1KVQA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvqA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvqA01
3KVOA 2Y99A 3VPHA 5HM8A 3GVHA 4XRRA 5JDIC 2AMFA 4NZ9A 4CQLA 2BELA 1R4NB 2WDZA 3JD1A 4OSOA 4LMPA 3TL3A 1XYGA 1VC2A 4WLOA 5BNTA 4YAIA 1IPFA 3F47A 4FFMA 4YAKA 5DCWA 4O0LA 3VHRA 4E33A 2Q1TA 3ZNQA 1LSSA 1SBYA 3DBHB 3VTZA 4DUPA 3DC2A 1JVSA 2F00A 3A9WA 3QJ5A 1HDYA 1VJ1A 4Z0HO 4XR9A 3ZWWA 1YBMA 3ZV5A 2Y1GA 1ADGA 1UR5A 4PG6A 3GVXA 4FBGA 3WGHA 1HZZA 2AG8A 3I6IA 4MVJF 5A03A 1HETA 2BGMA 4YQZA 3WGZA 4LN1A 1R0LA 4FGSA 2FP4A 3ONDA 1JA9A 1DAOA 1KERA 2JFHA 3VZPA 5L45A 3I23A 4E0BA 3DMYA 1EEHA 3V1YA 2EJVA 5H83A 3M6IA 1ISFA 1C14A 3HG7A 3DBRA 1UXIA 3L4BC 3E1KA 1YBVA 2WE7A 4XYGA 1YH3A 2GERA 2RHRA 4YACA 3B6ZA 4UUPA 4EI2A 4PLFA 3BIOA 2GASA 3LLVA 3ITKA 3S55A 5JCJA 5CDGA 5KOIA 5TSDA 4KDEA 2ZB7A 4BO9A 1T4BA 3RD5A 3NV9A 1H94A 1PJCA 4KUGA 1PX0A 1UXJA 3FTNA 3Q6IA 1WP4A 1W4ZA 5TLSA 1DIBA 2WSBA 5B4VA 4B7CA 5B37A 3HB4X 1DC6A 2P4HX 3KSUA 4CLOB 1YDWA 4RVFA 4Z9XA 4D0SA 3GRPA 4XDYA 4BL5A 4CM5A 1E3WA 5CEFA 2NTNA 1YL7A 4XYLA 2D5AA 3KLPX 1CRWG 1B8VA 2VZ8A 3PHHA 5COQA 4D3DA 1ULSA 4O63O 2Z1NA 3DZFA 4DGSA 3ZI0A 1X7HA 3DOCA 2NACA 5ER6A 1BRMA 3C7DB 3UKOA 3ZNOA 1ZMOA 2DTDA 4ZQEA 3PP8A 3IJPA 2BH9A 3GRKA 1KOLA 1R6DA 1WDMA 5AXBA 3UUWA 1NVTA 1FF9A 3JQAA 1B3BA 4UEOA 1LDYA 1CJCA 3JQBA 5T6BA 3GZNB 3U4HA 4E5MA 4WKGA 4JJGA 3VH2A 3BMCB 1XU9A 3KUXA 4BO7A 1LI4A 5MDHA 1RYEA 1N7GA 4N5LA 3D3WB 3PJDA 2F1KA 3PHJA 4BNFA 4CMJA 1IZ9A 1LDMA 1UZNA 3IS3A 3C85A 4PVDA 1AGNA 1BW9A 1E3IA 1VPDA 3F4BA 2DFVA 1PZHA 2OP0A 4IGFA 4KP7A 4UVEA 4Q3EA 1ZZEA 1J5PA 3VPXA 1ORRA 3AOGA 3JV7A 3HHPA 2TMGA 2I65A 1V9LA 4EJ6A 3C1TA 3HFGA 2YDYA 3HN2A 3DFZA 2EP5A 3OMLA 2QRJA 1HDGO 3EVTA 3OJ0A 4S1VA 4U5QA 3UN1A 2WWRA 4XKJA 3ZNNA 2PKQP 2B5VA 3ZH2A 1ZJYA 5FF9A 2VT2A 5TT0A 3FNGA 1F8GA 5ADHA 4H16A 1U4SA 3EHEA 4BNZA 4WOKA 4K1LA 5KVSA 1LDNA 3B1FA 3E9NA 2WD7A 5CDTA 2VT3A 4J9UE 1ZIDA 1U3UA 3Q0EA 2IYOA 2IXAA 1OFGA 4CODB 1U3WA 1LDGA 2CDBA 3M2TA 2VTEA 1O0SA 2B0JA 2W2LD 2SCUA 3E9MA 3QWFA 4LMRA 2VRCA 1WMBA 3E82A 2DBRA 3HN7A 1Z82A 2P2SA 4YAEA 1AHHA 3OJOA 4GL4A 4MIOA 2ET6A 4FB5A 3VPSA 3Q3CA 1RM3A 1XKQA 2J6IA 1E3LA 3JQ6A 3V8BA 3ITDA 4J0FA 1GU7A 4OOFA 2FY8A 4IDGA 3VVCA 3CTMA 1T2CA 3ICCA 5HWSA 1SEVA 2NQ8A 4GAEA 3RC2A 5JDCA 4Q3CA 3NJ8A 4IDAA 9LDTA 4L9RA 1PGOA 3KYBA 4XEHA 5KTKA 4KQXA 4LVUA 4INAA 1ZMTA 5F1OA 1P1KA 4XIYA 4ZRNA 4A27A 5C5IA 3UHAA 4ZD6A 2VNAA 1Y8QB 1DRWA 3B20A 1SO8A 5BNIA 1E1KA 4H15A 2Y93A 3G0OA 4TRMA 3NDIA 3HZZA 5A1TA 2DT5A 4XA8A 4ZVVA 1S7CA 4JNKA 1M75A 4AICA 4NU6A 1ADFA 1LQUA 2G82A 4WCFB 4EZBA 4YJHB 3ROQA 1CWUA 3IKVA 4IMRA 3I3OA 1LDBA 1YKFA 1DC3A 4XB2A 3VH3A 4GX1A 4ND5A 3WGYA 2DBZA 4PZEA 3FR7A 4H7PA 5ITWA 3FD8A 3MJEA 3RJ9A 1NAHA 1HT0A 3HWRA 4RGBA 5HRUA 1N5DA 4J49A 4E21A 3JYOA 1O89A 2NV6A 1PJBA 4WLUA 2CSUA 2QZ9A 2WYVA 3U4CA 4GX2A 3TNLA 4CV0A 4OJNA 1SB8A 4KWHA 4DVJA 4AJLA 2FN7A 1SPXA 3E5RA 2PV7A 3N7UA 4NBTA 1U4OA 3ANMA 5F5LA 1C1XB 1X0XA 4CV2A 1ZSYA 1WMAA 2NQTA 2PTGA 2YHIB 1KEWA 3F46A 3PGJA 4GLOA 2PY6A 2ZYGA 3RC1A 5K0ZA 1JKJA 3GHHA 2Q99A 3FR8A 4JN6B 4ZQGA 3I9KA 4D45A 3INTA 5TX7A 1QYDA 1OC2A 4I9HA 3RUHA 1I5RA 2QX7A 1I0ZA 1MX3A 4BO8A 3N74A 3D3EA 1KETA 4K6CA 3PDUA 1V3UA 4Q9NA 4MVJP 3O8QB 2W2KB 3KYDB 1FDWA 3O03A 5T67A 3PZRA 1JTVA 4BNJA 4I5DA 4AL4A 1CERA 3U4DA 2FZEA 2FZWA 4MKRA 3DBLA 1GTMA 1QR6A 1VLLA 1OC4A 1R4MA 5EL0A 5HBRA 2IZZA 3RVDA 2JHFA 4TRRA 4CL8A 4CV1A 2GZ1A 4FJ0A 5B1YA 3PLRA 4J7XA 4PGFA 3K30A 4GBJA 4CMEA 1IOLA 3P2YA 1BSVA 4AJJA 3OSUA 1JLLA 1XWFA 5CAEA 1EFKA 2HJSA 2DM6A 3F5QA 1E3JA 4PG7A 3GEGA 2GPTA 4EEXA 3PZBA 4RQUA 1QV7A 2DTXA 4ND4A 3H4VA 2X22A 4RPGA 4IDCA 5F5NA 3JQBC 5I9MA 2O3QA 4A7PA 4NQZA 1TLTA 3LSYA 2DTEA 4CM9A 2GN8A 1YJ8A 3DAPA 4JP2A 1XDWA 5G0SA 4Y8VA 1YRLA 4YJFB 3IC5A 2OP1A 4E5NA 2AQHA 3R6DA 4LRSB 1GFSA 3WGTA 1O94A 4FS3A 1SEPA 2XF8A 1CYDA 4BHTA 5F1KA 2C07A 4NJOA 5IG2A 4GKVA 3HDHA 2JHGA 3CEAA 5DCUA 1KY4A 2D1YA 4DL9A 3FWNA 3RKUA 2YQ4A 2GN4A 4LVCA 1YOVB 3PJFA 1U2GA 5JW6A 2WD8A 3JQ9C 3PQDA 4K26A 2P9GA 3W8EA 3OIGA 4EUEA 4XDZA 4OKNA 2H6EA 2O7QA 1LRJA 1MG0A 1MXHA 3VOSA 1P74A 1WWKA 1EVZA 4CMKA 1E5QA 1GDHA 3WFJA 2DPGA 3BZUA 5I8WA 3UF0A 1YS4A 1JAYA 3JQFA 3R0IA 1HLDA 4ZGWA 5EMHA 1AN9A 2OO5A 2X58A 5TRTA 2NADA 2A92A 3V5NA 4RLHA 4GKBA 4I5EA 5DF1A 2Q4EA 3D4OA 4E2XA 3O4RA 4UUMA 4HY3A 2B69A 4UUOA 1ZSNA 2OOSA 1LSUA 4WCDA 4BO6A 4U6SA 3DOJA 1ZJZA 2IDZA 4H3VA 3E6AA 3GNSA 2O48X 4IXWA 1M66A 4UUNA 4RPHA 3PLNA 4TMFA 2GRAA 1P45A 2NUAA 4CM3A 1GZ6A 2O4CA 4BQPA 3FF4A 3K5PA 4J0EA 1UXHA 4DA9A 1DIHA 3JQ7A 4NG5A 3ASUA 1EK6A 3R3JA 5GZ1A 1ZK1A 2VHVA 4IIVA 4MP3A 3KM0A 2DPHA 4RVHA 3LK7A 5JDCC 3W6UA 3WLEA 3IP3A 2C2YA 1ZCJA 4MVJA 2Y1DA 5L4SA 2YV3A 2UDPA 3ONFA 3F9IA 1GYPA 2E48A 2J5QA 2AEFA 3NT2A 1YVEI 2ILTA 3QA9A 4ZN6A 2P68A 4AJHA 5T8KC 3MJ4A 4WLVA 1LLQA 4ND1A 2A94A 2D0IA 5FI3A 5CPFA 4RCVA 3DXFA 3NDJA 1H6BA 2C82A 4I1IA 1EDZA 3O38A 3IAHA 2D59A 1YO6A 3L07A 3LT4A 2H5LA 4UVIA 3QY9A 4RVGA 4Y98A 4IQ0A 1BDMA 3SC6A 4RDIA 3ETDA 3H9EO 4WJZA 2NTVA 3BXXA 1UP7A 4XGNA 1I2CA 4ALLA 4O6VA 4EITA 3DB2A 3TL2A 3DBVO 4G5HA 2NVWA 3GEDA 4TRJA 1BMDA 5JS6A 4OGWA 4OO3A 2PNFA 3JCZA 4CMBA 3Q1LA 4HADA 5IFLA 2C7VA 2IEBA 3Q9NA 4E6PA 1UAGA 4JBIA 3UCXA 4B79A 2I9PA 1PZEA 5JE8A 4BIIA 5AXAA 2A35A 1PQPA 3BMOB 4JK3A 2RBEA 2FMUA 2GN6A 2NWQA 2X9GA 1V3VA 4M8SA 3I5MA 1Y8RB 1YONA 3BA1A 1S6YA 4BGVA 4CMAA 4F6LA 4HP8A 1OZAA 3S2EA 1TXGA 4YT4A 3H3FA 3GVPA 2E6UX 1HSZA 1VE9A 2Y1OA 4ZICA 3HDJA 3GPIA 4MVJG 2JD1A 3COSA 2RIRA 4CR8A 5JFOA 4CM4A 4J1NA 2CFCA 1BVUA 1E7YA 5U4QA 5A5FA 3T4EA 1PSDA 4QO7A 1SOVA 3BMNB 3D4PA 4E4YA 4EEZA 1VJTA 3M1LA 1BXGB 4CPDA 3H5RA 1XU7A 2AE2A 1L7DA 4II3A 2YY7A 4LW8A 1UDCA 3RQSA 4L4XA 2WYWA 4GPD1 1FDVA 2OORA 3GDFA 5GY7A 2UUPA 3JQDA 1VRWA 3CKYA 1GL3A 3RU9A 3WNVA 4DXHA 4CMGA 5B4UA 1U1IA 3BTUA 5A9SA 1UP4A 5EPOA 5FEUA 2EW2A 1X1EA 5EJ2A 2Y68A 3KHUA 2D4AA 3NKLA 5DBFA 1H0KA 2Z1MA 2Y1FA 2EKLA 4KMSA 4HWKA 4L76A 2FOIA 4ALKA 3D4NA 4QQRA 4JIGA 2CF6A 2G5CA 1NM5A 2HK9A 5JLAA 2HKIA 1LEHA 3D0OA 5L7YA 1PL7A 2Q3EA 5JC1A 4PLTA 2X6TA 1WDKA 4BKOA 2CUKA 4QO8A 4FC6A 2EIHA 2LDBA 4D79A 1FJHA 1PS9A 2QRKA 1Z45A 2CVOA 4I9UA 1P1RA 3CINA 2GYYA 1KEVA 2HK8A 1A7KA 4Q3AA 3AUAA 3ON5A 3LF2A 1DJNA 4WEOA 4AVYA 1HKUA 3WBFA 2A9FA 3EGOA 5BSHA 3BYZA 1JQBA 5KNLA 4EYEA 1HYHA 3QP9A 1EK5A 1Q7CA 4TKLA 1DDOA 2X9NA 5ES3A 1WNTA 5JC8A 4IZHA 4CUJA 5K6AC 1T24A 2BFOA 4NR0A 4CLHA 2PLAA 3G1UA 2X0RA 3WMXA 1DB3A 3RUAA 4ITUA 3WGGA 3OEYA 1YXMA 2Y0CA 1O6ZA 4YXFA 1VKNA 4W6ZA 4BMVA 3NGXA 2EKQA 3NRCA 2BF7A 8LDHA 3RFTA 2HK7A 2FR0A 2GGSA 2YV2A 4DC1A 2BGLA 4P8RA 4BO1A 4BNYA 3D5QA 1QLHA 4HX5A 4R51A 4Z0TA 1C0LA 1DSSG 4WE3A 2JKVA 3JD0A 1M6HA 3KYCB 1D1TA 2FSVA 3DONA 3JD2A 3UGKA 1HWYA 3V2HA 3ADPA 4KWIA 2ZB4A 2V65A 4YBZA 2ZB8A 3K8ZA 4Y67A 3QVOA 2X8LA 2HMVA 1N9GA 3MJTA 1P9LA 3ZHYA 1U2DA 3ONEA 5L51A 1ISJA 5EERA 1GPDG 5A3JA 1TEHA 3ADOA 4JP3A 4DPLA 1Y5MA 5THQA 3D64A 1NBOA 4XYBA 4B4OA 1GEEA 4D0RA 3QHAA 4IIUA 4DQUA 2QHXA 4DLLA 2O2SA 3LC1O 2HU2A 3LT0A 1YGYA 3DHNA 1R16A 3IQDB 4XIJA 4RZHA 2AHRA 1G0NA 4U0KA 1IHYA 3WFIA 4EUHA 1UXGA 3CUKA 5G4LA 4GQAA 3ETEA 4TZTA 3QWHA 4R41A 1SB9A 1KEPA 1HDRA 2AQKA 2EG9A 1K6XA 3INRA 4ONEA 5G0UA 3FBGA 1ENOA 1PU2A 1K89A 2Q1SA 3V1UA 4CQMA 3ZWBA 1K0UA 4BMSA 2I6TA 3I9JA 5C3MA 3ZGYA 5L9AA 1ZXBA 5KJ1A 4Q3NA 3K6JA 2I5PO 2Q2QA 3FSRA 1CQIA 4R5MA 4ZQBA 1A27A 3JQGB 5L3ZA 3UFXA 2P9EA 3GVCA 3PFWO 1T1SA 4GSLA 4ID9A 1BXZA 3WMWA 3Q11A 4ALNA 4FOSA 1SMKA 3CZMA 4EW6A 3PHGA 1IL0A 1HTBA 4L74A 4BO3A 2FR8A 3ANNA 3IUPA 5L7WA 2PKQO 4OL9A 4JQCA 4TKMA 4J2HA 3WWYA 1E5LA 1ZEJA 4QEDA 3GAFA 5C7IO 2OXIA 2AQIA 1JN0A 5IF3A 2D2IA 3RI3A 1QYXA 3W4JA 4D41A 2VQ3A 1XQ1A 1DEHA 4NHEA 4FGWA 3KXDA 4YEDA 4LSMA 3TZHA 2VUUA 3JD3A 3EDMA 2CVQA 5A04A 4R3WA 4D43A 3U3XA 4JJFA 3TOZA 3WSVA 4YT8A 1F8FA 4M89A 3DTYA 4B4WA 2PZMA 1DFHA 1LLUA 1OBFO 5H81A 4Y9DA 3DR3A 1WLYA 5FFFA 3EAGA 5JY6A 1FMCA 4CMCA 1DLJA 1HYEA 4KUEA 1HZJA 1UH5A 4LRTB 5KJCA 4CUKA 2NU7A 4FFRA 5ICSA 4IPTA 5IN5A 4PG8A 3CMCO 4RL6A 3TWOA 2Q46A 4KQWA 3H5AA 2RAFA 3W4IA 1UXKA 2VWHA 5F21A 3FCOA 2HDHA 3ZHBA 1LLCA 4RO0A 5F1PA 1EQUA 4K28A 2X5JO 4WEQA 4DPKA 1A7AA 3G49A 3ZWVA 4UEJA 4NBUA 4B8ZA 3ZWPA 3AFNA 1RWBA 3GT0A 4OOEA 3M1AA 4HV4A 3JYPA 2JAHA 1D7OA 2YHUA 4HNHA 1ADCA 3F6YA 1YB5A 3AM5A 4BO2A 3WJAA 3WLFA 5L4LA 4XJSA 4CLRB 5DOVA 3IMFA 2RH8A 2Q45A 4CUZA 3S2FA 4XYMA 4R16A 3WTCA 4J4HA 2ZYAA 4CM8B 4E12A 4ZJUA 1X1TA 1L7EA 2RCYA 5KKAA 3LZ6A 2X1HA 3NTQA 2HQ1A 3OQ1A 3QIVA 4YWJA 3WQSB 3IL2A 2J3KA 3DZHA 3ANLA 4Z9FA 4J3FA 3MEQA 4ALIA 1A9ZA 1ZK0A 3I9LA 3JQ9A 4R54A 3SJ7A 1M76A 5JCXA 4E5YA 4R1SA 4FN4A 4IJKA 4BKPA 5KIAA 5G0TA 2VN8A 2IYPA 5AQ1A 5H82A 4IDBA 4N5NA 7ADHA 4N7RA 1GQ2A 1NFRA 1F06A 2O23A 5CPBA 4PIVA 4IZIA 4GI2A 1E92A 4IGEA 1NVGA 2Q49A 3GNTA 4Z9YA 1C1DA 5T5QA 2C5EA 1I33A 5G0WA 4GSKA 3QWBA 4BMNA 2HMWA 1TVEA 1LX6A 4NMHA 5G4KB 3S1LA 3FHLA 2Y1CA 1H6DA 2EF1A 4R1TA 1GUZA 2D5CA 1VSVA 1GD1O 3DWFA 4IJWA 4PN3A 2VZ0A 2JCVA 2Y0EA 3FI9A 2PD3A 3X2FA 4BS9A 5BSGA 3SLGA 4DC0A 3W6ZA 4K6FA 3H6KA 8ADHA 3GF4A 3WQQA 3WGOA 1YJQA 3E03A 1XR3A 5IDYA 1Y6JA 1HF3A 3KEQA 1HL3A 2C7GA 3PDJA 2DC1A 1GYRA 2NVUA 4WPGA 5FYDA 3S8MA 1QP8A 4DRYA 2OZPA 3GAZA 2ZTMA 3SBOA 4I9NA 3DOOA 3RROA 5LCXA 1U7TA 4PVCA 4YT2A 3KB6A 2EP7A 5TS3A 2QZZA 1EE2A 3K73O 3TQHA 4U6QA 5CFZA 3GQVA 4FOOA 4ND2A 2VUSA 1PGPA 5GZ6A 4ESOA 2YUTA 3T7EA 4Z3KA 3NTRA 2I3GA 1QYVA 2POQX 2W2LA 3QV1A 1SNYA 4E5KA 3WNQA 5T8KA 4AJIA 4YYZA 4CMIA 2NTJA 3WB9A 5DP1A 2G76A 5G0VA 2OMEA 4Z3DA 3RCBA 4QXMA 2JJYA 3ASVA 5A05A 3I83A 3UOGA 1SCUA 4R01A 3E48A 3A1NA 4P22A 2LDXA 1I3MA 1HEUA 3GGPA 1EQ2A 4U0JA 2D8AA 2RH4A 5KVCA 5DN9A 2EWMA 1YQXA 5CDUA 4TVBA 2WYUA 3JQ8A 2GLXA 2J5KA 2EGGA 3PRJA 4IJUA 2DKNA 5ENVA 1DO8A 2O4UX 3WIDA 2GO1A 1RM0A 1RPNA 1UDBA 2YJZA 4S3MA 3C3XA 3KETA 3U5TA 2Y1EA 3L0DA 3VZSA 3AWDA 1B15A 2V7PA 2Z5LA 3I52A 3BMQB 2JCXA 1T1RA 1J0XO 5A9RA 2Y66A 4PLYA 3JYNA 4CQLB 5KJ6A 2HCTA 1QYWA 3NX4A 4UVHA 3JYQA 4IJVA 3RBVA 2B36A 4OAQA 3AI1A 3O26A 4TWRA 4ALMA 1E7QA 3HFSA 3PEFA 5T64A 1E6UA 1NXQA 4L4SA 5IAAA 3KSZO 3DTTA 3AU9A 4PRKA 4FFNA 3ABIA 2FRDA 5AVOA 3ZHXA 2PA3A 2QRLA 2QG4A 3VDQA 2X9VA 4MP8A 4UEKA 3FNEA 4RF5A 4YRDA 4CR7A 5A4DA 4XQ9A 3UICA 1PEDA 4OXYA 3PI7A 2X7HA 2W90A 1GQYA 3PXXA 3WSWA 4TROA 2BD0A 4YJGA 5ER9A 5LC1A 4AJNA 2OL4A 1G6KA 4LCJA 3DZBA 4JGBA 2I66A 4MVJM 2AEJA 3CZRA 4B4UA 3IOYA 1AUPA 1K6JA 3I9OA 1HE4A 1NAIA 2P91A 5I7EA 3OECA 1JKFA 3PHIA 1XQ6A 4IY1A 2P4QA 2ZKLA 4QX6A 5I9LA 4NJMA 4GGPA 3ZDFA 1GZ4A 2BHLA 1IHXA 2H9IA 4URFA 3U49A 1F12A 1WW8A 4EJ0A 2Q1UA 1PJ3A 1I32A 2FPIA 4XGIA 4M49A 3DBRB 3WOHA 3FNFA 4CM7A 3GUCA 3ZWOA 1DRVA 1ZH8A 2PGDA 3JQEA 4PLVA 2VYND 3TZQA 4PLGA 1EZ4A 3K9QO 3OJLA 1N8KA 1R0KA 4HUJA 6ADHA 1P1JA 2ZQYA 1X0VA 4OXNA 4DYDA 3NT5A 1XEAA 4GMGA 1WVGA 3OBBA 2ZTUA 3G3EA 3ZN2A 3MZ0A 2BFPA 3UH1A 3LLSA 4QTZA 4DIOA 4IDDA 4R4JA 3U9LA 5B12A 3KV3O 1U7HA 1P77A 4W82A 5A3VA 3MJCA 4W7HA 4F3YA 1OAAA 2GR9A 1EVYA 3RUDA 3WTBA 3GH3A 1DXYA 4NU5A 4XRGA 1IY8A 1NPYA 4E2YA 1E3WB 4IQGA 2VUTA 1IZ0A 1EUDA 3GGGA 1JVBA 3HADA 1T2EA 5BR7A 2DVMA 2H63A 3NAQA 5HS6A 5BNFA 2QQ5A 4FSHA 4YRBA 5K6AA 1TT5A 2BGKA 3ROKA 1ML3A 3K2BA 1BDBA 2FSSA 4L0QA 1I2BA 3MWDB 1X7DA 4GH5A 1PZGA 4GMFA 4YTEA 4JLWA 1PS0A 3L77A 1UUFA 1TB4A 4F46A 1V6AA 2BRUA 1LUAA 3OJEA 1R4NA 4BO5A 3SEFA 1QKIA 3HUDA 2PZJA 3N58A 4OKIA 4E2ZA 5I9NA 3JQAB 3AY7A 4NDNE 3PIIA 3KEOA 4MKXA 4XWYA 4LGVA 1DC5A 1E77A 4M1QA 3GUYA 1VL0A 3DBHA 1LDEA 2UV8A 4ZHSA 2BKAA 3BHIA 4L4RA 1UAYA 2JFFA 4XGKA 1PTJA 1GEGA 1ISMA 3AOEA 4XCVA 1ENYA 1GADO 1PR3A 4J91A 5TJHA 4FFLA 2XOXA 5CG2A 4JROA 4DMLA 1KVTA 3NTOA 1I36A 3F3SA 2AE1A 4QFDA 1W0CA 3RAJA 4NNJA 3QVSA 4AJOA 1BW9B 2J8ZA 4YAGA 4GWGA 1NQTA 2IE0A 1LLDA 3DHEA 1Z75A 3DMTC 1ARZA 1BVRA 1E1NA 3I1JA 5GMOA 2ZJ1A 3G79A 3ZV3A 1ZXLA 3ZU5A 1WXDA 3EYWA 4TZKA 3B70A 3GK3A 4PZDA 1A4UA 4PLWA 1D1SA 3QE3A 4O59O 4YJDA 4OIMA 1AE1A 3PWKA 4EUFA 3AU8A 1YE3A 3GNQA 3H9GA 3OHSX 2WD7B 1XELA 1K5HA 3ZHZA 3BTOA 1CETA 4OXKA 4E5PA 2CVZA 2TMDA 5AYVA 1DFIA 1I3NA 2CDAA 3VH1A 2Q4BA 3VKUA 3GOHA 3RC7A 4J4TA 4L73A 2H1SA 2O3TA 1U5AA 1DJQA 5G2OA 1N92A 3U0BA 2GF2A 3OP4A 2XAAA 3WYCA 5DBIA 4CLOA 4A03A 2O3RA 1O5IA 3OFSA 5AXCA 3LDHA 5TF4A 4FDAA 2QYTA 1GQQA 4L8VA 3M2PA 3OICA 4F45A 2PD4A 1U3TA 3EZYA 3PK0A 1VM6A 4YVFA 3ZV4A 1RM4A 3QLJA 2CF5A 2DLDA 2QIOA 1U28A 4WNIA 4AJKA 3PHLA 2XPCA 2VZ9A 1SAYA 4XYEA 1C3VA 3D7LA 1I01A 2Q50A 3ZWYA 4AFNA 4BB6A 4FQ8A 3PQFA 5JAMA 4UULA 1E0DA 4L75A 4MINA 4R68A 5COAA 1XLTA 4C4OA 2UVDA 3PYXA 4MIYA 4JJIA 1GR0A 4CV3A 3ENNA 3DZIA 1PZFA 3GDOA 1EE9A 4XQGA 5JYEA 2BFMA 2X5OA 3OQBA 2HMSA 2P5UA 3GZNA 2PZKA 5C7OO 3GFBA 3F5SA 3ZWMA 3VZRA 4BOYA 1PIWA 5ICMA 2EJWA 3BMCA 4IS2A 1B8PA 3ROPA 5DCYA 3UCFA 5TGDA 3OETA 1B0AA 3D3WA 3AUTA 1LC0A 1DHRA 1ONPA 2UUOA 4KTTE 3WQRA 3Q2KA 5IDWA 3QWIA 4GX0A 2W4QA 4J1SA 5I7VA 2OBNA 1TA4A 3QQPA 1R12A 4WNCA 5DBGA 5C37A 3DZJA 5BSEA 3S2IA 1R66A 2ZJ0A 4N54A 1TT7A 1E6EA 1OMOA 4PG4A 2B37A 2ZTVA 4LSWA 3C24A 3MJSA 4DLBA 5FI5A 5TJ9A 3DO5A 3LT1A 2VTDA 4BVAA 4K9DA 1L1FA 3P19A 3LF1A 4WASA 4ZRMA 1ZFNA 4PZCA 4KDFA 3AM3A 4D46A 3BAZA 1GUYA 1DOHA 3KLMX 3U09A 1QSGA 3INGA 3OF2A 4IDFA 5L95A 1EUZA 1Q0LA 2PGLA 1CQJA 4GGOA 3E9QA 4R9RA 1YB1A 2AXQA 5IN4A 2PFGA 1NPDA 4C7KA 3K31A 1ULUA 3NGLA 2G1UA 1H9AA 3HDYA 2HUNA 1GPJA 2R00C 5IXSA 1NNUA 5CDSA 1PL8A 4OHUA 3MOGA 1P3DA 4U7WA 2W8ZA 3EVNA 5L4NA 2HSDA 3GPDG 1YDEA 1FDUA 1VI2A 1EVJA 3DBLB 4NH4A 4AJ4A 4BNLA 1R4MB 5K9ZA 4CJXA 2NVBA 2X5KO 3RFXA 1GV1A 3NUGA 4ZQHA 5B4TA 1KVQA 4IBOA 4E30A 2WE8A 3S2GA 3IDSA 3VKVA 2VHZA 1LA2A 5U1PA 4GVLA 1PJSA 1A9YA 2CZCA 4HFMA 1NHWA 5MGBA 1LJ8A 2CY0A 3WXBA 3GLQA 4OQZA 5JBIA 1N2SA 2VYVD 4DYVA 1GCUA 1Q7GA 2FPGA 4W7IA 4M54A 1ENZA 4BO0A 4MDHA 1NFFA 4BNVA 4FR5A 3K92A 4LK3A 1HE5A 4W99A 5A9TA 4XZ3A 5JSFA 1NP3A 3IJRA 1X15A 5FWNA 4LCEA 3NT4A 3AOEC 1JU9A 1NPTO 2YFQA 4MJLA 3QVXA 3RWBA 3H65A 4WCFA 3PTZA 4YJHA 1BHSA 4ZU3A 3LYLA 4BV8A 4M87A 3VTFA 3A4VA 3L9WA 1XA0A 3KRTA 1MA0A 1WDLA 4RORA 1CDOA 1TT5B 3KO8A 4KZPA 3U4IA 1BGVA 4TQGA 1F0YA 1PGJA 4B8WA 3RU7A 1MXFA 1ZK2A 3KOUA 4EGFA 3GZ4A 1Q0QA 4XQCA 3OJFA 5BT9A 5DT9A 3EK2A 3OM9A 1C1XA 1KS9A 4FIZA 3KBOA 4QECA 2YHIA 4BB5A 1ZW1A 2FHSA 4ZA2A 4DIBA 3TDKA 4TSKA 1HLPA 3H2ZA 3AW9A 1ENPA 4WLNA 3H2SA 1P1FA 3QRWA 1KYQA 4IQ8A 3DQPA 1NYTA 2AG5A 1LU9A 3EY4A 3KTDA 4M55A 1H93A 2IODA 1NQOA 4RPKA 1KY5A 3DZKA 5JCJD 2EHDA 5J23A 1AXEA 4ILKA 1IB6A 3UW3A 4Q3DA 4DIFA 3O8QA 2W2KA 3KYDA 3WICA 2JD0A 4XR4A 4J1TA 3WBBA 2JD2A 2X23A 3DAGA 1A72A 2YV1A 4IINA 1Y5RA 4YAJA 4B7XA 3CPSA 1Y1PA 4PLHA 1HDZA 1X14A 3PJEA 3JQ7B 4UAGA 2FPPA 5DNAA 4CMHA 5JAZA 2PGJA 5DP2A 3FPLA 1M6WA 4AG3A 2VOJA 3TF5A 3GR6A 4JXKA 4MVJH 2I99A 4MIEA 3IKTA 5A06A 3SX2A 1R15A 1U5CA 3HQ4O 4FC7A 1Q1NA 4OM8A 1DBVO 1CIVA 2I3AA 2C59A 1YL5A 1LQTA 1AHIA 3L6OO 1WZIA 4JCOA 1ONOA 5JMWA 2XXBA 3V1TC 2BFAA 3G17A 3ETGA 3DAFA 2WEKA 2C54A 3HSKA 3PWSA 2HLPA 3W8DA 1HSOA 1HE2A 1YQDA 3AI2A 1H9BA 2BI7A 2IEDA 3GFGA 1P44A 4YJFA 1ISIA 3RC9A 2B35A 1DIRA 3JQAD 1KVRA 5DDIP 2J3HA 2WTBA 2I76A 3EUWA 4GVXA 2P9CA 2DBQA 5THKA 1DPGA 4CLEA 3RBZA 3DDNA 3TOXA 4BNHA 1Y9AA 3GG9A 3GN2A 4O1MA 3VDRA 1NVMB 4AJ1A 1YOVA 1E1MA 2DAPA 2EKPA 3WX0A 1MFPA 4NPCA 5L7TA 5F3RA 2DBVO 2HJRA 1FDSA 1NR1A 1Q2XA 1GAEO 2EXXA 5CDYA 4RF4A 3TFQA 4RVDA 1MV8A 4B4VA 3PWZA 2VWGA 2GZ2A 1PJQA 1T25A 2GD1O 2PR2A 2UYYA 4Y6SA 1G1AA 3PGXA 1HDXA 3AY6A 5TQVA 3V2GA 3G1TA 2P5YA 3PQEA 3ZU2A 4EJMA 3NDRA 3C7CB 5KCZA 5JAIA 2YQ5A 3MCVA 4FPXA 3PPIA 3WJ7A 3DZGA 2UAGA 5A5EA 3W1VA 1T4DA 4CM4B 4NI5A 1X7GA 1ZK3A 1MB4A 3FBTA 3L6EA 2C20A 4FJ1A 3H9JA 5KVQA 4Q3BA 4RPJA 3QWAA 3H9UA 3DEYX 2O3UA 4W9NC 4BUCA 3DFUA 3RUFA 3SJUA 3PYLA 3SXPA 3OA2A 4UREA 3F1KA 3RASA 4BNKA 2IXBA 1W6UA 1YB4A 3PJGA 1I3LA 4DBVO 1KEUA 1V0JA 2O3SA 5DZSA 1NWCA 5A9SB 4BQRA 2VCYA 4WECA 3AUUA 2NM0A 2V6FA 2YZ7A 3P2OA 2VRCD 1Z73A 3DHYA 1P0FA 1IYZA 4TRNA 5KJEA 1FXSA 3TZKA 2X0JA 3CMMA 1UDAA 3IP1A 4YPOA 1B7GO 4Z6KA 4XX0A 1QV6A 3H8VA 1ZVMA 1DLIA 1KC3A 2V6GA 5CHEA 5COBA 3C1OA 3EMKA 3GG2A 4HFNA 2VHWA 3FN4A 1SC6A 2Q2VA 3P5SA 2G17A 3HJAA 4KTVE 1B8UA 2I67A 2O3JA 3AUSA 3W8FA 1WPQA 3ZU4A 4G2NA 2CD9A 1W8DA 1PJ2A 2B5WA 2PZLA 4J7UA 3GN1A 4QT0A 2IRWA 3OEWA 4WCFC 3SVTA 4F6CA 3DMTA 3L4SO 2PH3A 1MC5A 3OIDA 4BKUA 1QG6A 4QFCA 4RLSA 2ZTLA 3A06A 4WGGA 3TSCA 3EC7A 4BO4A 2ZATA 1Q7BA 2CDCA 1ZBQA 1I30A 1HE3A 3MTJA 3UXYA 3TN7A 1C0IA 2OFPA 4YCAA 3HNPA 1T2AA 4NBWA 5IZCC 5IZ4A 2E37A 3K96A 2QW8A 4HXYA 3VAZA 1UP6A 1DFGA 3HDQA 4IDEA 3E8XA 3GY0A 4RF3A 2GN9A 2HRBA 1MG5A 2GCGA 2OHXA 4M86A 4BNGA 1K2WA 1E3EA 2PH5A 4NK4A 3IUSA 1Z6ZA 3GMSA 3AM4A 3FNHA 1B26A 1GV0A 3HB5X 4WLEA 3ZNPA 4BGIA 4HNGA 4Y6RA 3JTMA 4Q39A 1JDJA 2WJPA 4DBZA 1P0CA 5JNLA 3FWZA 1F17A 2FWMX 3QVTA 1O95A 3BMOA 5AOVA 4E31A 1B14A 1M2WA 5JO0A 1Y8RA 5JYDA 5IDQA 2ZCUA 1HYGA 4BNMA 4UVDA 1DIAA 4RDHA 1N9GB 4YR9A 4II2A 3NEPX 1RM5A 1I3KA 1GCOA 4QUKA 5AXDA 4B3JA 5U9CA 3ROMA 4GX5A 1RKXA 4A26A 3WYEA 2O2YA 5JPIA 4E3ZA 1O8CA 4KOAA 3JYLA 1U3VA 3JSAA 1I8TA 4J9VA 3KZVA 3BMNA 1OOEA 2JL1A 1XCBA 2Q2WA 1O9BA 1BXGA 3ZU3A 2EV9A 1DC4A 4I08A 5KJFA 4FD3A 1BXKA 3TZCA 1EBUA 5TC4A 3LT2A 4R5HA 2XXJA 5ENDA 4DMMA 1DIGA 3GMDA 5IDXA 4AJEA 3GGOA 1VJ0A 1D3AA 3OIFA 1I2ZA 4CQMB 3P7MA 3UAGA 3FRJA 2HMUA 4GWKA 1H6CA 2PK3A 3PFFA 3AY3A 1ADBA 1PQWA 5EESA 1DRUA 2DQ4A 3CSDA 5EINA 1SZJG 5KVVA 2OGUA 2ZK7A 3EZLA 3QVWA 1A4IA 4BNIA 4BKRA 1QMGA 3GC6A 1E1LA 3GDGA 2J5RA 3LVFO 1FDTA 1UZLA 1ZNQO 4MOWA 3TFOA 3H3JA 1GYQA 3H7AA 4RQTA 3SC4A 5JXWA 1IULA 2C0CA 1RYDA 1T2DA 3LC2O 3C1AA 4RV9A 4A73A 5BSFA 5ILOA 1A71A 1VL8A 1LNQA 4CM9D 1PGNA 3AI3A 4E13A 9LDBA 3OA0A 2VHXA 5T57A 3U62A 5HA5A 3PIDA 2PKRA 4DPMA 3BTSA 4CL3A 1I24A 1ONNA 3OH8A 1HDCA 3I4CA 4J90A 4D44A 4CM6A 2FR1A 3L6DA 4PLCA 3STHA 4CM1A 1B2LA 1DAPA 5C7LO 5HTOA 5I8ZA 3D5TA 4I5GA 1XSEA 3MWEB 2JFGA 3WR5A 3Q9UA 3LU1A 5JAQA 4BGEA 1ID1A 4XB1A 1CEQA 3H9QA 3I4FA 4HFJA 3RUEA 2R00A 3V2UA 2VWPA 3CXRA 3KYCA 5CEEA 4P38A 4JX8A 2D3TA 3ULKA 4RPLA 2Y67A 3SLKA 2VYNA 4XJTA 3W4KA 2AQ8A 1UJMA 3F4LA 3FTPA 2CMDA 4GLLA 2GSDA 4I8XA 4YA6A 4A0SA 4DTIA 4WLFA 2IZ1A 3UCEA 4BNWA 1PWZA 3BHJA 1VSUA 3TPCA 1MGOA 5I7FA 1JW9B 3E18A 4J6FA 2J3JA 1EVIA 1H5QA 1VL6A 1HXHA 1P1HA 3JQCA 1GZ3A 2E49A 4NFSA 4E32A 1JWBB 3FPCA 1QXSA 1HDOA 3R3SA 4CLDA 2BI8A 1ISGA 3B1KA 2NU9A 4N5MA 3WYBA 3LQFA 4R1UA 1Y7TA 3VC7A 1NX6A 1E6WA 3HE3A 4NBRA 2AW5A 2NNLD 2GNAA 4WK6A 1NQAO 3WIEA 4B7UA 2V6BA 3RUIA 4CR6A 2QYSA 4JBGA 3UVEA 2EW8A 1J6UA 3GHYA 4HKTA 3ZWNA 5EQDA 2R2GA 3AK4A 3PVZA 4EBFA 4QSMA 1EMDA 1I10A 2PWZA 2E4AA 3E5MA 1QORA 1M67A 1Y81A 1J4AA 3TZ6A 2NU6A 2YYYA 1ZKMA 4IXTA 1P31A 1LRLA 3AFMA 3JQGA 2VRBA 4MVJD 5L40A 3C8MA 4PRLA 1U8FO 5CEJA 5JY1A 1Z7EA 3WG9A 2GDZA 2B4QA 2X0IA 3I9MA 4MVJI 2G0TA 1K3TA 1K6IA 4TVOA 1R0SA 4D3SA 1XGKA 4JBHA 2WMDA 2A4KA 4XD2A 3WGQA 1JKIA 1H6AA 1NWHA 2EERA 4FFPA 5DOZA 3TRIA 1KC1A 5JDIA 1B16A 2C2XA 4NK5A 4ZQFA 3WS7A 4FW8A 4MKZA 4NFHA 3RSHA 3O9ZA 1PJ4A 2Q1WA 1C1DB 1WZEA 3R1IA 3ZCXA 2GZ3A 2HAEA 3RUCA 2C5AA 4U8GA 5IJZA 4J16A 4I5FA 3ZWAA 1NASA 1E7RA 2O7SA 1PWXA 2HRZA 2V6MA 2X0NA 1G0OA 4LISA 2VHYA 1LXCA 1MFZA 1GY8A 1PR9A 3CE6A 1MC4A 3GVIA 1QLJA 4OH1A 3I9NA 5ILGA 2X4GA 2NU8A 1ZK4A 1YQGA 1D8AA 4DWVA 4BNUA 4CLXA 2W98A 3ZW8A 1V8BA 2AA3A 4OQYA 3ENKA 4ALJA 1PJTA 3AJRA 4IM7A 1A5ZA 3ZZNA 1SOWA 2JAPA 2NVUB 4YDRA 4OMUA 1W73A 4A5OA 2PD6A 4BNXA 3X2EA 1GUFA 3C7AA 1C0KA 1P1IA 3D1LA 1BG6A 3VPFA 2YDXA 3RBXA 3L4BA 4BNNA 5LDGA 5A02A 5DULA 1V35A 4OYRA 4PCVA 4B3HA 1NTOA 3VH4A 3WWZA 4DQVA 4O5OA 4MPDA 4MVJE 2GUGA 3TJRA 5I7SA 2HO5A 1P33A 3Q2IA 3ZV6A 3ZWCA 3RKRA 3WDSA 1WAMA 6LDHA 4W4TA 1ZEMA 4D42A 2Y0DA 3A28A 4Z0PA 5TNXA 5ITVA 4CMIB 1XHLA 2NLOA 4IMPA 1BTOA 2EGHA 3DL2A 5HS4A 1KVSA 1OI7A 1PJLA 3ORFA 4YRAA 1C0PA 5EQFA 1N1EA 3RFVA 1NQ5A 3K2EA 4PLZA 1JWAB 1NFQA 1R37A 5LDHA 4CLRA 2AEMA 1PL6A 1T26A 1IUKA 5CP8A 2VWQA 1Y9EA 1AXGA 1DHTA 3JQ8B 4J2OA 4P4LA 3VVBA 3EW7A 1VKOA 1N7HA 4CM8A 1E7MA 4D7AA 1E7SA 2BMAA 1EBFA 1KVUA 4PFJA 4D3FA 4YQYA 1LC3A 2J3IA 2Z95A 1LSOA 4FJ2A 4NFYA 4DLAA 4J43A 3VZQA 1JAXA 1E7WA 2ZIZA 1H2HA 1EDOA 1YWGO 5GZ3A 2HMTA 1LBEA 1YBAA 5EIOA 2YW9A 4J1QA 3VPGA 2DFDA 4EDFA 1YL6A 4A2CA 1X13A 3ZWXA 3PYMA 1LRKA 3IIEA 1XIVA 4R9SA 3RJ5A 3BHMA 4ROSA 5KKCA 4KUHA 4N18A 1V3TA 1J49A 3I6QA 4P4GA 3LC7O 3KSDO 4G81A 4NIMA 4CMEC 4HBGA 2O50A 2IZ0A 4YJGB 3GA0A 3MJVA 2DU8A 3QW2A 4RVUA 1CF2O 5G4KA 5JO9A 3RIHA 1EFLA 4A10A 2BLLA 4R1NA 2NSDA 4MP6A 1BWSA 1H2BA 4YB8A 2CNBA 2YFHA 5CG1A 1PGQA 5TIIA 2DUUA 1ISHA 4W9NA 4DREA 2JCYA 3NYWA 3L9XA 3T7CA 5TT1A 4PLPA 4AJ2A 2VNSA 4P4NA 1EUCA 4RJTA 4R69A 3T4XA 3OQ6A 1NR7A 2B4TO 4BV9A 1F14A 4NJMB 2OBYA 1Q0HA 1HRDA 2ZQZA 4NBVA 4UVGA 1QYCA 4B3IA 4BNTA 2RHCA 3F1LA 2ZYDA 3JD4A 3A14A 1NHGA 1IE3A 4FFOA 1PQUA 1MP0A 4RZIA 1MLDA 4J7CA 2Y05A 7MDHA 1KBZA 5BQFA 4BGUA 1U8XX 1PS8A 4Y6PA 3ST7A 4J4BA 2B83A 4RF2A 1RJWA 1D4FA 4X54A 4DQXA 4C7JA 1ZUD1 1Y8QA 2VOEA 3CIFA 4HFRA 4YT5A 1N1GA 4E2WA 4PG5A 2ZB3A 5KWEA 1UZMA 2ZCVA 3MTGA 2B4RO 1Z74A 1T2FA 2EEZA 4RVSA 3ZW9A 4XQEA 1QRRA 1LSJA 3ICPA 4IS3A 4WUVA 1ZSVA 1LTHR 3JQFC 4FCCA 1ZO8A 2DUWA 2OUIA 4WOJA 4G65A 1FK8A 4R3NA 2E82A 1XG5A 1U9JA 5IXYA 3H5NA 1KIFA 3CH6A 3NJ4A 1MUUA 2X86A 1E3SA 3GEMA 3QSGA 4ND3A 4AJPA 3B1JA 2C29D 4MO2A 2R6JA 1TI7A 1Z7BA 4CQMD 3MOIA 4IUYA 2WM3A 5IZCA 3BTVA 1B3RA 4OSPA 5L53A 2VYVA 3WGIA 5JMPA 4BKQA 1IPEA 5EN4A 3BMQA
chains in the Genus database with same CATH superfamily
4QOGA 3EXAA 4YP6A 1MT3A 4BEWA 2BFDA 4NZ9A 5JS2A 3C8HA 2FQQA 3AILA 2P9ZA 5B7GA 1JDSA 1TYDE 2D7CA 1RC0A 4HNSA 4N39A 5B36A 4I4TF 4WLOA 3M9XA 1C81A 3LAWA 2HF7A 4YAKA 5JWRA 4E33A 4BTEA 3O4IA 4N7MA 4TLLB 1M1YE 3VTZA 2M1ZA 5ALOA 4DUPA 1MX9A 2AZMA 2XNDA 2ID4A 2QLFA 3AF4A 3K4PA 3RARA 1J42A 4RZQA 3OD1A 4E22A 1YBMA 4BRZA 1U0GA 3SSOA 1OBHA 2Y1GA 3B48A 2OXTA 3AP1A 1HV8A 1RWQA 2ZAMA 4PG6A 1JR3A 1T9KA 2RSLA 1HLGA 2QLLA 3O3OB 4MWDA 5JARA 4M4SA 4OY3A 5FPSA 2BEUA 4K9OA 4YQZA 4UMVA 3UMFA 3WGZA 4LN1A 5EXTA 4DQKA 2YIMA 4FGSA 2FP4A 2MYPA 3V00A 3C8DA 5K3SA 1JA9A 1WBDA 1DAOA 1V37A 2OGSA 2JFHA 3VZPA 2ZWOA 5KCMA 2JI6A 3DF9A 1FP4A 1U81A 4MIKA 4C0AC 3R9XB 1MJFA 2VF8A 3RVQA 3DMYA 1IJBA 3EEFA 4K8RB 4PX9A 3IHKA 3G9QA 3M6IA 1MOQA 1C14A 3T4UA 4N7JA 2WIBA 1RLUA 4RD3A 3L4BC 1FP6A 4KN8A 4L95C 4RETA 1DO0A 3MWYW 1MD9A 4XYGA 1XZCA 5DX0A 4AUNA 4BN5A 3NPAA 4V2IA 2GAOA 1CS0A 2RHRA 1UC9A 2BY4A 1Q74A 3JZFA 1H2AS 4D9FA 3BIOA 3JASA 4EI2A 2GASA 3KOWA 3CH5A 5CFQA 5KOIA 2C2MA 1PSWA 1K75A 1QO9A 1T91A 3MJHA 4KR6A 2G5GX 4CNBA 3UPTA 1XCGB 1PJCA 4M37A 3RFUA 2EFYA 5JBNA 3ECAA 4DWWA 4X63A 1KL7A 3AR5A 1GQOA 3IAS6 3JQQA 1DIBA 2FW0A 1YS2X 4RTSA 4OI1A 5BV7A 1D2RA 5B37A 2B8WA 1DC6A 1CTQA 1PUIA 2P4HX 3V2IA 4Z9XA 1AZSC 1KKLA 2NX2A 3GRPA 2Z2IA 1V11B 2ZU6A 3GUUA 3P9KA 4W1QA 4BL5A 2F55A 1I7SB 3QE0A 5EE1A 1Q77A 1SR8A 1ZJJA 1RVV1 1KEZA 1LY1A 2GAFA 2PMWB 1U98A 4PE5B 3TEFA 4XYLA 1CRWG 4KHZA 1P72A 2VZ8A 1MOPA 1NKTA 2FW1A 4W6QA 4B47A 1APBA 4MUAA 4AMYA 4C0HA 2X40A 2UYOA 1YFJA 1V43A 1QZTA 2XB8A 3RVPA 3DOCA 1IHDA 1W5SA 2W43A 5A3SA 4POOA 5ED4A 5KU7A 4FHGA 3T1TA 1RCTE 4MV6A 4BP3A 1V1MA 2P4EA 2CC2A 1ZI8A 2OORC 3DMGA 4HPJB 1HE8B 2FWNA 2R48A 5BYBA 1PNVA 4M99A 3ZC3A 4GOKA 3GRKA 1T6ZA 1XEWY 1KOLA 1MAUA 3HCCA 5FA5A 3ICWA 4LYGA 1KQOA 2C2ZA 4L4YA 1I2AA 3ELUA 3TXYA 2VC2B 4FZVA 3KQVA 5JNVA 3TTXA 4P86A 4UEOA 1MORA 1XPJA 1YSCA 2EKDA 1QG4A 3KJIA 2NSHA 2Q3HA 5EMJA 4I19A 3MAAC 1FFHA 4R8RA 2BT4A 4B35A 2A0WA 5ALEA 1NLYA 4F71A 1ZNWA 2V7UA 3KUXA 2IXFA 1HQYE 3W3AD 1PRYA 1J20A 5MDHA 1N7GA 5LXTB 4CRWB 3TW8B 1NM5C 2GRJA 2CL5A 3D3WB 3GJ3A 4MS4B 2F1KA 3T0GA 1QO0A 1UF9A 2B98A 3UJ8A 3IS3A 5CFRA 1LPOA 3QITA 4FDMA 1G21E 4GI7A 4PVDA 4UNQA 3UHJA 4AKSA 1RRVA 2GFHA 1E3IA 2DQKA 4UVEA 4Z4FA 1PZHA 2HRCA 3A6JA 1HM5A 1ZZEA 4EF4A 3F8SA 2SNIE 3FYTA 2VBCA 1ORRA 1IXKA 1ZKDA 1V2HE 3HHPA 3TJMA 3PXBA 1FSPA 2I65A 1V9LA 1HOTA 3C15C 1Q2UA 2YICA 3C1TA 3HFJA 3I09A 4EJ6A 3OMLA 4KO1S 4JLDA 4X20B 1HDGO 4JLKA 5AVJA 3EVTA 3OJ0A 4X7MA 3H2KA 1D4OA 1V8OA 1IIRA 4JZKA 1J0BA 4L1KA 3MINA 4QSHA 4B71A 3U19A 3ZNNA 2CB9A 3JWJA 2B5VA 3ZH2A 4DV4B 3W6OA 1ZJYA 3D7RA 5AESA 3LX4A 1KFKB 3M5WA 4Y2HA 5K5EA 2CMKA 3JY6A 2OLEA 2XT6A 3TTTA 5ADHA 4OP3A 3S1SA 5B58C 3WMGA 5IBPA 4E5VA 4H0NA 4BNZA 1K8QA 1X7YA 3CLUC 1C50A 4W9MC 2XUGA 5HFNA 4GP9A 3B1FA 4OFWA 4RZXA 2J3EA 4LYAA 4GI1A 2AOWA 4J9UE 1EP3B 1ZIDA 3ETLA 2H48A 4HNAB 1U3UA 3G0IA 5EKXA 5C9ZA 1F2TA 1UQUA 2QMOA 1MDBA 1VA4A 3QX9A 2EQ5A 1GO2A 2PU5A 3LL7A 2QXUA 1OFGA 2E0IA 2FZGA 2HEIA 3K6SB 5B1SA 3DDHA 2XT9A 5KMGB 3VC1A 2CDBA 1O0SA 2B0JA 2DFPA 2I78A 3GZTB 4L6CA 2W5UA 1KO4A 1CYEA 5M29A 1WOYA 1BKSB 3PR1A 3V9AA 3W0LB 2IHNA 1K9SA 2P6UA 1VLHA 1Z82A 1AHHA 1XVUA 3QELB 4IYJA 2IV3A 1H4VB 5K3EA 1PJZA 2H1WA 3FPFA 3ORRA 4ZT3A 5LZ4A 1UMBA 2ZDHA 1RYBA 2GCOA 5D1NA 2R8PA 4MB6A 4J0FA 3OZXA 4MPRA 4WHMA 2DUJA 5IAKA 4O4IF 1X8KA 2BFEB 4IDAA 2PFSA 1QG0A 3R9KA 4YMIA 3VR2D 4L9RA 3OWXA 1M1ZA 3KYBA 2GN2A 2VTKA 3E9DA 1B1CA 4GQIA 4H7JA 4TSRA 5KTKA 2IFTA 3PNBA 4LHZA 1ZMTA 4NICA 5F1OA 5BO5A 2BFBA 3AF5A 4XIYA 1Y3IA 4C4RA 3TEMA 2A67A 4TM7A 4ZD6A 4ROTA 3ZCUA 1FTQA 1OASA 1VYHA 2OCIA 7REQA 1RC1A 5BNIA 4H15A 2PO7A 4O02B 4QYIB 3WB0A 1SXQA 1FDIA 4PC2A 1KAQA 4TLEA 3NDIA 2AIRA 1RHKA 1U2EA 4XOIA 1F20A 2DT5A 2RHBA 3HLYA 3N2LA 3BD7A 2AD1A 5A1TA 3GJTA 5GONB 1MHPA 3VKHA 1E4VA 4JNKA 3VSBA 4D9CA 1N2CB 4NU6A 5BWOA 4W5NA 2CWDA 2C9OA 4F4UA 3ZHOA 1CWUA 1G64A 3SC2A 1FXUA 4IMRA 3F7MA 1TNDA 1YKFA 2VP5A 1AHNA 1PF7E 1W29A 1YZ3A 3D8SA 5DLEA 3TIIA 1ZAYA 5D01A 2DBZA 5J5VA 5FR2A 1TJYA 3RC3A 3KCNA 2A3NA 1VMIA 3FD8A 2RK6A 2XIJA 3MJEA 1NAHA 4Q12A 3RJ9A 1DO2A 1HT0A 2ZUSA 2IZ7A 4M0PA 2MSNA 5ICFA 1MZPA 3ZY3A 1N5DA 1TIPA 2PQ2A 2ZRPA 3QKUA 3UG6A 2ZIXA 1AF4A 2C98A 2NV6A 2O54A 4QM6A 3OY7A 2CSUA 1GRNA 2HPHA 2Q29A 4I7EA 1GUBA 4IFEA 1SVOA 5FJIA 3RS9A 2ZDGA 4OJNA 3FDZA 4KWHA 3KYJB 4XUEA 3B60A 3ZCTA 5DI3B 4EYSA 2BTOA 4AJLA 1GNLA 4ZEWA 3TOCA 1W0JD 1WABA 2XYVA 2FKNA 2J45A 3IP8A 3ANMA 2PXCA 4HZUB 3U17A 2A9VA 1C1XB 3NIFB 3TQSA 2FWPA 3A2LA 3OU6A 2P9FA 1X42A 1KEWA 3PGJA 5LJIA 1W5FA 2FMKA 1Z4OA 5IJ9B 1M8JA 4G0WA 2FFAA 1WMFA 5FPQA 4CIAA 2UXBB 3E3AA 4TQ9A 2ODBA 7ABPA 1J22A 4OU4A 1T6XA 2FPSA 2G28A 4EWLA 4QFBA 3FR8A 3Q7QA 2J6HA 3E9EA 2Z5VA 1W4RA 4NCXA 1JDBC 1WSDA 3TIGA 2G9VA 2QX7A 4PX3A 4H1VA 5E4TA 1MX3A 3OLQA 2MTBA 3RS3A 2WU8A 1TCCA 3N74A 3PNYA 1KETA 5G1PA 3T7IA 3WRYC 4F6RB 1EFAA 2QSZA 2V3WA 1KAOA 1MJGA 1ODTC 3HRKA 2EP8A 2JGLA 1C7RA 2W2KB 3KYDB 3LXMA 5CH3A 2PMCA 1VTKA 1QIFA 1QHSA 1RIFA 5EY5B 3VSAA 2IYNA 3IE2A 2FZWA 1H3NA 5HDBB 1WB9A 4LDPA 2HF2A 1GTMA 1QR6A 1VLLA 1NMEA 1VPTA 5CMLA 5TARA 4BFXA 4KXLA 1C9NA 1CUAA 2HRRA 2IYXA 2JHFA 3CWCA 4JC4A 3MCTA 5EWMB 5JFTA 2AGVA 4J7XA 4PGFA 4RHXA 1KO5A 1P5RA 4O4HF 1VKRA 3A9VA 4KBGA 1QVVA 4W63A 1YTUA 2WIAA 3FTFA 1OI3A 2I2AA 2O1WA 3WBKA 1IOLA 3PQ5A 3GLIB 5J2UB 1QTIA 1JR2A 5DGIA 4AJJA 1OLXA 1LFAA 4RWZA 2C57A 1EFKA 1VP3A 5DIZA 3LYAA 2HJSA 2XZLA 2ZJ2A 3IHLA 3OX3A 1SVMA 4PG7A 2GPTA 2RAUA 2QGZA 4QOSA 2M1XA 3VR4H 1QV7A 3LWZA 1XK7A 4GXNA 5CT6A 4UZSA 1SXJA 4U7JA 1SQ0A 2HA7A 3BQ9A 3JQBC 5I9MA 3GXBA 1L8XA 1W1IA 3QTLA 3HA7A 4RS3A 4S2UA 4N3AA 5FPTA 5HZKA 3W5AA 5K3FB 2I22A 1C2TA 1O54A 3TOVA 3LSYA 3H11A 1I6WA 4JXXA 1YJ8A 2WG0A 1JHPA 4JP2A 2QN1A 2RGUA 4HMOA 4YRLA 5G0SA 5J47A 3MHPA 1KYTA 4GOJA 2OP1A 2IKSA 1AIPA 3IPXA 1QRUA 1O96A 4C1NA 4LRSB 5TQ0A 5BRAA 2Q3LA 1O94A 2IWRA 2CLCX 5LM3A 1CYDA 2O8BA 4DM3A 2IYUA 3MW8A 5F1KA 3TPFA 3CRRA 1RADA 3QBTA 4D92A 3DNMA 3HDHA 1D2CA 4F3KA 1GTVA 2J0UB 1CUWA 2ZEJA 4NP6A 4EHJA 2C83A 3CSSA 4G4SO 2D1YA 4KAFA 2ZRGA 3UGQA 1FFBA 3MELA 3FWNA 3AF3A 2YQ4A 5DX1A 1NP6A 1TMKA 2ATCA 2XZDA 4Q9KA 3RKUA 1SC4A 4JI7B 3UJ7A 3N0RA 2ZB2A 3FZGA 1FFXA 1V8FA 2X4IA 3HJNA 2P9GA 2IOQA 4XCXA 1L8LA 5DGCA 2MYNA 2E4ZA 1FB5A 4MDYA 2H6EA 4O3FA 3VOSA 2VNKA 1U2QA 3DPIA 3GGDA 1X94A 3VHQA 3WY9A 4MPTA 1EVZA 2OGWA 3DVAA 3TLMA 4CMKA 4EVRA 1H9CA 2DPGA 3BZUA 2PZ8A 3M4NA 4Q3LA 3ZK9A 2HHHB 2DPLA 1ISRA 2C0PA 3ZQKA 1D9ZA 5B6JA 3VR6D 4AP9A 2HBZA 4ZGWA 1I0IA 2LIVA 3D6NB 3V7NA 5EMHA 4GPZA 4QPNA 3HJRA 1GPH1 1NJ2A 3NVKI 3FRHA 1TF5A 1G4UR 1WEHA 4GKBA 3DP9A 1FVHA 2XSZA 2PMKA 3O4RA 4E2XA 2BHSA 2V9PA 1VZ3A 1AA9A 4MLZA 4JI2B 2C2WA 1L0BA 2E1RA 3HO6A 4QDJA 3ILVA 4DCGA 1B00A 1MH1A 5HF6A 1JI3A 3D7NA 5DHPA 3VX4A 4KBFA 2ZIUB 4B81A 2JGJA 4I4TA 2ZYVX 4WCDA 4J0CA 2K87A 2X9LA 1Q92A 3KOYA 4MTLA 3ABRB 3KVNA 4OMDA 1ZJZA 2IDZA 1ZISA 3OLZA 3CRVA 2QJTA 4F9FA 2P5TB 4MGZR 3VYTB 2ZXFA 4IXWA 4NY1A 3RT1A 4UUNA 4RPHA 4W5JA 4JU8A 2GRAA 3K5PA 5KYNA 4KAAA 4M6WA 4KOEC 2QSYA 1U3DA 1KI2A 2R8XA 4UKDA 4O2BF 3LBNA 4LHXA 1N78A 5EHNA 3W6UA 1C8LA 3DGEC 4HOYA 3WLEA 4WY5A 4XLZA 4J0DA 3V4ZA 4DVGA 4HJRA 1HNNA 2AN1A 2V55B 3A9RA 6NULA 4KLZA 1POXA 2V6IA 4RJJA 1XLWA 3H2YA 4CI9A 4XX0B 5A7HA 2Y1DA 2OSVA 3DLTA 3CBGA 2IYEA 4Q4AA 2IYVA 5CHYA 2HR1A 4K2HA 2BUBA 2UDPA 2YV3A 4B3GA 1FNNA 3ONFA 1OXUA 2JRCA 3DE3X 4M21A 1M8GA 4UOQA 1GYPA 4NC9A 4PPQA 1EM8A 1N6PA 2JH8A 1JYFA 1PFWA 2JEOA 3NT2A 2QVYX 2BEJA 4C4AA 2OHOA 4GPIB 5IM4F 1QOZA 2P68A 4RESA 5T8KC 3K70C 4WLVA 2QPTA 2B21A 3TR0A 3UENA 3HM2A 3T3GA 4OP2A 2D0IA 8GPBA 4TSFD 1VSBA 2IEGA 3REQB 3ZDFA 2VR1A 1EDZA 3O38A 4V0KA 5ALDA 4KL8S 3U9TA 2A9RA 1XCOA 1UMDB 2G0AA 3L07A 5JAOA 1D07A 1GN8A 1QBGA 2QN2A 5H3LA 1THMA 1BDMA 1C5KA 1N77A 4A0FA 3HPRA 1BOFA 1XTPA 2G9RA 3ETDA 3PS9A 2Q9UA 4WJZA 2NTVA 2WTEA 2WJAA 1I2CA 4I4NA 4ISCA 3DB2A 4O6VA 4OMFG 3DBVO 2YW2A 4JR2A 5EQJB 4EITA 5JD3A 1U7XA 3MGKA 2C3PA 4WGFA 3L01A 2E9SA 1RI5A 2BVNA 1LBHA 4DMUB 4OO3A 1R0YA 3OFJA 1ZMBA 3FZQA 5KTSA 2V4MA 1X1DA 2B6NA 2FGKA 5P21A 1XNQB 3RABA 2GK6A 1V5FA 5K20A 3C8UA 3Q9NA 1FJGB 1YNSA 3GI1A 5IK2A 1L8AA 4JBIA 1BOOA 1PNOA 2GHTA 3VU8A 5FOVA 5JE8A 3OUUA 1QPGA 1NW8A 1WP9A 1PQPA 4DIEA 3BMOB 1FYFA 4JK3A 4U2CA 2FMUA 4H59A 4MKHA 3I34X 1V3VA 3A37A 4I55F 4IOKA 1HTWA 3PNOA 4PANA 1L4GA 5ETJA 2YVQA 3TW0A 4BGVA 4HWGA 4CMAA 3S2EA 1V16B 5KYXA 2JIZA 2F1HA 4XWGA 1YA6A 2AVNA 2E6UX 4JOSA 1BDHA 2HEGA 2BFWA 3GPIA 3HDJA 3OC6A 1JEQA 4MVJG 4DCTA 4A8JC 1TRHA 1DX4A 4AQ7A 2NO0A 3FTQA 1Z3CA 4J1NA 1BVUA 4DSAA 2EX4A 1I7PA 4B3CA 3UAOA 1HEIA 3CX6A 3MC1A 3D4PA 2A0FA 1NC1A 2B1GA 5LZ5A 4D6YA 1ESZA 1W76A 2ZETA 3M1LA 1KQPA 2V97A 4JNCA 4PXYA 4QBTA 4YRPA 2ONJA 3AEYA 3OEHD 3VC3A 4QWMA 3N0XA 5DNVA 5ITSA 1WHSA 4L4XA 2EQBA 1T9DA 2WYWA 2M6RA 1GGFA 2YR0A 1ANKA 1CDZA 3M6FA 2UUPA 5BSVA 4PBRA 5BXQC 2H54A 4EW3A 1KDOA 3CKYA 2VNJA 3UK1A 3VJLA 1GL3A 4ZVMA 3DE5X 2BBOA 1W88B 3MSXA 2A0XA 3OTWA 5FRDA 1ZPDA 2QM0A 5ALMA 3QV2A 2P65A 1X1EA 2ISQA 1NURA 1VMKA 1YS6A 3L1VA 4LQ4A 4S0ZA 3CKLA 3KEMA 4CCAA 1KOFA 5I45A 1Y3FE 2F67A 3CUVA 2Q62A 2EKLA 3FOFC 2R60A 5F73A 2QW0X 2JLAA 4ALKA 2XB6A 2XCQA 4QQRA 2B2CA 2MJLA 2CF6A 1EWTA 2B1JA 5EFOA 1Z07A 1GGHA 2ZRMA 1XPUA 2AOUA 5HILA 5L7YA 5IC6A 2ERXA 5JC1A 2PSDA 2X6TA 4BKOA 1AUXA 4FC6A 3HMKA 3ONWA 1DEKA 1R0CA 1XV5A 1P2FA 5CK4A 3CINA 4C7XA 2B6HA 4QT4A 4YMVA 1Y3DE 4BXOA 3MK31 4HAIA 4DLTA 3L0SA 3EMDA 1SVWA 1G16A 2AVDA 2C3MA 1A9QA 4DNOA 2J09A 3WBFA 3H5IA 5HHTA 4S35A 2WWXA 1PT9A 4FNAA 4HX9A 4OGFA 1USWA 1HYHA 1PBTA 1Q7CA 1RWOA 1YI8A 4LWOA 3STUA 4ZEXA 4YFYA 4ZOLB 5JC8A 4NYIQ 3QOFA 1T24A 3C3JA 1OBOA 1NBMD 5HW0A 3G1UA 5L3SB 1Z6GA 1J25A 3WMXA 4MR9A 4ZFNA 2RGXA 3DMPA 1CVIA 2YJ4A 4TL7A 3LDFA 4YXFA 1OHHA 2BGIA 4GM0A 4LXYA 4QOFA 5FORA 4ZGBA 1RZRA 3TH5A 3NGXA 2EKQA 3FSEA 1C4XA 2W4MA 2JB9A 1GU0A 3L7MA 2NN3C 4P8RA 4BO1A 5AOBA 5KNCH 2X8AA 3LO8A 3QPVA 4MRRA 4R1LA 4UCXA 5CIQA 1DSSG 4C3UA 3ROXA 2J85A 5HJ7A 2VJMB 4MGIR 2YC2C 2RHOA 3WK7A 3GFSA 3KYCB 2PS3A 4EHKA 1TPZA 1Y48E 2W6QA 1M1YA 4L9SA 1HWYA 3UGKA 1GQRA 1X7WB 2AMVA 2RK3A 4IUCS 4YRJA 3X1MA 2GAAA 2QBYA 4YBZA 3GD7A 1YIDA 1W87A 3K8ZA 4Y67A 1T8PA 3QVOA 4P4UA 1IM8A 3MJTA 3JTEA 3ZHYA 3C3WA 1LPMA 3ET5A 3H5VA 2NZ8A 1XE3A 5L51A 1TJPB 4ITVA 1QANA 5EHIA 3D5EA 3TCXB 1CUYA 1GDDA 2FV8A 2YHAA 4BEVA 2YMMA 4MQEB 5BYAA 2BE7A 2K5UA 3D64A 5THQA 5I7UA 4A8HA 5I7HA 2LE0A 5D51S 3WXMA 2CV0A 4Q4HA 3E7WA 2GK4A 1PQYA 4DQUA 4A4DA 2IEZA 3P94A 2O2SA 1B43A 5KHLB 3URKA 3DFKA 5E8RA 2FXIA 2XTAA 2EZTA 3DHNA 4BO6A 3IQDB 3PCXA 4I9FA 4AZTA 2BGJA 2UXCB 1N8SA 5CJPA 4H18A 1UXGA 2YASA 3HL4A 2WM9B 821PA 1FYVA 4EG3A 2XE7A 4BVEA 2I1QA 3SCZA 4CTKA 3DDSA 3QWHA 2CMHA 3ELYA 4R41A 3CNQS 1UK7A 3C4VA 1MT0A 2O57A 3INRA 1SKUA 4AURA 1Q50A 3PEWA 5KC9A 2ODEA 5AHKA 1UJ6A 1ENOA 1BEEA 3FBGA 3FZNA 1JEAA 1R8SA 3BXHA 2G63A 4RQAA 2LWIA 3V6MA 3V4SA 5J2TB 2X5XA 1D4AA 2H7CA 3QNMA 3S6JA 4RXUA 3K6JA 4HDRB 2C9YA 3EDRA 4I50B 4P7FA 4JIMA 3HXTA 1BYUA 3LRTA 1RE1A 4URHA 3TMAA 4NCJA 2X19A 4QNMA 4GI5A 4AY3A 2RDMA 4G1CA 4MULA 3B5IA 3JQPA 2RE8A 3COZA 1Z5OA 3IP9A 1XQ9A 1T5BA 3GVCA 2PWPA 3NUQA 1JFFA 2XVMA 1I6KA 3JVDA 3PFWO 4C88A 3DG9A 3L0BA 1UMCA 4UFPA 3WMWA 3KJGA 1ULZA 2GM4A 1SMKA 1R6VA 3BGOS 3H2BA 1R5OA 2XGSA 4EW6A 1SRRA 3CLRD 3PD1A 1IL0A 3WJ2A 3X2SA 3C14C 2HGSA 3NHSA 4L74A 4HAZA 4X8LA 2HRQA 3HB9A 4OUDA 3ANNA 1Y9ZA 4YRFA 2P3SA 4NQRA 4EYGA 4EB3A 2GXSA 1E2BA 2JFPA 2YXEA 4FGKA 4QG7A 4AX4A 1E5LA 5KTYA 1M0TA 5C7IO 2BPOA 5AVWA 1ZAKA 3IEPA 4NESA 5IF3A 2WAMA 2D2IA 1AB5A 3MBIA 1D9XA 3OCXA 1Z35A 3WP0A 2MR5A 5LWHA 4QUBA 1T8UA 1BCSB 3E9YA 3OZUA 1U28C 1D5CA 1CY7A 2BI4A 3LGXA 4LUCA 3WKCA 4FGWA 2HJ9A 4LK2A 4NVRA 1FE8A 4Y2JA 3RYHB 5IAGA 1ONSA 3LXUX 1TL7C 3UMRA 3IE1A 2W42A 1M1NB 3H16A 4KQMA 1J8YF 4MO9A 3WSVA 5AFSA 3EUAA 4JI1B 3MWEA 5F2NA 4M89A 3GUZA 2PZMA 1DFHA 2TRSB 5H81A 4Z54A 3DR3A 5A5EA 5FFFA 3EAGA 4FYYA 2NU8B 5MN5A 4B80A 4O4HA 2H4WA 4NABA 1Z47A 3F7TA 4P2GA 1CFZA 1HYEA 1WXHA 5HPYB 4IH9A 5KB3A 1FU4A 1UH5A 3N8DA 2YKGA 2ATEA 1WB5A 4UCWA 5B3KA 1CJMA 3X43A 2NU7A 4FFRA 3W5SA 2RK4A 1PG2A 3H5LA 1Z5GA 5EUMA 3OT5A 2Y4NA 5KTNA 4MWCA 1FP2A 2ZWMA 4ER6A 3ZX4A 3HK2A 1L7OA 5AHWA 1EFDN 1OX6A 3A4TA 3KKKA 1V39A 4PONA 5ALGA 2PL3A 4HNQA 3TWOA 1G21A 2VHCA 3OOJA 4G4JA 4S1NA 4BFLA 4EABA 1D03A 3H5AA 5E3HA 4WXHA 4D5EA 3OTIA 4ARCA 2RAFA 3KLOA 2P69A 5IVIA 1FVXA 2HDHA 2AN5A 4DCUA 1KWGA 2FN4A 4RO0A 4WKBA 4BQNA 1EQUA 5LJLA 3TG2A 1A7AA 1WQ1R 4HDMB 2O1SA 2QAIA 4RL4A 5A5GA 5DM2A 4GZ5A 4B8ZA 3NXSA 1KNXA 5FLYA 5IJ0B 1Y89A 1T0HB 1L4NA 2DKFA 2HBQA 3GT0A 4OOEA 4QUDA 3VR3D 1W9MA 4FT4A 3M1AA 4HV4A 2GPYA 3NIDB 2YY5A 2KJQA 5EKDA 2V0NA 1FQOA 3ECSA 3Q0IA 1L4BA 1J9EA 4HNHA 4EVIA 3E0XA 1ZWKA 3WJAA 3C5CA 5I4IA 3LP6A 3TXAA 3LQKA 4EG7A 4LF7B 2ZWIA 3L0ZA 4NAVA 5IJXA 3EIXA 3RVBA 2BJWA 2HREA 3A1UA 3P2KA 4LNUB 3WLLA 2RH8A 3R40A 1SUBA 5CXUA 2A9JA 4DLPA 3HVIA 4XD7D 1RKQA 4XYMA 1H2ZA 3UANA 5E7JA 3WTCA 2ZYAA 4DKXA 2VCEA 4RXTA 2VHJA 4CM8B 1VL5A 2ZANA 3A3KA 5CNIA 4FSDA 4A82A 1HR0B 3HL0A 3TMYA 2WAOA 1XZBA 2C1EA 2X1HA 3IL2A 2FOLA 2WK1A 2NO5A 2J3KA 4PTYA 2G67A 3AX6A 3Q3GE 3GRVA 1QKJA 4Z9FA 4US2R 3N2IA 1PR0A 2H9YA 1WE2A 2V7EA 1TCVA 4GLFA 3ITEA 4DDKA 1A9ZA 3E81A 3ONVA 5GGXA 1BQ4A 2XA2A 2A6PA 4O2AB 2V7QD 1E5VA 1PT5A 5I4BA 1KZGB 4N5NA 4I81A 1W5EA 2X0DA 1CUDA 3HR8A 3CR7A 3UB3A 4MWZA 4EHNA 5IARA 3ZHCA 2YC4C 3ET4A 4D8YA 5KWSA 3G2OA 4XE5A 3THXB 3LLUA 4AZ3B 1B2RA 1RWPA 3SE0A 5ESRA 2R3SA 5KYYB 3ERCA 4WZAE 5T5QA 1I33A 1QH1B 2O59A 3FGPA 1GAXA 1GLGA 2WB2A 5SY9A 2OPHA 1TVEA 1XNGA 4OB7A 1ATIA 4J0HA 2F3UA 1VBFA 2Y1CA 5CU7A 1P4SA 4R1TA 2QD4A 2QM3A 4Y1FA 5EZQA 3NNDA 2C5BA 1GUZA 1HL7A 2EL9A 4KKXB 3RS5A 1M7BA 2O0HA 1T9AA 2VJYA 4O2BA 1SHZA 4PN3A 1OR8A 1NVVR 1U8CB 3AONB 2GEDA 1FP7A 5LP6A 4K9MA 1W49A 1YZNA 2YIDA 3H6KA 1I4WA 1BGWA 1KY3A 1EVEA 1AMNA 2QR2A 1NT2A 1YJQA 3E03A 1MKYA 2AT1A 2HU5A 3BWCA 4BP9A 3ZXXA 3ONNA 2A84A 1HF3A 5M2QA 1WQ3A 2QG6A 1Q12A 4MYRA 4EHHA 1NULA 3SHOA 1FPMA 1QTNA 2XWSA 3OKPA 2JVKA 2OZPA 2VF4X 1CY1A 3GAZA 4PPNA 2Z2YA 5IM4A 5LCXA 1E5TA 1BHQ1 1F4LA 2HX1A 2LBPA 3E7XA 3J81k 1CUXA 4H60A 2IWHA 2I34A 1EE2A 3K73O 4QVKA 3VNBA 5EJ4A 1X87A 4HXGA 3X44A 3NNSA 3GQVA 1PGPA 4ESOA 4DBLE 3ZOZA 2FMHA 4Z3KA 1RRGA 2ES4A 3LY9A 3TRJA 3G0GA 3OCVA 3ZDBA 2XUIA 9GPBA 3DAOA 2QUAA 1WUYA 4YYZA 4CMIA 3TZEA 2NTJA 2ZI5A 2Q7DA 3F96A 3I6ZA 1A9XB 3BC1A 5DP1A 4V1CB 1NZDA 1EG2A 3DO8A 3ABZA 4LVNA 1T5SA 3CCFA 5MN4A 3AEQB 4L5AA 4C30A 3W6NA 4QAJA 4QXMA 2IQ5A 3I83A 1E8NA 1DAIA 2I4LA 3A1NA 4Q37A 2ZR0A 4UAUA 3SGLA 4BJ3A 4E15A 4DYHA 2IPXA 1ES9A 1S9DA 2FJPA 3TE7A 5LNK1 2E21A 1CULC 4M1KA 2SKDA 3MJRA 3PRJA 4IJUA 2D2VA 3GP8A 2ZAYA 4DEYA 1RM0A 3ELDA 4ZYZA 1OSNA 4S3MA 2ZSDA 3BL5A 3KETA 2Y1EA 4UARA 3VZSA 4UQPA 1B15A 1I4DD 3A27A 3T95A 5FR1A 2V7PA 4I55A 4EJSB 1XVTA 3CXUA 5LQSA 2VJQA 1H1DA 3ZH9B 2RGNA 4B17A 3JSXA 1QYWA 4HUTA 4Q9AA 4UVHA 3RBVA 4B84A 2BWJA 2B36A 5BNWA 3PQ4A 1ZR2A 5BYJA 3AI1A 5F33A 5HKKD 1IY1A 1E7QA 1MW9X 2PXAA 3HFSA 1NXQA 2PA0A 3ZYCA 4CZ2A 1QAMA 5IAAA 3AU9A 3G0HA 1FX0A 4LJ8A 4KIWA 4GS5A 2FRDA 5AVOA 3ZHXA 4Z8YA 3AKCA 1YC5A 3TVDA 3E7FA 4UEKA 2V7BA 2Z3WA 1SVUA 4XQ9A 5KHAA 5A4DA 1PEDA 2FLWA 4BBJA 4KHPB 4YJGA 2BD0A 1FNCA 4OXXA 4D4IA 4F85A 3RRJA 4F2PA 1KQFA 4BVJA 2QX4A 2I66A 4EFLA 4YMTA 2AEJA 3CZRA 4B4UA 2HIHA 2AB0A 1ZGBA 4RUKA 3U7EB 3BEDA 5CLGA 4YPFA 2GBCA 2PRSA 4BP8A 2IS6A 1LF0A 1AUPA 2Y2VA 1RWMA 1K6JA 4JNGA 3EARA 1K66A 3OURA 4OHFA 5FOSA 1G2PA 2P91A 3BBLA 1L5RA 3LYUA 3PHIA 3B1WA 4G63A 1Y4SA 1FLDA 1MRZA 2P6MA 2ZKLA 4IY1A 4LAFA 4LBYA 4QULA 4QX6A 4NJMA 4GGPA 1N6RA 1GZ4A 3DFMA 2Q3FA 4MAFA 2A2ZA 3HBNA 4NDAA 4F96A 2IHBA 2WWIA 3CO0S 2Q1UA 4ND7A 4XGIA 3C3CA 3S44A 3TRFA 2MINA 4M49A 3WOHA 1Z4LA 1K63A 1KJNA 3TAUA 1I7QB 4PLVA 3AJDA 4GRDA 4LC1A 1O87A 3HY4A 5DNCA 3NDPA 4FZRA 4PLGA 4ZYLA 4ECEA 4FWIB 3NOVA 1R0KA 4A0RA 4O4LB 4KQ6A 1P1JA 4OXNA 1X0VA 4DYDA 4LY6A 1PI3A 2W2QA 1FUIA 3Q7RA 2XKAA 1JQDA 4QFMA 3OBBA 4HLQB 1TPYA 3H7IA 2PEYA 2QROA 5C8DA 2Z9BA 3MZ0A 2BFPA 2O7VA 5LQNA 1H65A 3MLEA 3ML1A 3LLSA 4DIOA 1LS6A 3F6PA 4R4JA 4ZOCA 3MHTA 5B12A 1U7HA 5IUKC 1GA6A 1GZ7A 1HT3A 1UWLA 1ZNXA 3MJCA 4F3YA 1JH9A 3RUDA 1XZQA 4JU9A 4LDJA 4ABYA 4ZP1A 3P96A 2GJ9A 3CLHA 4RHFA 1FVOA 2A1UA 5JEEA 3GH3A 3SYMA 4NU5A 4XRGA 1IY8A 4P93A 4E2YA 3FJYA 4DUZB 1DKOA 4RIGA 4D3XA 4RKQA 1N3YA 2DH6A 2VUTA 4IQGA 1IZ0A 3L79A 4YHBA 1KMCA 1JVBA 2WMYA 3LHDA 5LIPA 5BR7A 1J07A 2DVMA 2H63A 3NAQA 4EF5A 3IXLA 5HX7A 3S81A 1KMHA 2C3UA 2ZFUA 3I4LA 1CUJA 1TEVA 3W90A 4HN2A 4OJMX 1EK0A 4LV8B 3NRBA 2FSSA 2CJFA 4TLBA 3SHWA 1NUPA 3VGJA 4BYGA 4NV1A 3BIXA 3KHTA 1PS0A 2PJUA 3L77A 4B7ZA 2FZ5A 2MWMA 1TB4A 4N3NA 3GLFE 1VLZA 1LBIA 2CLFB 3IMCA 3ILSA 2F3RA 1A95A 1PDOA 4G1UC 2J08A 1RWXA 3CCCA 3ZY5A 3SZUA 1JZQA 3N58A 2PZJA 4N40A 3EQ9A 3LP5A 3UM9A 4E2ZA 3JQAB 3RNLA 2H1HA 4FDTA 5F7XA 1CK4A 4H1TA 4YCCA 2CFOA 1DC5A 3WLKX 1DKPA 1VL0A 4GPTA 2VAVA 4ZHSA 2HQRA 2VHQA 1ABFA 4ATNA 2JEZA 2QRGA 4XGKA 2D1SA 4XCVA 5D1HA 1ENYA 1IBRA 1RMQA 4HVCA 2WF6A 3TUIC 1PR3A 3DWEX 3O4GA 2PS1A 2WPNA 4JKOA 4JYMA 2XOXA 3EFEA 5CG2A 1ZL2A 1LGYA 4JROA 1C9MA 1OFIA 4H2DA 3D1VA 5BORA 1W0KA 3NTOA 4DA7A 2IUFA 3D4LA 1YRHA 4MYDA 4EYKA 1G41A 4LBWA 2VH1A 3CRMA 1PHRA 4HF7A 1LTKA 2CHEA 2CKMA 2HADA 2NTYC 1I0LA 3DMTC 4MW1A 5T6MA 1BVRA 3QMVA 2ZJ1A 3SF0A 1YB7A 1YRWA 2Q7OE 3Q5GA 3COPA 2WOOA 2PLFA 4LWPA 4D9BA 4ZJYA 4J29A 2PBZA 1CU1A 1YI0A 1VZ2A 3PC8C 3EIUA 3HBFA 4MQMA 3DA8A 2YX1A 5KNBD 1QOPB 3GK3A 1G9XA 2ZBVA 3M7IA 4KV7A 4PZDA 3W3AH 1XJQA 4PGMA 3VX3A 3RV3A 4ZU1X 4ZV7A 2XCUA 3QU5A 4TLCA 1MF7A 1BQ3A 1AQLA 4OIMA 3AMVA 3QUTA 1A5BB 3PWKA 3CB2A 4MUHA 1YE3A 3GNQA 4Y0VA 1EAMA 1EFPA 4G84A 1L5KA 2J9YB 4ZHQF 5CCDA 1CETA 1MQ8B 2AKAB 1O6FA 1O4WA 5F9MA 1BHO1 2TMDA 5CDHA 5JD4A 1DFIA 1I3NA 4JLUA 3WWCA 2Q4BA 4TKVA 2CFRA 4L73A 2H1SA 2O3TA 1U5AA 1M7HA 3QJGA 1N92A 1SURA 4CIWA 4P33A 3AC0A 5CFNA 2SCUB 1EIZA 3AYXB 5DBIA 2XUFA 3D2AA 4A03A 2FQYA 3OFSA 3LDHA 3SHTA 4EX6A 1H8HA 1SD2A 1J2JA 4X7PA 2SICE 3P9QA 4C4ZA 4OHWA 3USCS 4BNDA 2FQ1A 2PD4A 3E53A 2O5EA 3GJ8A 3ZWDA 4YGYA 5JNRA 2ZSAA 1KU6A 2WJGA 5IANA 5C8YB 2PH7A 4ILEA 3QLJA 1S3IA 1U0FA 1WTAA 4YHHB 2CF5A 2MT9A 3RK0A 5DWVA 1Q11A 4BEBA 5AUNB 4U7HA 3TO5A 3UMCA 1ZI6A 3ETNA 5FFMA 1TJNA 2DR3A 3T7DA 1C29B 1YHYA 2CJWB 3C8ZA 4RBNA 4YMSA 3D7LA 1I01A 1RPTA 3G8AA 1VXOA 3OO0A 4I36A 4L0DA 4MW4A 1Y98A 3AKEA 4AFNA 4BB6A 4D6PA 4ER7A 1EK1A 3FHTA 3UA3A 2XE8A 2YCLA 4UULA 4W9RA 4B3FX 4N41A 1MAVA 1MMFB 2Y27A 4L75A 4R68A 4C4OA 1QV9A 2OAGA 3GFOA 3HYCA 2UVDA 1KYIA 1VGQA 3KJQA 4JJIA 1ILWA 3ENNA 1MX5A 1PZFA 1U2SA 2C94A 2H00A 1CUGA 2ORYA 1S02A 1YU6A 2I4TA 3O21A 3OQBA 4OA8A 5CNJA 1PV1A 3DXZA 3AVWA 2P5UA 3GZNA 4X62B 2PZKA 3G7SA 2B2NA 3ZWMA 3F5SA 3MQ4A 3GBVA 1PIWA 1AKVA 4IS2A 4NG4A 3BJZA 5CT9A 3WB2A 3C97A 1RAFA 2WNSA 4CDGA 3HNOA 4FTWA 4BC1A 3D31A 5TGDA 3BIFA 2PGNA 5KEIA 2VBGA 4FBLA 4OATA 1RAEA 1RJDA 2BEVB 2QP9X 3OZ7A 4AF8A 2VLIA 4JL6A 1B8OA 3R6TA 5BRJA 4Y6LA 1K5DA 1MO6A 1R8XA 4GKKB 3TQFA 3Q2KA 2W4QA 3BDAA 2PUGA 1TA4A 2BL4A 4QASA 5B55A 4W1SA 5BSEA 1OB5A 1R5BA 2HU8A 3T5CA 2ZJ0A 1KP3A 1IY0A 1OMOA 1SD5A 3C24A 3WDLA 3MJSA 3UJ3X 2IXGA 2JRLA 1Z08A 3HEMA 4J2TA 2RKWA 3DO5A 1FIUA 2JJ1D 3H4TA 3SKXA 2OBXA 3CCBA 5CVEA 1WXWA 3EODA 2DB3A 3ASZA 2I91A 5GGYA 3A6HA 1G63A 3G88A 1WUJS 4H7EA 2QN8A 4PO3X 4WASA 5KOJB 5EMNA 4KDFA 3TNYA 3AM3A 3QYJA 1CZRA 1JKJB 4PNPA 5ALHA 4QEZA 1CKEA 1O2DA 3KLMX 2YVUA 3WNZA 2V3VA 1IBLB 5JQGB 1EH5A 4IDFA 5B3AA 5F76A 2YRFA 4J7AA 1CQJA 1Y3HA 1GPNA 4L72A 1NUQA 1Q21A 4NU0A 1PFKA 3UKDA 5IN4A 1XNJA 4FGJA 5J4KA 4LZOA 3ETCA 2RGCA 4JHXA 4KWEA 5E1OA 3PC4A 4BV3A