1KVAA

E. coli ribonuclease hi d134a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCAELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvaA00
4CFDA 3DLGA 3THVA 1WAFA 3PV8A 4Z4CA 1D9FA 1UWBA 3TAQA 4CEOA 2X6SA 1Z26A 3KLFA 2BE2A 3V9WA 3OVNA 5HLFA 3PY8A 4NCAA 1RBSA 4DTNA 4ZTFA 4J2AA 2YKNA 4MFBA 1VSEA 3O4NA 4N47A 4DU4A 3BGRA 1QSYA 1U45A 1U4BA 2IDOA 2IS3A 3DLBA 2EX3A 3SPZA 4RG8A 3QETA 4O55A 3KLGA 4J2DA 1J53A 3V9UA 3NH2A 4KKOA 3ZSYA 4FLVA 5HRSA 4PA1A 3AA5X 3LAMA 1BCOA 1N6QA 1A5WA 1RT3A 4F3TA 3ZSZA 4JRPA 2G8WA 1RNHA 3HM9A 4R5PA 4Q5VA 3SQ1A 4I9QA 3K5OA 2W42A 3T3FA 4QAGA 4DTMA 4M3RA 4K8XA 1RBRA 1I3AA 4BDYA 3ITHA 5J2NA 3SV4A 1RBVA 1BIZA 4KHYA 4HUGA 1S1WA 2KZZA 1DTTA 4HCBA 2D5RA 3HO1A 4Z0UA 3SPYA 4M45A 1U48A 3AVAA 1R0AA 2KW4A 3DM2A 1TAQA 3P1GA 5C24A 1JL2A 2O4IA 4N56A 3U6FA 1D9DA 1B9DA 1SUQA 3DRPA 1GOAA 1TL1A 1I39A 3AO5A 4FJIA 3VA3A 4IKFA 1KTQA 2IOCA 4FLXA 1JXEA 3NH1A 3QINA 1TKXA 4IDKA 4M3WA 1WSEA 3IS9A 1KVCA 3L2RA 1LAWA 3CYMA 4IG0A 2OYQA 4CJ5A 4CE9A 1RDAA 1XI1A 1NOYA 3K2PA 1RT4A 3L3UA 1HRHA 3SCXA 4FJKA 4E7LA 3V81A 4HHTA 4BDPA 1BQMA 5J2QA 4H8KA 2BDPA 4CJFA 3DRRA 4CEEA 3RR7A 3KKRA 4FYDA 1GOCA 2HHXA 4ICLA 2DY4A 3HYFA 5KGXA 1EKEA 3SYZA 1S9EA 1LWEA 4FLWA 4MQ3A 1S1UA 4E7HA 3V9ZA 3TR8A 2A1SA 1ZBUA 2ATQA 2ZE2A 3QEWA 2F8SA 3VQDA 4CJQA 1C0UA 5FRNA 4F2SA 4CJWA 1X1PA 3O4QA 2VWJA 3NGIA 3TWHA 3RMAA 1RT7A 3C94A 4HTUA 1QS4A 2ZQBA 3KLHA 1SKSA 2B6AA 1VRTA 3WNEA 4CIFA 1Q9YA 4OGEA 4CHOA 2YNIA 1T03A 1RTHA 3HSTB 2OPSA 4B9VA 1XHZA 1F21A 2BGGA 3IRXA 4CFAA 1XC9A 4KB0A 1FKPA 3KLIA 1UAXA 4FJ8A 2E6LA 2KZMA 3NDKA 3OS1A 2D0BA 3SJJA 2P5GA 3OS0A 4KHSA 3ZCMA 4DS4A 4FM0A 1RTJA 4KPYA 1JLQA 2G8IA 3L2UA 4Y1CA 3CFPA 3SQ0A 4DTRA 2GUIA 2FBYA 1IKYA 1LAVA 5JS2A 2Z1IA 3L3VA 4IBNA 4DFMA 3MXMA 1IG9A 4OLAA 4HCCA 1C0TA 4FLUA 3RMCA 2KFNA 4ID1A 2DFHA 1X9WA 2F96A 3OYLA 3VQQA 1LWFA 3V1QA 1BCMA 4B08A 3NAEA 1T7PA 2FBXA 3LP3A 2PY5A 3NGYA 4CHNA 4O0IA 3QLHA 2X6NA 4KTWA 3ASMA 3QEIA 3IAYA 3I0RA 3O3GA 1VSIA 3DYAA 3LZJA 1HNIA 1UOCA 1REVA 4M41A 3AVCA 4DF4A 3QEXA 1LV5A 4Z4EA 3VA0A 3L2WA 3C6UA 3ISNC 1T05A 1BIUA 1L3UA 4M3ZA 3CQ8A 2RN2A 3SUNA 4KO0A 2HNZA 4OKKA 1IKXA 3PX6A 3OYKA 3SQ4A 4O44A 3PX4A 3S3OA 2G8KA 1K6YA 3HPGA 1S6PA 4NCBA 3AO4A 4KV8A 4RW4A 5I3UA 1QE1A 3O3FA 3H08A 4J2EA 3B6PA 4ID5A 3RRHA 4EZ9A 4E3SA 1D5AA 1U49A 4LY7A 4FM1A 3PUFA 3LP1A 1FK9A 3CM5A 3AVMA 3RMBA 4CJ4A 2YHAA 1NKEA 3M8RA 4F4KA 2RKIA 1DTQA 1TKDA 3PX0A 2OZSA 1A5VA 4CJSA 1KRPA 3SI6A 3RTVA 1S1VA 3D45A 3KK1A 3C95A 1NK0A 3KD1E 4FJGA 2WOMA 3OYCA 1RT1A 3HJFA 1RT5A 3NFAA 2OPPA 3M8SA 3EY1A 4OKEA 3AVIA 2VG5A 4CK2A 1CZBA 1RDBA 1BHLA 2XY7A 3DLEA 1J54A 1N5YA 2B5JA 4FJXA 3HP6A 5HBMA 4AHTA 4KTQA 2G8VA 3NGZA 4KI4A 4M3UA 3OYBA 2XRIA 3AVGA 3T19A 3QNNA 4OJRA 4HUFA 4RW6A 4OVLA 2P51A 3T1AA 3U3GA 3L2QA 4E7KA 3SUOA 4C8OA 4CJRA 4PUOA 3AO1A 2KFZA 2DFFA 3ALYA 4QOZB 4JLHA 3IG1A 4IFYA 1KSPA 1SL1A 3QEPA 4J2BA 4UQGA 1RDCA 1WSHA 3OY9A 1QSLA 4LSLA 1UA0A 2YV0X 4RW7A 4CHPA 4DWIA 4DSEA 4CJPA 3VQEA 1C6VA 3QO9A 2VWKA 4DTJA 4DG1A 4B9MA 2Q3SA 1RTIA 3DOLA 3OJUA 3NF6A 4KFBA 3KK2A 2A1RA 1WNSA 2XO7A 2DFEA 1VRUA 3P83D 3NF7A 4CJUA 3V1RA 4FCYA 4CGDA 5J2MA 4K8ZA 3LWMA 5JS1A 4I2QA 1HYSA 3SV3A 4PQUA 4E1MA 3AA4A 4FJNA 4M42A 1ZBFA 3LZIA 1JL1A 3AVLA 3ZT3A 4FK2A 4NCGA 4CEBA 3V9XA 3V1OA 1L3SA 5CZ2A 3SUQA 2B4JA 4W5NA 1ZBHA 1SKWA 2RPIA 1T8EA 4HUEA 3OYGA 1TK5A 1L5UA 4KHNA 3SUPA 1VSHA 4W5RA 3OYDA 2GV9A 4CHYA 3JSMA 3AVJA 4CIGA 3LDSA 1QTMA 3VQ9A 4Z4IA 2IC3A 1XWLA 2IGIA 3V6DA 1J5OA 2PYJA 4DSLA 1HQUA 2KTQA 1G15A 3K5MA 1U04A 2OZMA 2XY5A 1EP4A 2HHSA 4DTSA 5CZ1A 3BDPA 3G0ZA 3VQ8A 5SWMA 1VSFA 1KFSA 4E7JA 2QKBA 2BANA 2Y1IA 2EHGA 4I2PA 3WNGA 4C8LA 1QHTA 1S1TA 3KTQA 3LPUA 3AA3A 3VN5A 1TK0A 2YNHA 1JLBA 4BWJA 1QSSA 4EZ6A 3QERA 3HPOA 4FLZA 3NF9A 4CJLA 1BGXT 4Q0BA 3F73A 2RF2A 3MXJA 4BWMA 2HNYA 4H4MA 1NOZA 4LH4A 2ZD1A 3ZSQA 4CHZA 3KKSA 1S1XA 3DOKA 4FW2A 1WSFA 2VG7A 4OPKA 3OJSA 3EZ5A 4FZXC 1C1AA 2I5JA 2OPQA 3CFOA 3QESA 3TAGA 5KTQA 2HHVA 1RT6A 4TSXA 1U47A 4C8KA 4CJTA 1XHXA 5SZTA 1NJYA 1IKWA 4DU3A 1KLMA 4OLBA 3LALA 1Q9XA 4DMNA 3KLEA 4CJEA 4CCHA 2G8HA 4E0DA 3KJVA 4FZZA 1EXQA 2XY6A 1MU2A 1WSIA 1Z25A 2E6MA 4CFCA 4LSNA 2AJQA 1KVBA 4FJLA 3ZT1A 4KTZA 3TARA 2HHQA 4RW9A 5K14A 1GOBA 1WAJA 3B6OA 3MEGA 2NUBA 4DTXA 1NK9A 3K59A 4DLGA 1CXUA 3PO5A 4F2RA 4CGJA 1HNVA 4CF8A 1EETA 5KRTA 3DLKA 1D8YA 1ITGA 4FK0A 3NHGA 1B92A 1X9SA 1TVRA 1BISA 4B9TA 3LPTA 3RR8A 3OYNA 1JLAA 1NK6A 2YHBA 4LD0A 4CESA 3AVHA 4CJVA 4FJHA 4CEQA 3ULDA 4CJ3A 4FJ5A 4F3OA 1SKRA 4KHWA 3DI6A 4E19A 5DK5A 2HW3A 1VSDA 3VQ7A 5C42A 2XHBA 1NKCA 3KIOA 3HT3A 1CZ9A 1JXBA 4DQRA 3I8DA 1ZYQA 2FBVA 4O0JA 3PO4A 4O4GA 1SL2A 1J9AA 4KB1A 4DSKA 1S5JA 3OYMA 4PWDA 4H4OA 3HVRA 1TL3A 1RCHA 4DFPA 1YTUA 2Y1JA 2E4LA 1ASUA 5HRRA 1VSKA 5KRSA 4M3TA 1TKZA 1A5XA 3AO2A 4O5BA 3VQ4A 5T7BA 3MEEA 3AVNA 1IH7A 3LAKA 4CF0A 1C1BA 5HROA 3V9SA 4FVMA 4M3XA 1S9GA 1FKOA 2GBZA 4CERA 4W5QA 3KD5E 2Z1HA 3VQBA 3S9HA 4ELUA 3TAMA 3NE6A 2HVIA 4OGCA 2YKMA 4B9NA 1Y97A 4CF9A 2D0AA 2ETJA 1HQEA 4DU1A 1NK5A 4N76A 1VSJA 3MAQA 1WLJA 4NYFA 4FK4A 2Z1JA 1RTDA 3AVKA 3VQPA 3TAEA 3ZT0A 4N5SA 1HMVA 1BI4A 2VG6A 5J2PA 4KAZA 1JLFA 3P5JA 1W0HA 3CM6A 4BE1A 1TKTA 3ZSWA 2FC0A 4Z4GA 1WSGA 1HYZA 2QXFA 3FFIA 1C1CA 4NYNA 4AH9A 4Z4FA 2D0CA 3OYFA 5KGWA 3AO3A 1LW2A 1HYVA 1O1WA 4ELVA 4CECA 1KFDA 2HHWA 1KVAA 4B8CA 4DFKA 3CFRA 4DS5A 2OA8A 4KHQA 1IKVA 1JKHA 1RBUA 1ASWA 3SNNA 4ELTA 1WSJA 1TK8A 1LWCA 4AILC 5CYQA 3MEDA 3ZSRA 3V4IA 4B9UA 4FLTA 4KI6A 4FLYA 4BACA 4DQPA 1IO2A 3A2FA 1TV6A 4B8AB 4W5TA 3VQCA 3O3HA 3OYJA 2P1JA 3D0PA 1SL0A 4IG3A 3SZ2A 3ZSXA 3UIQA 1DLOA 4QCLA 4AHUA 1L3TA 3QIPA 3CG7A 3DLRA 4CEDA 4CK1A 5E41A 4AHVA 4W5OA 3QEVA 1QQCA 5KI6A 3SQ2A 2Z1GA 1W9HA 2HB5A 3C6TA 4DF8A 2XY8A 4E89A 1CLQA 1VSLA 4LH5A 4XIUA 5HRPA 1X9MA 1YVUA 4DTPA 1NK8A 1BQNA 2X74A 4Z4HA 4CGFA 3AV9A 1KLNA 2OPRA 3NH0A 3VQAA 4DSFA 4FM2A 1TGOA 4CF1A 4B3OA 4CK3A 3LWLA 2ITGA 3LP0A 4G1QA 2HMIA 2KQ2A 4DLEA 1NK4A 3K58A 3VQ5A 1LW0A 2IAJA 5C25A 3OYEA 3QIOA 4CIEA 1ZBLA 1NJXA 4CJKA 1ASVA 5CY4A 4M3YA 3DMJA 4CEZA 1JLGA 4Y1DA 4GW6A 3DLHA 4OKJA 2P5OA 1NJZA 1BL3A 3WNHA 4CEAA 2X78A 4YFUA 1HJRA 3K57A 3F9KA 3DRSA 3G10A 3OYHA 3HVTA 3QNOA 1HPZA 4OPJA 3TABA 4RW8A 2PYLA 3LANA 3LP2A 2FBTA 2HNDA 3ZSVA 4FXDA 4C8MA 1B9FA 5EU7A 4DQQA 3OYAA 4EP4A 1YT3A 4FJJA 3HPHA 4C8NA 5HRNA 4I7FA 2YNFA 3HP9A 3S3NA 4FJ9A 2WONA 4B9SA 4FJMA 3ZT4A 3M8QA 5D3GA 4WE1A 1KCFA 2HHUA 3NCIA 4FJ7A 3M8PA 4BDZA 2JLEA 4DSIA 3RWUA 1BI4B 4DQSA 3E01A 1JLCA 3ZSOA 2F8TA 5J1EA 1L3VA 3L2VA 3HK2A 3AVBA 4DTUA 2QKKA 4DQIA 4KRFA 4BE0A 1NK7A 4E1NA 1JLEA 4AHRA 4ZTJA 3NBPA 4JS5A 4DSJA 1TAUA 2O4GA 4BE2A 3WNFA 4F8RA 3MXIA 1C0MA 1FXXA 3EYZA 3K5LA 1S6QA 3KK3A 2LSNA 1VK0A 3AVFA 4AHCA 3L8BA 3HXMA 3MECA 2G8FA 2HVHA 4HVJA 4CFBA 4FZYA 1ZBIA 2YNGA 3OYIA 2HHTA 3NF8A 4DTOA 1EX4A 4AHSA 4E7IA 3K5NA 1SV5A 4FW1A 3RRGA 4PY5A 3AA2A 2DTUA 4JS4A 3TAPA 5FDLA 4GMJB 5I42A 2PZSA 3OS2A 4EP5A 3TAFA 4IFVA 4B9LA 4YNQA 4CHQA 1CXQA 1Q8IA 5FROA 1RT2A 1YTAA 3HL8A 3S3MA 4CGIA 4L8RB 1UA1A 4DFJA 3JYTA 4CEFA 5FRMA 1RDDA 1RBTA 5HP1A 4KREA 3TI0A 1NJWA 2QK9A 4GVMA 4I9LA 3RMDA 3U3YA 3TANA 2JGUA 1WN7A 3I0SA 4ZHRA 1RILA 1VSMA 5DMRA 4KHUA 4CGGA 4CF2A 3ZT2A 4N41A 2R7YA 1NKBA 5CYMA 3VQ6A 2G8UA 4JRQA 4CGHA
chains in the Genus database with same CATH superfamily
3PV8A 3VEWA 1TYQB 1D9FA 1UWBA 1KQSM 3C7NA 5HLFA 2QXLA 2P9PB 4ZTFA 4A5AA 2YKNA 4MFBA 4YOTA 3BGRA 1U45A 2IS3A 4KHPK 3S41A 1EO1A 3QETA 4O55A 3ZSYA 3LAMA 1QQMA 4BC5A 1RDWX 1A5WA 4MO5A 1OVYA 3ZSZA 1N36K 2V51B 1RNHA 3K0SA 4JK9A 5AQJA 4DTMA 1DGKN 1W2BM 4BY9C 4WYBA 4F9OA 4Y0WA 1RBVA 2HBJA 4IDHA 1SS6A 4FSVA 3SPYA 4LF7K 1Z6RA 3AVAA 4K42A 3DM2A 4BRNA 1B9DA 4BRQA 2NRTA 2O8FB 1P90A 2HOEA 3NH1A 4IOAL 3F2KA 3CYMA 4BGAA 4CJ5A 1LOTB 1QZ6A 3K2PA 1RT4A 3SCXA 1DEJA 1NMNA 1BA1A 4BDPA 1N32K 5M1PA 1VQ5N 3OTOK 3DRRA 4CEEA 2P9NB 4FYDA 1GOCA 4IFEA 4PL8A 1S1UA 4AQYK 4E7HA 1ZBUA 1ZXOA 4A62A 3O4QA 3NGIA 3NMUA 1RT7A 4HTUA 2ZQBA 3KLHA 3QICA 2B6AA 1VRTA 3WNEA 1N34K 3SAHA 4CHOA 2CGJA 3MCAB 1P8ZA 4FWSA 5TKWA 5M1QA 4CFAA 1XC9A 4CVNE 2KZMA 3D7EO 3SBGA 3J7YP 3OS0A 4KHSA 3ZCMA 4FM0A 2G8IA 5KQ8A 3TPQA 3SQ0A 4DTRA 1IKYA 1YITN 3L3VA 3MXMA 3EO3A 5FPEA 1U6ZA 2F96A 4M7XA 5AQNA 1U2VA 4KTWA 3QEIA 4JKDA 3O3GA 3DYAA 3CPEA 4M41A 5AFUA 4M3ZA 1L3UA 5EX5A 3CQ8A 5EVZA 3PSIA 1HLUA 2GUPA 3SQ4A 4CZMA 4DR2K 4KV8A 3ZEUA 4IOCL 2E2QA 3E1YA 4BVOA 3H08A 4CZKA 4JV5K 3B6PA 5ADXH 3CJBA 1GLDG 5C15A 3CD6N 1HNXK 4LY7A 3LP1A 3CM5A 1BU6O 2YHAA 4JN4A 3PX0A 1KRPA 3RTVA 1S1VA 2P9SA 1HPMA 5AQHA 3I8BA 1RDBA 1S3XA 4XH5A 4FJXA 3VERA 4AHTA 3MCPA 4QS9A 5KPTA 3N4QA 2HHHK 2F9TA 4E7KA 4PUOA 4CJRA 2E2OA 4QOZB 3IG1A 1SL1A 3QEPA 4UQGA 4DKWA 3ZX2A 4RW7A 2ZWHA 3HSCA 4DSEA 3RSEB 5BPLA 2ASPA 4CD3A 4KFBA 3ULEB 4I2QA 3AA4A 4FJNA 3EKUA 3LZIA 4M42A 1JL1A 3FZHA 2E2NA 4FK2A 4NCGA 3V9XA 4H5WA 5CZ2A 1EQYA 3WXKA 3CC2N 1QZ5A 1RDUA 1T8EA 3G71N 3HRGA 4CHYA 3LDSA 4Z4IA 4PL7A 2IGIA 2KTQA 4LF5K 1U04A 3WXJA 1M1KO 5AQGA 5GADP 4B3SK 4WQ4C 2ITMA 3WEEA 1KFSA 4B1XB 5BREA 5M1OA 4XH4A 1S1TA 1NU0A 4DV6K 1QSSA 4B3MK 2O8BA 4BRHA 4Q0BA 3EL2A 1SAZA 2Q97A 1NOZA 4B3RK 4WFBL 1CLQA 1WSFA 2VG7A 5CHIA 4DV0K 2F4VK 3CETA 4OPHA 5KTQA 5SZTA 4BR2A 4YOVA 4CJEA 1YIJN 2QA4N 2XY6A 1WSIA 3TARA 4RW9A 3B6OA 4DTXA 4DLGA 1CZAN 1HNVA 3QMLA 1EETA 3E9PA 4A61A 3THXB 3LPTA 2NZTA 1VQKN 1NK6A 4FJHA 4LD0A 2HBKA 4AM7A 2HMPA 2E2PA 3D6RA 1NKCA 3KIOA 5JLFA 4BG9A 1JXBA 3O6WA 3ENBA 3DXMA 3PO4A 1NGEA 3KHYA 4O4GA 4KB1A 3QB0A 4PWDA 3HVRA 1RCHA 4DFPA 2O8DB 2KLAA 5HRRA 1NGFA 1VSKA 3OHRA 3VQ4A 4O5BA 5AQFA 3AVNA 4CF0A 4FVMA 5KPZA 4BR9A 2A41A 4CERA 5BR8K 3TAMA 3NE6A 2HVIA 3C6AA 4KBOA 4FOIA 2ASOA 4B9NA 3KZBA 4BC4A 4N76A 3LDLA 5BRHA 4LF4K 4FK4A 1RTDA 1IBMK 4LFCK 3F9MA 3ZT0A 4N5SA 1HMVA 4RWTA 4KAZA 3UKRA 4KH5A 1W0HA 4BE1A 2D1KA 3ZSWA 2FC0A 4AH9A 1C1CA 4Z4FA 4WF9L 2D0CA 3OYFA 3A5MC 5B8HA 1O1WA 5H1SQ 1YI2N 4DFKA 4BGBA 3CFRA 1IKVA 3VOVA 1RBUA 1WSJA 3VGMA 1LWCA 3D2EA 3QBWA 4AILC 5CYQA 1MDUB 4DQPA 1TV6A 3SZ2A 1DLOA 3DLRA 3VF4A 4AHVA 4CW7B 3QEVA 1QQCA 4JHDA 1W9HA 5EY4A 2HB5A 3FZFA 2XY8A 1VSLA 2AP1A 1X9MA 1YVUA 2OPRA 1T3VA 1TGOA 5AQPA 4BRKA 1ATRA 3LP0A 3K58A 1JCFA 1WBDA 1ZBLA 1ASVA 2VQFK 5HL7L 2WTUA 3H3NO 1Q7YO 4WQ4A 4B9QA 5JMVA 5M1NA 3O9SA 3E66A 3FE1A 3OYHA 3QNOA 1QQNA 3TABA 4RW8A 3WQUA 3LP2A 1XNRK 3ZSVA 2E5LK 3GE1A 1HKCA 3OYAA 4IO8A 3Q7CA 3FFKB 4CD1A 3HP9A 3IUCA 2HHUA 2V7YA 2YX6A 4WE1A 2WFBA 2QEXN 3NCIA 3E01A 2O8EB 1X9JA 2UXDK 4DQIA 4KRFA 4E1NA 3UKUA 3NBPA 4JS5A 4DSJA 3CI5A 1QQOA 3WXIA 4AHCA 3HXMA 1JCEA 4FZYA 4CFBA 2ZJPL 4MDAA 1W97L 2HHTA 1VAZA 3RRGA 3TAPA 4KH6A 1NM1A 2PZSA 3OS2A 3TAFA 1CXQA 5GAEP 1VQPN 4DFJA 2P9LA 3JYTA 1RDDA 1S72N 5FPNA 4I9LA 3RMDA 3TANA 1WN7A 3I0SA 1K8AO 3DAWA 1V4SA 5DMRA 4KHUA 4WCEL 5AQZA 3WXLA 4MDBA 5CYMA 4JRQA 1BG3A 4CFDA 3AY9A 3THVA 3TSQA 1IV0A 4Z4CA 2CGKA 5FPDA 3KLFA 3OBYA 3V9WA 3DWLA 4NCAA 2W41A 1GLJO 1VSEA 4PKIA 4I6MB 4DU4A 4JK8A 4QS8A 3DLBA 2EX3A 1X3MA 2GELA 3SPZA 4RG8A 1OH5A 3GG4A 2Q36A 1J53A 4KKOA 3E9LA 1J5EK 2YHXA 4PA1A 1BCOA 1OH6A 4H03B 2AA4A 2G8WA 2YHWA 3K5OA 3T3FA 3C0BA 4QAGA 1XMQK 5AQVA 5J2NA 2P9UA 4DV1K 4GKKK 4JI1K 4HCBA 2A6AA 4Z0UA 4K0KK 2KW4A 3TU5A 4DV7K 2O4IA 1JL2A 2E1ZA 1DT9A 5LJVA 4IEEA 1TL1A 1I39A 3VA3A 1KTQA 1T44A 1JXEA 3EZWA 1TKXA 1HKBA 4ISFA 3AGRA 4M3WA 3IS9A 3M3ZA 4IG0A 5LMUK 4FJKA 3CJ1A 3A5LC 3R9PA 1NWKA 4E7LA 3LDOA 3VGKA 3FZKA 3KKRA 3WXMB 4C1NK 3I56N 2HHXA 1Q18A 1EKEA 1WOQA 3ATVA 4MQ3A 3VENA 3TR8A 3VGLA 3QEWA 2ZGZA 1C0UA 5FRNA 3ZYYX 4CJWA 3TWHA 1NMDA 4NLCA 1T03A 4U7BA 3HSTB 4B9VA 1F21A 4KB0A 1NLVA 1FKPA 4FJ8A 2KKZA 3HI0A 4JKGA 3OS1A 5AQMA 3LDQA 1RTJA 4Y1CA 5I9EB 1NJIO 5FLXO 2GUIA 2FBYA 5JVGL 1LAVA 5JS2A 1IG9A 3MN9A 1C0TA 4H0PA 4HCCA 2KFNA 3R8EA 3VQQA 4K41A 4B08A 2W6KA 3W3DA 4O0IA 1K8KA 2CGLA 1YJWN 3LZJA 1HNIA 2FF6A 1XUPO 4DF4A 3QEXA 1LV5A 4Z4EA 3U9ZA 3VA0A 3L2WA 3C6UA 4DR6K 3SUNA 2HNZA 4QS7A 3A0IX 4NCBA 2QWQA 3L0QA 3HPGA 1KAZA 1D4XA 5EXWA 5I3UA 4J2EA 3RRHA 4E3SA 1D5AA 3GBTA 4FM1A 1FK9A 1GLEG 5AQIA 3MN6A 2E1YA 4FWLA 1YUWA 5JLHA 3KK1A 2PFUA 1C0GA 3NFAA 3M8SA 3EY1A 4CK2A 3CJ7A 1BHLA 1V4TA 4BRAA 3HP6A 5HBMA 4KTQA 2VGMA 4FWRA 4CZHA 3OYBA 2XRIA 3QNNA 1IBKK 4HUFA 4RW6A 4OVLA 2KFZA 5TKYA 2DFFA 3QFUA 4DR5K 4JLHA 4IOXA 3C65A 4J2BA 1IG8A 1GLFO 1VQON 4LSLA 2YV0X 4DWIA 4CHPA 2GWJA 4CJPA 5AQUA 4DTJA 2YJFA 4B9MA 1RTIA 3DOLA 4DV2K 3KK2A 2A1RA 4CZLA 5IT9O 5J2MA 1GLLO 1HYSA 3ENOA 4E1MA 3ZT3A 3SUQA 1U2VB 3FGUA 1TK5A 1VQ4N 1XNQK 1VSHA 4W5RA 3OYDA 3IMXA 1Q82O 3JSMA 2YJEA 2IC3A 1J5OA 4DSLA 3K5MA 2OZMA 4BRDA 4L3QA 4DTSA 3G0ZA 4JI0K 1MWMA 3G25A 4CI6A 4E7JA 2BANA 3ZEUB 4BRPA 3WNGA 1ZC6A 2NNWA 3ID6A 3THWA 4C8LA 3VN5A 1TK0A 4BWJA 3EE9A 3QERA 1T6CA 3LDNA 4FLZA 1NNEA 3F73A 5AQKA 2RF2A 3LDPA 4JKEA 4X65K 4BWMA 2HNYA 4H4MA 4CHZA 3KKSA 1S1XA 1XC3A 3DOKA 5JVHL 4FZXC 3PLAA 4FOEA 2OPQA 2I5JA 2P9SB 1RT6A 1XHXA 1NJYA 1G99A 3KLEA 3J81O 4FZZA 1MU2A 3JAMO 1Z25A 4BRIA 1KVBA 2HHQA 1GOBA 2NUBA 2OANA 3CMEN 1CXUA 2FSNA 3BF3A 4CGJA 2VQEK 1D8YA 3CQYA 1ITGA 1B92A 1TVRA 2QI2A 3OYNA 1JLAA 5F0XA 2YHBA 3JS6A 3CF5L 3AVHA 4CEQA 4CJ3A 4FJ5A 4BRLA 3MMVA 2Q2RA 2HW3A 2XHBA 4DQRA 3FLCO 4A2BA 1S5JA 3OYMA 1VQLN 4H4OA 1TL3A 2Q0UA 1YTUA 5AZIA 2Y1JA 5KRSA 1TKZA 2HBLA 3K9JA 3LL3A 1S9GA 3C6HA 4W5QA 3WEEB 3S9HA 2YKMA 1RGIA 2ETJA 3O5BA 1NK5A 3MAQA 1GLAG 4CBUA 4DV4K 4WFAL 1T6DA 2QWNA 4FWPA 4Z4GA 2ZF5O 1WSGA 3FFIA 4NYNA 3Q7BA 1KFDA 1KVAA 4ILJA 3SNNA 2P9KA 1HKGA 3CCRN 1FJGK 1TK8A 3MEDA 3ZSRA 3V4IA 1IO2A 4FWOA 3VEZA 4B8AB 3OYJA 5A2QO 2P1JA 5AQYA 5C2FA 3CG7A 4CK1A 1L3TA 3CJAA 5KI6A 1NGDA 1BUPA 3C6TA 4DF8A 4E89A 4LH5A 3CC7N 4XIUA 4YOXA 2X74A 4Z4HA 1HX1A 4CGFA 1KLNA 3NH0A 5C0YA 1W7AA 4DSFA 4CF1A 4B3OA 4CK3A 3LWLA 2ITGA 4G1QA 4DLEA 3H1VX 2IAJA 2NRRA 3U8XA 3MWTA 4CEZA 4Y1DA 1BL3A 3WNHA 4JD2A 4CEAA 4FVUA 4X66K 3F9KA 3DRSA 3T7ZA 3HVTA 4BREA 2QWLA 3LANA 2FBTA 4PHTX 1E4GT 4C8MA 1B9FA 1OH7A 3HPHA 5HRNA 5KQDA 2YNFA 2CH5A 2WONA 4B9SA 2QWRA 3SAGA 4FJ7A 4DSIA 4B3TK 1NBWA 3RWUA 3EE8A 3UKRB 1JLCA 2F8TA 1NK7A 1JLEA 3WNFA 2D0PA 4F8RA 1FXXA 3D2EB 1VK0A 3AVFA 4BRCA 4AM6A 4HVJA 4DB3A 3OYIA 4DTOA 3O1WA 4AHSA 4E7IA 1VQ7N 3BEXA 3ULEA 4FW1A 3AA2A 1BA0A 4JS4A 1YF5L 4JHDB 4GMJB 5DM6L 4YHHK 4IFVA 4IWVA 5F1XA 3O9RA 3HL8A 5AQQA 5C12A 5FRMA 5GIOA 1QHAA 1NJWA 4GVMA 5AJ3K 3CERA 1IBLK 3ZT2A 4N41A 5FPMA 1ESVA 1NKBA 2G8UA 4FPAA 4MLEA 2QM1A 3VF2A 4CEOA 1Z26A 4CBXA 4GNIA 1HJOA 1RBSA 4J2AA 2I7NA 4H0OA 1NG9A 4N47A 1QSYA 4GV9A 2IDOA 3J80O 4H5NA 1XMOK 3KLGA 3NH2A 1DKGD 3THYA 2RHKA 3AA5X 3BP8A 3CCUN 1N6QA 3LM9A 1RT3A 4F3TA 3HM9A 3TSUA 4R5PA 4Q5VA 3J7ZO 3SQ1A 4I9QA 2FXUA 2W42A 4K8XA 4IJAA 1LCUA 4B1VA 3UKUB 1RBRA 4IXCA 4HUGA 1S1WA 3O08A 3FZLA 2KZZA 1DTTA 3HO1A 2D5RA 1U48A 3HZ6A 3VEXA 4MLHA 1R0AA 1TAQA 4EFHA 3P1GA 5C24A 4JI2K 4N56A 3U6FA 4E1JA 4H0TB 4U67L 4FJIA 4IKFA 2IOCA 4FLXA 3QINA 5LL6Z 1WSEA 1LAWA 2OYQA 4FO0A 3H1QA 1RDAA 1NOYA 3L3UA 1HRHA 2P9LB 3V81A 4CJFA 3RR7A 4ICLA 1IJJA 3HYFA 5AQOA 4H0VB 4YOYA 3CXCM 1S9EA 1LWEA 4FLWA 2ATQA 2ZE2A 2F8SA 4JYAK 3VQDA 4HTLA 4CJQA 3NVMA 5HOOA 4F2SA 1X1PA 2VWJA 4A59A 3RMAA 1SKSA 3VEVA 2HBMA 3QFPA 2YNIA 3J8AA 3HBTA 3F5TA 1BWFO 3IRXA 1UAXA 2E6LA 2YI1A 2P5GA 1JLQA 4JI7K 3L2UA 2PBDA 4OLAA 4W5NA 3ZETB 4FLUA 3RMCA 1VQ6N 1BCMA 1T7PA 2P9UB 2FBXA 3NGYA 4CHNA 3QLHA 2Q0RA 2X6NA 3ASMA 3I0RA 1NGCA 1VSIA 4K43A 4IJNA 5C10A 4PKGA 1REVA 1VQ8N 3AVCA 1WUAA 4ILGB 1T05A 4DR3K 4KO0A 4OKKA 2ZJRL 3S3OA 3OYKA 2G8KA 4O44A 1S6PA 4DUYK 3P31A 1QE1A 3O3FA 3SBTA 2V52B 4ID5A 3O9UA 4DQ8A 4O8KA 1U49A 3ZX0A 4Z94A 2IVOA 3AVMA 1YAGA 4CJ4A 2RKIA 3AARA 4B1UB 2D4WA 2QW9A 3KD1E 1QVGM 3C95A 1NK0A 4FJGA 1RT1A 4H5VA 1RT5A 3HJFA 2OPPA 4OKEA 4CBWA 1CZBA 3EEQA 2XY7A 2B5JA 3NGZA 4KI4A 4M3UA 3AVGA 5LY3A 3VESA 4OJRA 3U3GA 2P51A 3L2QA 3OA9A 3AO1A 3ALYA 1RDCA 4O5FA 1WSHA 1QSLA 4JKGB 3H46O 2BTFA 3VQEA 1FW6A 3QO9A 2VWKA 4DG1A 2IIRA 3OJUA 2UU9K 1RFQA 3P4IA 2XO7A 3P83D 3NF7A 1TUYA 4CGDA 4UY8O 3SV3A 3A5OC 1ZBFA 4A57A 4EHTA 2UXBK 1NGGA 4NB4A 3V1OA 1L3SA 2B4JA 4YDUC 3DXKA 2RPIA 4JKBA 3OYGA 1L5UA 1K8KB 2O8CA 1QTMA 3RVCA 4DV3K 3CCQN 3H6EA 2PYJA 1HQUA 2WBNA 4PKHA 4K25A 2XY5A 1QVFM 1EP4A 4C1NI 5CZ1A 3BDPA 3VEOA 1VSFA 2QKBA 2Y1IA 4I2PA 1QHTA 3KTQA 3LPUA 3AA3A 1JLBA 4EZ6A 1BGXT 3C7NB 3VTIA 4YORA 2E88A 5BN8A 2NRVA 3L6QA 4LH4A 2HF3A 4FW2A 3CFOA 4GV3A 2HHVA 1ATSA 4FWKA 3ZLJA 4C8KA 4BR5A 5E26A 5AQTA 4DU3A 3SAFA 1OH8A 4FJLA 4BVPA 3M6GA 3MN7A 1SZ2A 3PO5A 4FL9A 1Q81O 3O9QA 4CF8A 2ASMA 4FK0A 4JK7A 1X9SA 4XEIA 4B9TA 2E20A 5AR0A 4CESA 4CJVA 3PSFA 4F3OA 1SKRA 1NGJA 4KHWA 4E19A 1Y64A 2VYPA 5DK5A 1VSDA 3VQ7A 4YOWA 3HT3A 3PIPL 2H3GX 4BRMA 2IVNA 2VGNA 1ASUA 3VEYA 1A5XA 3AO2A 5T7BA 4H0YB 3MEEA 5C2DA 3LAKA 1C1BA 3MN5A 3V9SA 5HROA 2GBZA 4M63C 5ELZA 5BRFA 2Z1HA 4ELUA 3P39A 4CZGA 5GINA 3THWB 2P9IA 3BZCA 4GKJK 1HQEA 2F7TA 4DU1A 2V7ZA 1VSJA 1WLJA 4NYFA 2Z1JA 3VQPA 3TAEA 3IKMA 1OVQA 1BI4A 1JLFA 3T1YK 3CM6A 1TKTA 3CHWA 3HTVA 4JKHA 4GV6A 5AZJA 1LW2A 4CECA 2HHWA 4B8CA 4KHQA 4ELTA 3A8YA 4RTFD 2NRHA 3D2FA 2GTDA 4BACA 4FLYA 3WT0A 3A2FA 3VQCA 3O3HA 3D0PA 4IG3A 3ZSXA 4QCLA 4AHUA 3QIPA 1N5YA 4EAHD 5E41A 4W5OA 3SQ2A 3SLCA 2Z1GA 5AQSA 4CZIA 3CC4N 5HRPA 1NGAA 3VPZA 4BG8A 3VQAA 4FM2A 3CCVN 4G9ZA 4YDUA 3H45C 2KQ2A 4YOUA 3UE5A 3M5RA 3BY5A 5C25A 3QIOA 3AGKA 2IVPA 4CIEA 1NJXA 4CJKA 4M3YA 2A42A 3ENHA 4OKJA 5AZIB 1TYQA 4CZEA 4YFUA 3N4PA 3K57A 4B1ZA 4OPJA 2PYLA 2P9PA 2HNDA 4NLBA 3CCSN 3TTCA 4DQQA 1E3MA 4EP4A 4C8NA 2QWPA 3GOIA 5LJWA 3S3NA 4FJ9A 1N33K 4FJMA 3M8QA 2CH6A 5D3GA 1KCFA 4C23A 3ZX3A 4JI8K 4DR7K 3M8PA 2JLEA 1R59O 2FF3B 3DJCA 3A5NC 3ZSOA 2OCEA 3H3OB 5J1EA 3HK2A 3AVBA 4DTUA 2QKKA 4BE0A 4AHRA 4ZTJA 1Z05A 5AQLA 2O4GA 3SMPA 4DCHA 4BE2A 3U4LA 2P9KB 4M7YA 3EYZA 1S6QA 3KK3A 2LSNA 3L8BA 2G8FA 4DR4K 1ZBIA 5BPNA 2YNGA 3NF8A 1EX4A 1XQSC 1YVNA 3CCEN 3K5NA 2DTUA 2O8FA 3CMAN 5FDLA 4NXMK 4JI5K 4B9LA 4YNQA 4CHQA 1NGHA 4LF6K 1RT2A 3S3MA 4L8RB 1UA1A 4LF8K 4CEFA 4JI6K 5BN9A 1RBTA 3B8AX 5HP1A 3R1XA 4KREA 2QK9A 2ZM6K 2P9NA 3U3YA 1RILA 5AQXA 4CGGA 4WQ5C 2R7YA 2F9WA 2O8BB 4CGHA 3DLGA 1WAFA 3MDQA 4JD2B 3TAQA 2X6SA 2BE2A 3OVNA 3PY8A 1K73O 4DTNA 3O4NA 1U4BA 3CQXA 3TTFA 3L4IA 4BROA 3CJ9A 5AQRA 3V9UA 4O8UA 3MX5A 3BZKA 4J2DA 4LFAK 4FLVA 5HRSA 3ATUA 2NRXA 4OX9K 3KVGA 4JRPA 3O1BA 4DR1K 4M3RA 1I3AA 4ISEA 4BDYA 3ITHA 3SV4A 1JCGA 1BIZA 5GAHP 4KHYA 3PIOL 4M45A 2J4RA 2UUBK 3T1HK 4JI3K 2A40A 1D9DA 1SUQA 3DRPA 1GOAA 3AO5A 3DXMB 5GIPA 4IDKA 3NVKA 1KD1O 3DLLL 1KVCA 3L2RA 3E9OA 4CE9A 3ID8A 1XI1A 2NRWA 2QWOA 3VF6A 4HHTA 1GLBG 1BQMA 3CPWM 5J2QA 1NGBA 4H8KA 4FWMA 2BDPA 4CZFA 2DY4A 5KGXA 3AAPA 3SYZA 5M1FA 3V9ZA 4A2AA 2A1SA 3L4QA 3W0LA 2FSKA 3CJCA 1GLCG 3C94A 1QS4A 2KHOA 4CIFA 1Q9YA 4OGEA 1TUUA 3UB5A 3I33A 4CZJA 1RTHA 2OPSA 1XHZA 4GY2B 2BGGA 3KLIA 4AF1A 4FWNA 4LC9B 3VMFB 1NGIA 3NDKA 2YHYA 2D0BA 3SJJA 3RSEA 4DS4A 4KPYA 3O9TA 3THYB 2FLOA 3HOSA 3CFPA 2ZGYA 2Z1IA 4IBNA 1JJ2M 4DFMA 4H5TA 5EOYA 3G4SN 2VCPA 2DFHA 4ID1A 2VWBA 1X9WA 3OYLA 1LWFA 3V1QA 3NAEA 3KK7A 2PY5A 3LP3A 4WFNL 3AAQA 4EHUA 4DV5K 1Q86O 3WQTA 3IAYA 3KWIA 4IEIA 3O8MA 4RCHA 1E4FT 1UOCA 1S22A 3OBWA 3ISNC 1BIUA 2RN2A 1IKXA 3PX6A 4JNEA 3PX4A 3JXUA 1K6YA 3AO4A 4RW4A 1EWQA 4BC3A 4EZ9A 3HM8A 3WUHA 2D0OA 3TTDA 3PUFA 2W6LA 4BQZA 4WQ5A 3QDKA 3RMBA 1NKEA 3M8RA 4JI4K 4F4KA 1O13A 1ATNA 1TKDA 1DTQA 2OZSA 2UUAK 1A5VA 3GL1A 4CJSA 5F2RA 3SI6A 3D45A 3CIPA 4YY3K 2WOMA 3OYCA 2A5XA 3AVIA 2VG5A 1VQNN 5ADXA 3DLEA 1J54A 5CE3A 4MO4A 2G8VA 2YCHA 3OW2M 3T19A 3J7AP 3T1AA 3SUOA 4C8OA 4B1YB 3T69A 2JWKA 4IFYA 1KSPA 2OTJN 3LM2A 3OY9A 1OKJA 1UA0A 3THXA 3SJHA 3FR0A 1C6VA 4JAXA 5CR4A 3HOTA 2BH1A 2Q3SA 3CCLN 3NF6A 1WNSA 2DFEA 1VRUA 4CJUA 4IO9L 3V1RA 4HWIA 2E8AA 4FCYA 4JKCA 3LWMA 4K8ZA 5JS1A 4PQUA 4ILHA 3AVLA 4CEBA 1ZBHA 3M1FA 1SKWA 4KHNA 4HUEA 3SUPA 2GV9A 2O8DA 3AVJA 4CIGA 3VQ9A 1XWLA 3V6DA 4GVEA 1G15A 4BRFA 2HHSA 1YJ9N 3VQ8A 5SWMA 1WBBA 2EHGA 1YHQN 1VQ9N 2YNHA 3KWGA 3CCMN 2UUCK 3HPOA 3NF9A 4CJLA 4BC2A 2FSJA 3MX2A 3MXJA 1BO5O 4FPBA 2ZD1A 3ZSQA 5BPMA 4BRGA 4OPKA 3OJSA 3EZ5A 1C1AA 1BOTO 3QESA 3TAGA 4TSXA 3R6MA 1U47A 4CJTA 1IKWA 3P38A 4BQLA 1KLMA 4FWQA 4OLBA 3LALA 1Q9XA 4DMNA 4CCHA 2G8HA 4E0DA 3KJVA 1EXQA 5KPRA 2E6MA 1X3NA 5DM7L 4CFCA 4LSNA 2AJQA 3ZT1A 4KTZA 5K14A 1WAJA 3MEGA 1NK9A 2HSTA 3K59A 4F2RA 4H5RA 2OTLN 5KRTA 3DLKA 3NHGA 1KXPA 3RR8A 1BISA 2PAVA 1VHXA 1KAXA 2GX9A 4BR0A 3ULDA 4JEPA 3DI6A 5C42A 5AQWA 1CZ9A 1VQMN 3VETA 3I8DA 1ZYQA 2FBVA 4O0JA 1SL2A 1J9AA 4DSKA 3DXKB 3SMSA 3BF1A 1HNZK 2O8CB 2E4LA 4M3TA 3EN9A 1IH7A 1EWRA 4JKFA 4M3XA 4X64K 4CJ7A 1FKOA 3KD5E 3VQBA 2I7PA 4OGCA 2WC9A 4JKAA 5IWAK 1Y97A 4CF9A 2D0AA 1I94K 4BR7A 3TSPA 3AVKA 3QBXA 1J6ZA 3I55N 2VG6A 5J2PA 3P5JA 3IDHA 2GEMA 4OPAA 2O8EA 1HYZA 2QXFA 2UXCK 5KGWA 3AO3A 2DPNA 1HYVA 1M90O 4ELVA 5M1KA 2OA8A 2GWKA 2JWLA 4ISGA 2WUSA 2NLXA 1HUXA 4DS5A 1JKHA 1ASWA 2Q31A 4LFBK 2UYTA 1WB9A 4B9UA 4KI6A 1KC8O 4FLTA 4X62K 4W5TA 1SL0A 3UIQA 3ZETA 4CEDA 2A3ZA 2HF4A 4OO1J 1YXQA 4DTPA 1NK8A 1BQNA 3AV9A 5JICA 4DHYA 5LMNK 2NRZA 3G6EN 2HMIA 4B1WB 1NK4A 3VQ5A 1HNWK 1LW0A 3OYEA 4KH4A 2EWSA 5CY4A 3FZMA 3DMJA 3DLHA 1JLGA 2P5OA 4GW6A 3R3LA 4R79A 1YJNN 1NJZA 2BUPA 2X78A 1HJRA 3CCJN 3G10A 1ILYA 1BDGA 1HPZA 5E84A 3VTHA 3MWPA 4FXDA 5EU7A 5BR9A 4I6MA 1YT3A 4FJJA 4I7FA 2P9IB 3ZT4A 1MA9B 2Q1NA 4V19S 4BDZA 1BI4B 4DQSA 3O4WA 1K9MO 1L3VA 3L2VA 4A5BA 5AZJB 4DUZK 1N8RO 2QWMA 2RE2A 4J8FA 1TAUA 3MK6A 1H1VA 3IFRA 5MLCQ 4LF9K 4NXNK 3MXIA 1C0MA 4BR4A 3GDQA 3K5LA 2HVHA 5BRDA 4H0XB 3MECA 3D2FB 5AFUH 3U9DA 5GAGP 4NO7A 4PY5A 1SV5A 3O80A 2QTDA 3K9KA 5I42A 4EP5A 2ZJQL 3EKSA 1Q8IA 5FROA 4XH1A 1YTAA 1KAYA 4CGIA 3SK3A 3TI0A 2JGUA 4IZ9A 4ZHRA 1MWKA 1VSMA 1ZBSA 4CF2A 1C0FA 2W40A 1SQKA 4EIAA 3VQ6A 3BUZB 1HR0K
chains in the Genus database with same CATH topology
4CFDA 3DLGA 3THVA 1WAFA 3PV8A 4Z4CA 1D9FA 1UWBA 3TAQA 4CEOA 2X6SA 1Z26A 3KLFA 2BE2A 3V9WA 3OVNA 5HLFA 3PY8A 4NCAA 1RBSA 4DTNA 4ZTFA 4J2AA 2YKNA 4MFBA 1VSEA 3O4NA 4N47A 4DU4A 3BGRA 1QSYA 1U45A 1U4BA 2IDOA 2IS3A 3DLBA 2EX3A 3SPZA 4RG8A 3QETA 4O55A 3KLGA 4J2DA 1J53A 3V9UA 3NH2A 4KKOA 3ZSYA 4FLVA 5HRSA 4PA1A 3AA5X 3LAMA 1BCOA 1N6QA 1A5WA 1RT3A 4F3TA 3ZSZA 4JRPA 2G8WA 1RNHA 3HM9A 4R5PA 4Q5VA 3SQ1A 4I9QA 3K5OA 2W42A 3T3FA 4QAGA 4DTMA 4M3RA 4K8XA 1RBRA 1I3AA 4BDYA 3ITHA 5J2NA 3SV4A 1RBVA 1BIZA 4KHYA 4HUGA 1S1WA 2KZZA 1DTTA 4HCBA 2D5RA 3HO1A 4Z0UA 3SPYA 4M45A 1U48A 3AVAA 1R0AA 2KW4A 3DM2A 1TAQA 3P1GA 5C24A 1JL2A 2O4IA 4N56A 3U6FA 1D9DA 1B9DA 1SUQA 3DRPA 1GOAA 1TL1A 1I39A 3AO5A 4FJIA 3VA3A 4IKFA 1KTQA 2IOCA 4FLXA 1JXEA 3NH1A 3QINA 1TKXA 4IDKA 4M3WA 1WSEA 3IS9A 1KVCA 3L2RA 1LAWA 3CYMA 4IG0A 2OYQA 4CJ5A 4CE9A 1RDAA 1XI1A 1NOYA 3K2PA 1RT4A 3L3UA 1HRHA 3SCXA 4FJKA 4E7LA 3V81A 4HHTA 4BDPA 1BQMA 5J2QA 4H8KA 2BDPA 4CJFA 3DRRA 4CEEA 3RR7A 3KKRA 4FYDA 1GOCA 2HHXA 4ICLA 2DY4A 3HYFA 5KGXA 1EKEA 3SYZA 1S9EA 1LWEA 4FLWA 4MQ3A 1S1UA 4E7HA 3V9ZA 3TR8A 2A1SA 1ZBUA 2ATQA 2ZE2A 3QEWA 2F8SA 3VQDA 4CJQA 1C0UA 5FRNA 4F2SA 4CJWA 1X1PA 3O4QA 2VWJA 3NGIA 3TWHA 3RMAA 1RT7A 3C94A 4HTUA 1QS4A 2ZQBA 3KLHA 1SKSA 2B6AA 1VRTA 3WNEA 4CIFA 1Q9YA 4OGEA 4CHOA 2YNIA 1T03A 1RTHA 3HSTB 2OPSA 4B9VA 1XHZA 1F21A 2BGGA 3IRXA 4CFAA 1XC9A 4KB0A 1FKPA 3KLIA 1UAXA 4FJ8A 2E6LA 2KZMA 3NDKA 3OS1A 2D0BA 3SJJA 2P5GA 3OS0A 4KHSA 3ZCMA 4DS4A 4FM0A 1RTJA 4KPYA 1JLQA 2G8IA 3L2UA 4Y1CA 3CFPA 3SQ0A 4DTRA 2GUIA 2FBYA 1IKYA 1LAVA 5JS2A 2Z1IA 3L3VA 4IBNA 4DFMA 3MXMA 1IG9A 4OLAA 4HCCA 1C0TA 4FLUA 3RMCA 2KFNA 4ID1A 2DFHA 1X9WA 2F96A 3OYLA 3VQQA 1LWFA 3V1QA 1BCMA 4B08A 3NAEA 1T7PA 2FBXA 3LP3A 2PY5A 3NGYA 4CHNA 4O0IA 3QLHA 2X6NA 4KTWA 3ASMA 3QEIA 3IAYA 3I0RA 3O3GA 1VSIA 3DYAA 3LZJA 1HNIA 1UOCA 1REVA 4M41A 3AVCA 4DF4A 3QEXA 1LV5A 4Z4EA 3VA0A 3L2WA 3C6UA 3ISNC 1T05A 1BIUA 1L3UA 4M3ZA 3CQ8A 2RN2A 3SUNA 4KO0A 2HNZA 4OKKA 1IKXA 3PX6A 3OYKA 3SQ4A 4O44A 3PX4A 3S3OA 2G8KA 1K6YA 3HPGA 1S6PA 4NCBA 3AO4A 4KV8A 4RW4A 5I3UA 1QE1A 3O3FA 3H08A 4J2EA 3B6PA 4ID5A 3RRHA 4EZ9A 4E3SA 1D5AA 1U49A 4LY7A 4FM1A 3PUFA 3LP1A 1FK9A 3CM5A 3AVMA 3RMBA 4CJ4A 2YHAA 1NKEA 3M8RA 4F4KA 2RKIA 1DTQA 1TKDA 3PX0A 2OZSA 1A5VA 4CJSA 1KRPA 3SI6A 3RTVA 1S1VA 3D45A 3KK1A 3C95A 1NK0A 3KD1E 4FJGA 2WOMA 3OYCA 1RT1A 3HJFA 1RT5A 3NFAA 2OPPA 3M8SA 3EY1A 4OKEA 3AVIA 2VG5A 4CK2A 1CZBA 1RDBA 1BHLA 2XY7A 3DLEA 1J54A 1N5YA 2B5JA 4FJXA 3HP6A 5HBMA 4AHTA 4KTQA 2G8VA 3NGZA 4KI4A 4M3UA 3OYBA 2XRIA 3AVGA 3T19A 3QNNA 4OJRA 4HUFA 4RW6A 4OVLA 2P51A 3T1AA 3U3GA 3L2QA 4E7KA 3SUOA 4C8OA 4CJRA 4PUOA 3AO1A 2KFZA 2DFFA 3ALYA 4QOZB 4JLHA 3IG1A 4IFYA 1KSPA 1SL1A 3QEPA 4J2BA 4UQGA 1RDCA 1WSHA 3OY9A 1QSLA 4LSLA 1UA0A 2YV0X 4RW7A 4CHPA 4DWIA 4DSEA 4CJPA 3VQEA 1C6VA 3QO9A 2VWKA 4DTJA 4DG1A 4B9MA 2Q3SA 1RTIA 3DOLA 3OJUA 3NF6A 4KFBA 3KK2A 2A1RA 1WNSA 2XO7A 2DFEA 1VRUA 3P83D 3NF7A 4CJUA 3V1RA 4FCYA 4CGDA 5J2MA 4K8ZA 3LWMA 5JS1A 4I2QA 1HYSA 3SV3A 4PQUA 4E1MA 3AA4A 4FJNA 4M42A 1ZBFA 3LZIA 1JL1A 3AVLA 3ZT3A 4FK2A 4NCGA 4CEBA 3V9XA 3V1OA 1L3SA 5CZ2A 3SUQA 2B4JA 4W5NA 1ZBHA 1SKWA 2RPIA 1T8EA 4HUEA 3OYGA 1TK5A 1L5UA 4KHNA 3SUPA 1VSHA 4W5RA 3OYDA 2GV9A 4CHYA 3JSMA 3AVJA 4CIGA 3LDSA 1QTMA 3VQ9A 4Z4IA 2IC3A 1XWLA 2IGIA 3V6DA 1J5OA 2PYJA 4DSLA 1HQUA 2KTQA 1G15A 3K5MA 1U04A 2OZMA 2XY5A 1EP4A 2HHSA 4DTSA 5CZ1A 3BDPA 3G0ZA 3VQ8A 5SWMA 1VSFA 1KFSA 4E7JA 2QKBA 2BANA 2Y1IA 2EHGA 4I2PA 3WNGA 4C8LA 1QHTA 1S1TA 3KTQA 3LPUA 3AA3A 3VN5A 1TK0A 2YNHA 1JLBA 4BWJA 1QSSA 4EZ6A 3QERA 3HPOA 4FLZA 3NF9A 4CJLA 1BGXT 4Q0BA 3F73A 2RF2A 3MXJA 4BWMA 2HNYA 4H4MA 1NOZA 4LH4A 2ZD1A 3ZSQA 4CHZA 3KKSA 1S1XA 3DOKA 4FW2A 1WSFA 2VG7A 4OPKA 3OJSA 3EZ5A 4FZXC 1C1AA 2I5JA 2OPQA 3CFOA 3QESA 3TAGA 5KTQA 2HHVA 1RT6A 4TSXA 1U47A 4C8KA 4CJTA 1XHXA 5SZTA 1NJYA 1IKWA 4DU3A 1KLMA 4OLBA 3LALA 1Q9XA 4DMNA 3KLEA 4CJEA 4CCHA 2G8HA 4E0DA 3KJVA 4FZZA 1EXQA 2XY6A 1MU2A 1WSIA 1Z25A 2E6MA 4CFCA 4LSNA 2AJQA 1KVBA 4FJLA 3ZT1A 4KTZA 3TARA 2HHQA 4RW9A 5K14A 1GOBA 1WAJA 3B6OA 3MEGA 2NUBA 4DTXA 1NK9A 3K59A 4DLGA 1CXUA 3PO5A 4F2RA 4CGJA 1HNVA 4CF8A 1EETA 5KRTA 3DLKA 1D8YA 1ITGA 4FK0A 3NHGA 1B92A 1X9SA 1TVRA 1BISA 4B9TA 3LPTA 3RR8A 3OYNA 1JLAA 1NK6A 2YHBA 4LD0A 4CESA 3AVHA 4CJVA 4FJHA 4CEQA 3ULDA 4CJ3A 4FJ5A 4F3OA 1SKRA 4KHWA 3DI6A 4E19A 5DK5A 2HW3A 1VSDA 3VQ7A 5C42A 2XHBA 1NKCA 3KIOA 3HT3A 1CZ9A 1JXBA 4DQRA 3I8DA 1ZYQA 2FBVA 4O0JA 3PO4A 4O4GA 1SL2A 1J9AA 4KB1A 4DSKA 1S5JA 3OYMA 4PWDA 4H4OA 3HVRA 1TL3A 1RCHA 4DFPA 1YTUA 2Y1JA 2E4LA 1ASUA 5HRRA 1VSKA 5KRSA 4M3TA 1TKZA 1A5XA 3AO2A 4O5BA 3VQ4A 5T7BA 3MEEA 3AVNA 1IH7A 3LAKA 4CF0A 1C1BA 5HROA 3V9SA 4FVMA 4M3XA 1S9GA 1FKOA 2GBZA 4CERA 4W5QA 3KD5E 2Z1HA 3VQBA 3S9HA 4ELUA 3TAMA 3NE6A 2HVIA 4OGCA 2YKMA 4B9NA 1Y97A 4CF9A 2D0AA 2ETJA 1HQEA 4DU1A 1NK5A 4N76A 1VSJA 3MAQA 1WLJA 4NYFA 4FK4A 2Z1JA 1RTDA 3AVKA 3VQPA 3TAEA 3ZT0A 4N5SA 1HMVA 1BI4A 2VG6A 5J2PA 4KAZA 1JLFA 3P5JA 1W0HA 3CM6A 4BE1A 1TKTA 3ZSWA 2FC0A 4Z4GA 1WSGA 1HYZA 2QXFA 3FFIA 1C1CA 4NYNA 4AH9A 4Z4FA 2D0CA 3OYFA 5KGWA 3AO3A 1LW2A 1HYVA 1O1WA 4ELVA 4CECA 1KFDA 2HHWA 1KVAA 4B8CA 4DFKA 3CFRA 4DS5A 2OA8A 4KHQA 1IKVA 1JKHA 1RBUA 1ASWA 3SNNA 4ELTA 1WSJA 1TK8A 1LWCA 4AILC 5CYQA 3MEDA 3ZSRA 3V4IA 4B9UA 4FLTA 4KI6A 4FLYA 4BACA 4DQPA 1IO2A 3A2FA 1TV6A 4B8AB 4W5TA 3VQCA 3O3HA 3OYJA 2P1JA 3D0PA 1SL0A 4IG3A 3SZ2A 3ZSXA 3UIQA 1DLOA 4QCLA 4AHUA 1L3TA 3QIPA 3CG7A 3DLRA 4CEDA 4CK1A 5E41A 4AHVA 4W5OA 3QEVA 1QQCA 5KI6A 3SQ2A 2Z1GA 1W9HA 2HB5A 3C6TA 4DF8A 2XY8A 4E89A 1CLQA 1VSLA 4LH5A 4XIUA 5HRPA 1X9MA 1YVUA 4DTPA 1NK8A 1BQNA 2X74A 4Z4HA 4CGFA 3AV9A 1KLNA 2OPRA 3NH0A 3VQAA 4DSFA 4FM2A 1TGOA 4CF1A 4B3OA 4CK3A 3LWLA 2ITGA 3LP0A 4G1QA 2HMIA 2KQ2A 4DLEA 1NK4A 3K58A 3VQ5A 1LW0A 2IAJA 5C25A 3OYEA 3QIOA 4CIEA 1ZBLA 1NJXA 4CJKA 1ASVA 5CY4A 4M3YA 3DMJA 4CEZA 1JLGA 4Y1DA 4GW6A 3DLHA 4OKJA 2P5OA 1NJZA 1BL3A 3WNHA 4CEAA 2X78A 4YFUA 1HJRA 3K57A 3F9KA 3DRSA 3G10A 3OYHA 3HVTA 3QNOA 1HPZA 4OPJA 3TABA 4RW8A 2PYLA 3LANA 3LP2A 2FBTA 2HNDA 3ZSVA 4FXDA 4C8MA 1B9FA 5EU7A 4DQQA 3OYAA 4EP4A 1YT3A 4FJJA 3HPHA 4C8NA 5HRNA 4I7FA 2YNFA 3HP9A 3S3NA 4FJ9A 2WONA 4B9SA 4FJMA 3ZT4A 3M8QA 5D3GA 4WE1A 1KCFA 2HHUA 3NCIA 4FJ7A 3M8PA 4BDZA 2JLEA 4DSIA 3RWUA 1BI4B 4DQSA 3E01A 1JLCA 3ZSOA 2F8TA 5J1EA 1L3VA 3L2VA 3HK2A 3AVBA 4DTUA 2QKKA 4DQIA 4KRFA 4BE0A 1NK7A 4E1NA 1JLEA 4AHRA 4ZTJA 3NBPA 4JS5A 4DSJA 1TAUA 2O4GA 4BE2A 3WNFA 4F8RA 3MXIA 1C0MA 1FXXA 3EYZA 3K5LA 1S6QA 3KK3A 2LSNA 1VK0A 3AVFA 4AHCA 3L8BA 3HXMA 3MECA 2G8FA 2HVHA 4HVJA 4CFBA 4FZYA 1ZBIA 2YNGA 3OYIA 2HHTA 3NF8A 4DTOA 1EX4A 4AHSA 4E7IA 3K5NA 1SV5A 4FW1A 3RRGA 4PY5A 3AA2A 2DTUA 4JS4A 3TAPA 5FDLA 4GMJB 5I42A 2PZSA 3OS2A 4EP5A 3TAFA 4IFVA 4B9LA 4YNQA 4CHQA 1CXQA 1Q8IA 5FROA 1RT2A 1YTAA 3HL8A 3S3MA 4CGIA 4L8RB 1UA1A 4DFJA 3JYTA 4CEFA 5FRMA 1RDDA 1RBTA 5HP1A 4KREA 3TI0A 1NJWA 2QK9A 4GVMA 4I9LA 3RMDA 3U3YA 3TANA 2JGUA 1WN7A 3I0SA 4ZHRA 1RILA 1VSMA 5DMRA 4KHUA 4CGGA 4CF2A 3ZT2A 4N41A 2R7YA 1NKBA 5CYMA 3VQ6A 2G8UA 4JRQA 4CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFD A;  3DLG A;  3THV A;  1WAF A;  3PV8 A;  4Z4C A;  1D9F A;  1UWB A;  3TAQ A;  4CEO A;  2X6S A;  1Z26 A;  3KLF A;  2BE2 A;  3V9W A;  3OVN A;  5HLF A;  3PY8 A;  4NCA A;  1RBS A;  4DTN A;  4ZTF A;  4J2A A;  2YKN A;  4MFB A;  1VSE A;  3O4N A;  4N47 A;  4DU4 A;  3BGR A;  1QSY A;  1U45 A;  1U4B A;  2IDO A;  2IS3 A;  3DLB A;  2EX3 A;  3SPZ A;  4RG8 A;  3QET A;  4O55 A;  3KLG A;  4J2D A;  1J53 A;  3V9U A;  3NH2 A;  4KKO A;  3ZSY A;  4FLV A;  5HRS A;  4PA1 A;  3AA5 X;  3LAM A;  1BCO A;  1N6Q A;  1A5W A;  1RT3 A;  4F3T A;  3ZSZ A;  4JRP A;  2G8W A;  1RNH A;  3HM9 A;  4R5P A;  4Q5V A;  3SQ1 A;  4I9Q A;  3K5O A;  2W42 A;  3T3F A;  4QAG A;  4DTM A;  4M3R A;  4K8X A;  1RBR A;  1I3A A;  4BDY A;  3ITH A;  5J2N A;  3SV4 A;  1RBV A;  1BIZ A;  4KHY A;  4HUG A;  1S1W A;  2KZZ A;  1DTT A;  4HCB A;  2D5R A;  3HO1 A;  4Z0U A;  3SPY A;  4M45 A;  1U48 A;  3AVA A;  1R0A A;  2KW4 A;  3DM2 A;  1TAQ A;  3P1G A;  5C24 A;  1JL2 A;  2O4I A;  4N56 A;  3U6F A;  1D9D A;  1B9D A;  1SUQ A;  3DRP A;  1GOA A;  1TL1 A;  1I39 A;  3AO5 A;  4FJI A;  3VA3 A;  4IKF A;  1KTQ A;  2IOC A;  4FLX A;  1JXE A;  3NH1 A;  3QIN A;  1TKX A;  4IDK A;  4M3W A;  1WSE A;  3IS9 A;  1KVC A;  3L2R A;  1LAW A;  3CYM A;  4IG0 A;  2OYQ A;  4CJ5 A;  4CE9 A;  1RDA A;  1XI1 A;  1NOY A;  3K2P A;  1RT4 A;  3L3U A;  1HRH A;  3SCX A;  4FJK A;  4E7L A;  3V81 A;  4HHT A;  4BDP A;  1BQM A;  5J2Q A;  4H8K A;  2BDP A;  4CJF A;  3DRR A;  4CEE A;  3RR7 A;  3KKR A;  4FYD A;  1GOC A;  2HHX A;  4ICL A;  2DY4 A;  3HYF A;  5KGX A;  1EKE A;  3SYZ A;  1S9E A;  1LWE A;  4FLW A;  4MQ3 A;  1S1U A;  4E7H A;  3V9Z A;  3TR8 A;  2A1S A;  1ZBU A;  2ATQ A;  2ZE2 A;  3QEW A;  2F8S A;  3VQD A;  4CJQ A;  1C0U A;  5FRN A;  4F2S A;  4CJW A;  1X1P A;  3O4Q A;  2VWJ A;  3NGI A;  3TWH A;  3RMA A;  1RT7 A;  3C94 A;  4HTU A;  1QS4 A;  2ZQB A;  3KLH A;  1SKS A;  2B6A A;  1VRT A;  3WNE A;  4CIF A;  1Q9Y A;  4OGE A;  4CHO A;  2YNI A;  1T03 A;  1RTH A;  3HST B;  2OPS A;  4B9V A;  1XHZ A;  1F21 A;  2BGG A;  3IRX A;  4CFA A;  1XC9 A;  4KB0 A;  1FKP A;  3KLI A;  1UAX A;  4FJ8 A;  2E6L A;  2KZM A;  3NDK A;  3OS1 A;  2D0B A;  3SJJ A;  2P5G A;  3OS0 A;  4KHS A;  3ZCM A;  4DS4 A;  4FM0 A;  1RTJ A;  4KPY A;  1JLQ A;  2G8I A;  3L2U A;  4Y1C A;  3CFP A;  3SQ0 A;  4DTR A;  2GUI A;  2FBY A;  1IKY A;  1LAV A;  5JS2 A;  2Z1I A;  3L3V A;  4IBN A;  4DFM A;  3MXM A;  1IG9 A;  4OLA A;  4HCC A;  1C0T A;  4FLU A;  3RMC A;  2KFN A;  4ID1 A;  2DFH A;  1X9W A;  2F96 A;  3OYL A;  3VQQ A;  1LWF A;  3V1Q A;  1BCM A;  4B08 A;  3NAE A;  1T7P A;  2FBX A;  3LP3 A;  2PY5 A;  3NGY A;  4CHN A;  4O0I A;  3QLH A;  2X6N A;  4KTW A;  3ASM A;  3QEI A;  3IAY A;  3I0R A;  3O3G A;  1VSI A;  3DYA A;  3LZJ A;  1HNI A;  1UOC A;  1REV A;  4M41 A;  3AVC A;  4DF4 A;  3QEX A;  1LV5 A;  4Z4E A;  3VA0 A;  3L2W A;  3C6U A;  3ISN C;  1T05 A;  1BIU A;  1L3U A;  4M3Z A;  3CQ8 A;  2RN2 A;  3SUN A;  4KO0 A;  2HNZ A;  4OKK A;  1IKX A;  3PX6 A;  3OYK A;  3SQ4 A;  4O44 A;  3PX4 A;  3S3O A;  2G8K A;  1K6Y A;  3HPG A;  1S6P A;  4NCB A;  3AO4 A;  4KV8 A;  4RW4 A;  5I3U A;  1QE1 A;  3O3F A;  3H08 A;  4J2E A;  3B6P A;  4ID5 A;  3RRH A;  4EZ9 A;  4E3S A;  1D5A A;  1U49 A;  4LY7 A;  4FM1 A;  3PUF A;  3LP1 A;  1FK9 A;  3CM5 A;  3AVM A;  3RMB A;  4CJ4 A;  2YHA A;  1NKE A;  3M8R A;  4F4K A;  2RKI A;  1DTQ A;  1TKD A;  3PX0 A;  2OZS A;  1A5V A;  4CJS A;  1KRP A;  3SI6 A;  3RTV A;  1S1V A;  3D45 A;  3KK1 A;  3C95 A;  1NK0 A;  3KD1 E;  4FJG A;  2WOM A;  3OYC A;  1RT1 A;  3HJF A;  1RT5 A;  3NFA A;  2OPP A;  3M8S A;  3EY1 A;  4OKE A;  3AVI A;  2VG5 A;  4CK2 A;  1CZB A;  1RDB A;  1BHL A;  2XY7 A;  3DLE A;  1J54 A;  1N5Y A;  2B5J A;  4FJX A;  3HP6 A;  5HBM A;  4AHT A;  4KTQ A;  2G8V A;  3NGZ A;  4KI4 A;  4M3U A;  3OYB A;  2XRI A;  3AVG A;  3T19 A;  3QNN A;  4OJR A;  4HUF A;  4RW6 A;  4OVL A;  2P51 A;  3T1A A;  3U3G A;  3L2Q A;  4E7K A;  3SUO A;  4C8O A;  4CJR A;  4PUO A;  3AO1 A;  2KFZ A;  2DFF A;  3ALY A;  4QOZ B;  4JLH A;  3IG1 A;  4IFY A;  1KSP A;  1SL1 A;  3QEP A;  4J2B A;  4UQG A;  1RDC A;  1WSH A;  3OY9 A;  1QSL A;  4LSL A;  1UA0 A;  2YV0 X;  4RW7 A;  4CHP A;  4DWI A;  4DSE A;  4CJP A;  3VQE A;  1C6V A;  3QO9 A;  2VWK A;  4DTJ A;  4DG1 A;  4B9M A;  2Q3S A;  1RTI A;  3DOL A;  3OJU A;  3NF6 A;  4KFB A;  3KK2 A;  2A1R A;  1WNS A;  2XO7 A;  2DFE A;  1VRU A;  3P83 D;  3NF7 A;  4CJU A;  3V1R A;  4FCY A;  4CGD A;  5J2M A;  4K8Z A;  3LWM A;  5JS1 A;  4I2Q A;  1HYS A;  3SV3 A;  4PQU A;  4E1M A;  3AA4 A;  4FJN A;  4M42 A;  1ZBF A;  3LZI A;  1JL1 A;  3AVL A;  3ZT3 A;  4FK2 A;  4NCG A;  4CEB A;  3V9X A;  3V1O A;  1L3S A;  5CZ2 A;  3SUQ A;  2B4J A;  4W5N A;  1ZBH A;  1SKW A;  2RPI A;  1T8E A;  4HUE A;  3OYG A;  1TK5 A;  1L5U A;  4KHN A;  3SUP A;  1VSH A;  4W5R A;  3OYD A;  2GV9 A;  4CHY A;  3JSM A;  3AVJ A;  4CIG A;  3LDS A;  1QTM A;  3VQ9 A;  4Z4I A;  2IC3 A;  1XWL A;  2IGI A;  3V6D A;  1J5O A;  2PYJ A;  4DSL A;  1HQU A;  2KTQ A;  1G15 A;  3K5M A;  1U04 A;  2OZM A;  2XY5 A;  1EP4 A;  2HHS A;  4DTS A;  5CZ1 A;  3BDP A;  3G0Z A;  3VQ8 A;  5SWM A;  1VSF A;  1KFS A;  4E7J A;  2QKB A;  2BAN A;  2Y1I A;  2EHG A;  4I2P A;  3WNG A;  4C8L A;  1QHT A;  1S1T A;  3KTQ A;  3LPU A;  3AA3 A;  3VN5 A;  1TK0 A;  2YNH A;  1JLB A;  4BWJ A;  1QSS A;  4EZ6 A;  3QER A;  3HPO A;  4FLZ A;  3NF9 A;  4CJL A;  1BGX T;  4Q0B A;  3F73 A;  2RF2 A;  3MXJ A;  4BWM A;  2HNY A;  4H4M A;  1NOZ A;  4LH4 A;  2ZD1 A;  3ZSQ A;  4CHZ A;  3KKS A;  1S1X A;  3DOK A;  4FW2 A;  1WSF A;  2VG7 A;  4OPK A;  3OJS A;  3EZ5 A;  4FZX C;  1C1A A;  2I5J A;  2OPQ A;  3CFO A;  3QES A;  3TAG A;  5KTQ A;  2HHV A;  1RT6 A;  4TSX A;  1U47 A;  4C8K A;  4CJT A;  1XHX A;  5SZT A;  1NJY A;  1IKW A;  4DU3 A;  1KLM A;  4OLB A;  3LAL A;  1Q9X A;  4DMN A;  3KLE A;  4CJE A;  4CCH A;  2G8H A;  4E0D A;  3KJV A;  4FZZ A;  1EXQ A;  2XY6 A;  1MU2 A;  1WSI A;  1Z25 A;  2E6M A;  4CFC A;  4LSN A;  2AJQ A;  1KVB A;  4FJL A;  3ZT1 A;  4KTZ A;  3TAR A;  2HHQ A;  4RW9 A;  5K14 A;  1GOB A;  1WAJ A;  3B6O A;  3MEG A;  2NUB A;  4DTX A;  1NK9 A;  3K59 A;  4DLG A;  1CXU A;  3PO5 A;  4F2R A;  4CGJ A;  1HNV A;  4CF8 A;  1EET A;  5KRT A;  3DLK A;  1D8Y A;  1ITG A;  4FK0 A;  3NHG A;  1B92 A;  1X9S A;  1TVR A;  1BIS A;  4B9T A;  3LPT A;  3RR8 A;  3OYN A;  1JLA A;  1NK6 A;  2YHB A;  4LD0 A;  4CES A;  3AVH A;  4CJV A;  4FJH A;  4CEQ A;  3ULD A;  4CJ3 A;  4FJ5 A;  4F3O A;  1SKR A;  4KHW A;  3DI6 A;  4E19 A;  5DK5 A;  2HW3 A;  1VSD A;  3VQ7 A;  5C42 A;  2XHB A;  1NKC A;  3KIO A;  3HT3 A;  1CZ9 A;  1JXB A;  4DQR A;  3I8D A;  1ZYQ A;  2FBV A;  4O0J A;  3PO4 A;  4O4G A;  1SL2 A;  1J9A A;  4KB1 A;  4DSK A;  1S5J A;  3OYM A;  4PWD A;  4H4O A;  3HVR A;  1TL3 A;  1RCH A;  4DFP A;  1YTU A;  2Y1J A;  2E4L A;  1ASU A;  5HRR A;  1VSK A;  5KRS A;  4M3T A;  1TKZ A;  1A5X A;  3AO2 A;  4O5B A;  3VQ4 A;  5T7B A;  3MEE A;  3AVN A;  1IH7 A;  3LAK A;  4CF0 A;  1C1B A;  5HRO A;  3V9S A;  4FVM A;  4M3X A;  1S9G A;  1FKO A;  2GBZ A;  4CER A;  4W5Q A;  3KD5 E;  2Z1H A;  3VQB A;  3S9H A;  4ELU A;  3TAM A;  3NE6 A;  2HVI A;  4OGC A;  2YKM A;  4B9N A;  1Y97 A;  4CF9 A;  2D0A A;  2ETJ A;  1HQE A;  4DU1 A;  1NK5 A;  4N76 A;  1VSJ A;  3MAQ A;  1WLJ A;  4NYF A;  4FK4 A;  2Z1J A;  1RTD A;  3AVK A;  3VQP A;  3TAE A;  3ZT0 A;  4N5S A;  1HMV A;  1BI4 A;  2VG6 A;  5J2P A;  4KAZ A;  1JLF A;  3P5J A;  1W0H A;  3CM6 A;  4BE1 A;  1TKT A;  3ZSW A;  2FC0 A;  4Z4G A;  1WSG A;  1HYZ A;  2QXF A;  3FFI A;  1C1C A;  4NYN A;  4AH9 A;  4Z4F A;  2D0C A;  3OYF A;  5KGW A;  3AO3 A;  1LW2 A;  1HYV A;  1O1W A;  4ELV A;  4CEC A;  1KFD A;  2HHW A;  1KVA A;  4B8C A;  4DFK A;  3CFR A;  4DS5 A;  2OA8 A;  4KHQ A;  1IKV A;  1JKH A;  1RBU A;  1ASW A;  3SNN A;  4ELT A;  1WSJ A;  1TK8 A;  1LWC A;  4AIL C;  5CYQ A;  3MED A;  3ZSR A;  3V4I A;  4B9U A;  4FLT A;  4KI6 A;  4FLY A;  4BAC A;  4DQP A;  1IO2 A;  3A2F A;  1TV6 A;  4B8A B;  4W5T A;  3VQC A;  3O3H A;  3OYJ A;  2P1J A;  3D0P A;  1SL0 A;  4IG3 A;  3SZ2 A;  3ZSX A;  3UIQ A;  1DLO A;  4QCL A;  4AHU A;  1L3T A;  3QIP A;  3CG7 A;  3DLR A;  4CED A;  4CK1 A;  5E41 A;  4AHV A;  4W5O A;  3QEV A;  1QQC A;  5KI6 A;  3SQ2 A;  2Z1G A;  1W9H A;  2HB5 A;  3C6T A;  4DF8 A;  2XY8 A;  4E89 A;  1CLQ A;  1VSL A;  4LH5 A;  4XIU A;  5HRP A;  1X9M A;  1YVU A;  4DTP A;  1NK8 A;  1BQN A;  2X74 A;  4Z4H A;  4CGF A;  3AV9 A;  1KLN A;  2OPR A;  3NH0 A;  3VQA A;  4DSF A;  4FM2 A;  1TGO A;  4CF1 A;  4B3O A;  4CK3 A;  3LWL A;  2ITG A;  3LP0 A;  4G1Q A;  2HMI A;  2KQ2 A;  4DLE A;  1NK4 A;  3K58 A;  3VQ5 A;  1LW0 A;  2IAJ A;  5C25 A;  3OYE A;  3QIO A;  4CIE A;  1ZBL A;  1NJX A;  4CJK A;  1ASV A;  5CY4 A;  4M3Y A;  3DMJ A;  4CEZ A;  1JLG A;  4Y1D A;  4GW6 A;  3DLH A;  4OKJ A;  2P5O A;  1NJZ A;  1BL3 A;  3WNH A;  4CEA A;  2X78 A;  4YFU A;  1HJR A;  3K57 A;  3F9K A;  3DRS A;  3G10 A;  3OYH A;  3HVT A;  3QNO A;  1HPZ A;  4OPJ A;  3TAB A;  4RW8 A;  2PYL A;  3LAN A;  3LP2 A;  2FBT A;  2HND A;  3ZSV A;  4FXD A;  4C8M A;  1B9F A;  5EU7 A;  4DQQ A;  3OYA A;  4EP4 A;  1YT3 A;  4FJJ A;  3HPH A;  4C8N A;  5HRN A;  4I7F A;  2YNF A;  3HP9 A;  3S3N A;  4FJ9 A;  2WON A;  4B9S A;  4FJM A;  3ZT4 A;  3M8Q A;  5D3G A;  4WE1 A;  1KCF A;  2HHU A;  3NCI A;  4FJ7 A;  3M8P A;  4BDZ A;  2JLE A;  4DSI A;  3RWU A;  1BI4 B;  4DQS A;  3E01 A;  1JLC A;  3ZSO A;  2F8T A;  5J1E A;  1L3V A;  3L2V A;  3HK2 A;  3AVB A;  4DTU A;  2QKK A;  4DQI A;  4KRF A;  4BE0 A;  1NK7 A;  4E1N A;  1JLE A;  4AHR A;  4ZTJ A;  3NBP A;  4JS5 A;  4DSJ A;  1TAU A;  2O4G A;  4BE2 A;  3WNF A;  4F8R A;  3MXI A;  1C0M A;  1FXX A;  3EYZ A;  3K5L A;  1S6Q A;  3KK3 A;  2LSN A;  1VK0 A;  3AVF A;  4AHC A;  3L8B A;  3HXM A;  3MEC A;  2G8F A;  2HVH A;  4HVJ A;  4CFB A;  4FZY A;  1ZBI A;  2YNG A;  3OYI A;  2HHT A;  3NF8 A;  4DTO A;  1EX4 A;  4AHS A;  4E7I A;  3K5N A;  1SV5 A;  4FW1 A;  3RRG A;  4PY5 A;  3AA2 A;  2DTU A;  4JS4 A;  3TAP A;  5FDL A;  4GMJ B;  5I42 A;  2PZS A;  3OS2 A;  4EP5 A;  3TAF A;  4IFV A;  4B9L A;  4YNQ A;  4CHQ A;  1CXQ A;  1Q8I A;  5FRO A;  1RT2 A;  1YTA A;  3HL8 A;  3S3M A;  4CGI A;  4L8R B;  1UA1 A;  4DFJ A;  3JYT A;  4CEF A;  5FRM A;  1RDD A;  1RBT A;  5HP1 A;  4KRE A;  3TI0 A;  1NJW A;  2QK9 A;  4GVM A;  4I9L A;  3RMD A;  3U3Y A;  3TAN A;  2JGU A;  1WN7 A;  3I0S A;  4ZHR A;  1RIL A;  1VSM A;  5DMR A;  4KHU A;  4CGG A;  4CF2 A;  3ZT2 A;  4N41 A;  2R7Y A;  1NKB A;  5CYM A;  3VQ6 A;  2G8U A;  4JRQ A;  4CGH A; 
#chains in the Genus database with same CATH topology
 3PV8 A;  3VEW A;  1TYQ B;  1D9F A;  1UWB A;  1KQS M;  3C7N A;  5HLF A;  2QXL A;  2P9P B;  4ZTF A;  4A5A A;  2YKN A;  4MFB A;  4YOT A;  3BGR A;  1U45 A;  2IS3 A;  4KHP K;  3S41 A;  1EO1 A;  3QET A;  4O55 A;  3ZSY A;  3LAM A;  1QQM A;  4BC5 A;  1RDW X;  1A5W A;  4MO5 A;  1OVY A;  3ZSZ A;  1N36 K;  2V51 B;  1RNH A;  3K0S A;  4JK9 A;  5AQJ A;  4DTM A;  1DGK N;  1W2B M;  4BY9 C;  4WYB A;  4F9O A;  4Y0W A;  1RBV A;  2HBJ A;  4IDH A;  1SS6 A;  4FSV A;  3SPY A;  4LF7 K;  1Z6R A;  3AVA A;  4K42 A;  3DM2 A;  4BRN A;  1B9D A;  4BRQ A;  2NRT A;  2O8F B;  1P90 A;  2HOE A;  3NH1 A;  4IOA L;  3F2K A;  3CYM A;  4BGA A;  4CJ5 A;  1LOT B;  1QZ6 A;  3K2P A;  1RT4 A;  3SCX A;  1DEJ A;  1NMN A;  1BA1 A;  4BDP A;  1N32 K;  5M1P A;  1VQ5 N;  3OTO K;  3DRR A;  4CEE A;  2P9N B;  4FYD A;  1GOC A;  4IFE A;  4PL8 A;  1S1U A;  4AQY K;  4E7H A;  1ZBU A;  1ZXO A;  4A62 A;  3O4Q A;  3NGI A;  3NMU A;  1RT7 A;  4HTU A;  2ZQB A;  3KLH A;  3QIC A;  2B6A A;  1VRT A;  3WNE A;  1N34 K;  3SAH A;  4CHO A;  2CGJ A;  3MCA B;  1P8Z A;  4FWS A;  5TKW A;  5M1Q A;  4CFA A;  1XC9 A;  4CVN E;  2KZM A;  3D7E O;  3SBG A;  3J7Y P;  3OS0 A;  4KHS A;  3ZCM A;  4FM0 A;  2G8I A;  5KQ8 A;  3TPQ A;  3SQ0 A;  4DTR A;  1IKY A;  1YIT N;  3L3V A;  3MXM A;  3EO3 A;  5FPE A;  1U6Z A;  2F96 A;  4M7X A;  5AQN A;  1U2V A;  4KTW A;  3QEI A;  4JKD A;  3O3G A;  3DYA A;  3CPE A;  4M41 A;  5AFU A;  4M3Z A;  1L3U A;  5EX5 A;  3CQ8 A;  5EVZ A;  3PSI A;  1HLU A;  2GUP A;  3SQ4 A;  4CZM A;  4DR2 K;  4KV8 A;  3ZEU A;  4IOC L;  2E2Q A;  3E1Y A;  4BVO A;  3H08 A;  4CZK A;  4JV5 K;  3B6P A;  5ADX H;  3CJB A;  1GLD G;  5C15 A;  3CD6 N;  1HNX K;  4LY7 A;  3LP1 A;  3CM5 A;  1BU6 O;  2YHA A;  4JN4 A;  3PX0 A;  1KRP A;  3RTV A;  1S1V A;  2P9S A;  1HPM A;  5AQH A;  3I8B A;  1RDB A;  1S3X A;  4XH5 A;  4FJX A;  3VER A;  4AHT A;  3MCP A;  4QS9 A;  5KPT A;  3N4Q A;  2HHH K;  2F9T A;  4E7K A;  4PUO A;  4CJR A;  2E2O A;  4QOZ B;  3IG1 A;  1SL1 A;  3QEP A;  4UQG A;  4DKW A;  3ZX2 A;  4RW7 A;  2ZWH A;  3HSC A;  4DSE A;  3RSE B;  5BPL A;  2ASP A;  4CD3 A;  4KFB A;  3ULE B;  4I2Q A;  3AA4 A;  4FJN A;  3EKU A;  3LZI A;  4M42 A;  1JL1 A;  3FZH A;  2E2N A;  4FK2 A;  4NCG A;  3V9X A;  4H5W A;  5CZ2 A;  1EQY A;  3WXK A;  3CC2 N;  1QZ5 A;  1RDU A;  1T8E A;  3G71 N;  3HRG A;  4CHY A;  3LDS A;  4Z4I A;  4PL7 A;  2IGI A;  2KTQ A;  4LF5 K;  1U04 A;  3WXJ A;  1M1K O;  5AQG A;  5GAD P;  4B3S K;  4WQ4 C;  2ITM A;  3WEE A;  1KFS A;  4B1X B;  5BRE A;  5M1O A;  4XH4 A;  1S1T A;  1NU0 A;  4DV6 K;  1QSS A;  4B3M K;  2O8B A;  4BRH A;  4Q0B A;  3EL2 A;  1SAZ A;  2Q97 A;  1NOZ A;  4B3R K;  4WFB L;  1CLQ A;  1WSF A;  2VG7 A;  5CHI A;  4DV0 K;  2F4V K;  3CET A;  4OPH A;  5KTQ A;  5SZT A;  4BR2 A;  4YOV A;  4CJE A;  1YIJ N;  2QA4 N;  2XY6 A;  1WSI A;  3TAR A;  4RW9 A;  3B6O A;  4DTX A;  4DLG A;  1CZA N;  1HNV A;  3QML A;  1EET A;  3E9P A;  4A61 A;  3THX B;  3LPT A;  2NZT A;  1VQK N;  1NK6 A;  4FJH A;  4LD0 A;  2HBK A;  4AM7 A;  2HMP A;  2E2P A;  3D6R A;  1NKC A;  3KIO A;  5JLF A;  4BG9 A;  1JXB A;  3O6W A;  3ENB A;  3DXM A;  3PO4 A;  1NGE A;  3KHY A;  4O4G A;  4KB1 A;  3QB0 A;  4PWD A;  3HVR A;  1RCH A;  4DFP A;  2O8D B;  2KLA A;  5HRR A;  1NGF A;  1VSK A;  3OHR A;  3VQ4 A;  4O5B A;  5AQF A;  3AVN A;  4CF0 A;  4FVM A;  5KPZ A;  4BR9 A;  2A41 A;  4CER A;  5BR8 K;  3TAM A;  3NE6 A;  2HVI A;  3C6A A;  4KBO A;  4FOI A;  2ASO A;  4B9N A;  3KZB A;  4BC4 A;  4N76 A;  3LDL A;  5BRH A;  4LF4 K;  4FK4 A;  1RTD A;  1IBM K;  4LFC K;  3F9M A;  3ZT0 A;  4N5S A;  1HMV A;  4RWT A;  4KAZ A;  3UKR A;  4KH5 A;  1W0H A;  4BE1 A;  2D1K A;  3ZSW A;  2FC0 A;  4AH9 A;  1C1C A;  4Z4F A;  4WF9 L;  2D0C A;  3OYF A;  3A5M C;  5B8H A;  1O1W A;  5H1S Q;  1YI2 N;  4DFK A;  4BGB A;  3CFR A;  1IKV A;  3VOV A;  1RBU A;  1WSJ A;  3VGM A;  1LWC A;  3D2E A;  3QBW A;  4AIL C;  5CYQ A;  1MDU B;  4DQP A;  1TV6 A;  3SZ2 A;  1DLO A;  3DLR A;  3VF4 A;  4AHV A;  4CW7 B;  3QEV A;  1QQC A;  4JHD A;  1W9H A;  5EY4 A;  2HB5 A;  3FZF A;  2XY8 A;  1VSL A;  2AP1 A;  1X9M A;  1YVU A;  2OPR A;  1T3V A;  1TGO A;  5AQP A;  4BRK A;  1ATR A;  3LP0 A;  3K58 A;  1JCF A;  1WBD A;  1ZBL A;  1ASV A;  2VQF K;  5HL7 L;  2WTU A;  3H3N O;  1Q7Y O;  4WQ4 A;  4B9Q A;  5JMV A;  5M1N A;  3O9S A;  3E66 A;  3FE1 A;  3OYH A;  3QNO A;  1QQN A;  3TAB A;  4RW8 A;  3WQU A;  3LP2 A;  1XNR K;  3ZSV A;  2E5L K;  3GE1 A;  1HKC A;  3OYA A;  4IO8 A;  3Q7C A;  3FFK B;  4CD1 A;  3HP9 A;  3IUC A;  2HHU A;  2V7Y A;  2YX6 A;  4WE1 A;  2WFB A;  2QEX N;  3NCI A;  3E01 A;  2O8E B;  1X9J A;  2UXD K;  4DQI A;  4KRF A;  4E1N A;  3UKU A;  3NBP A;  4JS5 A;  4DSJ A;  3CI5 A;  1QQO A;  3WXI A;  4AHC A;  3HXM A;  1JCE A;  4FZY A;  4CFB A;  2ZJP L;  4MDA A;  1W97 L;  2HHT A;  1VAZ A;  3RRG A;  3TAP A;  4KH6 A;  1NM1 A;  2PZS A;  3OS2 A;  3TAF A;  1CXQ A;  5GAE P;  1VQP N;  4DFJ A;  2P9L A;  3JYT A;  1RDD A;  1S72 N;  5FPN A;  4I9L A;  3RMD A;  3TAN A;  1WN7 A;  3I0S A;  1K8A O;  3DAW A;  1V4S A;  5DMR A;  4KHU A;  4WCE L;  5AQZ A;  3WXL A;  4MDB A;  5CYM A;  4JRQ A;  1BG3 A;  4CFD A;  3AY9 A;  3THV A;  3TSQ A;  1IV0 A;  4Z4C A;  2CGK A;  5FPD A;  3KLF A;  3OBY A;  3V9W A;  3DWL A;  4NCA A;  2W41 A;  1GLJ O;  1VSE A;  4PKI A;  4I6M B;  4DU4 A;  4JK8 A;  4QS8 A;  3DLB A;  2EX3 A;  1X3M A;  2GEL A;  3SPZ A;  4RG8 A;  1OH5 A;  3GG4 A;  2Q36 A;  1J53 A;  4KKO A;  3E9L A;  1J5E K;  2YHX A;  4PA1 A;  1BCO A;  1OH6 A;  4H03 B;  2AA4 A;  2G8W A;  2YHW A;  3K5O A;  3T3F A;  3C0B A;  4QAG A;  1XMQ K;  5AQV A;  5J2N A;  2P9U A;  4DV1 K;  4GKK K;  4JI1 K;  4HCB A;  2A6A A;  4Z0U A;  4K0K K;  2KW4 A;  3TU5 A;  4DV7 K;  2O4I A;  1JL2 A;  2E1Z A;  1DT9 A;  5LJV A;  4IEE A;  1TL1 A;  1I39 A;  3VA3 A;  1KTQ A;  1T44 A;  1JXE A;  3EZW A;  1TKX A;  1HKB A;  4ISF A;  3AGR A;  4M3W A;  3IS9 A;  3M3Z A;  4IG0 A;  5LMU K;  4FJK A;  3CJ1 A;  3A5L C;  3R9P A;  1NWK A;  4E7L A;  3LDO A;  3VGK A;  3FZK A;  3KKR A;  3WXM B;  4C1N K;  3I56 N;  2HHX A;  1Q18 A;  1EKE A;  1WOQ A;  3ATV A;  4MQ3 A;  3VEN A;  3TR8 A;  3VGL A;  3QEW A;  2ZGZ A;  1C0U A;  5FRN A;  3ZYY X;  4CJW A;  3TWH A;  1NMD A;  4NLC A;  1T03 A;  4U7B A;  3HST B;  4B9V A;  1F21 A;  4KB0 A;  1NLV A;  1FKP A;  4FJ8 A;  2KKZ A;  3HI0 A;  4JKG A;  3OS1 A;  5AQM A;  3LDQ A;  1RTJ A;  4Y1C A;  5I9E B;  1NJI O;  5FLX O;  2GUI A;  2FBY A;  5JVG L;  1LAV A;  5JS2 A;  1IG9 A;  3MN9 A;  1C0T A;  4H0P A;  4HCC A;  2KFN A;  3R8E A;  3VQQ A;  4K41 A;  4B08 A;  2W6K A;  3W3D A;  4O0I A;  1K8K A;  2CGL A;  1YJW N;  3LZJ A;  1HNI A;  2FF6 A;  1XUP O;  4DF4 A;  3QEX A;  1LV5 A;  4Z4E A;  3U9Z A;  3VA0 A;  3L2W A;  3C6U A;  4DR6 K;  3SUN A;  2HNZ A;  4QS7 A;  3A0I X;  4NCB A;  2QWQ A;  3L0Q A;  3HPG A;  1KAZ A;  1D4X A;  5EXW A;  5I3U A;  4J2E A;  3RRH A;  4E3S A;  1D5A A;  3GBT A;  4FM1 A;  1FK9 A;  1GLE G;  5AQI A;  3MN6 A;  2E1Y A;  4FWL A;  1YUW A;  5JLH A;  3KK1 A;  2PFU A;  1C0G A;  3NFA A;  3M8S A;  3EY1 A;  4CK2 A;  3CJ7 A;  1BHL A;  1V4T A;  4BRA A;  3HP6 A;  5HBM A;  4KTQ A;  2VGM A;  4FWR A;  4CZH A;  3OYB A;  2XRI A;  3QNN A;  1IBK K;  4HUF A;  4RW6 A;  4OVL A;  2KFZ A;  5TKY A;  2DFF A;  3QFU A;  4DR5 K;  4JLH A;  4IOX A;  3C65 A;  4J2B A;  1IG8 A;  1GLF O;  1VQO N;  4LSL A;  2YV0 X;  4DWI A;  4CHP A;  2GWJ A;  4CJP A;  5AQU A;  4DTJ A;  2YJF A;  4B9M A;  1RTI A;  3DOL A;  4DV2 K;  3KK2 A;  2A1R A;  4CZL A;  5IT9 O;  5J2M A;  1GLL O;  1HYS A;  3ENO A;  4E1M A;  3ZT3 A;  3SUQ A;  1U2V B;  3FGU A;  1TK5 A;  1VQ4 N;  1XNQ K;  1VSH A;  4W5R A;  3OYD A;  3IMX A;  1Q82 O;  3JSM A;  2YJE A;  2IC3 A;  1J5O A;  4DSL A;  3K5M A;  2OZM A;  4BRD A;  4L3Q A;  4DTS A;  3G0Z A;  4JI0 K;  1MWM A;  3G25 A;  4CI6 A;  4E7J A;  2BAN A;  3ZEU B;  4BRP A;  3WNG A;  1ZC6 A;  2NNW A;  3ID6 A;  3THW A;  4C8L A;  3VN5 A;  1TK0 A;  4BWJ A;  3EE9 A;  3QER A;  1T6C A;  3LDN A;  4FLZ A;  1NNE A;  3F73 A;  5AQK A;  2RF2 A;  3LDP A;  4JKE A;  4X65 K;  4BWM A;  2HNY A;  4H4M A;  4CHZ A;  3KKS A;  1S1X A;  1XC3 A;  3DOK A;  5JVH L;  4FZX C;  3PLA A;  4FOE A;  2OPQ A;  2I5J A;  2P9S B;  1RT6 A;  1XHX A;  1NJY A;  1G99 A;  3KLE A;  3J81 O;  4FZZ A;  1MU2 A;  3JAM O;  1Z25 A;  4BRI A;  1KVB A;  2HHQ A;  1GOB A;  2NUB A;  2OAN A;  3CME N;  1CXU A;  2FSN A;  3BF3 A;  4CGJ A;  2VQE K;  1D8Y A;  3CQY A;  1ITG A;  1B92 A;  1TVR A;  2QI2 A;  3OYN A;  1JLA A;  5F0X A;  2YHB A;  3JS6 A;  3CF5 L;  3AVH A;  4CEQ A;  4CJ3 A;  4FJ5 A;  4BRL A;  3MMV A;  2Q2R A;  2HW3 A;  2XHB A;  4DQR A;  3FLC O;  4A2B A;  1S5J A;  3OYM A;  1VQL N;  4H4O A;  1TL3 A;  2Q0U A;  1YTU A;  5AZI A;  2Y1J A;  5KRS A;  1TKZ A;  2HBL A;  3K9J A;  3LL3 A;  1S9G A;  3C6H A;  4W5Q A;  3WEE B;  3S9H A;  2YKM A;  1RGI A;  2ETJ A;  3O5B A;  1NK5 A;  3MAQ A;  1GLA G;  4CBU A;  4DV4 K;  4WFA L;  1T6D A;  2QWN A;  4FWP A;  4Z4G A;  2ZF5 O;  1WSG A;  3FFI A;  4NYN A;  3Q7B A;  1KFD A;  1KVA A;  4ILJ A;  3SNN A;  2P9K A;  1HKG A;  3CCR N;  1FJG K;  1TK8 A;  3MED A;  3ZSR A;  3V4I A;  1IO2 A;  4FWO A;  3VEZ A;  4B8A B;  3OYJ A;  5A2Q O;  2P1J A;  5AQY A;  5C2F A;  3CG7 A;  4CK1 A;  1L3T A;  3CJA A;  5KI6 A;  1NGD A;  1BUP A;  3C6T A;  4DF8 A;  4E89 A;  4LH5 A;  3CC7 N;  4XIU A;  4YOX A;  2X74 A;  4Z4H A;  1HX1 A;  4CGF A;  1KLN A;  3NH0 A;  5C0Y A;  1W7A A;  4DSF A;  4CF1 A;  4B3O A;  4CK3 A;  3LWL A;  2ITG A;  4G1Q A;  4DLE A;  3H1V X;  2IAJ A;  2NRR A;  3U8X A;  3MWT A;  4CEZ A;  4Y1D A;  1BL3 A;  3WNH A;  4JD2 A;  4CEA A;  4FVU A;  4X66 K;  3F9K A;  3DRS A;  3T7Z A;  3HVT A;  4BRE A;  2QWL A;  3LAN A;  2FBT A;  4PHT X;  1E4G T;  4C8M A;  1B9F A;  1OH7 A;  3HPH A;  5HRN A;  5KQD A;  2YNF A;  2CH5 A;  2WON A;  4B9S A;  2QWR A;  3SAG A;  4FJ7 A;  4DSI A;  4B3T K;  1NBW A;  3RWU A;  3EE8 A;  3UKR B;  1JLC A;  2F8T A;  1NK7 A;  1JLE A;  3WNF A;  2D0P A;  4F8R A;  1FXX A;  3D2E B;  1VK0 A;  3AVF A;  4BRC A;  4AM6 A;  4HVJ A;  4DB3 A;  3OYI A;  4DTO A;  3O1W A;  4AHS A;  4E7I A;  1VQ7 N;  3BEX A;  3ULE A;  4FW1 A;  3AA2 A;  1BA0 A;  4JS4 A;  1YF5 L;  4JHD B;  4GMJ B;  5DM6 L;  4YHH K;  4IFV A;  4IWV A;  5F1X A;  3O9R A;  3HL8 A;  5AQQ A;  5C12 A;  5FRM A;  5GIO A;  1QHA A;  1NJW A;  4GVM A;  5AJ3 K;  3CER A;  1IBL K;  3ZT2 A;  4N41 A;  5FPM A;  1ESV A;  1NKB A;  2G8U A;  4FPA A;  4MLE A;  2QM1 A;  3VF2 A;  4CEO A;  1Z26 A;  4CBX A;  4GNI A;  1HJO A;  1RBS A;  4J2A A;  2I7N A;  4H0O A;  1NG9 A;  4N47 A;  1QSY A;  4GV9 A;  2IDO A;  3J80 O;  4H5N A;  1XMO K;  3KLG A;  3NH2 A;  1DKG D;  3THY A;  2RHK A;  3AA5 X;  3BP8 A;  3CCU N;  1N6Q A;  3LM9 A;  1RT3 A;  4F3T A;  3HM9 A;  3TSU A;  4R5P A;  4Q5V A;  3J7Z O;  3SQ1 A;  4I9Q A;  2FXU A;  2W42 A;  4K8X A;  4IJA A;  1LCU A;  4B1V A;  3UKU B;  1RBR A;  4IXC A;  4HUG A;  1S1W A;  3O08 A;  3FZL A;  2KZZ A;  1DTT A;  3HO1 A;  2D5R A;  1U48 A;  3HZ6 A;  3VEX A;  4MLH A;  1R0A A;  1TAQ A;  4EFH A;  3P1G A;  5C24 A;  4JI2 K;  4N56 A;  3U6F A;  4E1J A;  4H0T B;  4U67 L;  4FJI A;  4IKF A;  2IOC A;  4FLX A;  3QIN A;  5LL6 Z;  1WSE A;  1LAW A;  2OYQ A;  4FO0 A;  3H1Q A;  1RDA A;  1NOY A;  3L3U A;  1HRH A;  2P9L B;  3V81 A;  4CJF A;  3RR7 A;  4ICL A;  1IJJ A;  3HYF A;  5AQO A;  4H0V B;  4YOY A;  3CXC M;  1S9E A;  1LWE A;  4FLW A;  2ATQ A;  2ZE2 A;  2F8S A;  4JYA K;  3VQD A;  4HTL A;  4CJQ A;  3NVM A;  5HOO A;  4F2S A;  1X1P A;  2VWJ A;  4A59 A;  3RMA A;  1SKS A;  3VEV A;  2HBM A;  3QFP A;  2YNI A;  3J8A A;  3HBT A;  3F5T A;  1BWF O;  3IRX A;  1UAX A;  2E6L A;  2YI1 A;  2P5G A;  1JLQ A;  4JI7 K;  3L2U A;  2PBD A;  4OLA A;  4W5N A;  3ZET B;  4FLU A;  3RMC A;  1VQ6 N;  1BCM A;  1T7P A;  2P9U B;  2FBX A;  3NGY A;  4CHN A;  3QLH A;  2Q0R A;  2X6N A;  3ASM A;  3I0R A;  1NGC A;  1VSI A;  4K43 A;  4IJN A;  5C10 A;  4PKG A;  1REV A;  1VQ8 N;  3AVC A;  1WUA A;  4ILG B;  1T05 A;  4DR3 K;  4KO0 A;  4OKK A;  2ZJR L;  3S3O A;  3OYK A;  2G8K A;  4O44 A;  1S6P A;  4DUY K;  3P31 A;  1QE1 A;  3O3F A;  3SBT A;  2V52 B;  4ID5 A;  3O9U A;  4DQ8 A;  4O8K A;  1U49 A;  3ZX0 A;  4Z94 A;  2IVO A;  3AVM A;  1YAG A;  4CJ4 A;  2RKI A;  3AAR A;  4B1U B;  2D4W A;  2QW9 A;  3KD1 E;  1QVG M;  3C95 A;  1NK0 A;  4FJG A;  1RT1 A;  4H5V A;  1RT5 A;  3HJF A;  2OPP A;  4OKE A;  4CBW A;  1CZB A;  3EEQ A;  2XY7 A;  2B5J A;  3NGZ A;  4KI4 A;  4M3U A;  3AVG A;  5LY3 A;  3VES A;  4OJR A;  3U3G A;  2P51 A;  3L2Q A;  3OA9 A;  3AO1 A;  3ALY A;  1RDC A;  4O5F A;  1WSH A;  1QSL A;  4JKG B;  3H46 O;  2BTF A;  3VQE A;  1FW6 A;  3QO9 A;  2VWK A;  4DG1 A;  2IIR A;  3OJU A;  2UU9 K;  1RFQ A;  3P4I A;  2XO7 A;  3P83 D;  3NF7 A;  1TUY A;  4CGD A;  4UY8 O;  3SV3 A;  3A5O C;  1ZBF A;  4A57 A;  4EHT A;  2UXB K;  1NGG A;  4NB4 A;  3V1O A;  1L3S A;  2B4J A;  4YDU C;  3DXK A;  2RPI A;  4JKB A;  3OYG A;  1L5U A;  1K8K B;  2O8C A;  1QTM A;  3RVC A;  4DV3 K;  3CCQ N;  3H6E A;  2PYJ A;  1HQU A;  2WBN A;  4PKH A;  4K25 A;  2XY5 A;  1QVF M;  1EP4 A;  4C1N I;  5CZ1 A;  3BDP A;  3VEO A;  1VSF A;  2QKB A;  2Y1I A;  4I2P A;  1QHT A;  3KTQ A;  3LPU A;  3AA3 A;  1JLB A;  4EZ6 A;  1BGX T;  3C7N B;  3VTI A;  4YOR A;  2E88 A;  5BN8 A;  2NRV A;  3L6Q A;  4LH4 A;  2HF3 A;  4FW2 A;  3CFO A;  4GV3 A;  2HHV A;  1ATS A;  4FWK A;  3ZLJ A;  4C8K A;  4BR5 A;  5E26 A;  5AQT A;  4DU3 A;  3SAF A;  1OH8 A;  4FJL A;  4BVP A;  3M6G A;  3MN7 A;  1SZ2 A;  3PO5 A;  4FL9 A;  1Q81 O;  3O9Q A;  4CF8 A;  2ASM A;  4FK0 A;  4JK7 A;  1X9S A;  4XEI A;  4B9T A;  2E20 A;  5AR0 A;  4CES A;  4CJV A;  3PSF A;  4F3O A;  1SKR A;  1NGJ A;  4KHW A;  4E19 A;  1Y64 A;  2VYP A;  5DK5 A;  1VSD A;  3VQ7 A;  4YOW A;  3HT3 A;  3PIP L;  2H3G X;  4BRM A;  2IVN A;  2VGN A;  1ASU A;  3VEY A;  1A5X A;  3AO2 A;  5T7B A;  4H0Y B;  3MEE A;  5C2D A;  3LAK A;  1C1B A;  3MN5 A;  3V9S A;  5HRO A;  2GBZ A;  4M63 C;  5ELZ A;  5BRF A;  2Z1H A;  4ELU A;  3P39 A;  4CZG A;  5GIN A;  3THW B;  2P9I A;  3BZC A;  4GKJ K;  1HQE A;  2F7T A;  4DU1 A;  2V7Z A;  1VSJ A;  1WLJ A;  4NYF A;  2Z1J A;  3VQP A;  3TAE A;  3IKM A;  1OVQ A;  1BI4 A;  1JLF A;  3T1Y K;  3CM6 A;  1TKT A;  3CHW A;  3HTV A;  4JKH A;  4GV6 A;  5AZJ A;  1LW2 A;  4CEC A;  2HHW A;  4B8C A;  4KHQ A;  4ELT A;  3A8Y A;  4RTF D;  2NRH A;  3D2F A;  2GTD A;  4BAC A;  4FLY A;  3WT0 A;  3A2F A;  3VQC A;  3O3H A;  3D0P A;  4IG3 A;  3ZSX A;  4QCL A;  4AHU A;  3QIP A;  1N5Y A;  4EAH D;  5E41 A;  4W5O A;  3SQ2 A;  3SLC A;  2Z1G A;  5AQS A;  4CZI A;  3CC4 N;  5HRP A;  1NGA A;  3VPZ A;  4BG8 A;  3VQA A;  4FM2 A;  3CCV N;  4G9Z A;  4YDU A;  3H45 C;  2KQ2 A;  4YOU A;  3UE5 A;  3M5R A;  3BY5 A;  5C25 A;  3QIO A;  3AGK A;  2IVP A;  4CIE A;  1NJX A;  4CJK A;  4M3Y A;  2A42 A;  3ENH A;  4OKJ A;  5AZI B;  1TYQ A;  4CZE A;  4YFU A;  3N4P A;  3K57 A;  4B1Z A;  4OPJ A;  2PYL A;  2P9P A;  2HND A;  4NLB A;  3CCS N;  3TTC A;  4DQQ A;  1E3M A;  4EP4 A;  4C8N A;  2QWP A;  3GOI A;  5LJW A;  3S3N A;  4FJ9 A;  1N33 K;  4FJM A;  3M8Q A;  2CH6 A;  5D3G A;  1KCF A;  4C23 A;  3ZX3 A;  4JI8 K;  4DR7 K;  3M8P A;  2JLE A;  1R59 O;  2FF3 B;  3DJC A;  3A5N C;  3ZSO A;  2OCE A;  3H3O B;  5J1E A;  3HK2 A;  3AVB A;  4DTU A;  2QKK A;  4BE0 A;  4AHR A;  4ZTJ A;  1Z05 A;  5AQL A;  2O4G A;  3SMP A;  4DCH A;  4BE2 A;  3U4L A;  2P9K B;  4M7Y A;  3EYZ A;  1S6Q A;  3KK3 A;  2LSN A;  3L8B A;  2G8F A;  4DR4 K;  1ZBI A;  5BPN A;  2YNG A;  3NF8 A;  1EX4 A;  1XQS C;  1YVN A;  3CCE N;  3K5N A;  2DTU A;  2O8F A;  3CMA N;  5FDL A;  4NXM K;  4JI5 K;  4B9L A;  4YNQ A;  4CHQ A;  1NGH A;  4LF6 K;  1RT2 A;  3S3M A;  4L8R B;  1UA1 A;  4LF8 K;  4CEF A;  4JI6 K;  5BN9 A;  1RBT A;  3B8A X;  5HP1 A;  3R1X A;  4KRE A;  2QK9 A;  2ZM6 K;  2P9N A;  3U3Y A;  1RIL A;  5AQX A;  4CGG A;  4WQ5 C;  2R7Y A;  2F9W A;  2O8B B;  4CGH A;  3DLG A;  1WAF A;  3MDQ A;  4JD2 B;  3TAQ A;  2X6S A;  2BE2 A;  3OVN A;  3PY8 A;  1K73 O;  4DTN A;  3O4N A;  1U4B A;  3CQX A;  3TTF A;  3L4I A;  4BRO A;  3CJ9 A;  5AQR A;  3V9U A;  4O8U A;  3MX5 A;  3BZK A;  4J2D A;  4LFA K;  4FLV A;  5HRS A;  3ATU A;  2NRX A;  4OX9 K;  3KVG A;  4JRP A;  3O1B A;  4DR1 K;  4M3R A;  1I3A A;  4ISE A;  4BDY A;  3ITH A;  3SV4 A;  1JCG A;  1BIZ A;  5GAH P;  4KHY A;  3PIO L;  4M45 A;  2J4R A;  2UUB K;  3T1H K;  4JI3 K;  2A40 A;  1D9D A;  1SUQ A;  3DRP A;  1GOA A;  3AO5 A;  3DXM B;  5GIP A;  4IDK A;  3NVK A;  1KD1 O;  3DLL L;  1KVC A;  3L2R A;  3E9O A;  4CE9 A;  3ID8 A;  1XI1 A;  2NRW A;  2QWO A;  3VF6 A;  4HHT A;  1GLB G;  1BQM A;  3CPW M;  5J2Q A;  1NGB A;  4H8K A;  4FWM A;  2BDP A;  4CZF A;  2DY4 A;  5KGX A;  3AAP A;  3SYZ A;  5M1F A;  3V9Z A;  4A2A A;  2A1S A;  3L4Q A;  3W0L A;  2FSK A;  3CJC A;  1GLC G;  3C94 A;  1QS4 A;  2KHO A;  4CIF A;  1Q9Y A;  4OGE A;  1TUU A;  3UB5 A;  3I33 A;  4CZJ A;  1RTH A;  2OPS A;  1XHZ A;  4GY2 B;  2BGG A;  3KLI A;  4AF1 A;  4FWN A;  4LC9 B;  3VMF B;  1NGI A;  3NDK A;  2YHY A;  2D0B A;  3SJJ A;  3RSE A;  4DS4 A;  4KPY A;  3O9T A;  3THY B;  2FLO A;  3HOS A;  3CFP A;  2ZGY A;  2Z1I A;  4IBN A;  1JJ2 M;  4DFM A;  4H5T A;  5EOY A;  3G4S N;  2VCP A;  2DFH A;  4ID1 A;  2VWB A;  1X9W A;  3OYL A;  1LWF A;  3V1Q A;  3NAE A;  3KK7 A;  2PY5 A;  3LP3 A;  4WFN L;  3AAQ A;  4EHU A;  4DV5 K;  1Q86 O;  3WQT A;  3IAY A;  3KWI A;  4IEI A;  3O8M A;  4RCH A;  1E4F T;  1UOC A;  1S22 A;  3OBW A;  3ISN C;  1BIU A;  2RN2 A;  1IKX A;  3PX6 A;  4JNE A;  3PX4 A;  3JXU A;  1K6Y A;  3AO4 A;  4RW4 A;  1EWQ A;  4BC3 A;  4EZ9 A;  3HM8 A;  3WUH A;  2D0O A;  3TTD A;  3PUF A;  2W6L A;  4BQZ A;  4WQ5 A;  3QDK A;  3RMB A;  1NKE A;  3M8R A;  4JI4 K;  4F4K A;  1O13 A;  1ATN A;  1TKD A;  1DTQ A;  2OZS A;  2UUA K;  1A5V A;  3GL1 A;  4CJS A;  5F2R A;  3SI6 A;  3D45 A;  3CIP A;  4YY3 K;  2WOM A;  3OYC A;  2A5X A;  3AVI A;  2VG5 A;  1VQN N;  5ADX A;  3DLE A;  1J54 A;  5CE3 A;  4MO4 A;  2G8V A;  2YCH A;  3OW2 M;  3T19 A;  3J7A P;  3T1A A;  3SUO A;  4C8O A;  4B1Y B;  3T69 A;  2JWK A;  4IFY A;  1KSP A;  2OTJ N;  3LM2 A;  3OY9 A;  1OKJ A;  1UA0 A;  3THX A;  3SJH A;  3FR0 A;  1C6V A;  4JAX A;  5CR4 A;  3HOT A;  2BH1 A;  2Q3S A;  3CCL N;  3NF6 A;  1WNS A;  2DFE A;  1VRU A;  4CJU A;  4IO9 L;  3V1R A;  4HWI A;  2E8A A;  4FCY A;  4JKC A;  3LWM A;  4K8Z A;  5JS1 A;  4PQU A;  4ILH A;  3AVL A;  4CEB A;  1ZBH A;  3M1F A;  1SKW A;  4KHN A;  4HUE A;  3SUP A;  2GV9 A;  2O8D A;  3AVJ A;  4CIG A;  3VQ9 A;  1XWL A;  3V6D A;  4GVE A;  1G15 A;  4BRF A;  2HHS A;  1YJ9 N;  3VQ8 A;  5SWM A;  1WBB A;  2EHG A;  1YHQ N;  1VQ9 N;  2YNH A;  3KWG A;  3CCM N;  2UUC K;  3HPO A;  3NF9 A;  4CJL A;  4BC2 A;  2FSJ A;  3MX2 A;  3MXJ A;  1BO5 O;  4FPB A;  2ZD1 A;  3ZSQ A;  5BPM A;  4BRG A;  4OPK A;  3OJS A;  3EZ5 A;  1C1A A;  1BOT O;  3QES A;  3TAG A;  4TSX A;  3R6M A;  1U47 A;  4CJT A;  1IKW A;  3P38 A;  4BQL A;  1KLM A;  4FWQ A;  4OLB A;  3LAL A;  1Q9X A;  4DMN A;  4CCH A;  2G8H A;  4E0D A;  3KJV A;  1EXQ A;  5KPR A;  2E6M A;  1X3N A;  5DM7 L;  4CFC A;  4LSN A;  2AJQ A;  3ZT1 A;  4KTZ A;  5K14 A;  1WAJ A;  3MEG A;  1NK9 A;  2HST A;  3K59 A;  4F2R A;  4H5R A;  2OTL N;  5KRT A;  3DLK A;  3NHG A;  1KXP A;  3RR8 A;  1BIS A;  2PAV A;  1VHX A;  1KAX A;  2GX9 A;  4BR0 A;  3ULD A;  4JEP A;  3DI6 A;  5C42 A;  5AQW A;  1CZ9 A;  1VQM N;  3VET A;  3I8D A;  1ZYQ A;  2FBV A;  4O0J A;  1SL2 A;  1J9A A;  4DSK A;  3DXK B;  3SMS A;  3BF1 A;  1HNZ K;  2O8C B;  2E4L A;  4M3T A;  3EN9 A;  1IH7 A;  1EWR A;  4JKF A;  4M3X A;  4X64 K;  4CJ7 A;  1FKO A;  3KD5 E;  3VQB A;  2I7P A;  4OGC A;  2WC9 A;  4JKA A;  5IWA K;  1Y97 A;  4CF9 A;  2D0A A;  1I94 K;  4BR7 A;  3TSP A;  3AVK A;  3QBX A;  1J6Z A;  3I55 N;  2VG6 A;  5J2P A;  3P5J A;  3IDH A;  2GEM A;  4OPA A;  2O8E A;  1HYZ A;  2QXF A;  2UXC K;  5KGW A;  3AO3 A;  2DPN A;  1HYV A;  1M90 O;  4ELV A;  5M1K A;  2OA8 A;  2GWK A;  2JWL A;  4ISG A;  2WUS A;  2NLX A;  1HUX A;  4DS5 A;  1JKH A;  1ASW A;  2Q31 A;  4LFB K;  2UYT A;  1WB9 A;  4B9U A;  4KI6 A;  1KC8 O;  4FLT A;  4X62 K;  4W5T A;  1SL0 A;  3UIQ A;  3ZET A;  4CED A;  2A3Z A;  2HF4 A;  4OO1 J;  1YXQ A;  4DTP A;  1NK8 A;  1BQN A;  3AV9 A;  5JIC A;  4DHY A;  5LMN K;  2NRZ A;  3G6E N;  2HMI A;  4B1W B;  1NK4 A;  3VQ5 A;  1HNW K;  1LW0 A;  3OYE A;  4KH4 A;  2EWS A;  5CY4 A;  3FZM A;  3DMJ A;  3DLH A;  1JLG A;  2P5O A;  4GW6 A;  3R3L A;  4R79 A;  1YJN N;  1NJZ A;  2BUP A;  2X78 A;  1HJR A;  3CCJ N;  3G10 A;  1ILY A;  1BDG A;  1HPZ A;  5E84 A;  3VTH A;  3MWP A;  4FXD A;  5EU7 A;  5BR9 A;  4I6M A;  1YT3 A;  4FJJ A;  4I7F A;  2P9I B;  3ZT4 A;  1MA9 B;  2Q1N A;  4V19 S;  4BDZ A;  1BI4 B;  4DQS A;  3O4W A;  1K9M O;  1L3V A;  3L2V A;  4A5B A;  5AZJ B;  4DUZ K;  1N8R O;  2QWM A;  2RE2 A;  4J8F A;  1TAU A;  3MK6 A;  1H1V A;  3IFR A;  5MLC Q;  4LF9 K;  4NXN K;  3MXI A;  1C0M A;  4BR4 A;  3GDQ A;  3K5L A;  2HVH A;  5BRD A;  4H0X B;  3MEC A;  3D2F B;  5AFU H;  3U9D A;  5GAG P;  4NO7 A;  4PY5 A;  1SV5 A;  3O80 A;  2QTD A;  3K9K A;  5I42 A;  4EP5 A;  2ZJQ L;  3EKS A;  1Q8I A;  5FRO A;  4XH1 A;  1YTA A;  1KAY A;  4CGI A;  3SK3 A;  3TI0 A;  2JGU A;  4IZ9 A;  4ZHR A;  1MWK A;  1VSM A;  1ZBS A;  4CF2 A;  1C0F A;  2W40 A;  1SQK A;  4EIA A;  3VQ6 A;  3BUZ B;  1HR0 K; 
#chains in the Genus database with same CATH homology
 4CFD A;  3DLG A;  3THV A;  1WAF A;  3PV8 A;  4Z4C A;  1D9F A;  1UWB A;  3TAQ A;  4CEO A;  2X6S A;  1Z26 A;  3KLF A;  2BE2 A;  3V9W A;  3OVN A;  5HLF A;  3PY8 A;  4NCA A;  1RBS A;  4DTN A;  4ZTF A;  4J2A A;  2YKN A;  4MFB A;  1VSE A;  3O4N A;  4N47 A;  4DU4 A;  3BGR A;  1QSY A;  1U45 A;  1U4B A;  2IDO A;  2IS3 A;  3DLB A;  2EX3 A;  3SPZ A;  4RG8 A;  3QET A;  4O55 A;  3KLG A;  4J2D A;  1J53 A;  3V9U A;  3NH2 A;  4KKO A;  3ZSY A;  4FLV A;  5HRS A;  4PA1 A;  3AA5 X;  3LAM A;  1BCO A;  1N6Q A;  1A5W A;  1RT3 A;  4F3T A;  3ZSZ A;  4JRP A;  2G8W A;  1RNH A;  3HM9 A;  4R5P A;  4Q5V A;  3SQ1 A;  4I9Q A;  3K5O A;  2W42 A;  3T3F A;  4QAG A;  4DTM A;  4M3R A;  4K8X A;  1RBR A;  1I3A A;  4BDY A;  3ITH A;  5J2N A;  3SV4 A;  1RBV A;  1BIZ A;  4KHY A;  4HUG A;  1S1W A;  2KZZ A;  1DTT A;  4HCB A;  2D5R A;  3HO1 A;  4Z0U A;  3SPY A;  4M45 A;  1U48 A;  3AVA A;  1R0A A;  2KW4 A;  3DM2 A;  1TAQ A;  3P1G A;  5C24 A;  1JL2 A;  2O4I A;  4N56 A;  3U6F A;  1D9D A;  1B9D A;  1SUQ A;  3DRP A;  1GOA A;  1TL1 A;  1I39 A;  3AO5 A;  4FJI A;  3VA3 A;  4IKF A;  1KTQ A;  2IOC A;  4FLX A;  1JXE A;  3NH1 A;  3QIN A;  1TKX A;  4IDK A;  4M3W A;  1WSE A;  3IS9 A;  1KVC A;  3L2R A;  1LAW A;  3CYM A;  4IG0 A;  2OYQ A;  4CJ5 A;  4CE9 A;  1RDA A;  1XI1 A;  1NOY A;  3K2P A;  1RT4 A;  3L3U A;  1HRH A;  3SCX A;  4FJK A;  4E7L A;  3V81 A;  4HHT A;  4BDP A;  1BQM A;  5J2Q A;  4H8K A;  2BDP A;  4CJF A;  3DRR A;  4CEE A;  3RR7 A;  3KKR A;  4FYD A;  1GOC A;  2HHX A;  4ICL A;  2DY4 A;  3HYF A;  5KGX A;  1EKE A;  3SYZ A;  1S9E A;  1LWE A;  4FLW A;  4MQ3 A;  1S1U A;  4E7H A;  3V9Z A;  3TR8 A;  2A1S A;  1ZBU A;  2ATQ A;  2ZE2 A;  3QEW A;  2F8S A;  3VQD A;  4CJQ A;  1C0U A;  5FRN A;  4F2S A;  4CJW A;  1X1P A;  3O4Q A;  2VWJ A;  3NGI A;  3TWH A;  3RMA A;  1RT7 A;  3C94 A;  4HTU A;  1QS4 A;  2ZQB A;  3KLH A;  1SKS A;  2B6A A;  1VRT A;  3WNE A;  4CIF A;  1Q9Y A;  4OGE A;  4CHO A;  2YNI A;  1T03 A;  1RTH A;  3HST B;  2OPS A;  4B9V A;  1XHZ A;  1F21 A;  2BGG A;  3IRX A;  4CFA A;  1XC9 A;  4KB0 A;  1FKP A;  3KLI A;  1UAX A;  4FJ8 A;  2E6L A;  2KZM A;  3NDK A;  3OS1 A;  2D0B A;  3SJJ A;  2P5G A;  3OS0 A;  4KHS A;  3ZCM A;  4DS4 A;  4FM0 A;  1RTJ A;  4KPY A;  1JLQ A;  2G8I A;  3L2U A;  4Y1C A;  3CFP A;  3SQ0 A;  4DTR A;  2GUI A;  2FBY A;  1IKY A;  1LAV A;  5JS2 A;  2Z1I A;  3L3V A;  4IBN A;  4DFM A;  3MXM A;  1IG9 A;  4OLA A;  4HCC A;  1C0T A;  4FLU A;  3RMC A;  2KFN A;  4ID1 A;  2DFH A;  1X9W A;  2F96 A;  3OYL A;  3VQQ A;  1LWF A;  3V1Q A;  1BCM A;  4B08 A;  3NAE A;  1T7P A;  2FBX A;  3LP3 A;  2PY5 A;  3NGY A;  4CHN A;  4O0I A;  3QLH A;  2X6N A;  4KTW A;  3ASM A;  3QEI A;  3IAY A;  3I0R A;  3O3G A;  1VSI A;  3DYA A;  3LZJ A;  1HNI A;  1UOC A;  1REV A;  4M41 A;  3AVC A;  4DF4 A;  3QEX A;  1LV5 A;  4Z4E A;  3VA0 A;  3L2W A;  3C6U A;  3ISN C;  1T05 A;  1BIU A;  1L3U A;  4M3Z A;  3CQ8 A;  2RN2 A;  3SUN A;  4KO0 A;  2HNZ A;  4OKK A;  1IKX A;  3PX6 A;  3OYK A;  3SQ4 A;  4O44 A;  3PX4 A;  3S3O A;  2G8K A;  1K6Y A;  3HPG A;  1S6P A;  4NCB A;  3AO4 A;  4KV8 A;  4RW4 A;  5I3U A;  1QE1 A;  3O3F A;  3H08 A;  4J2E A;  3B6P A;  4ID5 A;  3RRH A;  4EZ9 A;  4E3S A;  1D5A A;  1U49 A;  4LY7 A;  4FM1 A;  3PUF A;  3LP1 A;  1FK9 A;  3CM5 A;  3AVM A;  3RMB A;  4CJ4 A;  2YHA A;  1NKE A;  3M8R A;  4F4K A;  2RKI A;  1DTQ A;  1TKD A;  3PX0 A;  2OZS A;  1A5V A;  4CJS A;  1KRP A;  3SI6 A;  3RTV A;  1S1V A;  3D45 A;  3KK1 A;  3C95 A;  1NK0 A;  3KD1 E;  4FJG A;  2WOM A;  3OYC A;  1RT1 A;  3HJF A;  1RT5 A;  3NFA A;  2OPP A;  3M8S A;  3EY1 A;  4OKE A;  3AVI A;  2VG5 A;  4CK2 A;  1CZB A;  1RDB A;  1BHL A;  2XY7 A;  3DLE A;  1J54 A;  1N5Y A;  2B5J A;  4FJX A;  3HP6 A;  5HBM A;  4AHT A;  4KTQ A;  2G8V A;  3NGZ A;  4KI4 A;  4M3U A;  3OYB A;  2XRI A;  3AVG A;  3T19 A;  3QNN A;  4OJR A;  4HUF A;  4RW6 A;  4OVL A;  2P51 A;  3T1A A;  3U3G A;  3L2Q A;  4E7K A;  3SUO A;  4C8O A;  4CJR A;  4PUO A;  3AO1 A;  2KFZ A;  2DFF A;  3ALY A;  4QOZ B;  4JLH A;  3IG1 A;  4IFY A;  1KSP A;  1SL1 A;  3QEP A;  4J2B A;  4UQG A;  1RDC A;  1WSH A;  3OY9 A;  1QSL A;  4LSL A;  1UA0 A;  2YV0 X;  4RW7 A;  4CHP A;  4DWI A;  4DSE A;  4CJP A;  3VQE A;  1C6V A;  3QO9 A;  2VWK A;  4DTJ A;  4DG1 A;  4B9M A;  2Q3S A;  1RTI A;  3DOL A;  3OJU A;  3NF6 A;  4KFB A;  3KK2 A;  2A1R A;  1WNS A;  2XO7 A;  2DFE A;  1VRU A;  3P83 D;  3NF7 A;  4CJU A;  3V1R A;  4FCY A;  4CGD A;  5J2M A;  4K8Z A;  3LWM A;  5JS1 A;  4I2Q A;  1HYS A;  3SV3 A;  4PQU A;  4E1M A;  3AA4 A;  4FJN A;  4M42 A;  1ZBF A;  3LZI A;  1JL1 A;  3AVL A;  3ZT3 A;  4FK2 A;  4NCG A;  4CEB A;  3V9X A;  3V1O A;  1L3S A;  5CZ2 A;  3SUQ A;  2B4J A;  4W5N A;  1ZBH A;  1SKW A;  2RPI A;  1T8E A;  4HUE A;  3OYG A;  1TK5 A;  1L5U A;  4KHN A;  3SUP A;  1VSH A;  4W5R A;  3OYD A;  2GV9 A;  4CHY A;  3JSM A;  3AVJ A;  4CIG A;  3LDS A;  1QTM A;  3VQ9 A;  4Z4I A;  2IC3 A;  1XWL A;  2IGI A;  3V6D A;  1J5O A;  2PYJ A;  4DSL A;  1HQU A;  2KTQ A;  1G15 A;  3K5M A;  1U04 A;  2OZM A;  2XY5 A;  1EP4 A;  2HHS A;  4DTS A;  5CZ1 A;  3BDP A;  3G0Z A;  3VQ8 A;  5SWM A;  1VSF A;  1KFS A;  4E7J A;  2QKB A;  2BAN A;  2Y1I A;  2EHG A;  4I2P A;  3WNG A;  4C8L A;  1QHT A;  1S1T A;  3KTQ A;  3LPU A;  3AA3 A;  3VN5 A;  1TK0 A;  2YNH A;  1JLB A;  4BWJ A;  1QSS A;  4EZ6 A;  3QER A;  3HPO A;  4FLZ A;  3NF9 A;  4CJL A;  1BGX T;  4Q0B A;  3F73 A;  2RF2 A;  3MXJ A;  4BWM A;  2HNY A;  4H4M A;  1NOZ A;  4LH4 A;  2ZD1 A;  3ZSQ A;  4CHZ A;  3KKS A;  1S1X A;  3DOK A;  4FW2 A;  1WSF A;  2VG7 A;  4OPK A;  3OJS A;  3EZ5 A;  4FZX C;  1C1A A;  2I5J A;  2OPQ A;  3CFO A;  3QES A;  3TAG A;  5KTQ A;  2HHV A;  1RT6 A;  4TSX A;  1U47 A;  4C8K A;  4CJT A;  1XHX A;  5SZT A;  1NJY A;  1IKW A;  4DU3 A;  1KLM A;  4OLB A;  3LAL A;  1Q9X A;  4DMN A;  3KLE A;  4CJE A;  4CCH A;  2G8H A;  4E0D A;  3KJV A;  4FZZ A;  1EXQ A;  2XY6 A;  1MU2 A;  1WSI A;  1Z25 A;  2E6M A;  4CFC A;  4LSN A;  2AJQ A;  1KVB A;  4FJL A;  3ZT1 A;  4KTZ A;  3TAR A;  2HHQ A;  4RW9 A;  5K14 A;  1GOB A;  1WAJ A;  3B6O A;  3MEG A;  2NUB A;  4DTX A;  1NK9 A;  3K59 A;  4DLG A;  1CXU A;  3PO5 A;  4F2R A;  4CGJ A;  1HNV A;  4CF8 A;  1EET A;  5KRT A;  3DLK A;  1D8Y A;  1ITG A;  4FK0 A;  3NHG A;  1B92 A;  1X9S A;  1TVR A;  1BIS A;  4B9T A;  3LPT A;  3RR8 A;  3OYN A;  1JLA A;  1NK6 A;  2YHB A;  4LD0 A;  4CES A;  3AVH A;  4CJV A;  4FJH A;  4CEQ A;  3ULD A;  4CJ3 A;  4FJ5 A;  4F3O A;  1SKR A;  4KHW A;  3DI6 A;  4E19 A;  5DK5 A;  2HW3 A;  1VSD A;  3VQ7 A;  5C42 A;  2XHB A;  1NKC A;  3KIO A;  3HT3 A;  1CZ9 A;  1JXB A;  4DQR A;  3I8D A;  1ZYQ A;  2FBV A;  4O0J A;  3PO4 A;  4O4G A;  1SL2 A;  1J9A A;  4KB1 A;  4DSK A;  1S5J A;  3OYM A;  4PWD A;  4H4O A;  3HVR A;  1TL3 A;  1RCH A;  4DFP A;  1YTU A;  2Y1J A;  2E4L A;  1ASU A;  5HRR A;  1VSK A;  5KRS A;  4M3T A;  1TKZ A;  1A5X A;  3AO2 A;  4O5B A;  3VQ4 A;  5T7B A;  3MEE A;  3AVN A;  1IH7 A;  3LAK A;  4CF0 A;  1C1B A;  5HRO A;  3V9S A;  4FVM A;  4M3X A;  1S9G A;  1FKO A;  2GBZ A;  4CER A;  4W5Q A;  3KD5 E;  2Z1H A;  3VQB A;  3S9H A;  4ELU A;  3TAM A;  3NE6 A;  2HVI A;  4OGC A;  2YKM A;  4B9N A;  1Y97 A;  4CF9 A;  2D0A A;  2ETJ A;  1HQE A;  4DU1 A;  1NK5 A;  4N76 A;  1VSJ A;  3MAQ A;  1WLJ A;  4NYF A;  4FK4 A;  2Z1J A;  1RTD A;  3AVK A;  3VQP A;  3TAE A;  3ZT0 A;  4N5S A;  1HMV A;  1BI4 A;  2VG6 A;  5J2P A;  4KAZ A;  1JLF A;  3P5J A;  1W0H A;  3CM6 A;  4BE1 A;  1TKT A;  3ZSW A;  2FC0 A;  4Z4G A;  1WSG A;  1HYZ A;  2QXF A;  3FFI A;  1C1C A;  4NYN A;  4AH9 A;  4Z4F A;  2D0C A;  3OYF A;  5KGW A;  3AO3 A;  1LW2 A;  1HYV A;  1O1W A;  4ELV A;  4CEC A;  1KFD A;  2HHW A;  1KVA A;  4B8C A;  4DFK A;  3CFR A;  4DS5 A;  2OA8 A;  4KHQ A;  1IKV A;  1JKH A;  1RBU A;  1ASW A;  3SNN A;  4ELT A;  1WSJ A;  1TK8 A;  1LWC A;  4AIL C;  5CYQ A;  3MED A;  3ZSR A;  3V4I A;  4B9U A;  4FLT A;  4KI6 A;  4FLY A;  4BAC A;  4DQP A;  1IO2 A;  3A2F A;  1TV6 A;  4B8A B;  4W5T A;  3VQC A;  3O3H A;  3OYJ A;  2P1J A;  3D0P A;  1SL0 A;  4IG3 A;  3SZ2 A;  3ZSX A;  3UIQ A;  1DLO A;  4QCL A;  4AHU A;  1L3T A;  3QIP A;  3CG7 A;  3DLR A;  4CED A;  4CK1 A;  5E41 A;  4AHV A;  4W5O A;  3QEV A;  1QQC A;  5KI6 A;  3SQ2 A;  2Z1G A;  1W9H A;  2HB5 A;  3C6T A;  4DF8 A;  2XY8 A;  4E89 A;  1CLQ A;  1VSL A;  4LH5 A;  4XIU A;  5HRP A;  1X9M A;  1YVU A;  4DTP A;  1NK8 A;  1BQN A;  2X74 A;  4Z4H A;  4CGF A;  3AV9 A;  1KLN A;  2OPR A;  3NH0 A;  3VQA A;  4DSF A;  4FM2 A;  1TGO A;  4CF1 A;  4B3O A;  4CK3 A;  3LWL A;  2ITG A;  3LP0 A;  4G1Q A;  2HMI A;  2KQ2 A;  4DLE A;  1NK4 A;  3K58 A;  3VQ5 A;  1LW0 A;  2IAJ A;  5C25 A;  3OYE A;  3QIO A;  4CIE A;  1ZBL A;  1NJX A;  4CJK A;  1ASV A;  5CY4 A;  4M3Y A;  3DMJ A;  4CEZ A;  1JLG A;  4Y1D A;  4GW6 A;  3DLH A;  4OKJ A;  2P5O A;  1NJZ A;  1BL3 A;  3WNH A;  4CEA A;  2X78 A;  4YFU A;  1HJR A;  3K57 A;  3F9K A;  3DRS A;  3G10 A;  3OYH A;  3HVT A;  3QNO A;  1HPZ A;  4OPJ A;  3TAB A;  4RW8 A;  2PYL A;  3LAN A;  3LP2 A;  2FBT A;  2HND A;  3ZSV A;  4FXD A;  4C8M A;  1B9F A;  5EU7 A;  4DQQ A;  3OYA A;  4EP4 A;  1YT3 A;  4FJJ A;  3HPH A;  4C8N A;  5HRN A;  4I7F A;  2YNF A;  3HP9 A;  3S3N A;  4FJ9 A;  2WON A;  4B9S A;  4FJM A;  3ZT4 A;  3M8Q A;  5D3G A;  4WE1 A;  1KCF A;  2HHU A;  3NCI A;  4FJ7 A;  3M8P A;  4BDZ A;  2JLE A;  4DSI A;  3RWU A;  1BI4 B;  4DQS A;  3E01 A;  1JLC A;  3ZSO A;  2F8T A;  5J1E A;  1L3V A;  3L2V A;  3HK2 A;  3AVB A;  4DTU A;  2QKK A;  4DQI A;  4KRF A;  4BE0 A;  1NK7 A;  4E1N A;  1JLE A;  4AHR A;  4ZTJ A;  3NBP A;  4JS5 A;  4DSJ A;  1TAU A;  2O4G A;  4BE2 A;  3WNF A;  4F8R A;  3MXI A;  1C0M A;  1FXX A;  3EYZ A;  3K5L A;  1S6Q A;  3KK3 A;  2LSN A;  1VK0 A;  3AVF A;  4AHC A;  3L8B A;  3HXM A;  3MEC A;  2G8F A;  2HVH A;  4HVJ A;  4CFB A;  4FZY A;  1ZBI A;  2YNG A;  3OYI A;  2HHT A;  3NF8 A;  4DTO A;  1EX4 A;  4AHS A;  4E7I A;  3K5N A;  1SV5 A;  4FW1 A;  3RRG A;  4PY5 A;  3AA2 A;  2DTU A;  4JS4 A;  3TAP A;  5FDL A;  4GMJ B;  5I42 A;  2PZS A;  3OS2 A;  4EP5 A;  3TAF A;  4IFV A;  4B9L A;  4YNQ A;  4CHQ A;  1CXQ A;  1Q8I A;  5FRO A;  1RT2 A;  1YTA A;  3HL8 A;  3S3M A;  4CGI A;  4L8R B;  1UA1 A;  4DFJ A;  3JYT A;  4CEF A;  5FRM A;  1RDD A;  1RBT A;  5HP1 A;  4KRE A;  3TI0 A;  1NJW A;  2QK9 A;  4GVM A;  4I9L A;  3RMD A;  3U3Y A;  3TAN A;  2JGU A;  1WN7 A;  3I0S A;  4ZHR A;  1RIL A;  1VSM A;  5DMR A;  4KHU A;  4CGG A;  4CF2 A;  3ZT2 A;  4N41 A;  2R7Y A;  1NKB A;  5CYM A;  3VQ6 A;  2G8U A;  4JRQ A;  4CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...