1KVAA

E. coli ribonuclease hi d134a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCAELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvaA00
3LPTA 1RT5A 3NF6A 3DOKA 4IG3A 1J5OA 1D8YA 4DLGA 5CYQA 3V1RA 3QIOA 3RRHA 4B9UA 4KRFA 5HROA 4CECA 3S3NA 4CJKA 3DRRA 4CERA 4Z4GA 3LAKA 1ZYQA 4KAZA 4G1QA 3V1OA 1RT7A 3AVBA 3SJJA 1C1AA 1W0HA 3QIPA 4E7HA 2B5JA 4C8KA 3HPHA 4DU1A 3QEPA 3HL8A 3NH2A 1HPZA 4CEDA 4O5BA 1HQUA 3S3MA 4LY7A 2HHUA 1I3AA 4CGDA 2JGUA 2XY6A 4B9NA 3TARA 3RRGA 4IKFA 4CHPA 4NCGA 5SWMA 3K5NA 4B08A 4AHCA 3V9ZA 3AVKA 4KO0A 4E1MA 2Y1IA 1QHTA 4KKOA 3CM6A 1DTQA 3LANA 1LAVA 4AHSA 1TV6A 2YNHA 3HYFA 1S1TA 4B8CA 3RMBA 1B9DA 4W5TA 3A2FA 1NK6A 3DOLA 5KRSA 3E01A 4L8RB 4E3SA 5JS1A 4HCBA 4ID1A 1TAUA 3AVJA 1WSJA 3DLEA 1FKPA 4CIGA 4DTPA 1DTTA 1TL1A 2E6MA 3MEGA 4N41A 4FLXA 1JXBA 4B9MA 3NGZA 4FZYA 4FW2A 3CFOA 4CGFA 4N56A 2YNFA 3T3FA 1VSJA 4KB0A 1Y97A 4CJQA 4CF2A 1U4BA 4B3OA 4F3OA 4RW8A 5HRSA 3OYFA 1SL0A 4DS5A 4RG8A 4BWMA 1Q9YA 1YVUA 4DMNA 4FJXA 1FK9A 4DTJA 2D0AA 3UIQA 2OZSA 3VA0A 4CEOA 1XHXA 3L2VA 4E1NA 4CJEA 1TKXA 3OS2A 4ELUA 4EP5A 2YKMA 4GVMA 5C24A 3SV3A 4FJNA 1WSFA 3QEIA 1L3TA 4AHRA 3NFAA 3AA3A 1LW2A 3TWHA 1KRPA 1F21A 3QLHA 4Q0BA 4FLVA 4N76A 4KTQA 3LDSA 4QOZB 4AHUA 1SV5A 2DY4A 3AVAA 4FZXC 1G15A 3HO1A 1BQNA 5FRMA 3F9KA 4UQGA 4J2DA 4FCYA 3SV4A 3KD1E 2HHSA 2DFHA 1ZBIA 3ASMA 3ZSQA 5HLFA 4FK4A 4Q5VA 4M41A 4KTWA 5FDLA 1RBSA 3HPGA 2VWJA 1VRUA 2Q3SA 5FROA 1KFDA 1S9EA 4IBNA 4OKKA 4N47A 4DF8A 2HMIA 2DFEA 4M3ZA 3I0SA 2KZZA 1BCMA 3RTVA 3NF7A 1D5AA 3OYAA 2KFNA 4N5SA 4B9VA 3NBPA 1C6VA 2HHXA 4PUOA 3SPZA 3DM2A 2A1SA 2Z1IA 1CXQA 4DTOA 1IKXA 3MEEA 4KB1A 1C0MA 1KSPA 3PY8A 1BGXT 4FM1A 1RNHA 3ZSOA 1TKTA 2GBZA 1SKRA 3KLEA 2PY5A 4K8ZA 1RILA 1NJYA 4FJIA 4PQUA 3T19A 3HVTA 3B6OA 4EZ6A 3TAGA 1ASWA 3H08A 4LD0A 3V9XA 4LSNA 2YKNA 3ZSRA 3KK3A 3HT3A 1X9SA 3S3OA 1UOCA 3D0PA 2HVIA 2HB5A 3LWMA 3HXMA 3C94A 4CEFA 1VSMA 1S5JA 4R5PA 1X1PA 4DFKA 3TAPA 1NK0A 4FLYA 3OYLA 3M8SA 2P5GA 1J53A 4CGIA 5D3GA 1BISA 2B4JA 3K5MA 2KTQA 1S9GA 3PUFA 4O4GA 1NK4A 1ASUA 1TVRA 1BQMA 4IFYA 3O3HA 1JLBA 3O3FA 3K58A 1JLGA 4DQQA 1S1UA 4ZTFA 1TK8A 3VQ6A 1NJZA 1NJXA 4ZHRA 4H4MA 4BE2A 3V1QA 5T7BA 4E89A 4BDPA 5CZ2A 3C95A 2JLEA 1HYSA 1WSHA 3B6PA 4KFBA 4YNQA 4FXDA 3OJUA 2IAJA 4FLWA 4C8MA 3TR8A 4Z0UA 3EYZA 2I5JA 2B6AA 2XRIA 2KW4A 1BIUA 1C1BA 2FBXA 2OPSA 4OGEA 4BACA 4OLAA 3WNFA 1VSFA 2G8WA 2PYJA 2OPQA 2X78A 5C25A 4LH5A 3O3GA 3OS0A 2G8IA 1BCOA 2ATQA 3ALYA 2FC0A 3DRSA 3L2RA 1KCFA 1IO2A 4O0IA 2VWKA 5HRPA 1QTMA 1KFSA 4F2SA 3HK2A 4HUGA 3AA4A 1U49A 3BDPA 4ICLA 1KLMA 1JLQA 3AV9A 4HUEA 1NKEA 3KKRA 2P5OA 4M3YA 1CLQA 4DTXA 3NCIA 4Y1DA 1CZ9A 3BGRA 4CJRA 1A5XA 3RR7A 2X74A 3OYDA 1QSYA 4FLZA 3AVHA 4IG0A 3MAQA 5KGWA 4JLHA 5J2NA 4KI6A 1VSDA 2YHAA 3CG7A 1WAJA 2P51A 4LH4A 1C0TA 1S1WA 1J9AA 5C42A 4M3UA 1U04A 4CGGA 2G8UA 1VSHA 4KV8A 3K57A 1NKCA 4M42A 3HP9A 4DQIA 5KRTA 3M8QA 4Z4FA 1REVA 3TANA 3MXJA 4JRQA 3OYCA 3EY1A 1TL3A 3V9WA 3DRPA 4CF9A 3DLHA 1NOYA 2HNYA 4J2EA 3CQ8A 2FBTA 3ZSZA 3OYIA 3KK2A 4BWJA 3OYGA 2HVHA 1RBUA 1BIZA 3V4IA 3VQAA 4HVJA 1EXQA 2IGIA 3FFIA 2YHBA 3QETA 1EKEA 1MU2A 3EZ5A 1NK9A 4CF0A 4CJWA 3ZSYA 3AVGA 4FLTA 1IKVA 2ZD1A 3LP0A 1WNSA 1WAFA 2WONA 4AHVA 3U3YA 1RTDA 1QSSA 2HW3A 1XC9A 1BI4B 2IDOA 3SCXA 4NYFA 1TAQA 3CFPA 2X6NA 1Q8IA 3KLGA 2HHVA 1ZBFA 1ZBLA 1JXEA 1T03A 4RW9A 2PZSA 1U48A 4Z4EA 3PX6A 1GOCA 5KGXA 4CF1A 4CJFA 3QNOA 2HHTA 1UAXA 3C6TA 2Z1JA 3ZSXA 3QEWA 4E7KA 3V6DA 1HRHA 3SUOA 1D9DA 3SI6A 2G8KA 1NK8A 3I8DA 1R0AA 1T8EA 1YT3A 3DLBA 2IOCA 1RBVA 4DFMA 3SNNA 4C8LA 3RMDA 4H8KA 4KHYA 3IRXA 1JLAA 1I39A 2EX3A 5KI6A 3AVFA 4KHUA 1Z26A 3QO9A 3U3GA 3ZT2A 2P1JA 3L3VA 1A5VA 1XHZA 3RR8A 4DSEA 3O4QA 4OGCA 4GW6A 1UA0A 4F4KA 5CZ1A 1XWLA 3QNNA 1VSIA 1BL3A 3KJVA 4M45A 4DSJA 1KVCA 4KHWA 1QS4A 4O55A 4W5RA 5CY4A 1L3VA 4FM0A 1IKWA 4CHNA 2OZMA 4EZ9A 4FJJA 2DFFA 5HRNA 4JRPA 4CGHA 4AH9A 4Z4HA 1C0UA 1TKDA 1D9FA 2O4IA 1KLNA 4OPJA 1RTHA 1ITGA 3HM9A 1Z25A 4CK3A 5HP1A 1RT1A 5DMRA 4DTRA 1U45A 3VQ8A 3OYJA 3AO4A 4DTSA 1JLEA 4FK2A 2BGGA 2OPPA 4FM2A 1HQEA 3V9SA 2A1RA 2QKBA 4CJ3A 2PYLA 3P83D 3OYEA 3L2WA 3QEXA 1T05A 2D5RA 2KFZA 1IG9A 4CCHA 2HHQA 4DSIA 4WE1A 3OJSA 2YV0X 1O1WA 4FJHA 3DMJA 3WNEA 1EX4A 1CZBA 3PV8A 4FJ7A 1QQCA 2Z1HA 1L3SA 4CJSA 1IKYA 3PO4A 4K8XA 3VQEA 1T7PA 3V9UA 1RT2A 1RCHA 4MFBA 1ZBUA 4FVMA 3WNGA 4IDKA 4QAGA 4CJPA 1KTQA 5K14A 3VQCA 4EP4A 2XY5A 1LV5A 2ETJA 3G0ZA 3RMCA 1XI1A 1NK7A 1LWCA 3VQPA 3SYZA 2KQ2A 2BANA 4FJLA 1RTIA 2BE2A 2G8HA 1UWBA 4E19A 4DFPA 3AA2A 1C1CA 3DI6A 3DLRA 2NUBA 3IS9A 4DQPA 1RDCA 3T1AA 4CEZA 4E7IA 3LAMA 4GMJB 4C8NA 4JS4A 4BDZA 1LWEA 3AVLA 3NGYA 1HNIA 4DLEA 1QSLA 1B9FA 1RBRA 3ZT3A 2G8VA 1TKZA 1JLCA 3LP2A 3PX4A 4KI4A 3NGIA 4F2RA 3OYMA 4HCCA 3C6UA 1TGOA 2E6LA 3LZIA 4RW7A 4DU3A 3QEVA 3NE6A 3V81A 3KIOA 5HRRA 3NAEA 2OA8A 4O44A 4KHQA 1JKHA 4HHTA 3U6FA 3MXMA 3K2PA 4AHTA 1X9WA 4FJKA 3KLHA 2Z1GA 4E0DA 3VQ9A 1HNVA 3TAFA 2QKKA 4DSFA 4OJRA 4I7FA 4OKJA 1S6QA 3L8BA 3DYAA 4ELVA 1ZBHA 4W5NA 2F8TA 2IC3A 3VQ7A 1WN7A 3MXIA 4AILC 3OVNA 5E41A 1N5YA 1BHLA 4CIFA 4M3XA 2EHGA 3K5OA 3SQ1A 4OLBA 2QK9A 3NDKA 4ID5A 4XIUA 4MQ3A 3AVCA 4CEBA 4BE1A 4M3TA 4BDYA 2AJQA 3LP3A 3PX0A 4Y1CA 1FKOA 3HP6A 4DTMA 3AA5X 1L5UA 4KHSA 3CFRA 2FBVA 3DLKA 2GUIA 1WSIA 3SUPA 3QINA 2D0CA 4HUFA 3OY9A 1YTAA 4CHOA 4CIEA 4CHYA 3LWLA 4W5QA 4DS4A 4Z4IA 1EETA 4CHZA 4PY5A 4I2PA 3NHGA 5J2QA 3I0RA 4OPKA 4CEAA 3AO2A 2VG6A 4FJ8A 3VQ4A 2GV9A 1RT6A 4FK0A 1GOAA 4FW1A 4E7JA 5HBMA 4KTZA 1KVBA 4M3RA 1BI4A 1X9MA 2YNIA 4NCAA 2HHWA 1W9HA 4JS5A 3ZT1A 4PWDA 3LZJA 4I2QA 4RW4A 4QCLA 3O4NA 1IH7A 4B9SA 3TAEA 3OYHA 1EP4A 3LPUA 1VRTA 3OYBA 4I9LA 4CJTA 4DTUA 1VSLA 3JYTA 3VA3A 3M8RA 1DLOA 4IFVA 3MEDA 2RF2A 3L2QA 1NK5A 1L3UA 4F3TA 2BDPA 3RWUA 1WSEA 3NF9A 4CK2A 3KK1A 5FRNA 3HPOA 1JL2A 4W5OA 2HNZA 2ZQBA 1A5WA 3AO3A 3CM5A 1TK5A 2F8SA 4NYNA 1S1VA 3VQ5A 4CEEA 3TAQA 3ZSVA 1HYZA 1SL2A 3PO5A 4Z4CA 3SQ0A 3VN5A 1TK0A 3ZCMA 2F96A 4B8AB 1FXXA 1JL1A 1KVAA 1LAWA 1RBTA 2RN2A 4KHNA 4DTNA 2WOMA 1SUQA 2FBYA 4CGJA 3RMAA 1SKSA 1YTUA 1HYVA 4CF8A 1UA1A 1VK0A 4CJ4A 5CYMA 4CJUA 1NKBA 3JSMA 1RT4A 4O0JA 3VQDA 3NH0A 3SUQA 1RT3A 4B9LA 5DK5A 3AO5A 4DG1A 3K5LA 3SQ2A 4FZZA 2LSNA 3KKSA 4CJ5A 1JLFA 5I42A 3TI0A 1VSKA 3NF8A 3AVNA 2E4LA 3ZSWA 3ZT4A 3OS1A 3VQQA 4CK1A 4FLUA 5J1EA 5KTQA 4DQRA 5J2MA 4ZTJA 2R7YA 4DWIA 2O4GA 1CXUA 3P1GA 3KD5E 1S1XA 1SL1A 2YNGA 2ZE2A 3S9HA 1LW0A 3LALA 4CE9A 3AVMA 1S6PA 4NCBA 4PA1A 3DLGA 4CFCA 3IAYA 4M3WA 3MECA 4CJVA 2OYQA 1K6YA 4LSLA 4FYDA 3P5JA 3K59A 4YFUA 1HMVA 2XHBA 4OKEA 2XO7A 3THVA 4FJ5A 3QERA 1NJWA 2XY7A 3AVIA 1B92A 1J54A 4I9QA 3TAMA 3ZT0A 3KLIA 2KZMA 1RDDA 2XY8A 2RKIA 4CESA 2W42A 4DQSA 3SQ4A 4F8RA 4FJ9A 1QE1A 3NH1A 2D0BA 5SZTA 4DSLA 1ASVA 4OVLA 4DSKA 2QXFA 2Y1JA 4J2AA 1WSGA 3L2UA 4B9TA 1U47A 4KREA 3AO1A 2RPIA 4CFDA 3IG1A 1GOBA 1RDAA 3LP1A 2OPRA 4TSXA 3QESA 4CEQA 3SUNA 1WLJA 3G10A 4CJLA 1HJRA 5JS2A 3SPYA 5I3UA 1SKWA 4C8OA 3D45A 5EU7A 4DFJA 4ELTA 1N6QA 3L3UA 1NOZA 4DU4A 3KLFA 3M8PA 4CHQA 3OYKA 1LWFA 3HJFA 3ULDA 1VSEA 1RDBA 2X6SA 3CYMA 3OYNA 4KPYA 3F73A 3SZ2A 2VG5A 5J2PA 2G8FA 3KTQA 1RTJA 3HSTB 4RW6A 2HNDA 2IS3A 4H4OA 3TABA 4BE0A 2VG7A 2ITGA 4CFBA 4CFAA 1Q9XA 4FJMA 3ISNC 4J2BA 2DTUA 4E7LA 4FJGA 3VQBA 3WNHA 4HTUA 3ITHA 4DF4A 3HVRA
chains in the Genus database with same CATH superfamily
1D8YA 4DCHA 2D4WA 4B9UA 3RRHA 3MMVA 3C0BA 4CJKA 3LAKA 3QIPA 3MN7A 4DV0K 3QFPA 4CEDA 4X62K 1HQUA 3S3MA 1N34K 2HHUA 4CGDA 3UE5A 4JKHA 4CHPA 5SWMA 4B08A 3VETA 4KO0A 4E1MA 1LAVA 1Z05A 4H5RA 3ID8A 1TV6A 3HYFA 3HOTA 4W5TA 5KRSA 4O5FA 1VQPN 5JS1A 3OBWA 3G71N 4WFNL 1FKPA 4BR2A 4DTPA 1DTTA 2E6MA 2E8AA 3TSUA 3NGZA 4CGFA 4N56A 4CJQA 1NLVA 4CF2A 2VGMA 4F3OA 4RW8A 5HRSA 3CPEA 4DS5A 4RG8A 1Q9YA 4BRCA 3VMFB 3L2VA 1XHXA 4CJEA 3QBWA 1KAZA 4BGAA 4ELUA 2YHWA 3EEQA 3GE1A 2O8DB 2E5LK 4B1UB 4KH5A 3TWHA 3QLHA 3CC7N 4FLVA 4KTQA 3AVAA 4UQGA 4J2DA 2UUCK 3KD1E 3ZYYX 1ZBIA 5AZIA 4Q5VA 5FDLA 1RBSA 1J6ZA 3VESA 1KFDA 1S9EA 4M3ZA 3I0SA 2KZZA 3RTVA 2KFNA 3OYAA 5JMVA 4N5SA 3NBPA 2HHXA 2A6AA 2Z1IA 4PL8A 4DTOA 1IKXA 4KB1A 1C0MA 4R79A 1ATRA 1TKTA 1VQ7N 4A2BA 1RILA 4JI8K 4FJIA 1FJGK 4LSNA 1JCGA 4IZ9A 4AF1A 3WEEB 3U4LA 3LWMA 5B8HA 4BG8A 1M90O 3OYLA 5D3GA 2KTQA 1S72N 5M1PA 3DXMA 1ASUA 3K58A 1QHAA 1N32K 3VF2A 4GV6A 4ZHRA 5T7BA 1HKGA 2RHKA 3C95A 1CZAN 4BDPA 3NVMA 5AQSA 1HYSA 4KFBA 4F9OA 2P9KB 3N4PA 3VEXA 3OJUA 4K42A 1C0FA 2FBXA 4OGEA 2BTFA 4JEPA 1QVFM 4CZIA 2QXLA 1HX1A 5JLFA 2G8WA 5GAHP 4LH5A 1BCOA 3ALYA 2FC0A 3L2RA 2NRWA 1IO2A 3MN6A 2VWKA 3ATUA 4HUGA 1U49A 1N8RO 4ICLA 1JLQA 3AV9A 4FWRA 1NKEA 4B1XB 1DEJA 4WF9L 4DTXA 4K25A 1A5XA 3RR7A 2X74A 3SK3A 4IG0A 5KGWA 3CC2N 4JLHA 5LJWA 5J2NA 1WAJA 1C0TA 5C42A 3UKRA 3IKMA 1U04A 3AGRA 2JWKA 4M7XA 5KRTA 3M8QA 4Z4FA 2Q97A 1REVA 4BRLA 3MXJA 3DRPA 4BRIA 4CBWA 4CW7B 1C0GA 4EAHD 3FFIA 3THXB 1NK9A 4RWTA 4H0TB 1FW6A 1NNEA 1RTDA 2QW9A 3EE8A 3U3YA 3W0LA 2HHVA 1T03A 1GOCA 1BA0A 2HHTA 1UAXA 3C6TA 3ZSXA 3V6DA 2G8KA 4E7KA 2F7TA 1HR0K 3WXLA 3DLBA 4B1VA 3SNNA 4C8LA 4CD1A 3IRXA 2QWLA 2EX3A 3AVFA 2CH6A 3A5OC 1W2BM 3C6HA 1XHZA 4DSEA 1XUPO 2O8CB 4IEEA 1UA0A 5CZ1A 4BR4A 4KBOA 3KJVA 5CY4A 1T44A 3CERA 4HTLA 2OZMA 4DQ8A 4JRPA 4CGHA 4JD2B 1C0UA 2O4IA 3CETA 3DJCA 4XH1A 5HP1A 1RT1A 1U45A 3A0IX 1JLEA 3GBTA 3J80O 4BR9A 1T05A 2D5RA 4BREA 4CCHA 4FWOA 1YJ9N 1EX4A 1CZBA 4MO5A 2CGJA 1QQCA 1L3SA 4K8XA 2NRTA 3V9UA 4IDKA 4IOXA 4EP4A 5K14A 1ESVA 1RTIA 2NLXA 3MCAB 2G8HA 3CI5A 3AA2A 1O13A 2NUBA 3T1AA 4CEZA 5AQMA 3NVKA 2FF3B 4GMJB 4JS4A 2OTJN 5C10A 3AVLA 3NGYA 1HKCA 2IVOA 3NGIA 4F2RA 4JKGA 3C6UA 4HCCA 3LZIA 4DU3A 4ISGA 4O44A 4KHQA 4CVNE 4JHDB 3K2PA 4QS8A 1HNVA 2QKKA 4OJRA 3VEYA 2FXUA 3L8BA 1ZBHA 4W5NA 1U2VB 2IC3A 3LDLA 1XNQK 4B1WB 5E41A 3SQ1A 3CCMN 3HM8A 3AVCA 4M3TA 4BDYA 2GELA 3CJCA 2CGKA 4DTMA 3AA5X 3R9PA 5C15A 4KHSA 3J7ZO 2D0CA 4CHYA 3VGMA 5BRHA 3CD6N 1EETA 4CZLA 4I2PA 4EFHA 2VG6A 4FK0A 3AY9A 1QZ6A 4FW1A 1BG3A 5ADXA 4M3RA 3ENBA 2YNIA 4JS5A 1ATNA 1K8KB 1OH7A 5H1SQ 3O4NA 4B9SA 1EP4A 3EE9A 4H5NA 5IT9O 4CZJA 3JYTA 3VA3A 3MEDA 4IO8A 1NK5A 2BDPA 4CK2A 1JL2A 1TK5A 1A5WA 4I6MA 3EL2A 4NYNA 1S1VA 4NB4A 5M1QA 3VQ5A 2A41A 2GWKA 4Z4CA 3ZLJA 3ZCMA 4YOUA 4WQ5C 5M1KA 2F96A 3VEVA 1JL1A 1FXXA 1RBTA 4DTNA 1EWQA 4KH4A 1SUQA 4CGJA 4JI3K 3RMAA 4GV9A 4K0KK 2KKZA 1VK0A 2DPNA 1NKBA 3C7NB 3JSMA 3VQDA 3SUQA 3BZKA 2QTDA 1NJIO 3T7ZA 3WXKA 5I9EB 2LSNA 2UXDK 1S22A 3TI0A 1VSKA 3AVNA 5J2MA 4BY9C 4DQRA 1HLUA 5LMUK 3OTOK 4M3WA 4CFCA 1XNRK 3MECA 4LSLA 5FPEA 3P5JA 1QVGM 1U2VA 5LL6Z 3IUCA 3QERA 3SBGA 5AZIB 1NG9A 2RKIA 3CXCM 4F8RA 1W97L 3Q7BA 4BG9A 2W41A 2HBJA 3P4IA 4DSKA 2QXFA 3L2UA 3EKUA 3O9RA 1U47A 1IBKK 1N36K 4KREA 1DKGD 3G6EN 1GOBA 3LP1A 3C6AA 1SKWA 3G10A 3CJ7A 1YAGA 4BR5A 2P9UA 3Q7CA 5AR0A 3L4IA 3SZ2A 1ZXOA 3DXMB 4DV5K 4BE0A 2VG7A 3SJHA 1BO5O 1Q9XA 3CMAN 4FJMA 1RDUA 2A40A 3HVRA 3LPTA 5FPMA 3DOKA 3V1RA 2P9KA 2IIRA 5AQNA 5HROA 3DRRA 4CERA 3AVBA 2NRVA 1C1AA 1SS6A 4DV1K 5E26A 4DU1A 3QEPA 1NU0A 4YOXA 3AARA 1VQ6N 1I3AA 4B9NA 3RRGA 3K5NA 4ISFA 1QHTA 3BZCA 2YNHA 4B8CA 4OPHA 3A2FA 1NK6A 4LF8K 5EVZA 3E01A 1X3MA 4E3SA 4ID1A 4BRHA 1TAUA 1TL1A 3MEGA 4N41A 5AQWA 4YOTA 1VQON 4FW2A 3CFOA 5BPMA 1K8AO 3SAFA 4KH6A 3S41A 4JKAA 4I6MB 3F9MA 2FF6A 1XMOK 4BWMA 1YVUA 4FJXA 2D0AA 2QEXN 3VA0A 1GLJO 5JVHL 3ENHA 2P9SA 4AHRA 1L3TA 3O5BA 3W3DA 2HHHK 4CZKA 4AHUA 3HBTA 4FZXC 3HO1A 2DY4A 1W7AA 2VWBA 1YITN 2HHSA 2JWLA 3ZSQA 5HLFA 4FK4A 1TYQB 2WTUA 3HPGA 2Q3SA 3ZX2A 5FROA 4N47A 4IBNA 2HMIA 2QWOA 1YJNN 2HOEA 1C6VA 3SPZA 3TTDA 5AQPA 1RNHA 2GBZA 3CMEN 5AQYA 3KLEA 2HBLA 4PQUA 3HVTA 4EZ6A 2OANA 1EQYA 3KK3A 3D0PA 5LMNK 2Q2RA 3C94A 4IFEA 4A59A 1VSMA 4R5PA 1NK0A 4DFKA 2QWPA 4FLYA 3VF6A 3M8SA 4CGIA 4O4GA 1NK4A 1BQMA 4DQQA 1S1UA 4ZTFA 1TK8A 3VQ6A 3A5LC 3V1QA 4E89A 4BRDA 2JLEA 2ZJPL 4IJNA 3B6PA 5CHIA 3TR8A 3EYZA 2I7NA 3H3OB 2KW4A 5EX5A 4LC9B 2OPSA 3OBYA 3LM2A 3IFRA 2PYJA 3MN9A 3DRSA 1KCFA 4F2SA 3O9TA 2P5OA 1VQ9N 3M3ZA 3NCIA 1CZ9A 3EKSA 3WEEA 1IBLK 4A5BA 3TSPA 4BRFA 4BVOA 1G99A 4RTFD 4IDHA 2QWMA 4BRQA 3D6RA 4KV8A 1NKCA 3HP9A 4PKIA 3TANA 3V9WA 1VQNN 3OYCA 3EY1A 3DLHA 1NOYA 2HNYA 4AM6A 3VPZA 3ZSZA 1VQMN 3KK2A 2YJEA 4BWJA 4DR4K 1HNXK 3QMLA 3HM9A 1MU2A 3EZ5A 4C1NK 4FWPA 4FLTA 1IKVA 2ZD1A 4AHVA 1WNSA 4BC2A 1QSSA 2HW3A 2O8BB 1XC9A 4BRAA 4NYFA 1NGEA 1TAQA 3CFPA 1ZBLA 4JK8A 3QNOA 3EO3A 4KHPK 1D9DA 4DQPA 1NK8A 3I8DA 4B9QA 1YT3A 3CCUN 5AQOA 1RBVA 3RMDA 4KHYA 1I39A 1HUXA 1EWRA 4KHUA 5JICA 1A5VA 2GX9A 3DXKA 4K43A 1E4GT 4GW6A 1VQ4N 4F4KA 4KHWA 1VSIA 1QS4A 5AQTA 4DV4K 5FLXO 5EXWA 4LF9K 1IKWA 4CHNA 4EZ9A 4Z4HA 1TKDA 4CK3A 4IWVA 4JN4A 4XEIA 3ULEA 4JYAK 4FK2A 2GWJA 3CCSN 3O9UA 3QEXA 1IG9A 2HHQA 4DSIA 3CPWM 1NGGA 2W6KA 2VGNA 3WNGA 4MLHA 3VOVA 4WQ4C 2XY5A 3UKUA 3MK6A 2ETJA 1VQLN 5C12A 3FZHA 4M7YA 3SYZA 2KQ2A 2BANA 2BE2A 1UWBA 5AQZA 4E19A 4DFPA 3DI6A 4LFBK 4CI6A 1RDCA 4E7IA 4DLEA 1RBRA 3EN9A 2WC9A 3QBXA 3E66A 2O8BA 3E9OA 4JKEA 5HRRA 3NAEA 3O1BA 4HHTA 1NGIA 5AQVA 4M63C 2J4RA 4FJKA 1S3XA 1RGIA 4DSFA 4H5WA 3DYAA 2UUAK 2F8TA 1WN7A 4AILC 1N5YA 1BHLA 5BR9A 4EHUA 2EHGA 3K5OA 4OLBA 4ILHA 4MQ3A 4BE1A 3KZBA 4Y1CA 5BRDA 3HP6A 3JXUA 3CFRA 3DLKA 3SUPA 3QINA 3IMXA 4CHOA 3LWLA 3MWPA 4W5QA 1NM1A 4PY5A 3NHGA 2QWNA 4Z94A 4FJ8A 3VQ4A 5GADP 5AFUA 4E7JA 2PFUA 1X9MA 3SLCA 1W9HA 4JKGB 2BH1A 4QCLA 1IH7A 3L0QA 2UXBK 4JKDA 1VRTA 3E1YA 4I9LA 3PLAA 1VSLA 2NRRA 1VQ8N 4IFVA 1TYQA 3KK1A 3HPOA 4W5OA 3CM5A 3AO3A 2YHYA 3OHRA 3R6MA 4YY3K 4CEEA 1SL2A 2RE2A 3JS6A 5AZJB 4B8AB 5M1NA 1Q86O 1MDUB 1YI2N 4BRPA 1NGFA 2UUBK 1YTUA 1HYVA 4CJ4A 2NNWA 5CYMA 4CJUA 3THWB 3KWIA 1RT3A 4BR0A 3AO5A 4O8KA 4FZZA 1RDWX 1QQMA 4H5VA 5AQKA 3ZSWA 3OS1A 2WUSA 5J1EA 4ZTJA 1K8KA 2O4GA 4FWMA 3KD5E 1P8ZA 1S1XA 2P9LA 5E84A 4M42A 3S9HA 3LALA 3UKRB 4CE9A 1S6PA 5LY3A 3IAYA 4FYDA 1K6YA 3LDQA 1WUAA 4CBUA 4QS7A 4YFUA 3THVA 2Q0RA 4FJ5A 1NMDA 4JKFA 3PSIA 3KLIA 1KXPA 1RDDA 2UXCK 2W42A 4FO0A 4FJ9A 5AQJA 3NH1A 3A5NC 3THXA 4DR6K 3J7AP 1NGHA 1EO1A 1T6DA 3AO1A 4CFDA 3TTFA 4DKWA 4CJ7A 3F5TA 3H45C 4GY2B 3VGKA 3O9SA 4CEQA 3K9JA 4CJLA 2HSTA 5I3UA 4IOAL 4C8OA 3D45A 4DFJA 4ELTA 4OPAA 1Z6RA 3L3UA 4DU4A 2E2NA 3KLFA 2E2PA 1VSEA 3FZFA 2HF4A 2X6SA 1Y64A 4H0VB 4O8UA 5J2PA 2P9IA 1RTJA 3O1WA 2HNDA 4DR7K 4CFBA 4CFAA 2W6LA 1U6ZA 3M5RA 3ISNC 2DTUA 4E7LA 3VQBA 3WNHA 2ZF5O 3H3NO 3ITHA 2A42A 1RT5A 4IG3A 4DV6K 1QQNA 1J5OA 1DT9A 3ATVA 3HZ6A 5EOYA 4B1ZA 4DR2K 3HSCA 4KRFA 5GAGP 1ZYQA 3MX5A 4UY8O 4X64K 4G1QA 1RT7A 3SJJA 4BRMA 4HWIA 3K0SA 1H1VA 4E7HA 1OKJA 5HOOA 2B5JA 4C8KA 3U8XA 4JI6K 3NH2A 4IO9L 4BGBA 1MWKA 2E1YA 4MDAA 3I55N 4IKFA 3J8AA 2XY6A 3B8AX 4NCGA 3V9ZA 1VQKN 4AHCA 5BREA 3AVKA 2Y1IA 4KKOA 3CM6A 3LANA 4AHSA 3DOLA 2PAVA 4ISEA 4L8RB 4HCBA 2P9PB 5C0YA 2IVNA 1WSJA 3DLEA 3FZLA 5BN8A 4FLXA 1JXBA 4B9MA 4B1YB 4FZYA 2YNFA 5M1OA 3VF4A 1OVYA 3F2KA 1VSJA 2ZGZA 4KB0A 5C2DA 1U4BA 3PSFA 4B3OA 4CZMA 1SL0A 5GIPA 3KVGA 3ULEB 1IBMK 1FK9A 4DTJA 3VERA 4WFBL 2OZSA 3FR0A 1IJJA 1TKXA 3OS2A 3VEOA 5KPTA 4EP5A 2YKMA 4GVMA 5C24A 3SV3A 4FJNA 1WSFA 4H5TA 3QEIA 3NFAA 3AA3A 1LW2A 1KRPA 1F21A 4N76A 3LDSA 3UKUB 1G15A 1BQNA 4FWQA 3FFKB 4FCYA 3SV4A 1T3VA 2E88A 5AQRA 3ASMA 3ID6A 1SQKA 2VWJA 1VRUA 2ZGYA 4OKKA 4DF8A 5KPRA 2HBKA 2QA4N 1D5AA 4B9VA 3WXIA 2FSJA 4PUOA 1GLDG 3LM9A 1CXQA 3MEEA 1LOTB 1NGDA 4FM1A 3ZSOA 2PY5A 4K8ZA 1ZBSA 3T19A 3T1HK 3MDQA 5AQFA 4JI7K 3MN5A 5FPDA 3A5MC 3HT3A 4JAXA 1X9SA 1UOCA 2HVIA 2HB5A 3HXMA 4CEFA 4YDUA 4DHYA 2GTDA 1J53A 1JCEA 2CGLA 2B4JA 3K5MA 4JHDA 3SAHA 1S9GA 4IFYA 3O3HA 3QICA 1JLBA 5AQQA 4B3MK 1GLEG 1YVNA 2OTLN 1NWKA 1NJXA 3HI0A 4H4MA 4BE2A 5CZ2A 4NXNK 4H0OA 3DLLL 1WSHA 4FXDA 1NGAA 5A2QO 3RSEA 2IAJA 4C8MA 5DM7L 4Z0UA 1BIUA 4H0YB 1X3NA 4BACA 4H03B 4EHTA 1VSFA 1RFQA 5C25A 3OS0A 2G8IA 4OO1J 2ATQA 2FSNA 4O0IA 2WBNA 1QTMA 1KFSA 3HK2A 3IDHA 3AA4A 2YI1A 3BDPA 1KLMA 2E20A 3KKRA 4JKCA 3TTCA 4Y1DA 3VTHA 4CJRA 1KC8O 1QSYA 4B3RK 2V7YA 2QI2A 4EIAA 5ADXH 3CJ9A 1YXQA 1VSDA 2YHAA 2FSKA 3CG7A 4WQ4A 4M3UA 1J9AA 5AZJA 3T69A 1XC3A 4YOWA 3D2FB 2G8UA 1VSHA 3L4QA 3K57A 1N33K 3O8MA 2KLAA 1TL3A 4CF9A 4H0XB 3CQ8A 3OYIA 1JJ2M 5AJ3K 1YF5L 4JKBA 1NGJA 3VQAA 4U67L 4HVJA 2IGIA 4WCEL 4CF0A 3ZSYA 3AVGA 3BP8A 2AP1A 4OX9K 1WAFA 2WONA 3C7NA 1WB9A 1Q82O 1Q8IA 3KLGA 2P9LB 1JXEA 2PZSA 4RW9A 1U48A 4Z4EA 3PX6A 2Q0UA 5KGXA 4CF1A 3UB5A 3FZMA 4DQIA 5ELZA 3SI6A 1R0AA 2IOCA 4DFMA 1KAXA 4H8KA 1ZC6A 3CCLN 2FLOA 5KI6A 1Z26A 3QO9A 3U3GA 3ZT2A 2P1JA 3L3VA 3R8EA 1BWFO 3RR8A 3O4QA 4FSVA 3TSQA 4Y0WA 4DR1K 4JD2A 4O55A 4GVEA 4W5RA 1VQ5N 2O8CA 4AQYK 4QS9A 4FJJA 2DFFA 5HRNA 1ATSA 3ZEUB 1D9FA 1KLNA 4OPJA 2D0OA 4NXMK 5DMRA 4DTRA 3G25A 3VQ8A 3OYJA 3GL1A 3AO4A 3CJAA 4DTSA 2BGGA 3HOSA 1HQEA 3V9SA 2A1RA 2QKBA 2P9UB 3FE1A 2PYLA 3OYEA 4X65K 4DB3A 4WE1A 3OJSA 1O1WA 3PV8A 4GKKK 5IWAK 1V4SA 4CJSA 1IKYA 3ZETA 5AQUA 1T7PA 1RT2A 3QB0A 3CF5L 4FVMA 4DUZK 4QAGA 1K9MO 1KQSM 3VQCA 1LV5A 3G0ZA 2UYTA 3RMCA 1XI1A 3ZX0A 1NK7A 5BR8K 3VQPA 4DR3K 4FJLA 2ZWHA 3DLRA 1C1CA 2VQFK 4DUYK 3LAMA 2EWSA 4BVPA 5C2FA 1B9FA 3ZT3A 3WXJA 2OCEA 2GEMA 3LP2A 3WXMB 5BPNA 2VQEK 3OYMA 1TGOA 3NE6A 3V81A 4YDUC 3KIOA 4A57A 2ASOA 1JKHA 4NLCA 3GDQA 3U6FA 3MXMA 4FWSA 4AHTA 4DV7K 2Z1GA 3VQ9A 4I7FA 4OKJA 4ELVA 2F9TA 3MXIA 1I94K 3OVNA 3DWLA 2E2OA 4M3XA 2QK9A 4XIUA 3TPQA 2QWRA 2AJQA 3LP3A 4JI5K 3PX0A 1WOQA 1FKOA 5GINA 1L5UA 2FBVA 2GUIA 2Q36A 3WUHA 3OY9A 4CIEA 4DS4A 4Z4IA 4DV3K 2O8FA 1IG8A 3I0RA 3AO2A 1RT6A 1GOAA 5GIOA 4KTZA 1KVBA 4BC4A 1GLAG 1BI4A 4PWDA 3RVCA 4RW4A 3CJ1A 3TAEA 3OYBA 2NRZA 4CJTA 3M8RA 1DLOA 2AA4A 3GOIA 2F4VK 2RF2A 1L3UA 4F3TA 3RWUA 5HL7L 1BOTO 5KPZA 5FRNA 1E3MA 2F8SA 3OA9A 3NMUA 3TAQA 4ILJA 4MDBA 3SQ0A 3O9QA 3PO5A 4PHTX 3A8YA 3HRGA 2RN2A 1KVAA 1LAWA 3OW2M 4KHNA 3AAQA 1YJWN 3SBTA 1SKSA 4GNIA 1UA1A 4WFAL 1RT4A 4O0JA 5DK5A 4DG1A 4MO4A 3K5LA 2V7ZA 3I56N 3KKSA 1JLFA 5I42A 1HNWK 4FLUA 3NF8A 4DV2K 5MLCQ 3O6WA 5KTQA 2A5XA 1P90A 2R7YA 4DWIA 1CXUA 3P1GA 4WQ5A 4NCBA 2ZE2A 1WBBA 3AVMA 4PA1A 3DLGA 4IOCL 3U9ZA 2XHBA 4K41A 5KQDA 1NJWA 3AVIA 4I9QA 3TAMA 3ZT0A 2XY8A 2YHXA 4CESA 5LJVA 1KD1O 2ZJRL 4A61A 2D0BA 4DSLA 4E1JA 1X9JA 2Y1JA 2IVPA 3CCQN 4RCHA 4B9TA 3E9LA 2RPIA 3IG1A 2O8EA 1IV0A 2OPRA 2WFBA 3QESA 1XMQK 3SUNA 3SPYA 3CCJN 1HJRA 2CH5A 4CZEA 5EU7A 3TU5A 1N6QA 1NOZA 3ZX3A 3N4QA 3LDPA 3OYKA 4A2AA 3HJFA 3ULDA 4IJAA 4LF4K 4FOIA 2KHOA 2VG5A 2G8FA 3KTQA 3HSTB 4RW6A 3TABA 4H4OA 2ITGA 4A5AA 4FJGA 4LF5K 2VYPA 3NF6A 1NGCA 4DLGA 5CYQA 3QIOA 3RSEB 1YUWA 4CECA 3S3NA 4KAZA 3V1OA 1W0HA 1VHXA 3BEXA 3O08A 3HPHA 5KQ8A 3HL8A 5TKYA 1HPZA 4O5BA 4A62A 4V19S 2E1ZA 4BRGA 4LY7A 2ITMA 2JGUA 3TARA 2H3GX 2YX6A 1DGKN 1DTQA 1GLCG 4AM7A 3WQTA 4CD3A 1S1TA 3RMBA 1B9DA 3AGKA 5TKWA 3AVJA 4CIGA 5F1XA 3CQYA 2ASPA 3SAGA 3ZEUA 3T3FA 4FWNA 1Y97A 4JI0K 3OYFA 3P38A 2Q1NA 3QFUA 1OH6A 4DMNA 3UIQA 4CEOA 4E1NA 2P9SB 4BQLA 3LDNA 4BC3A 1HKBA 3ZETB 4Q0BA 4FPAA 4QOZB 1SV5A 4YHHK 5FRMA 3F9KA 5BRFA 2E2QA 4BRNA 2DFHA 4M41A 4KTWA 1YIJN 3E9PA 2V52B 3I33A 2P9PA 2DFEA 5EY4A 1BCMA 3NF7A 4FVUA 3DM2A 2A1SA 3MX2A 1KSPA 3THYA 3PY8A 1BGXT 2NRXA 1SKRA 5AQGA 4GV3A 1NJYA 3VTIA 3FLCO 4JK7A 3VEWA 3B6OA 2V51B 3TAGA 1ASWA 3H08A 4LD0A 2NRHA 3V9XA 4B3SK 2YKNA 3ZSRA 5AQHA 4L3QA 3S3OA 1ILYA 1BDGA 4X66K 3LL3A 1S5JA 3TAPA 1X1PA 2P5GA 1BISA 5AQLA 3PUFA 1TVRA 4YOYA 3O3FA 1JLGA 4LFCK 1NJZA 3D2EB 3VENA 5CE3A 4YNQA 4FLWA 2I5JA 2B6AA 2XRIA 2YJFA 3J81O 2HMPA 1C1BA 4YORA 3FGUA 5CR4A 4OLAA 3WNFA 1OH5A 2OPQA 2X78A 3D7EO 3O3GA 2GUPA 3P39A 3KK7A 5HRPA 3WT0A 3KHYA 5JVGL 3C65A 4M3YA 4HUEA 1SZ2A 1CLQA 3AAPA 3BGRA 5M1FA 3OYDA 5AFUH 2HBMA 1E4FT 4FLZA 3AVHA 3MAQA 4JK9A 3R3LA 4KI6A 2P51A 4LH4A 1S1WA 3ENOA 4FPBA 4CGGA 3BUZB 4JRQA 4J2EA 2FBTA 2P9NB 3OYGA 1Q81O 2HVHA 1RBUA 1BIZA 3V4IA 1EXQA 1KAYA 2YHBA 3QETA 1EKEA 2O8FB 4CJWA 3U9DA 3H1QA 1GLFO 3R1XA 3HTVA 3LP0A 4FL9A 3THWA 1XQSC 1Q7YO 1BI4B 2IDOA 3SCXA 2X6NA 4G9ZA 1ZBFA 3BF3A 4JI2K 4CJFA 2P9IB 2Z1JA 3QEWA 1HRHA 3SUOA 1T8EA 4BRKA 4BR7A 4ILGB 4NO7A 3J7YP 4FWLA 4CZGA 1JLAA 4B3TK 4PKHA 2QWQA 1NBWA 1SAZA 4OGCA 3D2FA 3D2EA 2D1KA 1BA1A 3QNNA 1XWLA 1BL3A 4M45A 1K73O 1KVCA 4DSJA 1GLBG 1L3VA 4FM0A 2O8EB 3M1FA 2W40A 4FWKA 2HF3A 4AH9A 4BQZA 3BF1A 1RTHA 4PKGA 5AQXA 1ITGA 5BN9A 3M6GA 1Z25A 4FOEA 3H6EA 4H0PA 1MA9B 1R59O 2ASMA 3JAMO 3THYB 2OPPA 4FM2A 4CJ3A 3P83D 3L2WA 2KFZA 2VCPA 2O8DA 2F9WA 2YV0X 4FJHA 3DMJA 3WNEA 4PL7A 4FJ7A 3BY5A 2Z1HA 3O4WA 3PO4A 1GLLO 4JI4K 3VQEA 2UU9K 1RCHA 4MFBA 1ZBUA 3O80A 4CJPA 1KTQA 2PBDA 3CQXA 3KWGA 3SMSA 2ZM6K 5AQIA 5FPNA 1LWCA 3CHWA 1J5EK 3K9KA 3IS9A 4JV5K 4C8NA 4BDZA 2NZTA 1LWEA 4BC5A 1HNIA 3PIOL 3CCVN 2G8VA 1TKZA 1JLCA 3FZKA 3PX4A 1OVQA 4KI4A 3CCEN 4C1NI 2E6LA 4RW7A 3QEVA 1LCUA 3T1YK 2OA8A 1QZ5A 4LF6K 1X9WA 1T6CA 3KLHA 3QDKA 4E0DA 3TAFA 1S6QA 3VGLA 4XH4A 3VQ7A 5F0XA 1VAZA 3L6QA 4CIFA 1QQOA 4WYBA 3NDKA 4ID5A 4CEBA 5F2RA 1WSIA 4J8FA 4HUFA 1YTAA 3P31A 4CHZA 5J2QA 1TUUA 1D4XA 4CEAA 4OPKA 2GV9A 4LF7K 3CC4N 5HBMA 4IXCA 2QM1A 4NCAA 2HHWA 3ZT1A 3LZJA 4NLBA 1WBDA 4I2QA 2A3ZA 3H46O 2Q31A 3OYHA 3LPUA 4XH5A 4JI1K 4DTUA 4IEIA 2BUPA 3I8BA 3SMPA 3L2QA 1JCFA 1BUPA 1WSEA 3NF9A 2HNZA 2ZQBA 2ZJQL 2D0PA 1HYZA 3ZSVA 1TK0A 3VN5A 4C23A 4CZHA 4U7BA 5DM6L 4BROA 1MWMA 4CBXA 2WOMA 2FBYA 1NGBA 1TUYA 4CF8A 5BPLA 4MLEA 4Z4GA 4YOVA 4B9LA 3NH0A 1HNZK 3MWTA 4CZFA 3SQ2A 4LFAK 4CJ5A 1YHQN 2E4LA 1QSLA 3ZT4A 3H1VX 3VQQA 4CK1A 3DAWA 4DR5K 1SL1A 2YCHA 2YNGA 1LW0A 3CJBA 4CJVA 2OYQA 3K59A 1HMVA 3CIPA 4OKEA 2XO7A 3G4SN 3DXKB 2XY7A 1B92A 1J54A 2KZMA 4DQSA 3SQ4A 3CCRN 1NMNA 1HJOA 1QE1A 1OH8A 3LDOA 5SZTA 1ASVA 4OVLA 3GG4A 4J2AA 1WSGA 1V4TA 1RDAA 1HPMA 4TSXA 1Q18A 1WLJA 1BU6O 5JS2A 5JLHA 3M8PA 4CHQA 1LWFA 1RDBA 3MCPA 3CYMA 4GKJK 3OYNA 4KPYA 3F73A 2IS3A 3EZWA 4JNEA 2I7PA 1M1KO 3VEZA 4J2BA 3PIPL 2P9NA 4HTUA 3WQUA 5GAEP 4DF4A
chains in the Genus database with same CATH topology
3LPTA 1RT5A 3NF6A 3DOKA 4IG3A 1J5OA 1D8YA 4DLGA 5CYQA 3V1RA 3QIOA 3RRHA 4B9UA 4KRFA 5HROA 4CECA 3S3NA 4CJKA 3DRRA 4CERA 4Z4GA 3LAKA 1ZYQA 4KAZA 4G1QA 3V1OA 1RT7A 3AVBA 3SJJA 1C1AA 1W0HA 3QIPA 4E7HA 2B5JA 4C8KA 3HPHA 4DU1A 3QEPA 3HL8A 3NH2A 1HPZA 4CEDA 4O5BA 1HQUA 3S3MA 4LY7A 2HHUA 1I3AA 4CGDA 2JGUA 2XY6A 4B9NA 3TARA 3RRGA 4IKFA 4CHPA 4NCGA 5SWMA 3K5NA 4B08A 4AHCA 3V9ZA 3AVKA 4KO0A 4E1MA 2Y1IA 1QHTA 4KKOA 3CM6A 1DTQA 3LANA 1LAVA 4AHSA 1TV6A 2YNHA 3HYFA 1S1TA 4B8CA 3RMBA 1B9DA 4W5TA 3A2FA 1NK6A 3DOLA 5KRSA 3E01A 4L8RB 4E3SA 5JS1A 4HCBA 4ID1A 1TAUA 3AVJA 1WSJA 3DLEA 1FKPA 4CIGA 4DTPA 1DTTA 1TL1A 2E6MA 3MEGA 4N41A 4FLXA 1JXBA 4B9MA 3NGZA 4FZYA 4FW2A 3CFOA 4CGFA 4N56A 2YNFA 3T3FA 1VSJA 4KB0A 1Y97A 4CJQA 4CF2A 1U4BA 4B3OA 4F3OA 4RW8A 5HRSA 3OYFA 1SL0A 4DS5A 4RG8A 4BWMA 1Q9YA 1YVUA 4DMNA 4FJXA 1FK9A 4DTJA 2D0AA 3UIQA 2OZSA 3VA0A 4CEOA 1XHXA 3L2VA 4E1NA 4CJEA 1TKXA 3OS2A 4ELUA 4EP5A 2YKMA 4GVMA 5C24A 3SV3A 4FJNA 1WSFA 3QEIA 1L3TA 4AHRA 3NFAA 3AA3A 1LW2A 3TWHA 1KRPA 1F21A 3QLHA 4Q0BA 4FLVA 4N76A 4KTQA 3LDSA 4QOZB 4AHUA 1SV5A 2DY4A 3AVAA 4FZXC 1G15A 3HO1A 1BQNA 5FRMA 3F9KA 4UQGA 4J2DA 4FCYA 3SV4A 3KD1E 2HHSA 2DFHA 1ZBIA 3ASMA 3ZSQA 5HLFA 4FK4A 4Q5VA 4M41A 4KTWA 5FDLA 1RBSA 3HPGA 2VWJA 1VRUA 2Q3SA 5FROA 1KFDA 1S9EA 4IBNA 4OKKA 4N47A 4DF8A 2HMIA 2DFEA 4M3ZA 3I0SA 2KZZA 1BCMA 3RTVA 3NF7A 1D5AA 3OYAA 2KFNA 4N5SA 4B9VA 3NBPA 1C6VA 2HHXA 4PUOA 3SPZA 3DM2A 2A1SA 2Z1IA 1CXQA 4DTOA 1IKXA 3MEEA 4KB1A 1C0MA 1KSPA 3PY8A 1BGXT 4FM1A 1RNHA 3ZSOA 1TKTA 2GBZA 1SKRA 3KLEA 2PY5A 4K8ZA 1RILA 1NJYA 4FJIA 4PQUA 3T19A 3HVTA 3B6OA 4EZ6A 3TAGA 1ASWA 3H08A 4LD0A 3V9XA 4LSNA 2YKNA 3ZSRA 3KK3A 3HT3A 1X9SA 3S3OA 1UOCA 3D0PA 2HVIA 2HB5A 3LWMA 3HXMA 3C94A 4CEFA 1VSMA 1S5JA 4R5PA 1X1PA 4DFKA 3TAPA 1NK0A 4FLYA 3OYLA 3M8SA 2P5GA 1J53A 4CGIA 5D3GA 1BISA 2B4JA 3K5MA 2KTQA 1S9GA 3PUFA 4O4GA 1NK4A 1ASUA 1TVRA 1BQMA 4IFYA 3O3HA 1JLBA 3O3FA 3K58A 1JLGA 4DQQA 1S1UA 4ZTFA 1TK8A 3VQ6A 1NJZA 1NJXA 4ZHRA 4H4MA 4BE2A 3V1QA 5T7BA 4E89A 4BDPA 5CZ2A 3C95A 2JLEA 1HYSA 1WSHA 3B6PA 4KFBA 4YNQA 4FXDA 3OJUA 2IAJA 4FLWA 4C8MA 3TR8A 4Z0UA 3EYZA 2I5JA 2B6AA 2XRIA 2KW4A 1BIUA 1C1BA 2FBXA 2OPSA 4OGEA 4BACA 4OLAA 3WNFA 1VSFA 2G8WA 2PYJA 2OPQA 2X78A 5C25A 4LH5A 3O3GA 3OS0A 2G8IA 1BCOA 2ATQA 3ALYA 2FC0A 3DRSA 3L2RA 1KCFA 1IO2A 4O0IA 2VWKA 5HRPA 1QTMA 1KFSA 4F2SA 3HK2A 4HUGA 3AA4A 1U49A 3BDPA 4ICLA 1KLMA 1JLQA 3AV9A 4HUEA 1NKEA 3KKRA 2P5OA 4M3YA 1CLQA 4DTXA 3NCIA 4Y1DA 1CZ9A 3BGRA 4CJRA 1A5XA 3RR7A 2X74A 3OYDA 1QSYA 4FLZA 3AVHA 4IG0A 3MAQA 5KGWA 4JLHA 5J2NA 4KI6A 1VSDA 2YHAA 3CG7A 1WAJA 2P51A 4LH4A 1C0TA 1S1WA 1J9AA 5C42A 4M3UA 1U04A 4CGGA 2G8UA 1VSHA 4KV8A 3K57A 1NKCA 4M42A 3HP9A 4DQIA 5KRTA 3M8QA 4Z4FA 1REVA 3TANA 3MXJA 4JRQA 3OYCA 3EY1A 1TL3A 3V9WA 3DRPA 4CF9A 3DLHA 1NOYA 2HNYA 4J2EA 3CQ8A 2FBTA 3ZSZA 3OYIA 3KK2A 4BWJA 3OYGA 2HVHA 1RBUA 1BIZA 3V4IA 3VQAA 4HVJA 1EXQA 2IGIA 3FFIA 2YHBA 3QETA 1EKEA 1MU2A 3EZ5A 1NK9A 4CF0A 4CJWA 3ZSYA 3AVGA 4FLTA 1IKVA 2ZD1A 3LP0A 1WNSA 1WAFA 2WONA 4AHVA 3U3YA 1RTDA 1QSSA 2HW3A 1XC9A 1BI4B 2IDOA 3SCXA 4NYFA 1TAQA 3CFPA 2X6NA 1Q8IA 3KLGA 2HHVA 1ZBFA 1ZBLA 1JXEA 1T03A 4RW9A 2PZSA 1U48A 4Z4EA 3PX6A 1GOCA 5KGXA 4CF1A 4CJFA 3QNOA 2HHTA 1UAXA 3C6TA 2Z1JA 3ZSXA 3QEWA 4E7KA 3V6DA 1HRHA 3SUOA 1D9DA 3SI6A 2G8KA 1NK8A 3I8DA 1R0AA 1T8EA 1YT3A 3DLBA 2IOCA 1RBVA 4DFMA 3SNNA 4C8LA 3RMDA 4H8KA 4KHYA 3IRXA 1JLAA 1I39A 2EX3A 5KI6A 3AVFA 4KHUA 1Z26A 3QO9A 3U3GA 3ZT2A 2P1JA 3L3VA 1A5VA 1XHZA 3RR8A 4DSEA 3O4QA 4OGCA 4GW6A 1UA0A 4F4KA 5CZ1A 1XWLA 3QNNA 1VSIA 1BL3A 3KJVA 4M45A 4DSJA 1KVCA 4KHWA 1QS4A 4O55A 4W5RA 5CY4A 1L3VA 4FM0A 1IKWA 4CHNA 2OZMA 4EZ9A 4FJJA 2DFFA 5HRNA 4JRPA 4CGHA 4AH9A 4Z4HA 1C0UA 1TKDA 1D9FA 2O4IA 1KLNA 4OPJA 1RTHA 1ITGA 3HM9A 1Z25A 4CK3A 5HP1A 1RT1A 5DMRA 4DTRA 1U45A 3VQ8A 3OYJA 3AO4A 4DTSA 1JLEA 4FK2A 2BGGA 2OPPA 4FM2A 1HQEA 3V9SA 2A1RA 2QKBA 4CJ3A 2PYLA 3P83D 3OYEA 3L2WA 3QEXA 1T05A 2D5RA 2KFZA 1IG9A 4CCHA 2HHQA 4DSIA 4WE1A 3OJSA 2YV0X 1O1WA 4FJHA 3DMJA 3WNEA 1EX4A 1CZBA 3PV8A 4FJ7A 1QQCA 2Z1HA 1L3SA 4CJSA 1IKYA 3PO4A 4K8XA 3VQEA 1T7PA 3V9UA 1RT2A 1RCHA 4MFBA 1ZBUA 4FVMA 3WNGA 4IDKA 4QAGA 4CJPA 1KTQA 5K14A 3VQCA 4EP4A 2XY5A 1LV5A 2ETJA 3G0ZA 3RMCA 1XI1A 1NK7A 1LWCA 3VQPA 3SYZA 2KQ2A 2BANA 4FJLA 1RTIA 2BE2A 2G8HA 1UWBA 4E19A 4DFPA 3AA2A 1C1CA 3DI6A 3DLRA 2NUBA 3IS9A 4DQPA 1RDCA 3T1AA 4CEZA 4E7IA 3LAMA 4GMJB 4C8NA 4JS4A 4BDZA 1LWEA 3AVLA 3NGYA 1HNIA 4DLEA 1QSLA 1B9FA 1RBRA 3ZT3A 2G8VA 1TKZA 1JLCA 3LP2A 3PX4A 4KI4A 3NGIA 4F2RA 3OYMA 4HCCA 3C6UA 1TGOA 2E6LA 3LZIA 4RW7A 4DU3A 3QEVA 3NE6A 3V81A 3KIOA 5HRRA 3NAEA 2OA8A 4O44A 4KHQA 1JKHA 4HHTA 3U6FA 3MXMA 3K2PA 4AHTA 1X9WA 4FJKA 3KLHA 2Z1GA 4E0DA 3VQ9A 1HNVA 3TAFA 2QKKA 4DSFA 4OJRA 4I7FA 4OKJA 1S6QA 3L8BA 3DYAA 4ELVA 1ZBHA 4W5NA 2F8TA 2IC3A 3VQ7A 1WN7A 3MXIA 4AILC 3OVNA 5E41A 1N5YA 1BHLA 4CIFA 4M3XA 2EHGA 3K5OA 3SQ1A 4OLBA 2QK9A 3NDKA 4ID5A 4XIUA 4MQ3A 3AVCA 4CEBA 4BE1A 4M3TA 4BDYA 2AJQA 3LP3A 3PX0A 4Y1CA 1FKOA 3HP6A 4DTMA 3AA5X 1L5UA 4KHSA 3CFRA 2FBVA 3DLKA 2GUIA 1WSIA 3SUPA 3QINA 2D0CA 4HUFA 3OY9A 1YTAA 4CHOA 4CIEA 4CHYA 3LWLA 4W5QA 4DS4A 4Z4IA 1EETA 4CHZA 4PY5A 4I2PA 3NHGA 5J2QA 3I0RA 4OPKA 4CEAA 3AO2A 2VG6A 4FJ8A 3VQ4A 2GV9A 1RT6A 4FK0A 1GOAA 4FW1A 4E7JA 5HBMA 4KTZA 1KVBA 4M3RA 1BI4A 1X9MA 2YNIA 4NCAA 2HHWA 1W9HA 4JS5A 3ZT1A 4PWDA 3LZJA 4I2QA 4RW4A 4QCLA 3O4NA 1IH7A 4B9SA 3TAEA 3OYHA 1EP4A 3LPUA 1VRTA 3OYBA 4I9LA 4CJTA 4DTUA 1VSLA 3JYTA 3VA3A 3M8RA 1DLOA 4IFVA 3MEDA 2RF2A 3L2QA 1NK5A 1L3UA 4F3TA 2BDPA 3RWUA 1WSEA 3NF9A 4CK2A 3KK1A 5FRNA 3HPOA 1JL2A 4W5OA 2HNZA 2ZQBA 1A5WA 3AO3A 3CM5A 1TK5A 2F8SA 4NYNA 1S1VA 3VQ5A 4CEEA 3TAQA 3ZSVA 1HYZA 1SL2A 3PO5A 4Z4CA 3SQ0A 3VN5A 1TK0A 3ZCMA 2F96A 4B8AB 1FXXA 1JL1A 1KVAA 1LAWA 1RBTA 2RN2A 4KHNA 4DTNA 2WOMA 1SUQA 2FBYA 4CGJA 3RMAA 1SKSA 1YTUA 1HYVA 4CF8A 1UA1A 1VK0A 4CJ4A 5CYMA 4CJUA 1NKBA 3JSMA 1RT4A 4O0JA 3VQDA 3NH0A 3SUQA 1RT3A 4B9LA 5DK5A 3AO5A 4DG1A 3K5LA 3SQ2A 4FZZA 2LSNA 3KKSA 4CJ5A 1JLFA 5I42A 3TI0A 1VSKA 3NF8A 3AVNA 2E4LA 3ZSWA 3ZT4A 3OS1A 3VQQA 4CK1A 4FLUA 5J1EA 5KTQA 4DQRA 5J2MA 4ZTJA 2R7YA 4DWIA 2O4GA 1CXUA 3P1GA 3KD5E 1S1XA 1SL1A 2YNGA 2ZE2A 3S9HA 1LW0A 3LALA 4CE9A 3AVMA 1S6PA 4NCBA 4PA1A 3DLGA 4CFCA 3IAYA 4M3WA 3MECA 4CJVA 2OYQA 1K6YA 4LSLA 4FYDA 3P5JA 3K59A 4YFUA 1HMVA 2XHBA 4OKEA 2XO7A 3THVA 4FJ5A 3QERA 1NJWA 2XY7A 3AVIA 1B92A 1J54A 4I9QA 3TAMA 3ZT0A 3KLIA 2KZMA 1RDDA 2XY8A 2RKIA 4CESA 2W42A 4DQSA 3SQ4A 4F8RA 4FJ9A 1QE1A 3NH1A 2D0BA 5SZTA 4DSLA 1ASVA 4OVLA 4DSKA 2QXFA 2Y1JA 4J2AA 1WSGA 3L2UA 4B9TA 1U47A 4KREA 3AO1A 2RPIA 4CFDA 3IG1A 1GOBA 1RDAA 3LP1A 2OPRA 4TSXA 3QESA 4CEQA 3SUNA 1WLJA 3G10A 4CJLA 1HJRA 5JS2A 3SPYA 5I3UA 1SKWA 4C8OA 3D45A 5EU7A 4DFJA 4ELTA 1N6QA 3L3UA 1NOZA 4DU4A 3KLFA 3M8PA 4CHQA 3OYKA 1LWFA 3HJFA 3ULDA 1VSEA 1RDBA 2X6SA 3CYMA 3OYNA 4KPYA 3F73A 3SZ2A 2VG5A 5J2PA 2G8FA 3KTQA 1RTJA 3HSTB 4RW6A 2HNDA 2IS3A 4H4OA 3TABA 4BE0A 2VG7A 2ITGA 4CFBA 4CFAA 1Q9XA 4FJMA 3ISNC 4J2BA 2DTUA 4E7LA 4FJGA 3VQBA 3WNHA 4HTUA 3ITHA 4DF4A 3HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPT A;  1RT5 A;  3NF6 A;  3DOK A;  4IG3 A;  1J5O A;  1D8Y A;  4DLG A;  5CYQ A;  3V1R A;  3QIO A;  3RRH A;  4B9U A;  4KRF A;  5HRO A;  4CEC A;  3S3N A;  4CJK A;  3DRR A;  4CER A;  4Z4G A;  3LAK A;  1ZYQ A;  4KAZ A;  4G1Q A;  3V1O A;  1RT7 A;  3AVB A;  3SJJ A;  1C1A A;  1W0H A;  3QIP A;  4E7H A;  2B5J A;  4C8K A;  3HPH A;  4DU1 A;  3QEP A;  3HL8 A;  3NH2 A;  1HPZ A;  4CED A;  4O5B A;  1HQU A;  3S3M A;  4LY7 A;  2HHU A;  1I3A A;  4CGD A;  2JGU A;  2XY6 A;  4B9N A;  3TAR A;  3RRG A;  4IKF A;  4CHP A;  4NCG A;  5SWM A;  3K5N A;  4B08 A;  4AHC A;  3V9Z A;  3AVK A;  4KO0 A;  4E1M A;  2Y1I A;  1QHT A;  4KKO A;  3CM6 A;  1DTQ A;  3LAN A;  1LAV A;  4AHS A;  1TV6 A;  2YNH A;  3HYF A;  1S1T A;  4B8C A;  3RMB A;  1B9D A;  4W5T A;  3A2F A;  1NK6 A;  3DOL A;  5KRS A;  3E01 A;  4L8R B;  4E3S A;  5JS1 A;  4HCB A;  4ID1 A;  1TAU A;  3AVJ A;  1WSJ A;  3DLE A;  1FKP A;  4CIG A;  4DTP A;  1DTT A;  1TL1 A;  2E6M A;  3MEG A;  4N41 A;  4FLX A;  1JXB A;  4B9M A;  3NGZ A;  4FZY A;  4FW2 A;  3CFO A;  4CGF A;  4N56 A;  2YNF A;  3T3F A;  1VSJ A;  4KB0 A;  1Y97 A;  4CJQ A;  4CF2 A;  1U4B A;  4B3O A;  4F3O A;  4RW8 A;  5HRS A;  3OYF A;  1SL0 A;  4DS5 A;  4RG8 A;  4BWM A;  1Q9Y A;  1YVU A;  4DMN A;  4FJX A;  1FK9 A;  4DTJ A;  2D0A A;  3UIQ A;  2OZS A;  3VA0 A;  4CEO A;  1XHX A;  3L2V A;  4E1N A;  4CJE A;  1TKX A;  3OS2 A;  4ELU A;  4EP5 A;  2YKM A;  4GVM A;  5C24 A;  3SV3 A;  4FJN A;  1WSF A;  3QEI A;  1L3T A;  4AHR A;  3NFA A;  3AA3 A;  1LW2 A;  3TWH A;  1KRP A;  1F21 A;  3QLH A;  4Q0B A;  4FLV A;  4N76 A;  4KTQ A;  3LDS A;  4QOZ B;  4AHU A;  1SV5 A;  2DY4 A;  3AVA A;  4FZX C;  1G15 A;  3HO1 A;  1BQN A;  5FRM A;  3F9K A;  4UQG A;  4J2D A;  4FCY A;  3SV4 A;  3KD1 E;  2HHS A;  2DFH A;  1ZBI A;  3ASM A;  3ZSQ A;  5HLF A;  4FK4 A;  4Q5V A;  4M41 A;  4KTW A;  5FDL A;  1RBS A;  3HPG A;  2VWJ A;  1VRU A;  2Q3S A;  5FRO A;  1KFD A;  1S9E A;  4IBN A;  4OKK A;  4N47 A;  4DF8 A;  2HMI A;  2DFE A;  4M3Z A;  3I0S A;  2KZZ A;  1BCM A;  3RTV A;  3NF7 A;  1D5A A;  3OYA A;  2KFN A;  4N5S A;  4B9V A;  3NBP A;  1C6V A;  2HHX A;  4PUO A;  3SPZ A;  3DM2 A;  2A1S A;  2Z1I A;  1CXQ A;  4DTO A;  1IKX A;  3MEE A;  4KB1 A;  1C0M A;  1KSP A;  3PY8 A;  1BGX T;  4FM1 A;  1RNH A;  3ZSO A;  1TKT A;  2GBZ A;  1SKR A;  3KLE A;  2PY5 A;  4K8Z A;  1RIL A;  1NJY A;  4FJI A;  4PQU A;  3T19 A;  3HVT A;  3B6O A;  4EZ6 A;  3TAG A;  1ASW A;  3H08 A;  4LD0 A;  3V9X A;  4LSN A;  2YKN A;  3ZSR A;  3KK3 A;  3HT3 A;  1X9S A;  3S3O A;  1UOC A;  3D0P A;  2HVI A;  2HB5 A;  3LWM A;  3HXM A;  3C94 A;  4CEF A;  1VSM A;  1S5J A;  4R5P A;  1X1P A;  4DFK A;  3TAP A;  1NK0 A;  4FLY A;  3OYL A;  3M8S A;  2P5G A;  1J53 A;  4CGI A;  5D3G A;  1BIS A;  2B4J A;  3K5M A;  2KTQ A;  1S9G A;  3PUF A;  4O4G A;  1NK4 A;  1ASU A;  1TVR A;  1BQM A;  4IFY A;  3O3H A;  1JLB A;  3O3F A;  3K58 A;  1JLG A;  4DQQ A;  1S1U A;  4ZTF A;  1TK8 A;  3VQ6 A;  1NJZ A;  1NJX A;  4ZHR A;  4H4M A;  4BE2 A;  3V1Q A;  5T7B A;  4E89 A;  4BDP A;  5CZ2 A;  3C95 A;  2JLE A;  1HYS A;  1WSH A;  3B6P A;  4KFB A;  4YNQ A;  4FXD A;  3OJU A;  2IAJ A;  4FLW A;  4C8M A;  3TR8 A;  4Z0U A;  3EYZ A;  2I5J A;  2B6A A;  2XRI A;  2KW4 A;  1BIU A;  1C1B A;  2FBX A;  2OPS A;  4OGE A;  4BAC A;  4OLA A;  3WNF A;  1VSF A;  2G8W A;  2PYJ A;  2OPQ A;  2X78 A;  5C25 A;  4LH5 A;  3O3G A;  3OS0 A;  2G8I A;  1BCO A;  2ATQ A;  3ALY A;  2FC0 A;  3DRS A;  3L2R A;  1KCF A;  1IO2 A;  4O0I A;  2VWK A;  5HRP A;  1QTM A;  1KFS A;  4F2S A;  3HK2 A;  4HUG A;  3AA4 A;  1U49 A;  3BDP A;  4ICL A;  1KLM A;  1JLQ A;  3AV9 A;  4HUE A;  1NKE A;  3KKR A;  2P5O A;  4M3Y A;  1CLQ A;  4DTX A;  3NCI A;  4Y1D A;  1CZ9 A;  3BGR A;  4CJR A;  1A5X A;  3RR7 A;  2X74 A;  3OYD A;  1QSY A;  4FLZ A;  3AVH A;  4IG0 A;  3MAQ A;  5KGW A;  4JLH A;  5J2N A;  4KI6 A;  1VSD A;  2YHA A;  3CG7 A;  1WAJ A;  2P51 A;  4LH4 A;  1C0T A;  1S1W A;  1J9A A;  5C42 A;  4M3U A;  1U04 A;  4CGG A;  2G8U A;  1VSH A;  4KV8 A;  3K57 A;  1NKC A;  4M42 A;  3HP9 A;  4DQI A;  5KRT A;  3M8Q A;  4Z4F A;  1REV A;  3TAN A;  3MXJ A;  4JRQ A;  3OYC A;  3EY1 A;  1TL3 A;  3V9W A;  3DRP A;  4CF9 A;  3DLH A;  1NOY A;  2HNY A;  4J2E A;  3CQ8 A;  2FBT A;  3ZSZ A;  3OYI A;  3KK2 A;  4BWJ A;  3OYG A;  2HVH A;  1RBU A;  1BIZ A;  3V4I A;  3VQA A;  4HVJ A;  1EXQ A;  2IGI A;  3FFI A;  2YHB A;  3QET A;  1EKE A;  1MU2 A;  3EZ5 A;  1NK9 A;  4CF0 A;  4CJW A;  3ZSY A;  3AVG A;  4FLT A;  1IKV A;  2ZD1 A;  3LP0 A;  1WNS A;  1WAF A;  2WON A;  4AHV A;  3U3Y A;  1RTD A;  1QSS A;  2HW3 A;  1XC9 A;  1BI4 B;  2IDO A;  3SCX A;  4NYF A;  1TAQ A;  3CFP A;  2X6N A;  1Q8I A;  3KLG A;  2HHV A;  1ZBF A;  1ZBL A;  1JXE A;  1T03 A;  4RW9 A;  2PZS A;  1U48 A;  4Z4E A;  3PX6 A;  1GOC A;  5KGX A;  4CF1 A;  4CJF A;  3QNO A;  2HHT A;  1UAX A;  3C6T A;  2Z1J A;  3ZSX A;  3QEW A;  4E7K A;  3V6D A;  1HRH A;  3SUO A;  1D9D A;  3SI6 A;  2G8K A;  1NK8 A;  3I8D A;  1R0A A;  1T8E A;  1YT3 A;  3DLB A;  2IOC A;  1RBV A;  4DFM A;  3SNN A;  4C8L A;  3RMD A;  4H8K A;  4KHY A;  3IRX A;  1JLA A;  1I39 A;  2EX3 A;  5KI6 A;  3AVF A;  4KHU A;  1Z26 A;  3QO9 A;  3U3G A;  3ZT2 A;  2P1J A;  3L3V A;  1A5V A;  1XHZ A;  3RR8 A;  4DSE A;  3O4Q A;  4OGC A;  4GW6 A;  1UA0 A;  4F4K A;  5CZ1 A;  1XWL A;  3QNN A;  1VSI A;  1BL3 A;  3KJV A;  4M45 A;  4DSJ A;  1KVC A;  4KHW A;  1QS4 A;  4O55 A;  4W5R A;  5CY4 A;  1L3V A;  4FM0 A;  1IKW A;  4CHN A;  2OZM A;  4EZ9 A;  4FJJ A;  2DFF A;  5HRN A;  4JRP A;  4CGH A;  4AH9 A;  4Z4H A;  1C0U A;  1TKD A;  1D9F A;  2O4I A;  1KLN A;  4OPJ A;  1RTH A;  1ITG A;  3HM9 A;  1Z25 A;  4CK3 A;  5HP1 A;  1RT1 A;  5DMR A;  4DTR A;  1U45 A;  3VQ8 A;  3OYJ A;  3AO4 A;  4DTS A;  1JLE A;  4FK2 A;  2BGG A;  2OPP A;  4FM2 A;  1HQE A;  3V9S A;  2A1R A;  2QKB A;  4CJ3 A;  2PYL A;  3P83 D;  3OYE A;  3L2W A;  3QEX A;  1T05 A;  2D5R A;  2KFZ A;  1IG9 A;  4CCH A;  2HHQ A;  4DSI A;  4WE1 A;  3OJS A;  2YV0 X;  1O1W A;  4FJH A;  3DMJ A;  3WNE A;  1EX4 A;  1CZB A;  3PV8 A;  4FJ7 A;  1QQC A;  2Z1H A;  1L3S A;  4CJS A;  1IKY A;  3PO4 A;  4K8X A;  3VQE A;  1T7P A;  3V9U A;  1RT2 A;  1RCH A;  4MFB A;  1ZBU A;  4FVM A;  3WNG A;  4IDK A;  4QAG A;  4CJP A;  1KTQ A;  5K14 A;  3VQC A;  4EP4 A;  2XY5 A;  1LV5 A;  2ETJ A;  3G0Z A;  3RMC A;  1XI1 A;  1NK7 A;  1LWC A;  3VQP A;  3SYZ A;  2KQ2 A;  2BAN A;  4FJL A;  1RTI A;  2BE2 A;  2G8H A;  1UWB A;  4E19 A;  4DFP A;  3AA2 A;  1C1C A;  3DI6 A;  3DLR A;  2NUB A;  3IS9 A;  4DQP A;  1RDC A;  3T1A A;  4CEZ A;  4E7I A;  3LAM A;  4GMJ B;  4C8N A;  4JS4 A;  4BDZ A;  1LWE A;  3AVL A;  3NGY A;  1HNI A;  4DLE A;  1QSL A;  1B9F A;  1RBR A;  3ZT3 A;  2G8V A;  1TKZ A;  1JLC A;  3LP2 A;  3PX4 A;  4KI4 A;  3NGI A;  4F2R A;  3OYM A;  4HCC A;  3C6U A;  1TGO A;  2E6L A;  3LZI A;  4RW7 A;  4DU3 A;  3QEV A;  3NE6 A;  3V81 A;  3KIO A;  5HRR A;  3NAE A;  2OA8 A;  4O44 A;  4KHQ A;  1JKH A;  4HHT A;  3U6F A;  3MXM A;  3K2P A;  4AHT A;  1X9W A;  4FJK A;  3KLH A;  2Z1G A;  4E0D A;  3VQ9 A;  1HNV A;  3TAF A;  2QKK A;  4DSF A;  4OJR A;  4I7F A;  4OKJ A;  1S6Q A;  3L8B A;  3DYA A;  4ELV A;  1ZBH A;  4W5N A;  2F8T A;  2IC3 A;  3VQ7 A;  1WN7 A;  3MXI A;  4AIL C;  3OVN A;  5E41 A;  1N5Y A;  1BHL A;  4CIF A;  4M3X A;  2EHG A;  3K5O A;  3SQ1 A;  4OLB A;  2QK9 A;  3NDK A;  4ID5 A;  4XIU A;  4MQ3 A;  3AVC A;  4CEB A;  4BE1 A;  4M3T A;  4BDY A;  2AJQ A;  3LP3 A;  3PX0 A;  4Y1C A;  1FKO A;  3HP6 A;  4DTM A;  3AA5 X;  1L5U A;  4KHS A;  3CFR A;  2FBV A;  3DLK A;  2GUI A;  1WSI A;  3SUP A;  3QIN A;  2D0C A;  4HUF A;  3OY9 A;  1YTA A;  4CHO A;  4CIE A;  4CHY A;  3LWL A;  4W5Q A;  4DS4 A;  4Z4I A;  1EET A;  4CHZ A;  4PY5 A;  4I2P A;  3NHG A;  5J2Q A;  3I0R A;  4OPK A;  4CEA A;  3AO2 A;  2VG6 A;  4FJ8 A;  3VQ4 A;  2GV9 A;  1RT6 A;  4FK0 A;  1GOA A;  4FW1 A;  4E7J A;  5HBM A;  4KTZ A;  1KVB A;  4M3R A;  1BI4 A;  1X9M A;  2YNI A;  4NCA A;  2HHW A;  1W9H A;  4JS5 A;  3ZT1 A;  4PWD A;  3LZJ A;  4I2Q A;  4RW4 A;  4QCL A;  3O4N A;  1IH7 A;  4B9S A;  3TAE A;  3OYH A;  1EP4 A;  3LPU A;  1VRT A;  3OYB A;  4I9L A;  4CJT A;  4DTU A;  1VSL A;  3JYT A;  3VA3 A;  3M8R A;  1DLO A;  4IFV A;  3MED A;  2RF2 A;  3L2Q A;  1NK5 A;  1L3U A;  4F3T A;  2BDP A;  3RWU A;  1WSE A;  3NF9 A;  4CK2 A;  3KK1 A;  5FRN A;  3HPO A;  1JL2 A;  4W5O A;  2HNZ A;  2ZQB A;  1A5W A;  3AO3 A;  3CM5 A;  1TK5 A;  2F8S A;  4NYN A;  1S1V A;  3VQ5 A;  4CEE A;  3TAQ A;  3ZSV A;  1HYZ A;  1SL2 A;  3PO5 A;  4Z4C A;  3SQ0 A;  3VN5 A;  1TK0 A;  3ZCM A;  2F96 A;  4B8A B;  1FXX A;  1JL1 A;  1KVA A;  1LAW A;  1RBT A;  2RN2 A;  4KHN A;  4DTN A;  2WOM A;  1SUQ A;  2FBY A;  4CGJ A;  3RMA A;  1SKS A;  1YTU A;  1HYV A;  4CF8 A;  1UA1 A;  1VK0 A;  4CJ4 A;  5CYM A;  4CJU A;  1NKB A;  3JSM A;  1RT4 A;  4O0J A;  3VQD A;  3NH0 A;  3SUQ A;  1RT3 A;  4B9L A;  5DK5 A;  3AO5 A;  4DG1 A;  3K5L A;  3SQ2 A;  4FZZ A;  2LSN A;  3KKS A;  4CJ5 A;  1JLF A;  5I42 A;  3TI0 A;  1VSK A;  3NF8 A;  3AVN A;  2E4L A;  3ZSW A;  3ZT4 A;  3OS1 A;  3VQQ A;  4CK1 A;  4FLU A;  5J1E A;  5KTQ A;  4DQR A;  5J2M A;  4ZTJ A;  2R7Y A;  4DWI A;  2O4G A;  1CXU A;  3P1G A;  3KD5 E;  1S1X A;  1SL1 A;  2YNG A;  2ZE2 A;  3S9H A;  1LW0 A;  3LAL A;  4CE9 A;  3AVM A;  1S6P A;  4NCB A;  4PA1 A;  3DLG A;  4CFC A;  3IAY A;  4M3W A;  3MEC A;  4CJV A;  2OYQ A;  1K6Y A;  4LSL A;  4FYD A;  3P5J A;  3K59 A;  4YFU A;  1HMV A;  2XHB A;  4OKE A;  2XO7 A;  3THV A;  4FJ5 A;  3QER A;  1NJW A;  2XY7 A;  3AVI A;  1B92 A;  1J54 A;  4I9Q A;  3TAM A;  3ZT0 A;  3KLI A;  2KZM A;  1RDD A;  2XY8 A;  2RKI A;  4CES A;  2W42 A;  4DQS A;  3SQ4 A;  4F8R A;  4FJ9 A;  1QE1 A;  3NH1 A;  2D0B A;  5SZT A;  4DSL A;  1ASV A;  4OVL A;  4DSK A;  2QXF A;  2Y1J A;  4J2A A;  1WSG A;  3L2U A;  4B9T A;  1U47 A;  4KRE A;  3AO1 A;  2RPI A;  4CFD A;  3IG1 A;  1GOB A;  1RDA A;  3LP1 A;  2OPR A;  4TSX A;  3QES A;  4CEQ A;  3SUN A;  1WLJ A;  3G10 A;  4CJL A;  1HJR A;  5JS2 A;  3SPY A;  5I3U A;  1SKW A;  4C8O A;  3D45 A;  5EU7 A;  4DFJ A;  4ELT A;  1N6Q A;  3L3U A;  1NOZ A;  4DU4 A;  3KLF A;  3M8P A;  4CHQ A;  3OYK A;  1LWF A;  3HJF A;  3ULD A;  1VSE A;  1RDB A;  2X6S A;  3CYM A;  3OYN A;  4KPY A;  3F73 A;  3SZ2 A;  2VG5 A;  5J2P A;  2G8F A;  3KTQ A;  1RTJ A;  3HST B;  4RW6 A;  2HND A;  2IS3 A;  4H4O A;  3TAB A;  4BE0 A;  2VG7 A;  2ITG A;  4CFB A;  4CFA A;  1Q9X A;  4FJM A;  3ISN C;  4J2B A;  2DTU A;  4E7L A;  4FJG A;  3VQB A;  3WNH A;  4HTU A;  3ITH A;  4DF4 A;  3HVR A; 
#chains in the Genus database with same CATH topology
 1D8Y A;  4DCH A;  2D4W A;  4B9U A;  3RRH A;  3MMV A;  3C0B A;  4CJK A;  3LAK A;  3QIP A;  3MN7 A;  4DV0 K;  3QFP A;  4CED A;  4X62 K;  1HQU A;  3S3M A;  1N34 K;  2HHU A;  4CGD A;  3UE5 A;  4JKH A;  4CHP A;  5SWM A;  4B08 A;  3VET A;  4KO0 A;  4E1M A;  1LAV A;  1Z05 A;  4H5R A;  3ID8 A;  1TV6 A;  3HYF A;  3HOT A;  4W5T A;  5KRS A;  4O5F A;  1VQP N;  5JS1 A;  3OBW A;  3G71 N;  4WFN L;  1FKP A;  4BR2 A;  4DTP A;  1DTT A;  2E6M A;  2E8A A;  3TSU A;  3NGZ A;  4CGF A;  4N56 A;  4CJQ A;  1NLV A;  4CF2 A;  2VGM A;  4F3O A;  4RW8 A;  5HRS A;  3CPE A;  4DS5 A;  4RG8 A;  1Q9Y A;  4BRC A;  3VMF B;  3L2V A;  1XHX A;  4CJE A;  3QBW A;  1KAZ A;  4BGA A;  4ELU A;  2YHW A;  3EEQ A;  3GE1 A;  2O8D B;  2E5L K;  4B1U B;  4KH5 A;  3TWH A;  3QLH A;  3CC7 N;  4FLV A;  4KTQ A;  3AVA A;  4UQG A;  4J2D A;  2UUC K;  3KD1 E;  3ZYY X;  1ZBI A;  5AZI A;  4Q5V A;  5FDL A;  1RBS A;  1J6Z A;  3VES A;  1KFD A;  1S9E A;  4M3Z A;  3I0S A;  2KZZ A;  3RTV A;  2KFN A;  3OYA A;  5JMV A;  4N5S A;  3NBP A;  2HHX A;  2A6A A;  2Z1I A;  4PL8 A;  4DTO A;  1IKX A;  4KB1 A;  1C0M A;  4R79 A;  1ATR A;  1TKT A;  1VQ7 N;  4A2B A;  1RIL A;  4JI8 K;  4FJI A;  1FJG K;  4LSN A;  1JCG A;  4IZ9 A;  4AF1 A;  3WEE B;  3U4L A;  3LWM A;  5B8H A;  4BG8 A;  1M90 O;  3OYL A;  5D3G A;  2KTQ A;  1S72 N;  5M1P A;  3DXM A;  1ASU A;  3K58 A;  1QHA A;  1N32 K;  3VF2 A;  4GV6 A;  4ZHR A;  5T7B A;  1HKG A;  2RHK A;  3C95 A;  1CZA N;  4BDP A;  3NVM A;  5AQS A;  1HYS A;  4KFB A;  4F9O A;  2P9K B;  3N4P A;  3VEX A;  3OJU A;  4K42 A;  1C0F A;  2FBX A;  4OGE A;  2BTF A;  4JEP A;  1QVF M;  4CZI A;  2QXL A;  1HX1 A;  5JLF A;  2G8W A;  5GAH P;  4LH5 A;  1BCO A;  3ALY A;  2FC0 A;  3L2R A;  2NRW A;  1IO2 A;  3MN6 A;  2VWK A;  3ATU A;  4HUG A;  1U49 A;  1N8R O;  4ICL A;  1JLQ A;  3AV9 A;  4FWR A;  1NKE A;  4B1X B;  1DEJ A;  4WF9 L;  4DTX A;  4K25 A;  1A5X A;  3RR7 A;  2X74 A;  3SK3 A;  4IG0 A;  5KGW A;  3CC2 N;  4JLH A;  5LJW A;  5J2N A;  1WAJ A;  1C0T A;  5C42 A;  3UKR A;  3IKM A;  1U04 A;  3AGR A;  2JWK A;  4M7X A;  5KRT A;  3M8Q A;  4Z4F A;  2Q97 A;  1REV A;  4BRL A;  3MXJ A;  3DRP A;  4BRI A;  4CBW A;  4CW7 B;  1C0G A;  4EAH D;  3FFI A;  3THX B;  1NK9 A;  4RWT A;  4H0T B;  1FW6 A;  1NNE A;  1RTD A;  2QW9 A;  3EE8 A;  3U3Y A;  3W0L A;  2HHV A;  1T03 A;  1GOC A;  1BA0 A;  2HHT A;  1UAX A;  3C6T A;  3ZSX A;  3V6D A;  2G8K A;  4E7K A;  2F7T A;  1HR0 K;  3WXL A;  3DLB A;  4B1V A;  3SNN A;  4C8L A;  4CD1 A;  3IRX A;  2QWL A;  2EX3 A;  3AVF A;  2CH6 A;  3A5O C;  1W2B M;  3C6H A;  1XHZ A;  4DSE A;  1XUP O;  2O8C B;  4IEE A;  1UA0 A;  5CZ1 A;  4BR4 A;  4KBO A;  3KJV A;  5CY4 A;  1T44 A;  3CER A;  4HTL A;  2OZM A;  4DQ8 A;  4JRP A;  4CGH A;  4JD2 B;  1C0U A;  2O4I A;  3CET A;  3DJC A;  4XH1 A;  5HP1 A;  1RT1 A;  1U45 A;  3A0I X;  1JLE A;  3GBT A;  3J80 O;  4BR9 A;  1T05 A;  2D5R A;  4BRE A;  4CCH A;  4FWO A;  1YJ9 N;  1EX4 A;  1CZB A;  4MO5 A;  2CGJ A;  1QQC A;  1L3S A;  4K8X A;  2NRT A;  3V9U A;  4IDK A;  4IOX A;  4EP4 A;  5K14 A;  1ESV A;  1RTI A;  2NLX A;  3MCA B;  2G8H A;  3CI5 A;  3AA2 A;  1O13 A;  2NUB A;  3T1A A;  4CEZ A;  5AQM A;  3NVK A;  2FF3 B;  4GMJ B;  4JS4 A;  2OTJ N;  5C10 A;  3AVL A;  3NGY A;  1HKC A;  2IVO A;  3NGI A;  4F2R A;  4JKG A;  3C6U A;  4HCC A;  3LZI A;  4DU3 A;  4ISG A;  4O44 A;  4KHQ A;  4CVN E;  4JHD B;  3K2P A;  4QS8 A;  1HNV A;  2QKK A;  4OJR A;  3VEY A;  2FXU A;  3L8B A;  1ZBH A;  4W5N A;  1U2V B;  2IC3 A;  3LDL A;  1XNQ K;  4B1W B;  5E41 A;  3SQ1 A;  3CCM N;  3HM8 A;  3AVC A;  4M3T A;  4BDY A;  2GEL A;  3CJC A;  2CGK A;  4DTM A;  3AA5 X;  3R9P A;  5C15 A;  4KHS A;  3J7Z O;  2D0C A;  4CHY A;  3VGM A;  5BRH A;  3CD6 N;  1EET A;  4CZL A;  4I2P A;  4EFH A;  2VG6 A;  4FK0 A;  3AY9 A;  1QZ6 A;  4FW1 A;  1BG3 A;  5ADX A;  4M3R A;  3ENB A;  2YNI A;  4JS5 A;  1ATN A;  1K8K B;  1OH7 A;  5H1S Q;  3O4N A;  4B9S A;  1EP4 A;  3EE9 A;  4H5N A;  5IT9 O;  4CZJ A;  3JYT A;  3VA3 A;  3MED A;  4IO8 A;  1NK5 A;  2BDP A;  4CK2 A;  1JL2 A;  1TK5 A;  1A5W A;  4I6M A;  3EL2 A;  4NYN A;  1S1V A;  4NB4 A;  5M1Q A;  3VQ5 A;  2A41 A;  2GWK A;  4Z4C A;  3ZLJ A;  3ZCM A;  4YOU A;  4WQ5 C;  5M1K A;  2F96 A;  3VEV A;  1JL1 A;  1FXX A;  1RBT A;  4DTN A;  1EWQ A;  4KH4 A;  1SUQ A;  4CGJ A;  4JI3 K;  3RMA A;  4GV9 A;  4K0K K;  2KKZ A;  1VK0 A;  2DPN A;  1NKB A;  3C7N B;  3JSM A;  3VQD A;  3SUQ A;  3BZK A;  2QTD A;  1NJI O;  3T7Z A;  3WXK A;  5I9E B;  2LSN A;  2UXD K;  1S22 A;  3TI0 A;  1VSK A;  3AVN A;  5J2M A;  4BY9 C;  4DQR A;  1HLU A;  5LMU K;  3OTO K;  4M3W A;  4CFC A;  1XNR K;  3MEC A;  4LSL A;  5FPE A;  3P5J A;  1QVG M;  1U2V A;  5LL6 Z;  3IUC A;  3QER A;  3SBG A;  5AZI B;  1NG9 A;  2RKI A;  3CXC M;  4F8R A;  1W97 L;  3Q7B A;  4BG9 A;  2W41 A;  2HBJ A;  3P4I A;  4DSK A;  2QXF A;  3L2U A;  3EKU A;  3O9R A;  1U47 A;  1IBK K;  1N36 K;  4KRE A;  1DKG D;  3G6E N;  1GOB A;  3LP1 A;  3C6A A;  1SKW A;  3G10 A;  3CJ7 A;  1YAG A;  4BR5 A;  2P9U A;  3Q7C A;  5AR0 A;  3L4I A;  3SZ2 A;  1ZXO A;  3DXM B;  4DV5 K;  4BE0 A;  2VG7 A;  3SJH A;  1BO5 O;  1Q9X A;  3CMA N;  4FJM A;  1RDU A;  2A40 A;  3HVR A;  3LPT A;  5FPM A;  3DOK A;  3V1R A;  2P9K A;  2IIR A;  5AQN A;  5HRO A;  3DRR A;  4CER A;  3AVB A;  2NRV A;  1C1A A;  1SS6 A;  4DV1 K;  5E26 A;  4DU1 A;  3QEP A;  1NU0 A;  4YOX A;  3AAR A;  1VQ6 N;  1I3A A;  4B9N A;  3RRG A;  3K5N A;  4ISF A;  1QHT A;  3BZC A;  2YNH A;  4B8C A;  4OPH A;  3A2F A;  1NK6 A;  4LF8 K;  5EVZ A;  3E01 A;  1X3M A;  4E3S A;  4ID1 A;  4BRH A;  1TAU A;  1TL1 A;  3MEG A;  4N41 A;  5AQW A;  4YOT A;  1VQO N;  4FW2 A;  3CFO A;  5BPM A;  1K8A O;  3SAF A;  4KH6 A;  3S41 A;  4JKA A;  4I6M B;  3F9M A;  2FF6 A;  1XMO K;  4BWM A;  1YVU A;  4FJX A;  2D0A A;  2QEX N;  3VA0 A;  1GLJ O;  5JVH L;  3ENH A;  2P9S A;  4AHR A;  1L3T A;  3O5B A;  3W3D A;  2HHH K;  4CZK A;  4AHU A;  3HBT A;  4FZX C;  3HO1 A;  2DY4 A;  1W7A A;  2VWB A;  1YIT N;  2HHS A;  2JWL A;  3ZSQ A;  5HLF A;  4FK4 A;  1TYQ B;  2WTU A;  3HPG A;  2Q3S A;  3ZX2 A;  5FRO A;  4N47 A;  4IBN A;  2HMI A;  2QWO A;  1YJN N;  2HOE A;  1C6V A;  3SPZ A;  3TTD A;  5AQP A;  1RNH A;  2GBZ A;  3CME N;  5AQY A;  3KLE A;  2HBL A;  4PQU A;  3HVT A;  4EZ6 A;  2OAN A;  1EQY A;  3KK3 A;  3D0P A;  5LMN K;  2Q2R A;  3C94 A;  4IFE A;  4A59 A;  1VSM A;  4R5P A;  1NK0 A;  4DFK A;  2QWP A;  4FLY A;  3VF6 A;  3M8S A;  4CGI A;  4O4G A;  1NK4 A;  1BQM A;  4DQQ A;  1S1U A;  4ZTF A;  1TK8 A;  3VQ6 A;  3A5L C;  3V1Q A;  4E89 A;  4BRD A;  2JLE A;  2ZJP L;  4IJN A;  3B6P A;  5CHI A;  3TR8 A;  3EYZ A;  2I7N A;  3H3O B;  2KW4 A;  5EX5 A;  4LC9 B;  2OPS A;  3OBY A;  3LM2 A;  3IFR A;  2PYJ A;  3MN9 A;  3DRS A;  1KCF A;  4F2S A;  3O9T A;  2P5O A;  1VQ9 N;  3M3Z A;  3NCI A;  1CZ9 A;  3EKS A;  3WEE A;  1IBL K;  4A5B A;  3TSP A;  4BRF A;  4BVO A;  1G99 A;  4RTF D;  4IDH A;  2QWM A;  4BRQ A;  3D6R A;  4KV8 A;  1NKC A;  3HP9 A;  4PKI A;  3TAN A;  3V9W A;  1VQN N;  3OYC A;  3EY1 A;  3DLH A;  1NOY A;  2HNY A;  4AM6 A;  3VPZ A;  3ZSZ A;  1VQM N;  3KK2 A;  2YJE A;  4BWJ A;  4DR4 K;  1HNX K;  3QML A;  3HM9 A;  1MU2 A;  3EZ5 A;  4C1N K;  4FWP A;  4FLT A;  1IKV A;  2ZD1 A;  4AHV A;  1WNS A;  4BC2 A;  1QSS A;  2HW3 A;  2O8B B;  1XC9 A;  4BRA A;  4NYF A;  1NGE A;  1TAQ A;  3CFP A;  1ZBL A;  4JK8 A;  3QNO A;  3EO3 A;  4KHP K;  1D9D A;  4DQP A;  1NK8 A;  3I8D A;  4B9Q A;  1YT3 A;  3CCU N;  5AQO A;  1RBV A;  3RMD A;  4KHY A;  1I39 A;  1HUX A;  1EWR A;  4KHU A;  5JIC A;  1A5V A;  2GX9 A;  3DXK A;  4K43 A;  1E4G T;  4GW6 A;  1VQ4 N;  4F4K A;  4KHW A;  1VSI A;  1QS4 A;  5AQT A;  4DV4 K;  5FLX O;  5EXW A;  4LF9 K;  1IKW A;  4CHN A;  4EZ9 A;  4Z4H A;  1TKD A;  4CK3 A;  4IWV A;  4JN4 A;  4XEI A;  3ULE A;  4JYA K;  4FK2 A;  2GWJ A;  3CCS N;  3O9U A;  3QEX A;  1IG9 A;  2HHQ A;  4DSI A;  3CPW M;  1NGG A;  2W6K A;  2VGN A;  3WNG A;  4MLH A;  3VOV A;  4WQ4 C;  2XY5 A;  3UKU A;  3MK6 A;  2ETJ A;  1VQL N;  5C12 A;  3FZH A;  4M7Y A;  3SYZ A;  2KQ2 A;  2BAN A;  2BE2 A;  1UWB A;  5AQZ A;  4E19 A;  4DFP A;  3DI6 A;  4LFB K;  4CI6 A;  1RDC A;  4E7I A;  4DLE A;  1RBR A;  3EN9 A;  2WC9 A;  3QBX A;  3E66 A;  2O8B A;  3E9O A;  4JKE A;  5HRR A;  3NAE A;  3O1B A;  4HHT A;  1NGI A;  5AQV A;  4M63 C;  2J4R A;  4FJK A;  1S3X A;  1RGI A;  4DSF A;  4H5W A;  3DYA A;  2UUA K;  2F8T A;  1WN7 A;  4AIL C;  1N5Y A;  1BHL A;  5BR9 A;  4EHU A;  2EHG A;  3K5O A;  4OLB A;  4ILH A;  4MQ3 A;  4BE1 A;  3KZB A;  4Y1C A;  5BRD A;  3HP6 A;  3JXU A;  3CFR A;  3DLK A;  3SUP A;  3QIN A;  3IMX A;  4CHO A;  3LWL A;  3MWP A;  4W5Q A;  1NM1 A;  4PY5 A;  3NHG A;  2QWN A;  4Z94 A;  4FJ8 A;  3VQ4 A;  5GAD P;  5AFU A;  4E7J A;  2PFU A;  1X9M A;  3SLC A;  1W9H A;  4JKG B;  2BH1 A;  4QCL A;  1IH7 A;  3L0Q A;  2UXB K;  4JKD A;  1VRT A;  3E1Y A;  4I9L A;  3PLA A;  1VSL A;  2NRR A;  1VQ8 N;  4IFV A;  1TYQ A;  3KK1 A;  3HPO A;  4W5O A;  3CM5 A;  3AO3 A;  2YHY A;  3OHR A;  3R6M A;  4YY3 K;  4CEE A;  1SL2 A;  2RE2 A;  3JS6 A;  5AZJ B;  4B8A B;  5M1N A;  1Q86 O;  1MDU B;  1YI2 N;  4BRP A;  1NGF A;  2UUB K;  1YTU A;  1HYV A;  4CJ4 A;  2NNW A;  5CYM A;  4CJU A;  3THW B;  3KWI A;  1RT3 A;  4BR0 A;  3AO5 A;  4O8K A;  4FZZ A;  1RDW X;  1QQM A;  4H5V A;  5AQK A;  3ZSW A;  3OS1 A;  2WUS A;  5J1E A;  4ZTJ A;  1K8K A;  2O4G A;  4FWM A;  3KD5 E;  1P8Z A;  1S1X A;  2P9L A;  5E84 A;  4M42 A;  3S9H A;  3LAL A;  3UKR B;  4CE9 A;  1S6P A;  5LY3 A;  3IAY A;  4FYD A;  1K6Y A;  3LDQ A;  1WUA A;  4CBU A;  4QS7 A;  4YFU A;  3THV A;  2Q0R A;  4FJ5 A;  1NMD A;  4JKF A;  3PSI A;  3KLI A;  1KXP A;  1RDD A;  2UXC K;  2W42 A;  4FO0 A;  4FJ9 A;  5AQJ A;  3NH1 A;  3A5N C;  3THX A;  4DR6 K;  3J7A P;  1NGH A;  1EO1 A;  1T6D A;  3AO1 A;  4CFD A;  3TTF A;  4DKW A;  4CJ7 A;  3F5T A;  3H45 C;  4GY2 B;  3VGK A;  3O9S A;  4CEQ A;  3K9J A;  4CJL A;  2HST A;  5I3U A;  4IOA L;  4C8O A;  3D45 A;  4DFJ A;  4ELT A;  4OPA A;  1Z6R A;  3L3U A;  4DU4 A;  2E2N A;  3KLF A;  2E2P A;  1VSE A;  3FZF A;  2HF4 A;  2X6S A;  1Y64 A;  4H0V B;  4O8U A;  5J2P A;  2P9I A;  1RTJ A;  3O1W A;  2HND A;  4DR7 K;  4CFB A;  4CFA A;  2W6L A;  1U6Z A;  3M5R A;  3ISN C;  2DTU A;  4E7L A;  3VQB A;  3WNH A;  2ZF5 O;  3H3N O;  3ITH A;  2A42 A;  1RT5 A;  4IG3 A;  4DV6 K;  1QQN A;  1J5O A;  1DT9 A;  3ATV A;  3HZ6 A;  5EOY A;  4B1Z A;  4DR2 K;  3HSC A;  4KRF A;  5GAG P;  1ZYQ A;  3MX5 A;  4UY8 O;  4X64 K;  4G1Q A;  1RT7 A;  3SJJ A;  4BRM A;  4HWI A;  3K0S A;  1H1V A;  4E7H A;  1OKJ A;  5HOO A;  2B5J A;  4C8K A;  3U8X A;  4JI6 K;  3NH2 A;  4IO9 L;  4BGB A;  1MWK A;  2E1Y A;  4MDA A;  3I55 N;  4IKF A;  3J8A A;  2XY6 A;  3B8A X;  4NCG A;  3V9Z A;  1VQK N;  4AHC A;  5BRE A;  3AVK A;  2Y1I A;  4KKO A;  3CM6 A;  3LAN A;  4AHS A;  3DOL A;  2PAV A;  4ISE A;  4L8R B;  4HCB A;  2P9P B;  5C0Y A;  2IVN A;  1WSJ A;  3DLE A;  3FZL A;  5BN8 A;  4FLX A;  1JXB A;  4B9M A;  4B1Y B;  4FZY A;  2YNF A;  5M1O A;  3VF4 A;  1OVY A;  3F2K A;  1VSJ A;  2ZGZ A;  4KB0 A;  5C2D A;  1U4B A;  3PSF A;  4B3O A;  4CZM A;  1SL0 A;  5GIP A;  3KVG A;  3ULE B;  1IBM K;  1FK9 A;  4DTJ A;  3VER A;  4WFB L;  2OZS A;  3FR0 A;  1IJJ A;  1TKX A;  3OS2 A;  3VEO A;  5KPT A;  4EP5 A;  2YKM A;  4GVM A;  5C24 A;  3SV3 A;  4FJN A;  1WSF A;  4H5T A;  3QEI A;  3NFA A;  3AA3 A;  1LW2 A;  1KRP A;  1F21 A;  4N76 A;  3LDS A;  3UKU B;  1G15 A;  1BQN A;  4FWQ A;  3FFK B;  4FCY A;  3SV4 A;  1T3V A;  2E88 A;  5AQR A;  3ASM A;  3ID6 A;  1SQK A;  2VWJ A;  1VRU A;  2ZGY A;  4OKK A;  4DF8 A;  5KPR A;  2HBK A;  2QA4 N;  1D5A A;  4B9V A;  3WXI A;  2FSJ A;  4PUO A;  1GLD G;  3LM9 A;  1CXQ A;  3MEE A;  1LOT B;  1NGD A;  4FM1 A;  3ZSO A;  2PY5 A;  4K8Z A;  1ZBS A;  3T19 A;  3T1H K;  3MDQ A;  5AQF A;  4JI7 K;  3MN5 A;  5FPD A;  3A5M C;  3HT3 A;  4JAX A;  1X9S A;  1UOC A;  2HVI A;  2HB5 A;  3HXM A;  4CEF A;  4YDU A;  4DHY A;  2GTD A;  1J53 A;  1JCE A;  2CGL A;  2B4J A;  3K5M A;  4JHD A;  3SAH A;  1S9G A;  4IFY A;  3O3H A;  3QIC A;  1JLB A;  5AQQ A;  4B3M K;  1GLE G;  1YVN A;  2OTL N;  1NWK A;  1NJX A;  3HI0 A;  4H4M A;  4BE2 A;  5CZ2 A;  4NXN K;  4H0O A;  3DLL L;  1WSH A;  4FXD A;  1NGA A;  5A2Q O;  3RSE A;  2IAJ A;  4C8M A;  5DM7 L;  4Z0U A;  1BIU A;  4H0Y B;  1X3N A;  4BAC A;  4H03 B;  4EHT A;  1VSF A;  1RFQ A;  5C25 A;  3OS0 A;  2G8I A;  4OO1 J;  2ATQ A;  2FSN A;  4O0I A;  2WBN A;  1QTM A;  1KFS A;  3HK2 A;  3IDH A;  3AA4 A;  2YI1 A;  3BDP A;  1KLM A;  2E20 A;  3KKR A;  4JKC A;  3TTC A;  4Y1D A;  3VTH A;  4CJR A;  1KC8 O;  1QSY A;  4B3R K;  2V7Y A;  2QI2 A;  4EIA A;  5ADX H;  3CJ9 A;  1YXQ A;  1VSD A;  2YHA A;  2FSK A;  3CG7 A;  4WQ4 A;  4M3U A;  1J9A A;  5AZJ A;  3T69 A;  1XC3 A;  4YOW A;  3D2F B;  2G8U A;  1VSH A;  3L4Q A;  3K57 A;  1N33 K;  3O8M A;  2KLA A;  1TL3 A;  4CF9 A;  4H0X B;  3CQ8 A;  3OYI A;  1JJ2 M;  5AJ3 K;  1YF5 L;  4JKB A;  1NGJ A;  3VQA A;  4U67 L;  4HVJ A;  2IGI A;  4WCE L;  4CF0 A;  3ZSY A;  3AVG A;  3BP8 A;  2AP1 A;  4OX9 K;  1WAF A;  2WON A;  3C7N A;  1WB9 A;  1Q82 O;  1Q8I A;  3KLG A;  2P9L B;  1JXE A;  2PZS A;  4RW9 A;  1U48 A;  4Z4E A;  3PX6 A;  2Q0U A;  5KGX A;  4CF1 A;  3UB5 A;  3FZM A;  4DQI A;  5ELZ A;  3SI6 A;  1R0A A;  2IOC A;  4DFM A;  1KAX A;  4H8K A;  1ZC6 A;  3CCL N;  2FLO A;  5KI6 A;  1Z26 A;  3QO9 A;  3U3G A;  3ZT2 A;  2P1J A;  3L3V A;  3R8E A;  1BWF O;  3RR8 A;  3O4Q A;  4FSV A;  3TSQ A;  4Y0W A;  4DR1 K;  4JD2 A;  4O55 A;  4GVE A;  4W5R A;  1VQ5 N;  2O8C A;  4AQY K;  4QS9 A;  4FJJ A;  2DFF A;  5HRN A;  1ATS A;  3ZEU B;  1D9F A;  1KLN A;  4OPJ A;  2D0O A;  4NXM K;  5DMR A;  4DTR A;  3G25 A;  3VQ8 A;  3OYJ A;  3GL1 A;  3AO4 A;  3CJA A;  4DTS A;  2BGG A;  3HOS A;  1HQE A;  3V9S A;  2A1R A;  2QKB A;  2P9U B;  3FE1 A;  2PYL A;  3OYE A;  4X65 K;  4DB3 A;  4WE1 A;  3OJS A;  1O1W A;  3PV8 A;  4GKK K;  5IWA K;  1V4S A;  4CJS A;  1IKY A;  3ZET A;  5AQU A;  1T7P A;  1RT2 A;  3QB0 A;  3CF5 L;  4FVM A;  4DUZ K;  4QAG A;  1K9M O;  1KQS M;  3VQC A;  1LV5 A;  3G0Z A;  2UYT A;  3RMC A;  1XI1 A;  3ZX0 A;  1NK7 A;  5BR8 K;  3VQP A;  4DR3 K;  4FJL A;  2ZWH A;  3DLR A;  1C1C A;  2VQF K;  4DUY K;  3LAM A;  2EWS A;  4BVP A;  5C2F A;  1B9F A;  3ZT3 A;  3WXJ A;  2OCE A;  2GEM A;  3LP2 A;  3WXM B;  5BPN A;  2VQE K;  3OYM A;  1TGO A;  3NE6 A;  3V81 A;  4YDU C;  3KIO A;  4A57 A;  2ASO A;  1JKH A;  4NLC A;  3GDQ A;  3U6F A;  3MXM A;  4FWS A;  4AHT A;  4DV7 K;  2Z1G A;  3VQ9 A;  4I7F A;  4OKJ A;  4ELV A;  2F9T A;  3MXI A;  1I94 K;  3OVN A;  3DWL A;  2E2O A;  4M3X A;  2QK9 A;  4XIU A;  3TPQ A;  2QWR A;  2AJQ A;  3LP3 A;  4JI5 K;  3PX0 A;  1WOQ A;  1FKO A;  5GIN A;  1L5U A;  2FBV A;  2GUI A;  2Q36 A;  3WUH A;  3OY9 A;  4CIE A;  4DS4 A;  4Z4I A;  4DV3 K;  2O8F A;  1IG8 A;  3I0R A;  3AO2 A;  1RT6 A;  1GOA A;  5GIO A;  4KTZ A;  1KVB A;  4BC4 A;  1GLA G;  1BI4 A;  4PWD A;  3RVC A;  4RW4 A;  3CJ1 A;  3TAE A;  3OYB A;  2NRZ A;  4CJT A;  3M8R A;  1DLO A;  2AA4 A;  3GOI A;  2F4V K;  2RF2 A;  1L3U A;  4F3T A;  3RWU A;  5HL7 L;  1BOT O;  5KPZ A;  5FRN A;  1E3M A;  2F8S A;  3OA9 A;  3NMU A;  3TAQ A;  4ILJ A;  4MDB A;  3SQ0 A;  3O9Q A;  3PO5 A;  4PHT X;  3A8Y A;  3HRG A;  2RN2 A;  1KVA A;  1LAW A;  3OW2 M;  4KHN A;  3AAQ A;  1YJW N;  3SBT A;  1SKS A;  4GNI A;  1UA1 A;  4WFA L;  1RT4 A;  4O0J A;  5DK5 A;  4DG1 A;  4MO4 A;  3K5L A;  2V7Z A;  3I56 N;  3KKS A;  1JLF A;  5I42 A;  1HNW K;  4FLU A;  3NF8 A;  4DV2 K;  5MLC Q;  3O6W A;  5KTQ A;  2A5X A;  1P90 A;  2R7Y A;  4DWI A;  1CXU A;  3P1G A;  4WQ5 A;  4NCB A;  2ZE2 A;  1WBB A;  3AVM A;  4PA1 A;  3DLG A;  4IOC L;  3U9Z A;  2XHB A;  4K41 A;  5KQD A;  1NJW A;  3AVI A;  4I9Q A;  3TAM A;  3ZT0 A;  2XY8 A;  2YHX A;  4CES A;  5LJV A;  1KD1 O;  2ZJR L;  4A61 A;  2D0B A;  4DSL A;  4E1J A;  1X9J A;  2Y1J A;  2IVP A;  3CCQ N;  4RCH A;  4B9T A;  3E9L A;  2RPI A;  3IG1 A;  2O8E A;  1IV0 A;  2OPR A;  2WFB A;  3QES A;  1XMQ K;  3SUN A;  3SPY A;  3CCJ N;  1HJR A;  2CH5 A;  4CZE A;  5EU7 A;  3TU5 A;  1N6Q A;  1NOZ A;  3ZX3 A;  3N4Q A;  3LDP A;  3OYK A;  4A2A A;  3HJF A;  3ULD A;  4IJA A;  4LF4 K;  4FOI A;  2KHO A;  2VG5 A;  2G8F A;  3KTQ A;  3HST B;  4RW6 A;  3TAB A;  4H4O A;  2ITG A;  4A5A A;  4FJG A;  4LF5 K;  2VYP A;  3NF6 A;  1NGC A;  4DLG A;  5CYQ A;  3QIO A;  3RSE B;  1YUW A;  4CEC A;  3S3N A;  4KAZ A;  3V1O A;  1W0H A;  1VHX A;  3BEX A;  3O08 A;  3HPH A;  5KQ8 A;  3HL8 A;  5TKY A;  1HPZ A;  4O5B A;  4A62 A;  4V19 S;  2E1Z A;  4BRG A;  4LY7 A;  2ITM A;  2JGU A;  3TAR A;  2H3G X;  2YX6 A;  1DGK N;  1DTQ A;  1GLC G;  4AM7 A;  3WQT A;  4CD3 A;  1S1T A;  3RMB A;  1B9D A;  3AGK A;  5TKW A;  3AVJ A;  4CIG A;  5F1X A;  3CQY A;  2ASP A;  3SAG A;  3ZEU A;  3T3F A;  4FWN A;  1Y97 A;  4JI0 K;  3OYF A;  3P38 A;  2Q1N A;  3QFU A;  1OH6 A;  4DMN A;  3UIQ A;  4CEO A;  4E1N A;  2P9S B;  4BQL A;  3LDN A;  4BC3 A;  1HKB A;  3ZET B;  4Q0B A;  4FPA A;  4QOZ B;  1SV5 A;  4YHH K;  5FRM A;  3F9K A;  5BRF A;  2E2Q A;  4BRN A;  2DFH A;  4M41 A;  4KTW A;  1YIJ N;  3E9P A;  2V52 B;  3I33 A;  2P9P A;  2DFE A;  5EY4 A;  1BCM A;  3NF7 A;  4FVU A;  3DM2 A;  2A1S A;  3MX2 A;  1KSP A;  3THY A;  3PY8 A;  1BGX T;  2NRX A;  1SKR A;  5AQG A;  4GV3 A;  1NJY A;  3VTI A;  3FLC O;  4JK7 A;  3VEW A;  3B6O A;  2V51 B;  3TAG A;  1ASW A;  3H08 A;  4LD0 A;  2NRH A;  3V9X A;  4B3S K;  2YKN A;  3ZSR A;  5AQH A;  4L3Q A;  3S3O A;  1ILY A;  1BDG A;  4X66 K;  3LL3 A;  1S5J A;  3TAP A;  1X1P A;  2P5G A;  1BIS A;  5AQL A;  3PUF A;  1TVR A;  4YOY A;  3O3F A;  1JLG A;  4LFC K;  1NJZ A;  3D2E B;  3VEN A;  5CE3 A;  4YNQ A;  4FLW A;  2I5J A;  2B6A A;  2XRI A;  2YJF A;  3J81 O;  2HMP A;  1C1B A;  4YOR A;  3FGU A;  5CR4 A;  4OLA A;  3WNF A;  1OH5 A;  2OPQ A;  2X78 A;  3D7E O;  3O3G A;  2GUP A;  3P39 A;  3KK7 A;  5HRP A;  3WT0 A;  3KHY A;  5JVG L;  3C65 A;  4M3Y A;  4HUE A;  1SZ2 A;  1CLQ A;  3AAP A;  3BGR A;  5M1F A;  3OYD A;  5AFU H;  2HBM A;  1E4F T;  4FLZ A;  3AVH A;  3MAQ A;  4JK9 A;  3R3L A;  4KI6 A;  2P51 A;  4LH4 A;  1S1W A;  3ENO A;  4FPB A;  4CGG A;  3BUZ B;  4JRQ A;  4J2E A;  2FBT A;  2P9N B;  3OYG A;  1Q81 O;  2HVH A;  1RBU A;  1BIZ A;  3V4I A;  1EXQ A;  1KAY A;  2YHB A;  3QET A;  1EKE A;  2O8F B;  4CJW A;  3U9D A;  3H1Q A;  1GLF O;  3R1X A;  3HTV A;  3LP0 A;  4FL9 A;  3THW A;  1XQS C;  1Q7Y O;  1BI4 B;  2IDO A;  3SCX A;  2X6N A;  4G9Z A;  1ZBF A;  3BF3 A;  4JI2 K;  4CJF A;  2P9I B;  2Z1J A;  3QEW A;  1HRH A;  3SUO A;  1T8E A;  4BRK A;  4BR7 A;  4ILG B;  4NO7 A;  3J7Y P;  4FWL A;  4CZG A;  1JLA A;  4B3T K;  4PKH A;  2QWQ A;  1NBW A;  1SAZ A;  4OGC A;  3D2F A;  3D2E A;  2D1K A;  1BA1 A;  3QNN A;  1XWL A;  1BL3 A;  4M45 A;  1K73 O;  1KVC A;  4DSJ A;  1GLB G;  1L3V A;  4FM0 A;  2O8E B;  3M1F A;  2W40 A;  4FWK A;  2HF3 A;  4AH9 A;  4BQZ A;  3BF1 A;  1RTH A;  4PKG A;  5AQX A;  1ITG A;  5BN9 A;  3M6G A;  1Z25 A;  4FOE A;  3H6E A;  4H0P A;  1MA9 B;  1R59 O;  2ASM A;  3JAM O;  3THY B;  2OPP A;  4FM2 A;  4CJ3 A;  3P83 D;  3L2W A;  2KFZ A;  2VCP A;  2O8D A;  2F9W A;  2YV0 X;  4FJH A;  3DMJ A;  3WNE A;  4PL7 A;  4FJ7 A;  3BY5 A;  2Z1H A;  3O4W A;  3PO4 A;  1GLL O;  4JI4 K;  3VQE A;  2UU9 K;  1RCH A;  4MFB A;  1ZBU A;  3O80 A;  4CJP A;  1KTQ A;  2PBD A;  3CQX A;  3KWG A;  3SMS A;  2ZM6 K;  5AQI A;  5FPN A;  1LWC A;  3CHW A;  1J5E K;  3K9K A;  3IS9 A;  4JV5 K;  4C8N A;  4BDZ A;  2NZT A;  1LWE A;  4BC5 A;  1HNI A;  3PIO L;  3CCV N;  2G8V A;  1TKZ A;  1JLC A;  3FZK A;  3PX4 A;  1OVQ A;  4KI4 A;  3CCE N;  4C1N I;  2E6L A;  4RW7 A;  3QEV A;  1LCU A;  3T1Y K;  2OA8 A;  1QZ5 A;  4LF6 K;  1X9W A;  1T6C A;  3KLH A;  3QDK A;  4E0D A;  3TAF A;  1S6Q A;  3VGL A;  4XH4 A;  3VQ7 A;  5F0X A;  1VAZ A;  3L6Q A;  4CIF A;  1QQO A;  4WYB A;  3NDK A;  4ID5 A;  4CEB A;  5F2R A;  1WSI A;  4J8F A;  4HUF A;  1YTA A;  3P31 A;  4CHZ A;  5J2Q A;  1TUU A;  1D4X A;  4CEA A;  4OPK A;  2GV9 A;  4LF7 K;  3CC4 N;  5HBM A;  4IXC A;  2QM1 A;  4NCA A;  2HHW A;  3ZT1 A;  3LZJ A;  4NLB A;  1WBD A;  4I2Q A;  2A3Z A;  3H46 O;  2Q31 A;  3OYH A;  3LPU A;  4XH5 A;  4JI1 K;  4DTU A;  4IEI A;  2BUP A;  3I8B A;  3SMP A;  3L2Q A;  1JCF A;  1BUP A;  1WSE A;  3NF9 A;  2HNZ A;  2ZQB A;  2ZJQ L;  2D0P A;  1HYZ A;  3ZSV A;  1TK0 A;  3VN5 A;  4C23 A;  4CZH A;  4U7B A;  5DM6 L;  4BRO A;  1MWM A;  4CBX A;  2WOM A;  2FBY A;  1NGB A;  1TUY A;  4CF8 A;  5BPL A;  4MLE A;  4Z4G A;  4YOV A;  4B9L A;  3NH0 A;  1HNZ K;  3MWT A;  4CZF A;  3SQ2 A;  4LFA K;  4CJ5 A;  1YHQ N;  2E4L A;  1QSL A;  3ZT4 A;  3H1V X;  3VQQ A;  4CK1 A;  3DAW A;  4DR5 K;  1SL1 A;  2YCH A;  2YNG A;  1LW0 A;  3CJB A;  4CJV A;  2OYQ A;  3K59 A;  1HMV A;  3CIP A;  4OKE A;  2XO7 A;  3G4S N;  3DXK B;  2XY7 A;  1B92 A;  1J54 A;  2KZM A;  4DQS A;  3SQ4 A;  3CCR N;  1NMN A;  1HJO A;  1QE1 A;  1OH8 A;  3LDO A;  5SZT A;  1ASV A;  4OVL A;  3GG4 A;  4J2A A;  1WSG A;  1V4T A;  1RDA A;  1HPM A;  4TSX A;  1Q18 A;  1WLJ A;  1BU6 O;  5JS2 A;  5JLH A;  3M8P A;  4CHQ A;  1LWF A;  1RDB A;  3MCP A;  3CYM A;  4GKJ K;  3OYN A;  4KPY A;  3F73 A;  2IS3 A;  3EZW A;  4JNE A;  2I7P A;  1M1K O;  3VEZ A;  4J2B A;  3PIP L;  2P9N A;  4HTU A;  3WQU A;  5GAE P;  4DF4 A; 
#chains in the Genus database with same CATH homology
 3LPT A;  1RT5 A;  3NF6 A;  3DOK A;  4IG3 A;  1J5O A;  1D8Y A;  4DLG A;  5CYQ A;  3V1R A;  3QIO A;  3RRH A;  4B9U A;  4KRF A;  5HRO A;  4CEC A;  3S3N A;  4CJK A;  3DRR A;  4CER A;  4Z4G A;  3LAK A;  1ZYQ A;  4KAZ A;  4G1Q A;  3V1O A;  1RT7 A;  3AVB A;  3SJJ A;  1C1A A;  1W0H A;  3QIP A;  4E7H A;  2B5J A;  4C8K A;  3HPH A;  4DU1 A;  3QEP A;  3HL8 A;  3NH2 A;  1HPZ A;  4CED A;  4O5B A;  1HQU A;  3S3M A;  4LY7 A;  2HHU A;  1I3A A;  4CGD A;  2JGU A;  2XY6 A;  4B9N A;  3TAR A;  3RRG A;  4IKF A;  4CHP A;  4NCG A;  5SWM A;  3K5N A;  4B08 A;  4AHC A;  3V9Z A;  3AVK A;  4KO0 A;  4E1M A;  2Y1I A;  1QHT A;  4KKO A;  3CM6 A;  1DTQ A;  3LAN A;  1LAV A;  4AHS A;  1TV6 A;  2YNH A;  3HYF A;  1S1T A;  4B8C A;  3RMB A;  1B9D A;  4W5T A;  3A2F A;  1NK6 A;  3DOL A;  5KRS A;  3E01 A;  4L8R B;  4E3S A;  5JS1 A;  4HCB A;  4ID1 A;  1TAU A;  3AVJ A;  1WSJ A;  3DLE A;  1FKP A;  4CIG A;  4DTP A;  1DTT A;  1TL1 A;  2E6M A;  3MEG A;  4N41 A;  4FLX A;  1JXB A;  4B9M A;  3NGZ A;  4FZY A;  4FW2 A;  3CFO A;  4CGF A;  4N56 A;  2YNF A;  3T3F A;  1VSJ A;  4KB0 A;  1Y97 A;  4CJQ A;  4CF2 A;  1U4B A;  4B3O A;  4F3O A;  4RW8 A;  5HRS A;  3OYF A;  1SL0 A;  4DS5 A;  4RG8 A;  4BWM A;  1Q9Y A;  1YVU A;  4DMN A;  4FJX A;  1FK9 A;  4DTJ A;  2D0A A;  3UIQ A;  2OZS A;  3VA0 A;  4CEO A;  1XHX A;  3L2V A;  4E1N A;  4CJE A;  1TKX A;  3OS2 A;  4ELU A;  4EP5 A;  2YKM A;  4GVM A;  5C24 A;  3SV3 A;  4FJN A;  1WSF A;  3QEI A;  1L3T A;  4AHR A;  3NFA A;  3AA3 A;  1LW2 A;  3TWH A;  1KRP A;  1F21 A;  3QLH A;  4Q0B A;  4FLV A;  4N76 A;  4KTQ A;  3LDS A;  4QOZ B;  4AHU A;  1SV5 A;  2DY4 A;  3AVA A;  4FZX C;  1G15 A;  3HO1 A;  1BQN A;  5FRM A;  3F9K A;  4UQG A;  4J2D A;  4FCY A;  3SV4 A;  3KD1 E;  2HHS A;  2DFH A;  1ZBI A;  3ASM A;  3ZSQ A;  5HLF A;  4FK4 A;  4Q5V A;  4M41 A;  4KTW A;  5FDL A;  1RBS A;  3HPG A;  2VWJ A;  1VRU A;  2Q3S A;  5FRO A;  1KFD A;  1S9E A;  4IBN A;  4OKK A;  4N47 A;  4DF8 A;  2HMI A;  2DFE A;  4M3Z A;  3I0S A;  2KZZ A;  1BCM A;  3RTV A;  3NF7 A;  1D5A A;  3OYA A;  2KFN A;  4N5S A;  4B9V A;  3NBP A;  1C6V A;  2HHX A;  4PUO A;  3SPZ A;  3DM2 A;  2A1S A;  2Z1I A;  1CXQ A;  4DTO A;  1IKX A;  3MEE A;  4KB1 A;  1C0M A;  1KSP A;  3PY8 A;  1BGX T;  4FM1 A;  1RNH A;  3ZSO A;  1TKT A;  2GBZ A;  1SKR A;  3KLE A;  2PY5 A;  4K8Z A;  1RIL A;  1NJY A;  4FJI A;  4PQU A;  3T19 A;  3HVT A;  3B6O A;  4EZ6 A;  3TAG A;  1ASW A;  3H08 A;  4LD0 A;  3V9X A;  4LSN A;  2YKN A;  3ZSR A;  3KK3 A;  3HT3 A;  1X9S A;  3S3O A;  1UOC A;  3D0P A;  2HVI A;  2HB5 A;  3LWM A;  3HXM A;  3C94 A;  4CEF A;  1VSM A;  1S5J A;  4R5P A;  1X1P A;  4DFK A;  3TAP A;  1NK0 A;  4FLY A;  3OYL A;  3M8S A;  2P5G A;  1J53 A;  4CGI A;  5D3G A;  1BIS A;  2B4J A;  3K5M A;  2KTQ A;  1S9G A;  3PUF A;  4O4G A;  1NK4 A;  1ASU A;  1TVR A;  1BQM A;  4IFY A;  3O3H A;  1JLB A;  3O3F A;  3K58 A;  1JLG A;  4DQQ A;  1S1U A;  4ZTF A;  1TK8 A;  3VQ6 A;  1NJZ A;  1NJX A;  4ZHR A;  4H4M A;  4BE2 A;  3V1Q A;  5T7B A;  4E89 A;  4BDP A;  5CZ2 A;  3C95 A;  2JLE A;  1HYS A;  1WSH A;  3B6P A;  4KFB A;  4YNQ A;  4FXD A;  3OJU A;  2IAJ A;  4FLW A;  4C8M A;  3TR8 A;  4Z0U A;  3EYZ A;  2I5J A;  2B6A A;  2XRI A;  2KW4 A;  1BIU A;  1C1B A;  2FBX A;  2OPS A;  4OGE A;  4BAC A;  4OLA A;  3WNF A;  1VSF A;  2G8W A;  2PYJ A;  2OPQ A;  2X78 A;  5C25 A;  4LH5 A;  3O3G A;  3OS0 A;  2G8I A;  1BCO A;  2ATQ A;  3ALY A;  2FC0 A;  3DRS A;  3L2R A;  1KCF A;  1IO2 A;  4O0I A;  2VWK A;  5HRP A;  1QTM A;  1KFS A;  4F2S A;  3HK2 A;  4HUG A;  3AA4 A;  1U49 A;  3BDP A;  4ICL A;  1KLM A;  1JLQ A;  3AV9 A;  4HUE A;  1NKE A;  3KKR A;  2P5O A;  4M3Y A;  1CLQ A;  4DTX A;  3NCI A;  4Y1D A;  1CZ9 A;  3BGR A;  4CJR A;  1A5X A;  3RR7 A;  2X74 A;  3OYD A;  1QSY A;  4FLZ A;  3AVH A;  4IG0 A;  3MAQ A;  5KGW A;  4JLH A;  5J2N A;  4KI6 A;  1VSD A;  2YHA A;  3CG7 A;  1WAJ A;  2P51 A;  4LH4 A;  1C0T A;  1S1W A;  1J9A A;  5C42 A;  4M3U A;  1U04 A;  4CGG A;  2G8U A;  1VSH A;  4KV8 A;  3K57 A;  1NKC A;  4M42 A;  3HP9 A;  4DQI A;  5KRT A;  3M8Q A;  4Z4F A;  1REV A;  3TAN A;  3MXJ A;  4JRQ A;  3OYC A;  3EY1 A;  1TL3 A;  3V9W A;  3DRP A;  4CF9 A;  3DLH A;  1NOY A;  2HNY A;  4J2E A;  3CQ8 A;  2FBT A;  3ZSZ A;  3OYI A;  3KK2 A;  4BWJ A;  3OYG A;  2HVH A;  1RBU A;  1BIZ A;  3V4I A;  3VQA A;  4HVJ A;  1EXQ A;  2IGI A;  3FFI A;  2YHB A;  3QET A;  1EKE A;  1MU2 A;  3EZ5 A;  1NK9 A;  4CF0 A;  4CJW A;  3ZSY A;  3AVG A;  4FLT A;  1IKV A;  2ZD1 A;  3LP0 A;  1WNS A;  1WAF A;  2WON A;  4AHV A;  3U3Y A;  1RTD A;  1QSS A;  2HW3 A;  1XC9 A;  1BI4 B;  2IDO A;  3SCX A;  4NYF A;  1TAQ A;  3CFP A;  2X6N A;  1Q8I A;  3KLG A;  2HHV A;  1ZBF A;  1ZBL A;  1JXE A;  1T03 A;  4RW9 A;  2PZS A;  1U48 A;  4Z4E A;  3PX6 A;  1GOC A;  5KGX A;  4CF1 A;  4CJF A;  3QNO A;  2HHT A;  1UAX A;  3C6T A;  2Z1J A;  3ZSX A;  3QEW A;  4E7K A;  3V6D A;  1HRH A;  3SUO A;  1D9D A;  3SI6 A;  2G8K A;  1NK8 A;  3I8D A;  1R0A A;  1T8E A;  1YT3 A;  3DLB A;  2IOC A;  1RBV A;  4DFM A;  3SNN A;  4C8L A;  3RMD A;  4H8K A;  4KHY A;  3IRX A;  1JLA A;  1I39 A;  2EX3 A;  5KI6 A;  3AVF A;  4KHU A;  1Z26 A;  3QO9 A;  3U3G A;  3ZT2 A;  2P1J A;  3L3V A;  1A5V A;  1XHZ A;  3RR8 A;  4DSE A;  3O4Q A;  4OGC A;  4GW6 A;  1UA0 A;  4F4K A;  5CZ1 A;  1XWL A;  3QNN A;  1VSI A;  1BL3 A;  3KJV A;  4M45 A;  4DSJ A;  1KVC A;  4KHW A;  1QS4 A;  4O55 A;  4W5R A;  5CY4 A;  1L3V A;  4FM0 A;  1IKW A;  4CHN A;  2OZM A;  4EZ9 A;  4FJJ A;  2DFF A;  5HRN A;  4JRP A;  4CGH A;  4AH9 A;  4Z4H A;  1C0U A;  1TKD A;  1D9F A;  2O4I A;  1KLN A;  4OPJ A;  1RTH A;  1ITG A;  3HM9 A;  1Z25 A;  4CK3 A;  5HP1 A;  1RT1 A;  5DMR A;  4DTR A;  1U45 A;  3VQ8 A;  3OYJ A;  3AO4 A;  4DTS A;  1JLE A;  4FK2 A;  2BGG A;  2OPP A;  4FM2 A;  1HQE A;  3V9S A;  2A1R A;  2QKB A;  4CJ3 A;  2PYL A;  3P83 D;  3OYE A;  3L2W A;  3QEX A;  1T05 A;  2D5R A;  2KFZ A;  1IG9 A;  4CCH A;  2HHQ A;  4DSI A;  4WE1 A;  3OJS A;  2YV0 X;  1O1W A;  4FJH A;  3DMJ A;  3WNE A;  1EX4 A;  1CZB A;  3PV8 A;  4FJ7 A;  1QQC A;  2Z1H A;  1L3S A;  4CJS A;  1IKY A;  3PO4 A;  4K8X A;  3VQE A;  1T7P A;  3V9U A;  1RT2 A;  1RCH A;  4MFB A;  1ZBU A;  4FVM A;  3WNG A;  4IDK A;  4QAG A;  4CJP A;  1KTQ A;  5K14 A;  3VQC A;  4EP4 A;  2XY5 A;  1LV5 A;  2ETJ A;  3G0Z A;  3RMC A;  1XI1 A;  1NK7 A;  1LWC A;  3VQP A;  3SYZ A;  2KQ2 A;  2BAN A;  4FJL A;  1RTI A;  2BE2 A;  2G8H A;  1UWB A;  4E19 A;  4DFP A;  3AA2 A;  1C1C A;  3DI6 A;  3DLR A;  2NUB A;  3IS9 A;  4DQP A;  1RDC A;  3T1A A;  4CEZ A;  4E7I A;  3LAM A;  4GMJ B;  4C8N A;  4JS4 A;  4BDZ A;  1LWE A;  3AVL A;  3NGY A;  1HNI A;  4DLE A;  1QSL A;  1B9F A;  1RBR A;  3ZT3 A;  2G8V A;  1TKZ A;  1JLC A;  3LP2 A;  3PX4 A;  4KI4 A;  3NGI A;  4F2R A;  3OYM A;  4HCC A;  3C6U A;  1TGO A;  2E6L A;  3LZI A;  4RW7 A;  4DU3 A;  3QEV A;  3NE6 A;  3V81 A;  3KIO A;  5HRR A;  3NAE A;  2OA8 A;  4O44 A;  4KHQ A;  1JKH A;  4HHT A;  3U6F A;  3MXM A;  3K2P A;  4AHT A;  1X9W A;  4FJK A;  3KLH A;  2Z1G A;  4E0D A;  3VQ9 A;  1HNV A;  3TAF A;  2QKK A;  4DSF A;  4OJR A;  4I7F A;  4OKJ A;  1S6Q A;  3L8B A;  3DYA A;  4ELV A;  1ZBH A;  4W5N A;  2F8T A;  2IC3 A;  3VQ7 A;  1WN7 A;  3MXI A;  4AIL C;  3OVN A;  5E41 A;  1N5Y A;  1BHL A;  4CIF A;  4M3X A;  2EHG A;  3K5O A;  3SQ1 A;  4OLB A;  2QK9 A;  3NDK A;  4ID5 A;  4XIU A;  4MQ3 A;  3AVC A;  4CEB A;  4BE1 A;  4M3T A;  4BDY A;  2AJQ A;  3LP3 A;  3PX0 A;  4Y1C A;  1FKO A;  3HP6 A;  4DTM A;  3AA5 X;  1L5U A;  4KHS A;  3CFR A;  2FBV A;  3DLK A;  2GUI A;  1WSI A;  3SUP A;  3QIN A;  2D0C A;  4HUF A;  3OY9 A;  1YTA A;  4CHO A;  4CIE A;  4CHY A;  3LWL A;  4W5Q A;  4DS4 A;  4Z4I A;  1EET A;  4CHZ A;  4PY5 A;  4I2P A;  3NHG A;  5J2Q A;  3I0R A;  4OPK A;  4CEA A;  3AO2 A;  2VG6 A;  4FJ8 A;  3VQ4 A;  2GV9 A;  1RT6 A;  4FK0 A;  1GOA A;  4FW1 A;  4E7J A;  5HBM A;  4KTZ A;  1KVB A;  4M3R A;  1BI4 A;  1X9M A;  2YNI A;  4NCA A;  2HHW A;  1W9H A;  4JS5 A;  3ZT1 A;  4PWD A;  3LZJ A;  4I2Q A;  4RW4 A;  4QCL A;  3O4N A;  1IH7 A;  4B9S A;  3TAE A;  3OYH A;  1EP4 A;  3LPU A;  1VRT A;  3OYB A;  4I9L A;  4CJT A;  4DTU A;  1VSL A;  3JYT A;  3VA3 A;  3M8R A;  1DLO A;  4IFV A;  3MED A;  2RF2 A;  3L2Q A;  1NK5 A;  1L3U A;  4F3T A;  2BDP A;  3RWU A;  1WSE A;  3NF9 A;  4CK2 A;  3KK1 A;  5FRN A;  3HPO A;  1JL2 A;  4W5O A;  2HNZ A;  2ZQB A;  1A5W A;  3AO3 A;  3CM5 A;  1TK5 A;  2F8S A;  4NYN A;  1S1V A;  3VQ5 A;  4CEE A;  3TAQ A;  3ZSV A;  1HYZ A;  1SL2 A;  3PO5 A;  4Z4C A;  3SQ0 A;  3VN5 A;  1TK0 A;  3ZCM A;  2F96 A;  4B8A B;  1FXX A;  1JL1 A;  1KVA A;  1LAW A;  1RBT A;  2RN2 A;  4KHN A;  4DTN A;  2WOM A;  1SUQ A;  2FBY A;  4CGJ A;  3RMA A;  1SKS A;  1YTU A;  1HYV A;  4CF8 A;  1UA1 A;  1VK0 A;  4CJ4 A;  5CYM A;  4CJU A;  1NKB A;  3JSM A;  1RT4 A;  4O0J A;  3VQD A;  3NH0 A;  3SUQ A;  1RT3 A;  4B9L A;  5DK5 A;  3AO5 A;  4DG1 A;  3K5L A;  3SQ2 A;  4FZZ A;  2LSN A;  3KKS A;  4CJ5 A;  1JLF A;  5I42 A;  3TI0 A;  1VSK A;  3NF8 A;  3AVN A;  2E4L A;  3ZSW A;  3ZT4 A;  3OS1 A;  3VQQ A;  4CK1 A;  4FLU A;  5J1E A;  5KTQ A;  4DQR A;  5J2M A;  4ZTJ A;  2R7Y A;  4DWI A;  2O4G A;  1CXU A;  3P1G A;  3KD5 E;  1S1X A;  1SL1 A;  2YNG A;  2ZE2 A;  3S9H A;  1LW0 A;  3LAL A;  4CE9 A;  3AVM A;  1S6P A;  4NCB A;  4PA1 A;  3DLG A;  4CFC A;  3IAY A;  4M3W A;  3MEC A;  4CJV A;  2OYQ A;  1K6Y A;  4LSL A;  4FYD A;  3P5J A;  3K59 A;  4YFU A;  1HMV A;  2XHB A;  4OKE A;  2XO7 A;  3THV A;  4FJ5 A;  3QER A;  1NJW A;  2XY7 A;  3AVI A;  1B92 A;  1J54 A;  4I9Q A;  3TAM A;  3ZT0 A;  3KLI A;  2KZM A;  1RDD A;  2XY8 A;  2RKI A;  4CES A;  2W42 A;  4DQS A;  3SQ4 A;  4F8R A;  4FJ9 A;  1QE1 A;  3NH1 A;  2D0B A;  5SZT A;  4DSL A;  1ASV A;  4OVL A;  4DSK A;  2QXF A;  2Y1J A;  4J2A A;  1WSG A;  3L2U A;  4B9T A;  1U47 A;  4KRE A;  3AO1 A;  2RPI A;  4CFD A;  3IG1 A;  1GOB A;  1RDA A;  3LP1 A;  2OPR A;  4TSX A;  3QES A;  4CEQ A;  3SUN A;  1WLJ A;  3G10 A;  4CJL A;  1HJR A;  5JS2 A;  3SPY A;  5I3U A;  1SKW A;  4C8O A;  3D45 A;  5EU7 A;  4DFJ A;  4ELT A;  1N6Q A;  3L3U A;  1NOZ A;  4DU4 A;  3KLF A;  3M8P A;  4CHQ A;  3OYK A;  1LWF A;  3HJF A;  3ULD A;  1VSE A;  1RDB A;  2X6S A;  3CYM A;  3OYN A;  4KPY A;  3F73 A;  3SZ2 A;  2VG5 A;  5J2P A;  2G8F A;  3KTQ A;  1RTJ A;  3HST B;  4RW6 A;  2HND A;  2IS3 A;  4H4O A;  3TAB A;  4BE0 A;  2VG7 A;  2ITG A;  4CFB A;  4CFA A;  1Q9X A;  4FJM A;  3ISN C;  4J2B A;  2DTU A;  4E7L A;  4FJG A;  3VQB A;  3WNH A;  4HTU A;  3ITH A;  4DF4 A;  3HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...