1KVQA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structures of the S124A, S124T, and S124V site-directed mutants of UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvqA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvqA01
3NTQA 2JD2A 3PWSA 3CTMA 2VWPA 3DTTA 4FJ0A 2E48A 2FR0A 4A7PA 2DBZA 3GN2A 3WMWA 1Y81A 3WJ7A 2I9PA 2YFHA 2ZIZA 3JSAA 3OP4A 5I9NA 5COAA 1WLYA 4NDNE 3VOSA 1C1XB 1EBUA 2V6BA 5L4LA 4WNCA 1GADO 4FGWA 3VHRA 4YAGA 2F00A 2F1KA 3RD5A 5TT0A 3DL2A 5TLSA 3OJEA 3JQAB 5A06A 3D7LA 1WMBA 4FJ2A 3WGTA 1AE1A 3VKUA 3S2EA 2J3JA 1DHTA 2P5YA 1HF3A 2PNFA 1EZ4A 3UCFA 5KWEA 2WJPA 1A7KA 1QYCA 2Q2QA 2Y67A 2YV2A 3K2EA 4Z0TA 3EK2A 2NVUB 1X0VA 3JYQA 3ZWXA 5JMWA 6ADHA 1EDOA 2YZ7A 3JYNA 3LK7A 2HAEA 1ZK0A 2VOJA 3B1KA 4L4RA 1TEHA 2GZ2A 1PR3A 4NBUA 4XCVA 4Y6RA 2OUIA 4LISA 4P4LA 4QECA 2PGDA 3DZJA 4MP6A 1U5CA 2EV9A 4JROA 1T2FA 2JKVA 4E5PA 2BFAA 4RPJA 1E7RA 1HL3A 4Y98A 1IOLA 3KYCA 1R16A 4TRMA 1FDVA 7MDHA 3F47A 4Z9FA 1Z75A 4FQ8A 5F3RA 4RDIA 3RUFA 1A9ZA 2PFGA 3WNQA 1W6UA 1ADFA 3D4NA 4WUVA 2E4AA 4ALKA 4YR9A 4D0SA 2FMUA 4CLRA 5DBGA 2Q99A 1KEUA 4G81A 3CKYA 4RVSA 4RF3A 2B35A 3UF0A 1DPGA 2FR1A 3BA1A 3IUPA 4B8WA 1KC1A 2QG4A 2IZZA 3E18A 1FDTA 2DPHA 2C5EA 1LSUA 2G82A 4PLVA 4EYEA 3JQ7A 3DBHB 1DIHA 3AI1A 3OJLA 4BNYA 4BNGA 4GGPA 2BGLA 2ZB7A 3KSUA 3NAQA 1Y1PA 4J7XA 2JD1A 4E13A 1M6HA 5TX7A 1PQWA 2I3GA 4IJKA 5B4TA 5BQFA 3FNEA 3OJ0A 4XYMA 1NVTA 1AHHA 1TVEA 3DMYA 3HDHA 4PLTA 5B4VA 4NFYA 1H6CA 1C1XA 1VL8A 2Z1NA 3UCEA 3QY9A 4BNHA 5BNTA 1W8DA 1RKXA 1AUPA 1PGJA 2WSBA 4GX0A 3ZI0A 1J49A 3JQAA 2FHSA 4J4BA 5CG1A 4I5EA 4IDEA 1LI4A 1WW8A 1GUFA 3ZDFA 2X1HA 2XAAA 4CR8A 1N92A 3FHLA 1N5DA 3HB4X 4A26A 2GN9A 1DLIA 5K9ZA 1S6YA 1Z73A 2OBYA 3C8MA 2R2GA 3PTZA 1E3SA 4HWKA 1T25A 4XQGA 5L7YA 3V8BA 5DDIP 3MOGA 4CLEA 3FNHA 5A3VA 4QFDA 4QX6A 4HBGA 1OOEA 1TT5A 1GV1A 3GZ4A 3ROPA 4A2CA 2GF2A 1X14A 4FDAA 2ZTMA 1XEAA 3EUWA 3BHIA 3BMCA 4BB6A 5KVVA 3LC2O 2EJVA 4LCEA 2V7PA 4CQMB 4IQ8A 4J6FA 1E7MA 2JAHA 2IEBA 1QORA 3K73O 4ND4A 4XB1A 2XXBA 3GQVA 4GMGA 4E2ZA 1ZSYA 1IHXA 1HZJA 1PJTA 2QYSA 3CINA 4OSOA 1DSSG 4Q3CA 4CLRB 5CDSA 1HETA 1M75A 1C14A 4ND5A 3BIOA 3DB2A 1NM5A 3NV9A 4TKLA 4BO5A 1GUZA 4CMEC 2O2YA 3PFWO 1E92A 5DBIA 3DBHA 3PGXA 1C3VA 4FBGA 1MX3A 2GN4A 1HYGA 5EQFA 4NPCA 3DBVO 1NAIA 1UUFA 2JJYA 1LEHA 4A0SA 5I7EA 2VUSA 3LT1A 4ZD6A 3I1JA 4WLFA 3RC7A 1IPEA 5KTKA 2ZYDA 3OIGA 1E3IA 2VYNA 2Y99A 2C59A 3A1NA 1M76A 3HNPA 3SX2A 3H2SA 3HFGA 1DIBA 1RYEA 3HB5X 4HKTA 1NQOA 4N5LA 3JYOA 1RM0A 5DN9A 1E7QA 5B1YA 1ZO8A 4QFCA 4BNXA 2GASA 4HNHA 1E3LA 2FSVA 3E9QA 3I9JA 3I3OA 4WJZA 2ZTUA 3JQFC 4GSLA 4EEXA 3JD3A 4BKOA 1WDLA 3PK0A 3OIFA 1QV7A 4AG3A 3T4EA 3ZWPA 4QUKA 1MGOA 4TVBA 2O2SA 4DQVA 3PP8A 1YBAA 3GMSA 3FF4A 3C85A 4E3ZA 1M66A 1KEWA 3B70A 4XYLA 1TT5B 1PS8A 3DDNA 5G0TA 4E33A 3STHA 3EW7A 1QSGA 4CM3A 4E31A 3QVWA 4HFJA 1X15A 1T4BA 2YDYA 3BMCB 3H9QA 4BKPA 5H82A 4HP8A 3A28A 4CQMA 4RPKA 5LCXA 1LLDA 3V1UA 3GEDA 4KUHA 2JD0A 2CDCA 2C2XA 2EKLA 3ZV4A 3KV3O 5GZ6A 3WYBA 2RHRA 1A9YA 1YQXA 2EW8A 5JAMA 1XWFA 3U4DA 2GERA 3G49A 1IZ0A 3U4HA 5IZCA 2ZYAA 3HWRA 5ENDA 3ZHZA 5LC1A 3CEAA 2Z1MA 1E7YA 5IG2A 2Y93A 3VH3A 1WNTA 3ZNOA 4IGEA 3PYLA 3KLPX 3PHIA 3FPCA 1OC4A 3ORFA 4D42A 3L07A 4LN1A 1EEHA 1N2SA 1SOWA 4Z0PA 5JO0A 2BI8A 3E8XA 5BNFA 3GLQA 3OSUA 4DLBA 4ZVVA 4GH5A 4GBJA 2X9NA 1E3WA 4GSKA 4DA9A 4RVFA 4JJGA 3ANMA 4FFLA 4Z3KA 4MVJG 3JQ9A 4ESOA 4QSMA 4FCCA 1H5QA 2FSSA 2J5RA 1J6UA 2VHZA 1HDRA 3JD2A 2C82A 1LUAA 4CM4A 2IZ0A 4DQUA 1UZMA 2JFGA 1MG5A 2W2LA 3VH2A 3H9UA 2DVMA 4NR0A 4AJJA 1VE9A 3BTOA 4OOFA 4Q3DA 3ETDA 1XA0A 3GHHA 1ZK3A 3OIDA 4CLOA 3R1IA 2W4QA 3RJ5A 4UUNA 2CF6A 3IQDB 4XZ3A 3AY3A 1YONA 4OO3A 3A4VA 4AJ1A 2FWMX 1CJCA 2X23A 4ZQFA 4GGOA 5COBA 3RKRA 3RFTA 1I10A 3UW3A 1NNUA 4GVXA 3VZRA 1SCUA 3NTOA 3AOGA 3OH8A 2PD4A 4TRNA 2AW5A 3AK4A 4IXWA 1H2HA 1GCUA 4CLDA 1MFZA 1DC3A 1K6JA 1JWBB 3CPSA 1R66A 3GGGA 2B69A 3VPSA 1ZNQO 2WYWA 3CIFA 2NLOA 2EKQA 2P9EA 3VPGA 2RAFA 4R9RA 3FRJA 1B26A 4BS9A 1U2DA 3GOHA 5A9SA 2X4GA 1TXGA 2O3UA 1LC3A 2RBEA 4R54A 1FJHA 1W0CA 1IYZA 2A4KA 4NU6A 3ZWWA 1GAEO 3MTGA 5F1KA 3WGZA 1E6UA 5EMHA 5IZCC 1PS0A 5KIAA 1MA0A 2QQ5A 3MJCA 2X22A 5K0ZA 1PQPA 2HO5A 2ZJ0A 3TZQA 3UAGA 4BO6A 4CQMD 2IDZA 5JYEA 3DZHA 1U4OA 5TRTA 1QKIA 3HE3A 4AICA 3W1VA 1EUZA 4DYVA 2Q46A 1NR7A 1PJCA 2UUOA 5I9LA 4A27A 4R1NA 2O48X 1BSVA 3VPFA 3SLGA 1P44A 1NQ5A 2HDHA 3ZN2A 2BH9A 3ZU4A 3DBRA 1E3WB 5B12A 2CY0A 2VN8A 4ITUA 2NWQA 5A9TA 4DREA 3IC5A 3WGYA 4PZCA 1WZIA 4QO7A 1JLLA 1R4NB 2Q4BA 2DPGA 1MXFA 1N1GA 1P1HA 1DAPA 2PKQP 4IDBA 4U5QA 3CZMA 2ET6A 3R3JA 4Y6SA 4FFMA 5DF1A 1YB4A 4DLAA 1LDGA 3W4IA 4CM4B 4JGBA 5AQ1A 3P5SA 2UVDA 4RF4A 5G4KA 4WLOA 1PJ4A 3GN1A 2AQIA 4UVEA 1ONNA 3U5TA 4EUHA 3S8MA 3ZV3A 4CM6A 2YFQA 2VTDA 1YJ8A 4CLOB 5G0SA 2FPPA 1VJ0A 1H94A 3ETEA 1SBYA 4MVJI 4PFJA 2Y68A 3MJEA 1VJ1A 5KOIA 1ZMOA 3G79A 2VUTA 3U9LA 3UVEA 4TSKA 4YQZA 3WBFA 4N5MA 5ES3A 4ZJUA 5L7TA 1DIRA 5FEUA 3M2TA 2HU2A 3CSDA 3ICPA 1P0FA 4RLHA 2CD9A 1T2EA 4Z9XA 2EGHA 4IQ0A 2C07A 1TI7A 2VT2A 2CFCA 3OICA 2CUKA 5A9SB 3Q11A 2DM6A 2YW9A 4MPDA 2OORA 2ZCVA 4IMPA 4UVDA 4UEKA 3ZW8A 1R0LA 1AN9A 3JQBC 1JWAB 1YH3A 4OXYA 3W4JA 1DXYA 2CDAA 4U0JA 1GYQA 4Q39A 4R5HA 2X6TA 1XSEA 2PA3A 5GMOA 1Y7TA 3L4BA 4MVJE 1O5IA 1RM3A 1UJMA 3KTDA 1V35A 2ZQZA 3MJSA 5CPBA 1EFKA 4CMBA 4CM5A 4F3YA 3DAFA 4IINA 4YRAA 3DC2A 3I6IA 1WWKA 3OQ6A 1HDGO 4GVLA 3DBRB 1KYQA 3GEMA 4JP2A 1N8KA 3AU8A 2LDBA 2FPGA 1KIFA 3IKVA 3ICCA 1CQJA 1HDYA 1MP0A 3C7DB 4URFA 2W2KB 1R4NA 1MC4A 4PLYA 3WR5A 3HHPA 4XDYA 5JW6A 2NU9A 4RDHA 3PJFA 5CDUA 1KY4A 5JYDA 4I5FA 4NHEA 1ZJYA 4KZPA 4M54A 1I3NA 5IAAA 3K31A 5G4KB 4UVHA 1Q1NA 1N7HA 3DAPA 4HFNA 3PWKA 2IXAA 1I2ZA 1B3RA 1IUKA 3LQFA 4MJLA 2P2SA 3ZU3A 4CMGA 5TC4A 4FS3A 4D44A 5IN4A 3PXXA 3TZHA 4ND2A 4DYDA 3MTJA 1PJQA 3BZUA 4BO3A 2ILTA 2CDBA 5ENVA 3GA0A 1NPDA 3AOEA 1BXZA 3UCXA 4E12A 4MVJA 4ZHSA 1R15A 4RF2A 4WLUA 2IRWA 4YPOA 1WDMA 2E37A 5KKCA 5I8WA 3RIHA 1NPYA 4TQGA 3GVPA 4RVDA 3RWBA 4EUFA 2G1UA 3EHEA 3F9IA 1X1TA 1KVQA 3ZWOA 4PLFA 1ZXBA 3TFOA 1U4SA 4FR5A 3IOYA 4F46A 3I6QA 3M1AA 4OGWA 3G17A 1DC6A 2WD8A 2AE1A 4KUEA 3JQ8B 3CUKA 4CMKA 2EHDA 3D4OA 3AM3A 4OKIA 3WSWA 1LSOA 2IYPA 2FOIA 1R4MA 2EKPA 2PY6A 3IJPA 4R3WA 1QR6A 1XHLA 1HZZA 4AJPA 1SAYA 4GLLA 3WFJA 4G65A 1PL8A 3OM9A 3RBZA 4KQWA 4FOOA 4U8GA 3VDQA 4R3NA 3ZU5A 3BMNB 1T2DA 1GYPA 1BXKA 2A35A 2RCYA 2ZB8A 3PQEA 2HK8A 4XIJA 3G1TA 1GQQA 2C7VA 3GC6A 3I83A 3ITKA 1Y5MA 1EDZA 4RV9A 4PVCA 3KXDA 4U0KA 3NT5A 2W2KA 1WAMA 3ENKA 4E5MA 4UAGA 4EITA 1O0SA 3C1TA 3NRCA 2BFOA 3F3SA 2JL1A 3UH1A 3LVFO 4BNUA 4YT2A 1E7SA 3Q6IA 3G1UA 1K0UA 2AHRA 4J1TA 4BKQA 3BTVA 5HBRA 2NU6A 3WGGA 1LC0A 2IZ1A 1B7GO 4CL8A 3EZLA 2Q1SA 4J91A 5DBFA 4I9HA 1HYHA 3H5RA 3DEYX 3KSDO 3GPDG 1B16A 1K6IA 1PZEA 1NWCA 1TB4A 3DMTC 4BNZA 5ICMA 4ZGWA 3PEFA 5HS6A 4YYZA 2SCUA 3HZZA 4GLOA 1Z45A 4RJTA 3ANNA 3VH1A 3PQFA 2E6UX 1ONOA 2X9GA 3CXRA 3QVTA 4ZQHA 2YV3A 1HSOA 4YJFB 2OGUA 4A10A 1EVZA 1PZGA 1ZBQA 3C24A 1ADGA 1CERA 1W73A 4NMHA 4IZHA 1PJ3A 3EAGA 1LDBA 3TOZA 4J1SA 1BW9B 1YDWA 2PZLA 2RH8A 3GRPA 2J3HA 2O3RA 1G6KA 1U8FO 4B4WA 4AL4A 2HMTA 4LMRA 3RUAA 5COQA 2PTGA 3V2UA 3HG7A 5L51A 3JYPA 5B37A 4CM9D 3I9MA 4EJ0A 1OAAA 4KMSA 5FI5A 4R9SA 2WMDA 1KS9A 1B8PA 1GEEA 1LRKA 2HRZA 3JQ8A 2J5QA 3MCVA 4AFNA 3FNFA 4IJWA 1FDSA 1VSUA 2RIRA 1R4MB 4Y9DA 3DOJA 1V6AA 1QRRA 2I6TA 1LDYA 5DCUA 3TZCA 5JMPA 4EZBA 4BNWA 4BHTA 2H6EA 2OBNA 4NFSA 1VL6A 4JJFA 1MUUA 2X7HA 2HCTA 3BMNA 3D5TA 2FRDA 3U09A 2CZCA 3EVNA 2X5KO 5L9AA 2D8AA 3FTPA 5I7VA 2OP0A 2P4QA 3WS7A 4YJHA 2BGMA 2PD3A 1VM6A 3GFBA 2I5PO 2OMEA 3H7AA 1Q7CA 3E03A 1PWZA 3RUIA 1RWBA 3GFGA 4DGSA 4JBHA 4CMAA 2DTEA 3WQQA 4PG7A 1VL0A 1I0ZA 3DOCA 4INAA 4NQZA 3S2IA 4BGEA 4Q3BA 4TWRA 4YXFA 4FB5A 1PJBA 4CQLA 3JQCA 4RPGA 4KTTE 5G0WA 3H5AA 4WK6A 1Y6JA 5IDQA 4RF5A 4GAEA 1XELA 2A9FA 4LGVA 3Q2IA 1LJ8A 5J23A 5KJ1A 4DWVA 2OHXA 2HJSA 4PLCA 3GH3A 2O4UX 3DMTA 3RU7A 4ND1A 5A04A 1YBVA 4YJFA 1NTOA 2J3IA 3DHYA 1YKFA 5T8KA 2O7QA 1UR5A 2ZQYA 3ETGA 3VZPA 1F8FA 1BW9A 3QSGA 4JX8A 2Q50A 1HE4A 1NQTA 2Z95A 4EJMA 1B14A 4HY3A 4LRSB 2IE0A 3AY7A 1BG6A 2R00C 3E5RA 4TRJA 4PG4A 4AVYA 3PJGA 3C1AA 5FWNA 2HMSA 4BNLA 5DULA 4BNNA 4L0QA 4D79A 2J8ZA 2V6GA 3RC9A 3A06A 1LLQA 4DXHA 4J7CA 1M2WA 1WXDA 1U3UA 2FPIA 1UDAA 2VRCA 4OIMA 4MO2A 2BF7A 3AY6A 4XR9A 4FN4A 3HJAA 5BSHA 1QP8A 1YB5A 3Q9NA 4GX2A 1Z74A 1ZK2A 1HLPA 5C7IO 3JD1A 3HN7A 1GZ3A 1A4IA 1DC5A 1XCBA 4J49A 4MKZA 4WNIA 4J16A 3NT4A 5A05A 1C0PA 1UDCA 3L0DA 3UICA 4C7KA 3I4FA 3TJRA 4XIYA 2FZEA 4YJHB 4AJOA 4E2XA 1B8UA 3EVTA 5L7WA 3FD8A 3WFIA 1E1MA 1R6DA 4O1MA 1AXEA 3ULKA 1P3DA 3ZCXA 3FBGA 1UXHA 5TGDA 4D7AA 5L45A 3UKOA 1IB6A 2NU8A 1BVRA 1VPDA 3LT0A 3IIEA 4CQLB 4FPXA 1TT7A 1KVTA 1FDUA 2B83A 3A14A 4XB2A 3KSZO 1ULSA 5JXWA 3QV1A 3UXYA 3GHYA 3UHAA 3PDUA 4IXTA 3DONA 1S7CA 1WPQA 2YY7A 3EMKA 5MDHA 2DT5A 1SB9A 3QHAA 3RBVA 1L1FA 2VYVA 3WTCA 1LNQA 2ZB4A 4MIEA 4BNMA 2PZMA 4MINA 1GZ4A 4KWHA 4XEHA 5JAQA 5CFZA 2WM3A 5JDCA 1O95A 1T4DA 2EXXA 4PRLA 3T7EA 3S55A 1ISFA 4J1QA 4OYRA 2UDPA 3KUXA 2W8ZA 4LMPA 1MB4A 3ON5A 3C1OA 5F5NA 3NEPX 4IBOA 4IDDA 1XU7A 1UXJA 2J6IA 5KVSA 3H65A 3KBOA 1PGPA 2OXIA 3ZHXA 2FP4A 2X0RA 2R00A 1B0AA 2D5CA 3PWZA 3VAZA 5IJZA 4GQAA 1JA9A 1E5LA 2PK3A 4IS3A 1KERA 1PZHA 4DL9A 3TDKA 3BXXA 3DOOA 1ZIDA 4HNGA 4EGFA 4NH4A 2JHGA 1YBMA 3PJDA 1BHSA 4MVJM 3TPCA 3E9MA 4WLVA 4YT5A 1EVJA 2VNAA 4PLZA 1GQYA 3I9OA 4OMUA 1T2AA 4D3DA 2B5VA 4EJ6A 1ZSVA 3QLJA 3RASA 5ADHA 1YE3A 2X0IA 4YT4A 5JCJA 2H9IA 4IZIA 4GWGA 1H2BA 1ENZA 1LRLA 1B2LA 1ZVMA 2I76A 1KVRA 3DFZA 2B4RO 4BIIA 4AJLA 1R12A 1XLTA 4XRRA 5JPIA 3GNTA 3NX4A 5C7OO 4YQYA 4J2OA 3DZIA 2VHYA 3N74A 5ILGA 4JBGA 5EINA 1LTHR 4C4OA 1O6ZA 1T2CA 3EGOA 5A1TA 3SC6A 4HX5A 3PHJA 1N9GA 2PKRA 3GAFA 5EPOA 1HSZA 5AXDA 2VT3A 3O03A 3WGHA 4L8VA 2GR9A 2YV1A 4WKGA 1HWYA 1LQUA 2AQHA 1U1IA 4R1TA 4XJSA 3TWOA 3WSVA 3RC2A 2YHUA 5HA5A 1NHWA 1HTBA 3I5MA 3Q2KA 1E1KA 2NTVA 4RGBA 1XU9A 1XDWA 5FF9A 3V5NA 2NVWA 3IUSA 1V3VA 4P4GA 3P2OA 3H4VA 1D1TA 1HDOA 4ALIA 1JVSA 4XR4A 3OFSA 2HMWA 2Y1DA 1LU9A 5BNIA 1Y9AA 1UDBA 6LDHA 4JCOA 4XYEA 4CM8A 4RQUA 3JQ6A 3WX0A 2NNLD 1Q7GA 2Q4EA 3H5NA 3WJAA 1GTMA 1PJSA 2D1YA 4W7IA 5F1PA 1LSSA 3HDQA 4LVUA 3GF4A 4O63O 4J0FA 5G4LA 4R1UA 4KUGA 4MKRA 5DCWA 3VDRA 5JFOA 1NP3A 1P0CA 3PIDA 4JIGA 3GNQA 4ZN6A 4GL4A 3NKLA 1N7GA 1DC4A 1A4UA 1IY8A 1IE3A 3PFFA 4F45A 1DRVA 1P1JA 3O9ZA 3LT2A 3ONEA 4H7PA 1DO8A 1A7AA 2NQTA 4UVGA 4Z3DA 3SXPA 4WCFC 3AFMA 1QXSA 1X7DA 5IXYA 2QRLA 2PD6A 5T5QA 4B7UA 1PWXA 5DP1A 2I65A 1UZNA 3OECA 4J1NA 1X7HA 1I36A 4E21A 3RJ9A 1V8BA 1ARZA 3CH6A 5KKAA 3ZNPA 1FK8A 2Y0CA 1LA2A 3PHGA 4N54A 1J5PA 4PZDA 1P9LA 3ZU2A 5A02A 4L74A 3GGPA 3W4KA 1N9GB 5EL0A 1C0KA 2P4HX 5KJFA 4Q3NA 4TKMA 5HTOA 4XRGA 4IDFA 2J5KA 1V9LA 4RO0A 1K89A 1U3WA 4XQEA 3KO8A 2YYYA 5EIOA 4YJGA 4L75A 4M89A 1EE2A 2OP1A 2WYVA 2X0NA 3F1KA 4O6VA 4NBVA 1JQBA 1UP7A 3F1LA 4MVJH 4KDEA 2YJZA 3ROMA 1MFPA 2ZTVA 3GUCA 3M1LA 1EQ2A 3G0OA 3ZZNA 1NXQA 2CVOA 2E49A 1ENOA 3RBXA 2HRBA 4N7RA 3CE6A 3WLEA 4BMVA 1UZLA 4JN6B 4XD2A 2EWMA 2VRCD 4XGNA 5CDTA 1I3LA 2B4TO 3EYWA 2PGJA 3DFUA 1F8GA 4HADA 4CMIA 3OMLA 3UN1A 3GDOA 3WDSA 3I9LA 4CM8B 2AQ8A 1UXIA 4QQRA 4RORA 3VC7A 4CM9A 4LW8A 1ISJA 1MV8A 4DMLA 2D0IA 4F6CA 2UAGA 4XJTA 1U28A 3VTZA 1CF2O 2B0JA 5A3JA 1V0JA 3FWZA 3AU9A 1A72A 4EUEA 3MJ4A 3FCOA 3K6JA 3W6UA 2Q2WA 5JCXA 3KEQA 3ONDA 5TQVA 2IYOA 5CEEA 3VTFA 4ALLA 1PR9A 3COSA 2UUPA 2WD7A 3TSCA 3X2FA 3GVXA 3MJVA 2Q1UA 3PLNA 5KNLA 4BQRA 1LLUA 5DZSA 3PHLA 4GKBA 3KZVA 1BDBA 1LDNA 2ZB3A 1T1SA 1PX0A 1K2WA 4IDAA 5FI3A 5BSFA 1R0SA 3GPIA 4HXYA 3SBOA 8ADHA 4O5OA 3SEFA 1H6BA 1M6WA 2Q45A 4MVJF 2W2LD 4BNIA 3EC7A 2EG9A 3AM5A 3B6ZA 5FYDA 1G0NA 3TL2A 1JDJA 3NGLA 4ZICA 1NHGA 3AUSA 4BB5A 1EK5A 4OOEA 4UUPA 4RCVA 3L4BC 2PH5A 3H9JA 2ZK7A 4RVHA 3TQHA 1U3VA 4YAIA 3PIIA 4E0BA 4XYGA 4EBFA 2Q1TA 1SB8A 4FFPA 3X2EA 4YJGB 4S3MA 4TZKA 4II2A 2X5OA 3DZKA 1O89A 5DNAA 4BO8A 4PLGA 4CLHA 1IL0A 1ISMA 3F5QA 4Y6PA 2FY8A 1I3MA 2Y1FA 1Z6ZA 2BELA 2HMVA 3Q9UA 3V1TC 1I2BA 4RVUA 1CIVA 1QMGA 2C7GA 4YBZA 4OL9A 2XOXA 4XX0A 4CMIB 1GPJA 1ZK1A 5I8ZA 4P22A 2ZKLA 1PIWA 3IP1A 4NU5A 1T1RA 4FGSA 2I67A 3QJ5A 4LCJA 4E2WA 4Z9YA 4W7HA 4WEQA 2VWGA 2DAPA 3UOGA 3L6DA 1IPFA 1SEVA 4JJIA 1E3JA 4BMSA 4PZEA 5K6AC 1YO6A 5L3ZA 1Z82A 3BYZA 3FTNA 5AXAA 1PS9A 4PG8A 4LRTB 1P31A 2C54A 2WD7B 3K30A 4GKVA 4WASA 4YWJA 3OBBA 3WYEA 2QZZA 3I4CA 4DTIA 1G1AA 5A4DA 5TIIA 3PYXA 4JK3A 2CVQA 4J0EA 1A71A 4PN3A 5KVCA 5TS3A 1U7TA 4L4SA 3NDJA 4NNJA 3P19A 5IXSA 4DC1A 1CQIA 3LZ6A 4WOJA 5DP2A 2G76A 3GNSA 4WGGA 3LYLA 5BSEA 3INGA 4J43A 2HK9A 1RM5A 2NSDA 4BO7A 1D1SA 4W9NA 3U0BA 2GZ3A 3E82A 2QHXA 3E6AA 1SEPA 3H2ZA 2Y1CA 1I33A 4ILKA 1WVGA 3SLKA 1PJLA 3TL3A 2DBRA 3M2PA 4I9UA 4QTZA 4YB8A 1QYWA 1D8AA 2IXBA 5JCJD 4BO0A 2EIHA 1E5QA 3BTSA 3IMFA 4I5DA 3GEGA 4YAEA 3ZWYA 1I5RA 1NVMB 5I7FA 3GR6A 2DUUA 2DBQA 4UREA 1DFIA 3MWDB 3OHSX 3CMMA 4XQCA 4FFNA 4IM7A 5JSFA 2VWHA 3PHHA 1ZK4A 4UULA 2P9CA 3JD4A 2C0CA 2GGSA 3EZYA 1JVBA 3QWBA 3ZNNA 4ALNA 2PWZA 2C5AA 4DBVO 2BFMA 2CVZA 1NWHA 4GWKA 4CUZA 2GN6A 2EERA 3I23A 3WGQA 4JQCA 3WQSB 1RM4A 3H6KA 4M49A 1GEGA 1HXHA 2YQ4A 4BNJA 4N5NA 4XWYA 3PJEA 1E0DA 3QVOA 1QG6A 3V2HA 5TJ9A 2VHXA 2Y66A 3WWZA 2X9VA 3GVIA 4YAKA 1ISIA 4LSWA 4BV9A 4CMHA 2I99A 4QXMA 3BMOB 3DZGA 1XIVA 4BKUA 5CP8A 2R6JA 4OXKA 2O3SA 4R01A 4BNTA 1HDZA 1F14A 3JQDA 4CMCA 2X0JA 3C3XA 3RCBA 1XG5A 4JBIA 1QV6A 2GSDA 3RFVA 3PPIA 4ID9A 4AJEA 4E2YA 3F46A 4BQPA 5IF3A 1HE5A 2EW2A 5AXBA 4J2HA 1KVSA 2GN8A 4J4TA 4E4YA 3FR7A 3L6OO 3RUHA 3AW9A 4GI2A 2PR2A 2V6MA 1DLJA 2AE2A 3LLSA 5CEFA 1QYVA 1JKJA 1LX6A 4B3HA 1EUCA 3PDJA 3QIVA 4X54A 3JQFA 5U1PA 2EF1A 4PG6A 5T8KC 3B20A 3NUGA 4ZQBA 3R0IA 5T57A 2VCYA 4R4JA 5TSDA 4B3IA 1Q0HA 1ADBA 4B4OA 1GYRA 5IDXA 2X8LA 3DO5A 5IFLA 1J0XO 4I1IA 4OM8A 1PU2A 3L9WA 3DHEA 5JDIC 3U4CA 1O94A 1K3TA 3ITDA 2O4CA 2DFVA 3D3WB 1KY5A 3HQ4O 3R3SA 2EGGA 3MZ0A 1QYXA 2GLXA 3ABIA 4MIOA 5H81A 5I9MA 1OMOA 4B7XA 4NBTA 1DHRA 1SZJG 4R51A 5GZ3A 3AJRA 3FSRA 3KHUA 3T4XA 3WGIA 4EEZA 1DEHA 4LVCA 4W99A 4Z0HO 1ZUD1 3L9XA 1YB1A 3WIEA 4PLWA 1Q7BA 1NQAO 4GX1A 2O7SA 3GZNA 4KWIA 5A03A 3ROQA 1PGOA 2WTBA 1XKQA 3BTUA 4YCAA 3AWDA 4NG5A 4DBZA 3BMOA 3JD0A 1P1KA 3RC1A 2NV6A 1JU9A 5T64A 2POQX 1U8XX 3H3FA 4R41A 1EQUA 3W8EA 1H6AA 2VZ9A 3PGJA 2AQKA 1LSJA 3WNVA 1YL7A 4G2NA 3CZRA 3ZW9A 1I3KA 2PV7A 5CAEA 1BDMA 4S1VA 1E1LA 4IDCA 2JAPA 2G0TA 3I52A 4Q3EA 3DQPA 3LSYA 3QW2A 4IUYA 3TOXA 4CM1A 3MWEB 4TROA 4BGIA 1HKUA 3F4BA 4MVJD 3GT0A 5KCZA 1YXMA 2CF5A 4D0RA 5A5EA 4RQTA 1RPNA 4PRKA 3V2GA 1DRWA 5L95A 4ZRMA 2QIOA 3OF2A 1EK6A 2YHIA 1U3TA 3VKVA 3ZWNA 5U4QA 3WTBA 1G0OA 4AJ2A 4YJDA 4YA6A 2HSDA 3OEWA 4DPLA 2D59A 4DMMA 2DC1A 5KJCA 4YAJA 2E82A 5BT9A 1EMDA 3LC1O 3SC4A 2AG8A 4BV8A 3ADOA 1Q0LA 4IDGA 3D3WA 3N7UA 3LLVA 4RZHA 1IHYA 3GVCA 4IMRA 4K1LA 5EQDA 4PLHA 4E32A 2Q2VA 3RFXA 5BR7A 2V6FA 1E7WA 3FNGA 1YRLA 4L9RA 3HADA 3KYDB 1U5AA 1UH5A 3VVBA 4ROSA 1JN0A 2PLAA 3DBLB 1NX6A 3KETA 5EN4A 1K5HA 2VYND 3HUDA 3ZV5A 9LDBA 4MP8A 3A9WA 5JDCC 1ZW1A 3LF2A 3QRWA 1NR1A 3Q3CA 3KLMX 1HDXA 3GZNB 1HE2A 1NFFA 3RVDA 1O9BA 1CRWG 1UP6A 2H5LA 1VKOA 4OH1A 4J3FA 4ZRNA 1BXGA 4UEOA 5LDGA 3T7CA 4IJUA 5CHEA 3PI7A 3RAJA 1SOVA 3MJTA 1EVYA 1EFLA 4K6CA 3HSKA 2B37A 4OJNA 4J9UE 5C3MA 2BD0A 2YQ5A 1GPDG 3C7AA 1F12A 3DTYA 3RROA 1TLTA 3W8FA 1D7OA 1UAGA 3V1YA 1U2GA 5JBIA 4K9DA 1AXGA 1ISHA 2Q3EA 3OJFA 3AUTA 1P74A 4MVJP 1UAYA 5MGBA 1C0LA 3RUEA 1F17A 3NJ4A 5C7LO 2P5UA 4CM7A 2NTJA 3TF5A 1KEVA 3ASVA 5HWSA 4FIZA 3AI2A 4HUJA 3SJ7A 1RYDA 1ULUA 2BKAA 5G0UA 5L4SA 2YHIB 1I32A 1XQ1A 3CMCO 2Q49A 1Y9EA 3NDIA 1W4ZA 2NVBA 5G0VA 2WE8A 4Y8VA 3L4SO 1VKNA 1DIGA 3UGKA 2BMAA 3QWFA 3WMXA 3W6ZA 1ML3A 2BFPA 4M8SA 2DBVO 2EJWA 2OL4A 2D5AA 3VH4A 3IAHA 2X5JO 3HN2A 3AI3A 4J9VA 3NYWA 1OC2A 1JW9B 4PVDA 4DPKA 1V3UA 1X0XA 1GU7A 5KJEA 3IKTA 1FMCA 4M86A 4BNVA 3OEYA 4DVJA 3EY4A 2HLPA 2CNBA 3DZFA 3L77A 3AM4A 3JQEA 1NAHA 4FD3A 4JP3A 4A73A 2Y1EA 2VRBA 3JYLA 2GD1O 5ER9A 1LDEA 3KYDA 2QRJA 3GG9A 5DCYA 4W6ZA 5F21A 1B8VA 2QRKA 4I8XA 3DBLA 2JHFA 1RJWA 4LK3A 3DHNA 1I2CA 5I7SA 4AJKA 4B3JA 5HM8A 2EP5A 4K26A 4IJVA 4BVAA 1UXKA 2NQ8A 3F5SA 3JQBA 5HRUA 1ADCA 4BGVA 2PZKA 1BXGB 3TZ6A 4WCDA 4CMJA 4DUPA 1X13A 1GQ2A 4NK5A 3KOUA 5HS4A 3P2YA 1Z7BA 4OXNA 2FN7A 4BMNA 1I24A 3RQSA 5EESA 3KVOA 3LC7O 3ONFA 4R5MA 4YEDA 3H8VA 4DPMA 4AJNA 2TMGA 2IEDA 4E30A 1JAYA 1GDHA 1H93A 2GRAA 1WP4A 3K2BA 3IDSA 3U4IA 2GO1A 3JCZA 4YTEA 3QE3A 4PGFA 3UFXA 1AHIA 4H3VA 4RL6A 5TF4A 2HK7A 4XDZA 1ZH8A 4DLLA 5L40A 2X58A 5CG2A 4J4HA 4U6SA 1ZJZA 1PEDA 1FDWA 3DWFA 2Q1WA 1U7HA 2O3JA 4FJ1A 1LRJA 3AUUA 3E48A 4ONEA 4DIFA 1EUDA 5B4UA 1OBFO 5DT9A 3WBBA 5ITVA 1FXSA 5FFFA 5LDHA 4OAQA 2ZCUA 3QA9A 4K28A 4CV0A 1JAXA 2B5WA 1PGNA 5JAZA 3GVHA 4IIUA 4GPD1 4CJXA 2Y0DA 1DBVO 1VJTA 5GZ1A 2HMUA 1X7GA 2GZ1A 3GG2A 4CMEA 3ENNA 3NGXA 3ZGYA 1BRMA 1P1IA 4ZQEA 2B4QA 4C7JA 3AOEC 4NK4A 4NIMA 1CWUA 2EP7A 2WWRA 1LDMA 3KYBA 5L53A 1KC3A 1D3AA 1F0YA 1SMKA 4W4TA 3ASUA 4E6PA 4NBRA 1K6XA 2VOEA 1R37A 1YOVA 1AGNA 3MEQA 2P91A 1YL5A 1HRDA 2PGLA 3PYMA 1GV0A 1LLCA 3ZWVA 2JCYA 2VZ8A 4BOYA 1QLJA 4B4VA 3AUAA 1JKFA 4JXKA 2GUGA 5AYVA 3ZNQA 1PL6A 1N1EA 4I5GA 1R0KA 2XF8A 1YDEA 1P45A 3TZKA 4UUOA 3WICA 2I3AA 4R1SA 2BLLA 4XA8A 5TNXA 3Q0EA 3ZWBA 4E5YA 4P8RA 2Y1GA 4MIYA 4F6LA 3JTMA 3VVCA 3ZWAA 4L73A 1Q2XA 2O23A 5ILOA 5DOZA 4U7WA 2JFFA 3D0OA 4GMFA 1NYTA 2J3KA 2YUTA 4FC7A 3WG9A 3QP9A 1FF9A 3JQAD 1H9AA 3I9NA 4P4NA 2VHVA 4NBWA 2AMFA 1GD1O 4NFHA 5A9RA 4B4UA 4I08A 2DKNA 3I9KA 4XQ9A 3GAZA 5CPFA 1QLHA 1PQUA 3O8QA 1HT0A 5BSGA 3PZBA 4AJHA 3H3JA 4TVOA 3ST7A 4CV2A 3QVXA 2I66A 4E5KA 4WPGA 1ZEJA 1OFGA 1MG0A 1JTVA 2A92A 3NTRA 4NJMB 4OSPA 4PCVA 4ZQGA 3IJRA 1E77A 2GCGA 2D4AA 3B1FA 2JFHA 3O4RA 4QO8A 1PTJA 2WYUA 3O26A 3JQGA 4RZIA 2DLDA 2NUAA 2VQ3A 1MXHA 3DXFA 4BO1A 4E5NA 5EERA 1PZFA 4QT0A 4MKXA 2VTEA 3GDGA 2AA3A 4UUMA 5THQA 1H9BA 3QWIA 3ZHBA 4BNFA 4D45A 4DIOA 4DRYA 2QX7A 5AOVA 3GGOA 4CUJA 4M1QA 5K6AA 4Z6KA 4YRDA 2O50A 3U49A 5H83A 1J4AA 1BMDA 1GFSA 1DJNA 2QZ9A 3D3EA 1ZXLA 4TMFA 1ISGA 4AJ4A 3FR8A 2C2YA 4HFRA 1DJQA 2AEMA 1NFQA 4ND3A 1YOVB 2JCVA 3TN7A 1H0KA 5F5LA 3FBTA 3S2GA 4QEDA 4G5HA 1ENYA 3RU9A 1SPXA 4NJOA 3ZWMA 2QW8A 1OZAA 1EBFA 1O8CA 3HDYA 4MP3A 1VSVA 1YQGA 1PGQA 1PL7A 1UXGA 4KP7A 1YGYA 2P9GA 2VYVD 3E1KA 3D5QA 3WXBA 2Y05A 2Z5LA 2PH3A 5GY7A 4CV3A 2HKIA 4CODB 3H9EO 1WMAA 5TT1A 3MOIA 5JC1A 4IY1A 1C1DB 5TJHA 1B15A 2VUUA 2AEFA 4KTVE 3KRTA 4BO4A 4R16A 2CMDA 4XGIA 1P1RA 4PIVA 2BI7A 3UUWA 5IN5A 3ZH2A 3BHMA 4IPTA 2GYYA 5L4NA 4R69A 3H9GA 3INRA 2NU7A 4UVIA 3K96A 3PVZA 1GR0A 1DFGA 4OKNA 1V3TA 3U3XA 4XYBA 4EDFA 5CDYA 1EE9A 3LT4A 4CR7A 2LDXA 4D41A 1XQ6A 3O8QB 5DOVA 2UYYA 2OFPA 3D1LA 4HFMA 2P68A 4NJMA 1E6WA 1WZEA 2C29D 4FOSA 1VRWA 3JQ9C 4W82A 1P77A 1Y8RA 4NI5A 4TRRA 4DC0A 2NACA 2GNAA 4B7CA 2WDZA 1IZ9A 4W9NC 3RSHA 3JQGB 4FW8A 2XXJA 1MC5A 1ZZEA 3L6EA 4BO9A 1LBEA 4D3FA 2RHCA 1DRUA 3BAZA 3C7CB 2WEKA 1T24A 3GRKA 4RPLA 4RLSA 1YWGO 4BNKA 2OOSA 1GY8A 1KETA 4FFRA 1CEQA 1I30A 2BGKA 3ANLA 3EDMA 4WEOA 3WQRA 3DR3A 3D64A 1I8TA 1SC6A 5IDYA 3TRIA 3Q1LA 4YT8A 3WWYA 4ALMA 4UEJA 4II3A 3BMQA 3GK3A 2W90A 4BL5A 3ROKA 2DFDA 4IS2A 4WOKA 5G2OA 2D2IA 1HDCA 1LQTA 2HUNA 3D4PA 1XYGA 4OHUA 4OQZA 3QWHA 2NM0A 3GUYA 4Q9NA 5T6BA 3VZQA 2VWQA 4WCFB 3S1LA 1ZEMA 1KEPA 3DAGA 3RI3A 4J7UA 3E5MA 5EJ2A 4D46A 5JY1A 3QQPA 4Y67A 4ZA2A 3ZV6A 4CUKA 2GDZA 3PZRA 1C1DA 1HYEA 1Z7EA 1MLDA 2ZATA 4JLWA 4WE3A 2G5CA 4IGFA 1L7DA 1YS4A 4O0LA 3M6IA 4B8ZA 3K8ZA 1XR3A 4JNKA 3FPLA 4EW6A 2G17A 1I01A 2X86A 2ZYGA 3BHJA 5THKA 4RPHA 3SVTA 3PRJA 2D3TA 4DQXA 3OQBA 1OI7A 4WECA 3OETA 3RKUA 3PQDA 1BVUA 2EEZA 3GY0A 3KM0A 1E1NA 3F4LA 1Y8QB 2W98A 3VPHA 3LU1A 3FWNA 1GL3A 1PSDA 4OQYA 3QWAA 3KEOA 2NTNA 4NZ9A 4GX5A 1B3BA 4MOWA 3K9QO 3NJ8A 4IIVA 2TMDA 1Y8RB 2WE7A 4M55A 1YQDA 3RUCA 1NPTO 1T26A 4CR6A 4J90A 2NADA 1P33A 3VPXA 1EVIA 1P1FA 5JC8A 4A5OA 1NASA 5JO9A 1LXCA 1WDKA 3NT2A 1F06A 1YL6A 1XGKA 4KDFA 2O3QA 3G3EA 1ID1A 4D3SA 3WIDA 2YDXA 5JE8A 4YACA 1YVEI 3OA2A 2Y1OA 4PG5A 4DIBA 4FC6A 3OQ1A 5KVQA 4O59O 3BMQB 1QYDA 2RH4A 8LDHA 1A5ZA 1U9JA 2ZJ1A 1VC2A 3WOHA 1HE3A 2DU8A 4RVGA 4MDHA 3WLFA 5JDIA 4CLXA 2OO5A 4U6QA 4WCFA 2H1SA 2HQ1A 1BWSA 1HLDA 7ADHA 1ONPA 1JKIA 3LF1A 4WLEA 3ADPA 3IP3A 1SNYA 1DB3A 1SO8A 3QVSA 1ZMTA 4CV1A 4P38A 5T67A 3HFSA 4D43A 2C20A 3OA0A 4KQXA 3AFNA 1CYDA 4M87A 4K6FA 5C5IA 4AJIA 3E9NA 4H15A 4A03A 1Q0QA 3NDRA 5CEJA 4TZTA 5JNLA 1VI2A 5JY6A 3U62A 3R6DA 3KB6A 3B1JA 4BO2A 1TA4A 3N58A 3INTA 5IZ4A 1DIAA 2HJRA 1ZKMA 1BTOA 1KBZA 2GPTA 3O38A 1E6EA 3K92A 2O3TA 3JV7A 3K5PA 5ER6A 1BGVA 4B79A 1A27A 1Y8QA 2VHWA 2VNSA 1C0IA 2CSUA 3VZSA 3TFQA 4L4XA 1KVUA 1H6DA 2A94A 1NBOA 1Y5RA 3IS3A 4LSMA 1D4FA 1ZSNA 1NVGA 2XPCA 1X1EA 1E3EA 2VZ0A 4XKJA 5A5FA 2ZTLA 4YRBA 4IQGA 1NFRA 1GUYA 3FN4A 3OJOA 3WYCA 1ZFNA 1ORRA 4CL3A 2NVUA 5IDWA 2PZJA 1CETA 5C37A 2DTDA 2DQ4A 3RUDA 4BKRA 4ALJA 4EI2A 5ICSA 1YJQA 4CPDA 2B36A 3ZHYA 3WB9A 3DZBA 5JS6A 1DAOA 2AXQA 3WGOA 5AVOA 1GCOA 5JLAA 3TNLA 4L76A 5U9CA 3LDHA 4R68A 4HV4A 2OZPA 5KJ6A 3SJUA 2JCXA 4KOAA 1GZ6A 3FI9A 5F1OA 3W8DA 3KYCB 4BUCA 4BGUA 3F6YA 2V65A 2BRUA 1M67A 1VLLA 4WLNA 2DUWA 2BHLA 4XGKA 3PLRA 1DOHA 2AG5A 3HDJA 3P7MA 4ZU3A 3ZWCA 2AEJA 1HEUA 1L7EA 2PKQO 2FR8A 4N18A 5AXCA 3GMDA 2UV8A 5JAIA 2Y0EA 4PLPA 4YDRA 9LDTA 1UP4A 1ZCJA 1IULA 1PJ2A 2IODA 4Q3AA 4FFOA 3GDFA 1ENPA 5CDGA 2DTXA 2QYTA 3IL2A 4YVFA 1CDOA 4H16A 3JQ7B 1KOLA 3S2FA 4I9NA 2FZWA 5ITWA 1DDOA 2H63A 1DFHA 4FSHA
chains in the Genus database with same CATH superfamily
5EZ5A 1L4KA 4D4IA 1EFDN 4JELA 4MHOA 2FN8A 2Y76A 2VWPA 2X7XA 1HFWA 4WKBA 5ALMA 1Y81A 1ISSA 2YFHA 2ZIZA 1VJDA 3JSAA 1NMSA 3PXDA 5COAA 1TQDA 3BSYA 4LQ4A 1YK0A 2FAXA 5C46F 2VATA 1W0KA 4MR8B 4NDNE 3EE6A 1C1XB 4PONA 1L5VA 3VOSA 2V6BA 4AMBA 2FWPA 1GWNA 1G7SA 4FGWA 3SIWA 2DKFA 3FBWA 3FJ1A 1AKVA 3PR1A 2F1KA 5EMMA 4YAGA 3IHWA 1KKUA 2C9CA 3OZTA 2CWDA 1EHIA 1W0KD 3RUPA 5A06A 1XPRA 2VNJA 1WMBA 4FJ2A 3VKUA 2K2WA 4C07A 3M6WA 4XDHA 2OZLA 3RIMA 1EZ4A 1D2GA 1RJDA 3L7OA 5AJUA 1T15A 3HYNA 5ABPA 5BWOA 3HKEA 3QLUC 4RULA 4V1CB 5GONA 4UZSA 1F5NA 2YZKA 4Z0TA 1QOQB 3FLAA 4GKKB 3JYQA 3A6HA 3CF0A 5KYWB 4JJZA 4A6EA 1XRNA 3VYVA 3LK7A 2Y92A 4JHLA 1ZK0A 2BKLA 4Q9IA 1AUVA 3Q3VA 1PR3A 1L4MA 4M37A 5BNZA 4FFDA 4AYXA 3WLQA 1XTPA 3VJMA 1MAVA 4MQBA 1G9SA 4MI3A 4PS1A 4RPJA 2WSSA 4N0EA 5IJ0A 5J4VA 4Y98A 4DA6A 2BMFA 2IBSA 4XE5A 2I1WA 1XLVA 2OPHA 2IHZA 4F7WA 7MDHA 3C7KA 5F3RA 4JVOA 4E1AA 5A7FA 3IB3A 2J0UA 1L5GB 3I58A 3GLFA 3M9WA 1W6UA 3CCCA 1FRFS 2QTTA 3D4NA 3IPRA 2GKOA 3TDMA 2Z5FA 4CNQA 1RBYA 3GA7A 4LJ4A 4LE1A 3BT7A 2YS7A 4CLRA 1YACA 3M3DA 1KEUA 1IONA 3VBCA 1PNTA 3VPBA 4LAFA 4FMCB 1TKAA 1Y5LA 3BA1A 2O54A 2J67A 3DKPA 2OYSA 4C4PA 1KDPA 3OOHA 4L1KA 1PEKE 1V16B 2BFBA 3DBHB 3H6GA 1JIJA 3USCS 1B6TA 1DIHA 2UZ1B 1YHNA 3HK2A 4OHYA 1XVTA 1KYYA 2GVDC 1OB2A 3EQ6A 2B78A 1IWPB 1N0IA 1NT4A 3OTQA 1PNRA 3MAJA 1IQRA 4DV6B 1WUTA 3OT1A 2QP9X 1LVHA 2XZTA 2RD2A 4MR9A 3MYYA 1PQWA 2ECKA 3PC4A 1QRSA 1G1MA 4HH1A 3HJUA 2OA0A 2RJNA 3N2KB 1M2HA 4L02A 2IHBA 1NNEA 1U8AA 3KTOA 3QIAA 1AHHA 3DMYA 4G5FA 5EGSA 4NFYA 2Z6UA 5KOJA 4Z7OB 1Q6YA 1T8WA 4R1MA 4BLUA 3VR5D 4KR9A 1FDOA 2QOEA 4JLPA 3GLVA 1J99A 1OFHA 1TMGE 1SOMA 3GCZA 1J9EA 1PGJA 3NIDB 4F1JA 2C4WA 3ZI0A 4C3UA 4D9KA 1CVIA 1AK1A 2G0AA 2ORWA 2DHQA 2FHSA 3AR3A 4HS4A 1Y6RA 3NTUA 4J4BA 4QVGA 2W2PA 4TTQA 4X00A 4YR7A 5CG1A 3S6JA 1WW8A 1N77A 2Q4OA 1G20A 2XIJA 1AQNA 4AP9A 2EWWA 3IAUA 2IHKA 2QTWB 3HB4X 3ZWKA 3BA6A 1A7JA 2HIMA 3EMDA 4LZLA 2P41A 1C9JA 3E1GA 2XYQA 3C8MA 2R2GA 1TTQB 1E3SA 3FKSD 3PTZA 2ZZMA 4CNBA 2XQJA 2GK7A 3MOGA 4QWWA 3WVNA 4FKZA 3P27A 4HYQA 2MSNA 4Q9HA 1XPJA 3ESZA 1NXXA 1TT5A 5A3VA 3AB3A 1E2BA 4G0WA 2J45A 3ZZMA 5IC4A 2D13A 2RJOA 1T4CA 2HQSA 5IJ0B 1XEAA 2RHMA 1WB5A 5K3SA 2I7VA 4MVCA 7REQA 5CDFE 3GCDA 1U0LA 4P7JA 4IQ8A 4J6FA 3PFNA 5IUJC 1ZJ5A 2IEBA 1QORA 3K73O 2J0UB 4MTCA 4XB1A 3UWSA 4OI1A 3GQVA 5CB6A 2PO5A 3D6TB 4J16C 5CT4A 1KMNA 4KQ9A 4OSOA 2OSVA 5C4IA 2L69A 1ELOA 5I4BA 4E1BA 1M75A 2XQGA 3BIOA 3DB2A 1VMDA 4KIJA 4KQEA 4KRYA 3STUA 1U11A 4TKLA 4MQ4A 1N6PA 4EPRA 5BORA 1OVMA 3TDNA 2LIPA 3DF9A 3WC4A 3HA7A 1ESNA 3G23A 4JLMA 4KVAA 1Y6FA 2WKQA 3AHDA 4TVSA 1R6AA 4I1OA 3ILXA 2F3TA 3GJXC 4UC0A 2Z5VA 5EP2A 1N57A 4UE6A 2FE4A 2AVDA 1D2HA 2OKCA 3LT1A 4AXBA 4ZYTA 4BVBA 1MQ9A 4Z99A 5A2QA 5AVKA 2I3ZA 1IPEA 1E1RA 2ZYDA 5KTKA 3QSYA 4QYXA 1IHUA 4F2DA 2GNPA 5CFNA 2VR1A 3QMPA 4KRGA 2WIKA 1M76A 3GLUA 3HNPA 4YHBA 1H8HA 1I13A 4HWSA 3GJYA 3HFGA 4RSMA 3SX2A 1DIBA 1RYEA 2XDYA 4UCXA 1NQOA 3RAPR 5MHTA 2HCFA 1E7QA 3A2LA 5FNVB 2GA9A 1XCGB 2A14A 2WIAA 2VSNA 2GASA 3DW1X 3FE2A 2FSVA 1LVGA 5DYNA 4DJJA 3FNBA 3HKCB 5JNTA 2GAIA 3WO1A 1Z83A 2ECOA 3B6MA 2HC9A 3MN1A 1W1IA 3LA6A 3RVNA 4MO9A 3G13A 3B9BA 3EQZA 1IK6A 3CN7A 3KR0A 1GAWA 2QX4A 3ZWPA 2DQSA 6Q21A 5JNRA 3QYPA 3P8ZA 1MGOA 4TVBA 4LSGA 3V80A 2O2SA 4HC4A 4N4AA 4ZOAA 1KI9A 2C4TA 4PSDA 4CKZA 3AR7A 2PM8A 2IV2X 1SCIA 2XYVA 3GRVA 3P4YA 4TTAA 4MS4A 1RXVA 1M66A 4KQ6A 1KJZA 1VL1A 2NSLA 1O94C 1SK8A 2F17A 3B70A 2OHJA 2Q3LA 5G0TA 5GTDA 4KFCA 2AVNA 3EW7A 3AHIA 1KU0A 4PQYA 4Q7KA 1QFYA 2ZJ2A 3CR3C 1T4CB 3V8MA 5JD6A 2YVQA 3QVWA 3PCTA 5FWYA 2XCOA 3AXTA 3FVQA 4CDGA 1RI1A 3A28A 3VUFA 2Z3VA 2WSYB 4RPKA 1LLDA 1RAEA 1YIAA 2HPVA 1QO0A 3GEDA 3N05A 4RD1A 4A5SA 2JD0A 4BCCA 2W42A 4QU8A 3OZWA 3L4KA 1WX1A 4WCVA 1MB0A 2CDCA 4C01A 3KVRA 5BV0A 2TMKA 1S2NA 3C4QA 4H7KA 5GZ6A 3WYBA 3ZDRA 4HQKA 5JAMA 1TLLA 1XWFA 3LYUA 1DKRA 1WXQA 2BY4A 5BOSA 2GERA 1P7CA 4DLSA 2ZRQA 4QPCA 4X0EA 4XD7A 1XLTC 2VDRB 1ZRHA 3E2IA 2J3DA 4ESEA 5KYYA 3IUYA 1HFKA 5IZCA 2ZYAA 1MOSA 4C0WA 2I8LA 3OE5A 5ENDA 2IV3A 1TUIA 4R7ZA 4W1SA 2H7XA 2XUHA 5GAJA 2O14A 4QTUB 1BD4A 3KSMA 4KVZA 1MJGA 5LC1A 4EPXA 2JGJA 2EKZA 1CUBA 4CKEB 1D09A 3OTWA 3RSQA 3VH3A 2C98A 1CFJA 1DL5A 1LS1A 5CK5A 1G7RA 1CS0A 4HO1X 2XHZA 4K7JA 3UM9A 4RD2A 5CH3A 4E3WA 2H51A 1JILA 1J24A 1QB8A 2QTCA 4LN1A 3S0JA 4L8YA 3TCXB 3DEIA 4D42A 4D3XA 1N2SA 5KTOA 4UPDA 8GPBA 1IB0A 4F3TA 8AT1A 3E8XA 3TIVA 2CDNA 3HWWA 4GBJA 3QU7A 2BTQA 4RVFA 1KAGA 4JJGA 1B8NA 3OCUA 1CJMA 3KHTA 1KPIA 1DINA 1O9HA 4YN3A 1E1QD 3AEKA 1NF8A 1DADA 2EBFX 3KCNA 3JQ9A 2C9MA 3SSNA 5L3SB 3D54D 1L2TA 1IUNA 1LK0A 3LA8A 3PX7A 5K1ZA 1QP4A 5HKOA 4BCBA 1TAQA 5CBPB 1SC9A 3S4YA 2H4WA 5IBCA 5GADl 4IOLA 3MQ2A 3SNHA 2RKBA 3WGJA 2DWQA 2ZU0C 2JFGA 3RC8A 1R4AA 4JXJA 1WHSA 1Z0ZA 4G25A 2HDWA 4LUCA 4EA7A 4F7DA 5E95A 5KPJA 4GZMA 3H9UA 4NR0A 1OHHD 4AJJA 4E46A 4YUWA 1BROA 2MT9A 3BTOA 4LZPA 1XB2A 3QVVA 1M6YA 4OXRA 3ZTWA 4F06A 5AFSA 1XA0A 5TQJA 1KZ4A 1NNLA 2ONCA 4O0MA 4EMUA 2W4QA 4UUNA 2CF6A 1AZWA 3CLRD 1GN8A 1Z4NA 2FKAA 2PT7A 2GJAA 3P96A 3RF7A 4EO9A 3KDSE 5LXTA 4N7BA 3OZVA 3R5HA 2MYNA 5J40A 4GE0A 2PX0A 1PJAA 3LPMA 3UMSA 3JZFA 5FWYB 2WQ6A 2I7DA 3T1YB 3OURA 3VR1A 3SX4A 4HRVA 3UW3A 1R4ZA 4I19A 2XDAA 4GVXA 3VZRA 4PO3X 4EJSA 2GAOA 4COKA 3MPOA 3OH8A 2IX9A 4TRNA 4UXHA 4OEHA 5HKKA 1Z8FA 2GBLA 2PKYX 4L9AA 2V1UA 5AVXA 1GCUA 4G0XA 1JWBB 1LTQA 4V0LA 4MGKR 1SBQA 3WL3A 1E6LA 2BKUA 3A6FA 3OAAA 5HIMA 4R9RA 3FRJA 3B53X 5ULLA 1B26A 1T3TA 2HXSA 3HVUA 3KKMA 1P3JA 1U2DA 2P0YA 3HBLA 2X4GA 2CHQA 3L8CA 4F1KA 1ZU4A 4P7BA 1QYIA 2OECA 1BU8A 2EATA 2A4KA 1GPBA 2PN1A 1ECGA 3IQIX 4MV0A 3RVSA 3WGZA 4DDWA 3FNRA 1XMIA 4N3GA 3NPAA 4F92B 5DTIA 3ROXA 4BIMA 5IBQA 3AP2A 1ZRMA 1GLGA 1I94B 3IYLW 2IDZA 1U4OA 3EVCA 5AW1A 4B2YA 4DYVA 3QBVA 1UFKA 5FJIA 1NR7A 2ECFA 2F59A 3DC7A 2XZOA 1PYOA 2O48X 3SLGA 1RRKA 5HCNA 1VIMA 1Q92A 1Y3DE 3ZZ1A 5B12A 2CY0A 1QIKA 4ITUA 5AI5A 4I4NA 5A9TA 3O2JA 4YROA 4CEJB 4NRDA 3FKSA 1SXJE 4ZYWA 2W11A 3OX3A 1UK9A 4P82A 5NULA 3WGYA 3SZMA 1OV4A 2DPGA 2Q4BA 3L0IB 4MR7A 2IKQA 2D8MA 3OTHA 1SU4A 2OCAA 3QFSA 3TQCA 4UTRA 2VRNA 4AS1A 4DLAA 1X3SA 3W4IA 4NU0A 4A2WA 4AMYA 1Q11A 3HCNA 4RK7A 4PXAA 4V0QA 2XYHA 2GBGA 2HHJA 3AH8A 1N9ZA 3GN1A 2Z6QA 2RC5A 6PFKA 3PU6A 4RY8A 4UVEA 3U5TA 1WZ2A 3BD6A 3S8MA 1PZXA 4CM6A 1YJ8A 3QENA 1RCUA 4XIFA 5EXDA 1VJ0A 4RHCA 1Q21A 3RQIA 1V37A 4HNRA 1JKXA 5IFKA 4DR1B 3E8SA 1RJEA 3O0DA 4PFJA 5FOTA 2XTJA 5BYKA 3OA2A 4L7VA 1VJ1A 4LXYA 3EOBI 1QH0A 2GMWA 2F9LA 4NZNA 2WJ6A 4OJKA 1VB3A 2LKDA 3IVAA 4WESB 3U9LA 3OKCA 4GMHA 1IEVA 3QEKA 4TSKA 3ENZA 5FTLA 4I2VA 4JNGA 4N5MA 2P8JA 4RZXA 2AFHE 2YC4C 3PNLA 5FEUA 2B4YA 3CSDA 3M2TA 3FUTA 3W5HA 4ERNA 5MN4A 3FOWA 3L7YA 1T2EA 4ER6A 3T0GA 2EGHA 2P9FA 4IQ0A 5M7EA 3KQVA 1A2KC 1TI7A 1Q19A 3TUZC 1V5EA 1P17A 3OICA 2CUKA 4FEYA 5A9SB 1L4EA 1GTRA 2DM6A 2YW9A 3SZGA 5SYNA 1S8OA 4UVDA 1OGYA 4BATA 3JQBC 3RHFA 1W75A 2BJVA 2XMQA 4FYJA 1ORHA 2OT3B 3QUAA 3HKDA 1KDVA 1CZHA 2CHVA 1DXYA 2PV0A 1WMEA 4ZCTA 3KKPA 1FFWA 1FW8A 4JB3A 2YJ5A 3M6VA 4RCZA 1TUBA 2QNRA 2X6TA 4IH9A 2NZ2A 4PSCA 3TSYA 1N6HA 2BW0A 3L4BA 4MVJE 3HP1A 1QIGA 1RM3A 2IUEA 4O5AA 3HYLA 1J8MF 3MRXA 4PS0A 4XWGA 1V8OA 4QJ4A 3C6QA 4I1YA 1T3ZA 1TFUA 4ZEXA 4MUXA 4F3YA 3MIZA 4CIVA 4G0QA 4YRAA 3DC2A 3GJTA 2WUFA 2DFTA 2F3PA 2HSZA 3MMNA 3OQ6A 4ZD6A 3RNOA 2R4TA 1P5HA 1KIFA 4CEJA 3EIUA 1S2GA 1CQJA 1MP0A 2XVZA 3VR3D 4EMSA 4PYQA 4DBLE 5EHZA 4PAOA 1QQTA 3CZ5A 3A9RA 1P3Y1 1I0IA 1MC4A 3R4CA 3IOMA 5J3JA 3UJ3X 4KDCA 1JEYA 3CUEF 1R0BA 1VP9A 1KY4A 3MSCA 4I5FA 4PCLA 3PRKE 5DN6A 1ZJYA 5JYCA 4KZPA 1S3FA 2HSEA 1I3NA 3F6BX 1X7XA 3K31A 3PSAA 4MLDA 5I9BA 4MJ7A 4II7A 3TQFA 3D8UA 4HL6A 2O8BB 2H06A 3N5KA 5JJBA 1D1QA 1N7HA 4J03A 1CK4A 4F84A 1KNQA 1IH8A 1O6FA 1QF7A 3PKZA 4JL8A 3G85A 3PWKA 5CURA 1MABB 2FPPB 2KLBA 1HORA 4PRYA 1B3RA 3FA2A 4EPYA 1WTAA 2ID9A 2C1ZA 2P2SA 3Q8XB 3ZU3A 3M4YA 2J9ZB 1Z12A 2R96A 2CLDX 5IAJA 3OPNA 1LPOA 1AB6A 1YQ9A 3DUFA 2XJ4A 5JECA 4DNPA 4KK3A 1OFUA 3VYSB 4Y3UA 5B58C 5J2TF 3MUFA 1XAJA 3ELDA 1SVNA 4GM0A 1WL8A 4GKJB 3VKGA 1B00A 3IERA 5U4XA 4MVJA 3PUZA 1H2XA 3CLKA 1NVVR 3LG2A 3TD6A 4DANA 4LHSA 4IZOA 2IRWA 3ORRA 1WDMA 1DIOB 4HDSB 3NC4A 5KKCA 4U00A 4L9SA 2WWFA 1FFCA 4R9NA 5F76A 3HPRA 4YMIA 3AZQA 1BH6A 3OX2A 3V3KA 5HFJA 1ODLA 2PVSA 4FE4A 5IARA 3VHQA 5IWAB 2W8BA 4LBWA 1KVQA 1SM4A 2ANBA 2QJWA 3EDCA 1G42A 2AI3A 3F8SA 4UKDA 1RKQA 3DEKA 1E4EA 3EF1A 2P7HA 2X42A 1PR5A 2J33A 4RKYA 5HR5A 3M1AA 4OGWA 4IGKA 2PFKA 4TYYA 1DC6A 5HCIA 3FDZB 4UXIA 2ZJ5A 2AE1A 2PXXA 3VV3A 1YVPA 3NBFA 3VNSA 3PL1A 4CMKA 2EHDA 3RDPA 1PDVA 1LSOA 1V96A 1WPRA 2JJQA 2FOIA 4LDJA 1TU3A 3HR4A 3SZ3A 2LR0A 2YXNA 2BGGA 1EFPB 1YVDA 4OBXA 4R3WA 4LY3A 3CR8A 4NMWA 3LJKA 3ZJVA 2CLEB 1H4TA 1RAHA 1SC1A 2Q3FA 4KQWA 1SHLA 4FOOA 4MWOA 4LOAA 4R3NA 3TLGB 4PN7A 3DV2A 3BMNB 2ZE8A 1T2DA 2JLBA 4ZT4A 3BK1A 2CD7A 2G1JA 3FYCA 2A35A 5K2MA 3TKAA 2YJ6A 2V55B 4NE7A 4UTVA 2HK8A 3G1TA 1U0RA 2CJXA 2ZT8A 3GC6A 1JHZA 2OBXA 2HZ7A 3JY6A 4OUDB 2BCEA 3V55A 5KNDA 2B25A 4QPPA 4QU5A 1F1JA 5E9AA 4P84A 2HU8A 2R97A 3ZC3A 2V7WA 3N2LA 3PNVA 3UH1A 3LVFO 3PC8C 5K0GA 4HQNA 3B3JA 1B8OA 1T5OA 4LBZA 1K0UA 4EW2A 2VDMB 3EOZA 4KPGA 2DF8A 3BTVA 4RPIA 5HBRA 1KP2A 3WGGA 4ARAA 5BN5A 1G9XA 1LC0A 2VDKB 1N3LA 1XTUA 2VF8A 3CNHA 3GRCA 3N6RA 4UZFA 4J91A 5FORA 1NY6A 3AUKA 3RJZA 3ED5A 1RADA 4I9HA 3WYFA 2FN3A 1Z4MA 2H2FA 2IY7A 1OGJA 4BBJA 3AM1A 3DHVA 1E99A 4M1SA 4AS2A 1TB4A 1PZEA 2WIFA 4BNZA 3U1BA 1O6BA 2BHSA 2QRHA 2FEMA 4PPQA 3D5EA 3PEFA 4M0LA 4F8JA 4ZGWA 4YYZA 3U7QB 1V25A 1Z45A 1KS2A 1A96A 1MJNA 4OBWA 3PQFA 3MW8A 2ZJ7A 3VH1A 1ONOA 3CXRA 3QVTA 5F5XA 4ZU1X 1YV9A 3Q88A 3BDIA 5B36A 1DBQA 4NNOA 1HSOA 2PWYA 4A10A 4ZZ3A 2FN9A 3H04A 1QIJA 1ADGA 1EEXB 1W73A 4G9EA 1YCGA 4IZHA 1RQNA 2PQ0A 4Y1EA 2QLMA 1W4LA 3C16C 1QTIA 4HB0A 1BW9B 3WGUA 2C7PA 2PH1A 2JAQA 3F47A 1YDWA 2ESRA 2PZLA 1ZIXA 2GFQA 2ZPAA 3C15C 1AQYA 3GRPA 1D2CA 1VFNA 2ZDGA 2J3HA 2X41A 3SDBA 3ZDYB 1G6KA 4DZZA 5KC9A 2HSWA 5EJFA 4V0NA 1X2BA 3VPCA 2FZKA 4QBIA 2OYRA 3RUAA 3M89A 4KI0A 4TMKA 3HG7A 2VT6A 2HH9A 2P2LA 3V4LA 3JYPA 3R5TA 2SKDA 5SYMA 1OIVA 1QLWA 2QMUA 3A4NA 1RIIA 4LJLA 3K7EA 4LOJA 4BN0A 4DNQA 3F73A 1P7VA 3FXAA 1E62A 1OAAA 4JC4A 3MOSA 3A9TA 1VCHA 1JLHA 1GA1A 1GEEA 2HRZA 1KJIA 3JQ8A 3MCVA 4ZKDA 4IG4A 4KV7A 1JB9A 3MJRA 4P3XA 4TPKA 1Z0DA 4C22A 3DDSA 2I6TA 1JHUA 1ULHA 1XNJA 1E2LA 3REFA 2BZ0A 1UC8A 8ATCA 2OBNA 2P8SA 1Y82A 5DMHA 1A77A 4JJFA 2X7HA 1Z4PX 2HCTA 2AFHB 1VLHA 5CVEA 1TJPB 1VYHA 3OCCA 3ONNA 4RZUA 3M1YA 4B47A 4EFDA 3NONA 5FQOA 5L9AA 2D8AA 4RGYA 3FTPA 5E6UB 2YJNA 4L50A 5I7VA 3WS7A 1QHYA 1Z25A 2JDIA 2PD3A 1NJGA 1MO2A 3GP5A 2HA6A 2AG1A 3WAJA 2AK3A 4P98A 3H7AA 4UHKA 2ADMA 4KO4S 2FZVA 3GBSA 2B9VA 4G89A 4GBGA 3UMRA 1K86A 2VO1A 3WQQA 3D7NA 1VL0A 2P7IA 4KIFA 5IT9A 3S2IA 4AQDA 1ESZA 1WUHS 1MQ8B 1CX9B 3AP3A 3LKBA 3OSZA 2C5FA 2R85A 2XSZD 3C8DA 4S1OA 4CQLA 4DA8A 5CCXA 4YRIA 1DTEA 3K9NA 1CG6A 3IILA 3WDMA 5K0EA 4MUKA 1ZXXA 3AINA 3MD9A 3MS4A 5IDQA 2C8VA 3FYUA 4GAEA 3M5WA 4PR0A 5FBZA 3V33A 1LJ8A 2CJWA 5J23A 1M2FA 4DWVA 1M33A 4Z2YA 1PQ4A 3L18A 4OP3A 3V6MA 3K9FC 1QK5A 1BCRA 2WNSA 3MCTA 3SXUA 4YJFA 3GDWA 3LGAA 3C70A 5T8KA 1TJNA 4EGCB 2EL9A 1N0WA 2ZQYA 4K6MA 3D3NA 2IYNA 3DCIA 4ZYXA 1N8SA 3THYA 1YA6A 3D6NB 2QGFA 4KVFA 1C8BA 1F8FA 2NYUA 4OQPA 3HCPA 3G9XA 1JR4A 4LXXA 1DAHA 1UPFA 1QH1A 2VK4A 4XSHA 2ZXEA 4DUYB 4WY5A 2AJ8A 4FDMA 5CYPA 1GITA 2CXQA 2IXFA 3QOXA 4NULA 2UVPB 5DH9A 1UDRA 1XU4A 3TW8A 2W6QA 5IWCA 1WU7A 4MPJA 3TXYA 2V8OA 2WHRA 4BNLA 2P2ZA 5DULA 1TQ8A 7ABPA 3A06A 3OLVA 4DXHA 2HU7A 4J7CA 2QGNA 5ALJA 1F2VA 1U3UA 1TMKA 1YAJA 4TMTA 3LO5A 4GPZA 5TPZA 4BNDB 5EXSA 5AW6A 1GSHA 2IH2A 4XTRA 1X77A 2IK8A 5C81A 4J1GA 3AUJB 3P26A 4GX2A 1YB5A 3FWHA 1VJRA 1LW6E 1OE0A 5SYAA 1MAAA 4MW1A 4TV9B 4D81A 4PYMA 1YZ3A 5A5GA 3ZPXA 3C3EA 3G7NA 4J49A 2FVXA 3QHPA 4JJ6A 3ZLVA 2C58A 3GLSA 4J16A 1QVRA 3CLTD 4ZJPA 4Z4IA 3H7IA 1CFZA 3I4FA 4KSBA 5CGQB 2IIVA 5FNVF 4DB4A 4AJOA 1ZJ4A 5TQ2A 2SICE 5JZMA 4EBBA 2JCGA 3C3PA 4CIXA 3PI6A 1NZDA 4BYGA 5EHQA 3I2IA 2VS1A 4PPNA 1B8UA 1YC2A 5L7WA 3KJHA 1T5BA 4GOMD 3S5UA 3BH6A 4BV3A 1ATZA 2W22A 4A0GA 5JHGB 2W2MA 1C0EA 3P20A 4DRXB 1R9MA 4WDRA 5LLTA 4CIWA 2YWHA 5TGDA 2F7SA 5DHAA 5L45A 3R6TA 5HKKD 5B57C 3UKOA 2ZBPA 2FW9A 3T6KA 4CQLB 121PA 1M2OB 3EXEB 1BS1A 2DULA 4G97A 1I7DA 2QE7A 3ZY5A 4ZP1A 1XZNA 3AESB 2OSBA 1YVRA 2PG3A 2Y6VA 4NL4H 4UM8B 4XB2A 2WOOA 3GNLA 2OFXA 3FHTA 4IXTA 2HB6A 3OAAD 5JRJA 1NLFA 1WPQA 1SUFA 3EMKA 1O2DA 1YZNA 3QHAA 2FJPA 2VYVA 3EZXA 3ZIAD 4L4UA 2BUBA 3SMQA 1BCRB 4MINA 4X6YA 4XEHA 3QPVA 3SK0A 3SXUB 5CFZA 4Z53A 5JDCA 2JW5A 2AS0A 2EXXA 3EA0A 4NVRA 4PRLA 5IEJA 5ALLA 1YU9A 2G71A 4LQDA 1NNSA 3S55A 1SA0A 1M0EA 4OYRA 4OHKA 4YV2A 2UDPA 2VP9A 1MB4A 2QKYA 1IBCA 2H16A 3ON5A 3C1OA 3KAJA 3ZY6A 2JATA 4HYTA 1GGMA 3MF4A 2B3TA 4KQFA 2VDQB 4WT7A 4F2PA 3U7IA 1WOYA 1DEKA 1P18A 3N2GA 4Q24A 4MHTA 4QICA 3L0YA 2OXIA 1HUQA 3CQ9A 3OZIA 2X0RA 5CA1B 2R00A 4KQHA 5JADA 4DOMA 3ZJTA 2JAWA 5KWSA 4QYSA 3CZAA 1GQFA 4TT3D 1B6RA 1ZRNA 4ENVA 3DOOA 1MDBA 2VKQA 4M0FA 4UHHA 5BXYA 2CJFA 4HNGA 3JALA 2J0VA 1Z56C 1N5RA 1SZCA 4MWSA 1YBMA 2HMAA 3FW1A 2C4UA 5EIWA 3TPCA 3S8YA 1NI4B 4KGVA 4XAQA 4PLZA 2VNAA 4ANFA 4TV9A 1EVEA 3M0EA 4OMUA 2CT8A 2WP8J 3GPCA 4R8LA 1EWVA 2JFUA 2AMYA 1P81A 1UZUA 2EJCA 3KS9A 1VCMA 3IXLA 1YE3A 4N3BA 3T9AA 1SHTX 3D8NA 3V9AA 2X0IA 5JCJA 5DE3A 3EJ6A 1X7WA 2H9IA 3NS7A 1RACA 1NW5A 3D7SA 3F9CA 4YP7A 4HN4B 3SF8B 3IHLA 3TB4A 5ALEA 3TE6A 2XXAA 5TQ2B 1T4GA 1LRLA 1ZVMA 3ACCA 2OQIA 3LRXA 3N53A 2B4RO 3GLIB 3P9ZA 2XTNA 1WMDA 1XLTA 2YMLA 4XRRA 4YMUA 2CXHA 3NX4A 1GL6A 4RXMA 1A5TA 1SRRA 3W9UA 1I2DA 1KYIA 3DF7A 2CNKA 3A2NA 3DZIA 1OWNA 3N74A 3QM1A 5EINA 1LTHR 3EGOA 1MA3A 3KELA 4JL6A 2B21A 1SVLA 5A1TA 4QOGA 3EQ8A 3PHJA 1C7QA 3Q7TA 4LNHA 1HSZA 1EWQA 1SVKA 3EAQA 4X3PA 4ZO8A 5CTAA 4HBZA 4JLVA 2QXYA 4AZSA 1VBFA 2IWRA 2XV1A 4TSRA 3DG9A 2JLUA 3Q1KA 2YV1A 1NN3A 2QD4A 3UJ7A 1KAHA 2AQHA 4XJSA 3WSVA 4OKSA 2CXUA 4EMBA 1KRXA 1PF7E 1NHWA 3RFUA 3E35A 3VVLA 2Q9BA 4MV1A 2YTZA 1E1CB 5CFOA 1RI5A 4HDAA 1VSBA 2X5XA 2DLNA 1XDWA 4RGBA 2AB0A 4UCQA 5FF9A 3V5NA 2BM0A 3HBFA 5LD2C 4P4GA 3P2OA 5ELLA 3H4VA 8MHTA 3TL6A 1CJKC 4URWR 1K66A 3X1YA 2Y71A 3BWMA 1SA0B 3FJYA 2X3YA 4KREA 2P1ZA 3OFSA 1UEJA 3PC2A 5DHUA 5TY0A 3R7DA 3TW0A 4D8XA 5BR4A 1ZUIA 3BE8A 4RD3A 2J9RA 2WMOB 3ICWA 3VYUB 3QE9Y 3GMIA 4L51A 1Y9AA 4Q6WA 4QPDA 3EVDA 3HCEA 3JQ6A 3H86A 1R00A 1Q44A 3SM3A 3LKZA 1S9DA 4Q4CA 2Q4EA 2FP4B 1NXVA 1GTMA 1VLQA 1EH5A 4K2HA 4UNQA 3WJAA 2R2AA 1ZNYA 3LGXA 1LSSA 2W0MA 1TO1E 2TSYB 3EG9B 4O63O 5J63A 3IUJA 5G4LA 2H1LA 1J7JA 4MKRA 5J4YA 5J58A 4CTJA 5JFOA 4NPAA 1P0CA 2C31A 4IKEA 3EXAA 3WLKX 5HQ3A 2H2WA 3JALB 3B3GA 1QRTA 1VG1A 1DRVA 1TM1E 3L0CA 4M76B 3OU2A 1ZR4A 1A7AA 2NQTA 1HM5A 2DETA 1MJFA 1M1YE 2GZDA 2XW6A 2GH1A 3GJZA 4LJ7A 4F0JA 4LJRA 2CXNA 2PD6A 4B7UA 1PWXA 2ZR9A 1LNSA 1JWLA 4TLMB 2AEEA 4RMNA 4AY5A 3KKZA 3O5AA 3AEUB 2AI1A 3EEYA 1X7HA 4MB2A 1G5RA 1UJBA 3REOA 3UB2A 4ECEA 1I36A 3L82B 1FTNA 1FS6A 4E21A 5FL7D 2CHFA 1V8BA 5K3FB 3BKXA 2QTNA 3JARA 1D6JA 4MGIR 4QXOA 5AVJA 1HG1A 3BFJA 5KKAA 3ZKWA 1ULTA 1LA2A 3PHGA 1N25A 4N3AA 1H0SA 3E5NA 3RNLA 4BN4A 1J5PA 1F6WA 3KU1A 1YCFA 1O54A 5IS2A 2RARA 2GX6A 2A1UA 4L74A 2C2MA 2SKEA 1L8OA 5C8DA 4MQUA 4FDTA 1KO4A 4M0DA 5JLJA 1BGWA 1RQ7A 2P4HX 4JL5A 2OV1A 2WHPB 4Q3NA 5HTOA 4GOKA 2NO9A 2DY0A 1NP6A 1V9LA 2J5KA 3IJ5A 2V7QD 1K89A 3CUTA 2YHAA 2V98A 2VI5A 3NVAA 5FPYA 5T41A 4RTRA 1WB9A 1JBEA 2E4ZA 2YYYA 3ND6A 5EIOA 5AW3A 4L75A 1NLYA 1P91A 3M70A 1JHOA 2ZRDA 4KSCA 4EJ2A 2OP1A 3V3TA 4RAQA 1VIVA 3MUEA 4NBVA 3FM9A 3KX2A 2CC2A 4EWLA 1MFPA 2X3UA 4QODA 3S2YA 1XMPA 3M1LA 4TUYB 1EQ2A 1FP4A 4KEAA 3ZZNA 1QU3A 3EYAA 4BFZA 3WLEA 4MUAA 1YJAA 3IMEA 3QJYA 5I7AA 4A91A 4G0NA 2BDUA 2CEKA 5H70A 3RK1A 5EJ6A 5KDOA 1EFAA 4BJ1A 2B4TO 4XX1A 3ODGA 1JSLA 3DFUA 4HADA 4R8KA 3SQMA 5KSOA 4KNYA 3IMCA 4X7BA 2ZRAA 3WDSA 2ZFUA 3EA5A 2AQ8A 4BJ5A 1AS0A 3O74A 4QQRA 2ZR0A 1ORWA 1BFDA 2LXNA 1GRVA 2PMWB 2NPFA 4XWOA 1A69A 4TMXA 4JEIA 2OCXA 1VJ5A 3R5FA 3VTZA 2B0JA 2CLCX 5A3JA 4U7FA 1XZHA 2RAUA 4EUEA 4K3VA 3PG5A 4U7PB 1NYLA 2GT1A 3K6JA 3M83A 1XQWA 1NI3A 2CMKA 1L4UA 3QKWA 4QOFA 4X7RA 3W04A 5BSTA 3O2NA 3KEQA 2FWBA 2R8OA 3UAVA 1V8DA 4QG3A 3T12A 2IYOA 5CEEA 4GO1A 4GRDA 1ZOSA 1XKLA 2WD7A 4YV7A 3OZ7A 1UMKA 4KXXA 5DGXA 1DC7A 3IVGA 1VFPA 4IH1A 1LLUA 5ANRB 4B80A 4X62B 5DZSA 2P27A 4ER3A 4F3KA 5T4HA 5BQ5A 3IQHX 3VI3B 5HYVA 4J94A 4EW3A 1PX0A 1Q6ZA 1KFCB 1QIHA 1J1UA 3L8DA 1RJGA 4IDAA 1G2IA 2WHYA 4JNCA 1BKDR 1R0SA 2IIBA 3GPIA 4HXYA 1IOWA 3SBOA 2D1FA 2MU1A 2XCSB 2VPTA 4JJEA 2ISQA 2BSAA 2WJJA 4MVJF 1NBHA 1OYVA 4JOCA 1Z5GA 5EJAA 1G0NA 2EFCB 3MUOA 5DLQC 1P80A 2J6CA 1BHQ1 4IRXA 5C35A 1R50A 3ZDEA 2IXTA 1TTPB 1EK5A 3OQJA 5F2KA 2YMPA 4ACBA 4GNKA 4NV0A 1QGDA 3FZGA 3L4BC 1L5RA 4RCVA 1M34E 3Q3GE 4CEHA 3JATB 3BQMB 1PBNA 3TQHA 3WFZA 1L8LA 3CZ4A 4Y6QA 4D97A 3PIIA 1EDEA 4XYGA 1I0LA 4QREA 3FOZA 3E1SA 2FPSA 3R41A 1Y1RA 3OHPA 4EA8A 3A1WA 4PC1A 5ERGB 5DNAA 1OJ7A 3PC7A 3RTGA 1WV0A 1RXSA 1CR4A 2FY8A 3G2OA 4Y6PA 5I9SA 3PD7A 3Q9UA 5JH7F 1CIVA 2DQZA 1TYDE 4Y2UA 3LNCA 3RJTA 3QX9A 2R1VA 4OL9A 1FMJA 1L5MA 2ZXFA 4NCXA 4WJKB 2FDCA 2XOXA 1FNMA 3BWBA 1HY3A 1AB5A 1CJVC 4LGMA 3OE7A 5KPDA 1PHPA 1TZBA 2HJHA 4ZVSA 1ZK1A 3WLNA 1MIOA 2BEUB 4WVFA 4QSHA 2Z58A 1PIWA 2ZVDA 1T1RA 4FGSA 5LA6A 2ERCA 4OQMA 1US8B 3EXHC 3TOVA 3HZHA 4DT1B 3FOBA 3GLKA 4E2WA 2ZROA 3THWB 2O8CB 1EP9A 4OXIA 1NBME 2J08A 4BECA 5P8WA 1IPFA 1E96A 1JR2A 1RXIA 4OYYA 1MO5A 1EP1B 3FZQA 4U63A 1AQ6A 3DVRX 1S01A 4PZEA 2Y1WA 2VPXA 3Q85A 5CD9A 4P4UA 3R77A 3FIUA 2N1BA 3BN3A 2MINA 1R6UA 1LS6A 1RWMA 4E70A 4OQLA 5AXAA 2YUIA 4AYWA 2PQ6A 4FS8A 4W9RA 2XOEA 2XUPA 3K30A 1KK1A 2J41A 4GKVA 1E1YA 4E09A 4YWJA 1OCEA 1XN4A 3ESYA 4U1RA 1NF2A 1K3UB 1H1TA 5A4DA 5LP6F 5TIIA 3L4EA 3UT6A 2AL7A 3BSWA 5I47A 1ECFA 5KVCA 5EP4A 1U7TA 3NDJA 3VOBA 1KK0A 3FCYA 1CUSA 1ESCA 1TTTA 1CQIA 5KYUA 4OSEA 3LYLA 1UMCA 1J0BA 3VNRA 2QUAA 2HK9A 1RM5A 1WP9A 2NSDA 3QITA 4RY9A 3CNOA 4BO7A 4OX9B 3NAMA 2GHTA 1IAQA 3ET5A 2OK7A 2A2ZA 1A97A 1QRAA 4LMAA 3EG5A 1II8B 1R8JA 1G3RA 3KQOA 3TUIC 2CXRA 4JKOA 2J32A 4AQYB 4UAUA 3K8QA 1KAOA 3IIJA 2Q62A 5A3RA 3SLKA 4PSKA 1FTQA 2J5BA 3DWIA 5EUMA 5REQB 3TL3A 5BV1A 3JX9A 5DGHA 5DJ5A 4NAHA 4BX2A 2BDTA 3O82A 3I2JA 2P2NA 2O7VA 3EXG1 3M2PA 3W7BA 2XBUA 4ZVUA 4UTPA 2AMJA 1N6NA 1QYWA 1EWRA 2P77A 3GJSA 3L1HA 3LZDA 4FK8A 5C51B 3GOQA 1G55A 2MYTA 3GJ4A 2FG7C 1DS6A 3F49S 3U31A 4F86A 1Q17A 4HTFA 5FLYA 5ICCA 3BTSA 5DNEA 5BMVF 4ZAFA 4I5DA 3GEGA 4YAEA 1GCGA 2WQZA 1A9RA 5I7FA 3GR6A 5F12A 2DBQA 2WFAA 4DUGD 4NCNA 1JEAA 4MCAA 1DFIA 1JAHA 4L72A 4EO4A 2IXDA 4OI0A 1XTSA 2XUFA 2WPDA 1N6KA 1H66A 1MIOB 1XA4A 1Z8HA 2BEUA 3AX6A 4IIGA 2GD0A 1JVBA 2IFTA 1HNNA 4MDEA 1US8A 4INOA 2OZEA 4B32A 1Q0ZA 3MB8A 5EXTA 1UKBA 2C5AA 2PWZA 3UANA 4DBVO 5AM0A 2XTZA 1NWHA 1KNXA 2IU6A 4GWKA 1FYDA 4CUZA 1Y6GA 5ELMA 1VHQA 2W58A 4X63A 5MF6A 2HEGA 4IRUB 3RRYA 4Q7JB 4OHCA 5FO1A 1M83A 1RM4A 1GEGA 2PJZA 4LHVA 1H2YA 1AD2A 4QPNA 3SHTA 1AH2A 2XQFA 2YXPX 3QVOA 1ZKDA 4GQBA 4GUAA 1Z0KA 3UPDA 2DHEA 1CRLA 2Y66A 3BC1A 2X9VA 1JE1A 5CXXA 4RVCA 4LFCB 2CXSA 4LSWA 1KQGA 1BC5A 2Q0XA 2X4LA 2BVNA 5FAKA 3H84A 4QXMA 3BMOB 2I1VB 1K0FA 1ZN2A 3DA8A 5D3ZA 3NHMA 4BKUA 2AFIA 4CKBA 1ZH2A 2R6JA 1IM5A 1TQ2A 4BLTA 5B3JA 4RAOA 1HDZA 4BWGA 1F14A 4CMCA 1J8FA 1MVOA 2X0JA 3C3XA 1XG5A 1WUIS 3B1ZA 3UQYS 5KSYA 4AT1A 4A1OA 2XMCA 4MS3B 4I3FA 4NOKA 4MSUA 4LTMA 3F46A 2XVAA 1HE5A 2EW2A 2ADOA 3NYIA 2IW3A 3H2JA 1UODA 2GN8A 1E98A 2IGTA 2IYXA 3A4MA 3I5UA 3L6OO 3PQ5A 3RUHA 3VSDA 3KPWA 1KJYA 1E8DA<