J2D A;  3K59 A;  1RT4 A;  2PZS A;  3HPG A;  3NAE A;  1N5Y A;  3QET A;  3T19 A;  4M45 A;  4RW8 A;  2QKB A;  1CXU A;  4KFB A;  1L5U A;  3KLF A;  1BIZ A;  4O44 A;  5C25 A;  3B6P A;  4DU1 A;  3IRX A;  5FDL A;  3C95 A;  2W42 A;  1VSH A;  4HTU A;  3V1R A;  1YTU A;  1WSG A;  3RR7 A;  4TSX A;  3SUN A;  4W5O A;  3L2V A;  4Z4G A;  3SPZ A;  4KRF A;  1T8E A;  4CJP A;  3PX4 A;  1S1V A;  4CHO A;  1LV5 A;  1S1W A;  1HYZ A;  5HRN A;  4CJE A;  3CM6 A;  3SQ0 A;  1D9F A;  1UA0 A;  3VQ9 A;  2VG6 A;  2KFZ A;  3DLB A;  4OKK A;  3IS9 A;  2G8K A;  1SV5 A;  4J2A A;  1T05 A;  4O0I A;  1QHT A;  5KGW A;  1VSI A;  4DS4 A;  1UAX A;  4CEB A;  4CES A;  4AIL C;  3RMC A;  1TK5 A;  2P5G A;  3L3U A;  4ID5 A;  2HHW A;  1U48 A;  3DRR A;  3TR8 A;  4CJF A;  4MQ3 A;  4LD0 A;  1C1C A;  1CZB A;  3KK1 A;  5EU7 A;  1IKX A;  4UQG A;  3V9Z A;  2Y1I A;  4CIG A;  4KHQ A;  4RW4 A;  4CJK A;  4FLY A;  2HNZ A;  3OS0 A;  4FM0 A;  1ZYQ A;  1RT5 A;  4CF0 A;  2O4G A;  4JRQ A;  4J2E A;  3OJS A;  4B8A B;  3QLH A;  1TKZ A;  4H4O A;  3AVF A;  1VSM A;  1TKT A;  5FRM A;  5C24 A;  3AO3 A;  4XIU A;  3EZ5 A;  2XRI A;  1IKV A;  4DQI A;  2G8U A;  4FLU A;  1VSL A;  2HHV A;  4DU3 A;  2D5R A;  3LWM A;  5E41 A;  3HPO A;  5JS1 A;  5SZT A;  3KK2 A;  3LAK A;  4OKE A;  4RW6 A;  3OYA A;  3OYN A;  3MED A;  2BAN A;  1BCO A;  5J2Q A;  5I3U A;  1IO2 A;  3OYL A;  4IFY A;  3PO5 A;  4C8M A;  4HCC A;  3BGR A;  1EET A;  1YTA A;  3HP9 A;  3HYF A;  4CF2 A;  4CJR A;  3NH2 A;  4AHT A;  4BAC A;  3QNO A;  2XO7 A;  3KTQ A;  3AA3 A;  2IS3 A;  4CJU A;  1W0H A;  3OYG A;  4DFM A;  2OZM A;  3CFO A;  4ELV A;  4FM1 A;  4FK0 A;  1C6V A;  3B6O A;  2RF2 A;  3CFP A;  1NKE A;  3DLE A;  1S1U A;  2D0C A;  4WE1 A;  4DTR A;  3TAB A;  1RTJ A;  3ASM A;  5I42 A;  4FJG A;  1ZBF A;  3VA3 A;  4CJQ A;  4E19 A;  4KHW A;  4DSE A;  1HQE A;  3KD5 E;  4OLB A;  4KO0 A;  3CM5 A;  4DTP A;  1Z25 A;  4CFC A;  4E7L A;  2FC0 A;  2GV9 A;  2Z1J A;  3HVR A;  5D3G A;  3PY8 A;  4CHY A;  4FZX C;  1WAJ A;  3TAM A;  3SJJ A;  3ZSQ A;  2HHU A;  2X78 A;  3V81 A;  1C0U A;  1KLM A;  4HUE A;  4E7H A;  3S9H A;  2BDP A;  3HP6 A;  1GOB A;  2DTU A;  1G15 A;  4GMJ B;  2HB5 A;  3SUO A;  4CK1 A;  1T7P A;  4CHQ A;  4JS4 A;  3AO5 A;  5KTQ A;  2Y1J A;  3PO4 A;  4CEA A;  3NFA A;  1XI1 A;  1XC9 A;  3K57 A;  5CZ1 A;  4PY5 A;  1QQC A;  4DTU A;  1LWC A;  1KVC A;  4OJR A;  4NYF A;  4M3R A;  5C42 A;  3PV8 A;  3IAY A;  4Y1D A;  3P5J A;  2YNF A;  2G8W A;  1VSK A;  3AVB A;  4EP4 A;  1RDC A;  3TI0 A;  4QCL A;  2VWJ A;  5J2P A;  3L2W A;  3NGI A;  3LPT A;  4E1N A;  4F2S A;  3DRS A;  4PWD A;  4B9N A;  3LAN A;  4CJS A;  3SCX A;  2G8H A;  4I9L A;  1RBS A;  3DLK A;  2I5J A;  4FJ5 A;  4C8K A;  3ZCM A;  1NJW A;  4IFV A;  1TK0 A;  1HQU A;  3EYZ A;  2ITG A;  3HM9 A;  4BDZ A;  3AVG A;  1LW2 A;  1B9D A;  4FK2 A;  4B9S A;  1D9D A;  1DTT A;  1U49 A;  1CLQ A;  1JXE A;  3SV3 A;  2HHQ A;  4NYN A;  2F96 A;  1O1W A;  5HBM A;  4AHR A;  2ZE2 A;  4L8R B;  3T1A A;  1SUQ A;  1KTQ A;  2LSN A;  1GOC A;  1U04 A;  2E6M A;  4CEZ A;  1FKO A;  5KGX A;  3OYF A;  5HRO A;  1UA1 A;  1NJY A;  1JL2 A;  3L2R A;  3AVL A;  1JLA A;  3OY9 A;  3AO4 A;  4CJV A;  4ICL A;  1SKW A;  3K5L A;  3QEP A;  4CF9 A;  3QIP A;  3SUP A;  2ETJ A;  1N6Q A;  1NKB A;  2QK9 A;  3LAL A;  4DFJ A;  2DFF A;  1RDB A;  3QIN A;  4CJW A;  3C94 A;  2EX3 A;  3LZJ A;  4DFP A;  1RBR A;  4YFU A;  3NGY A;  4AHC A;  4FW1 A;  3OYJ A;  4FJL A;  2HHX A;  3RMA A;  4BDY A;  4H8K A;  4DTN A;  4CGF A;  3AA5 X;  3K5M A;  2DY4 A;  1TAU A;  5KRT A;  4ZTJ A;  4RW7 A;  4ZHR A;  4I2Q A;  3U3Y A;  1TGO A;  3SNN A;  3M8P A;  4KB0 A;  1FK9 A;  4DTJ A;  1XHX A;  4N5S A;  4JRP A;  5CZ2 A;  3LP3 A;  3KKS A;  3AVK A;  4OGE A;  4HCB A;  4O55 A;  4E7J A;  3HVT A;  1R0A A;  2VWK A;  3QEV A;  4KAZ A;  4E3S A;  3ISN C;  3JYT A;  1S1X A;  1UOC A;  4JLH A;  1JXB A;  5J2N A;  3VQE A;  3DM2 A;  2G8V A;  2P51 A;  4B3O A;  3TAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...