1KVUA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Mechanistic roles of tyrosine 149 and serine 124 in UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvuA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvuA01
4J3FA 2NVWA 4B4OA 2YZ7A 3WQRA 4BNZA 3B6ZA 4MVJD 5CDSA 2HK7A 4LCJA 4FCCA 1T2FA 2RHCA 2X0RA 4U0KA 2WM3A 1CETA 4JJFA 1M66A 3VVBA 3WSWA 5A4DA 5BNTA 4Q3DA 1NFQA 1HZZA 1SPXA 3GEGA 3SX2A 3GAZA 3WWZA 2VHWA 4BO0A 1VSUA 4PLGA 5IJZA 4D79A 1DOHA 1PZEA 3B70A 4XYMA 3SBOA 1EK6A 3ULKA 3JD3A 1QLJA 3WTCA 5BSHA 1ADFA 2PZKA 2DFVA 2EP7A 5A5EA 4BKUA 1I24A 1HWYA 4GSKA 1ZJZA 1D1TA 2BF7A 3P7MA 4DQXA 1GYRA 5CDTA 3AJRA 4O6VA 1NYTA 5CDUA 4EBFA 2C2XA 2RCYA 1DBVO 4DRYA 6LDHA 1DLJA 2B5WA 2J5RA 4BOYA 2W90A 4YT5A 4R41A 3NDJA 4BNIA 4WASA 4LW8A 4BKQA 2QX7A 1Q1NA 4K9DA 4XQEA 4ESOA 5BSGA 3UN1A 2A94A 3V2HA 2YFHA 3JQ8B 2W2KB 1I36A 4PZDA 1AXEA 1DFHA 1LUAA 4GX2A 5TS3A 2HQ1A 2FHSA 2POQX 4CODB 3ZDFA 3JV7A 1FDSA 1HTBA 3ZWPA 1X1EA 4PG7A 4JX8A 4O0LA 1IULA 3KYCA 8ADHA 3GMDA 2VHZA 4IDAA 3INTA 5EERA 3SJ7A 1UP7A 3KHUA 3MWDB 3JQFC 3GVPA 3DAGA 2NVBA 2RIRA 2YHIA 5GZ1A 5IN5A 1EVJA 1NTOA 5JDCA 2FR0A 1SNYA 4ITUA 2SCUA 4Y98A 5AYVA 3HHPA 4Q3EA 1LQUA 2HMTA 3DZIA 4EUEA 1DPGA 4DBVO 4J7UA 1UZNA 4RZIA 4D46A 4P22A 3A14A 4DIOA 2DPGA 1T1SA 3KRTA 3MJ4A 2C2YA 3VDRA 3RJ9A 3S2FA 1PSDA 3SLGA 1PJQA 4D42A 2B5VA 1CF2O 4AJ4A 1GEEA 4CMIB 5EPOA 2WE7A 3EZYA 1LLQA 3IS3A 3EDMA 3C8MA 3KM0A 4J0EA 1PWZA 4MKRA 4AJNA 2HDHA 3FD8A 1WPQA 1IPEA 5G4LA 4UEJA 4NJOA 1NR1A 3RROA 5H83A 1RPNA 4FBGA 1P74A 3BHJA 3E9MA 4WE3A 1R12A 1ULSA 2I99A 4CM8B 5FEUA 4UUNA 4RF3A 4E5MA 2CVQA 3WJ7A 4XGNA 1YO6A 3R1IA 3OEWA 3OICA 3S2GA 4CLDA 1XU9A 2AMFA 2UV8A 4OKIA 7MDHA 4TVBA 1ENZA 2DTDA 1E6UA 1ZIDA 2I6TA 1ZVMA 1QP8A 4PCVA 1E7YA 4KP7A 3LDHA 3B1KA 2RAFA 3H9QA 4JCOA 1C1XA 2W2LA 5JCXA 4R9RA 2HMWA 4IINA 4MINA 4ND1A 4II3A 2R2GA 3ITDA 3U4DA 3P2YA 2CFCA 1HZJA 1KIFA 1ISIA 1OC4A 1F8FA 1PZHA 1U3WA 4HFRA 5A9SB 1LX6A 3L6DA 4ILKA 3IP1A 3D3WB 1U3UA 1YXMA 3V1YA 4CM1A 2IYPA 4TRNA 2GN4A 4BKPA 1GFSA 4FFPA 4RVDA 2EERA 1QV6A 4GKVA 2PR2A 3D5QA 3PTZA 1YL6A 2EKQA 3W8FA 1KVSA 1AUPA 1TA4A 5DBIA 5JDCC 1BSVA 3ANLA 5BNIA 1JKIA 4WECA 4WEQA 3DAPA 3ZWMA 4L74A 2GDZA 1NR7A 3GDGA 3OJFA 3BMQB 5IDXA 4M55A 4ONEA 3UCFA 5F5LA 3U09A 2OL4A 4M87A 3DHEA 1HSZA 1XQ6A 3RU9A 4BIIA 4PLHA 3BHMA 4XYLA 2NACA 3KBOA 2HJRA 5GY7A 1PJSA 4RQTA 4OIMA 4BNLA 1DIRA 1PS8A 3QJ5A 5HS4A 2VTEA 4XDZA 1HE2A 3BYZA 1U4OA 2X22A 2WTBA 4JK3A 3FTNA 4L4RA 4NBVA 5KKCA 4B79A 3E5MA 5JC8A 4NBUA 1PGOA 3BZUA 2J5KA 3SJUA 1PGNA 3K92A 3OQBA 5A03A 1V8BA 2HK8A 3PPIA 4QQRA 4JBHA 4N5NA 2ZYAA 4GSLA 4CR8A 2EXXA 2J6IA 3D1LA 1PL7A 2E49A 2FWMX 4FFNA 4F6LA 5GMOA 3OIFA 4XYEA 3DBHA 1H5QA 2H1SA 5TQVA 2VZ8A 3WGQA 1KS9A 1E3IA 2YQ4A 1C14A 3DR3A 1KBZA 1PQPA 2HO5A 3NJ4A 3HNPA 3OETA 1HYEA 1ZJYA 4PLTA 4IBOA 2CMDA 4I9HA 1ISGA 1PS9A 3RQSA 4E33A 1GL3A 3H9EO 1X15A 2D3TA 4A26A 4L75A 2GERA 2DVMA 3EVTA 3GRKA 4YT2A 2VCYA 2YDYA 4W4TA 1YL5A 1ZCJA 3LF1A 3PK0A 4F45A 2QW8A 1YS4A 1Y9EA 2Q50A 1E3SA 3V5NA 1GV0A 5J23A 2AG5A 1JKFA 1NWHA 3GDFA 1JTVA 2NM0A 4PLCA 3QY9A 3F46A 4IQ0A 1QR6A 5C7OO 1EK5A 2PWZA 3GZNA 4E6PA 1PL6A 1C0KA 2D5CA 3GA0A 3OP4A 4NNJA 3K73O 3QWAA 1GR0A 1GD1O 3JD0A 4D43A 4QEDA 3FCOA 3JQ7A 2O3JA 2I9PA 2YFQA 3A1NA 3PJFA 1BGVA 1ISMA 3KXDA 1KY5A 3WG9A 5JC1A 1LRLA 1ZEMA 3NTQA 1X13A 2CVOA 3CPSA 3W6UA 2C59A 1QMGA 2GF2A 4GGOA 3T4EA 1P3DA 5IDWA 1GZ4A 1AHHA 4I5EA 3H6KA 4B3JA 3UH1A 1OBFO 5JPIA 1A4UA 3KTDA 1PJTA 2QG4A 2IZ1A 1YGYA 5JE8A 1SAYA 2HMVA 3RUHA 4CM3A 1ONPA 1BWSA 2BRUA 3FWNA 3OA2A 4BV8A 4DTIA 3ZNPA 1NQ5A 4NFHA 1P1FA 2JD0A 2ZJ0A 2O3QA 4AJLA 3AM5A 1A7KA 1ZFNA 4FFMA 3RAJA 1TT5B 2NNLD 1PJLA 3N7UA 5AOVA 4CM4A 3RIHA 4PG5A 2X7HA 3RASA 3E18A 4OKNA 1IYZA 1M67A 3V2GA 2Q46A 1YBMA 3C1AA 3QE3A 2OGUA 1KEPA 3LC7O 1BXGB 4QFDA 3NGXA 4E2WA 2I76A 4BNMA 5I7EA 3RC1A 4RVGA 3PYLA 4TZKA 2Q2VA 3VPFA 1Y8RA 1VSVA 3VZRA 4D3FA 1SEPA 2NU6A 1HE4A 4FPXA 3ZV6A 4AJPA 1GADO 3IKTA 3AI2A 1KC3A 1F06A 3DTTA 4FFLA 4R68A 4WLUA 1Y81A 5JCJA 3HE3A 4NU6A 3ZZNA 2AA3A 1YDWA 3PZRA 3PFWO 2Y1FA 1YB4A 4KUGA 1N1EA 2HRZA 1OI7A 4B4WA 1XCBA 3L0DA 3I9OA 5KJFA 4RL6A 1YBAA 2ZB4A 4L76A 1YL7A 3GLQA 3K2EA 4XDYA 1PQUA 3ADOA 2WD7B 4KUEA 5I8ZA 4ZQHA 4R51A 2AEMA 3U4IA 2AHRA 3JD2A 1K6XA 2VTDA 3DL2A 4CM9D 2VHXA 1DJQA 1FJHA 1JA9A 2FSVA 3ORFA 1A5ZA 2CY0A 3DOOA 3EVNA 4IIUA 3BTOA 5CPBA 5FI3A 1EDOA 1PX0A 2WE8A 3WIDA 4K26A 3ANNA 4XCVA 3I6QA 3WQSB 2PH5A 2GN9A 3ONDA 3GK3A 3TNLA 2CVZA 4RPHA 1WZEA 3ROKA 3C3XA 7ADHA 3UAGA 5F5NA 1Z73A 1PJCA 1X7DA 2QRKA 1MLDA 3DBLB 3FWZA 3VH1A 2C54A 4CQMD 1VL6A 2YYYA 3AOEA 1WLYA 3AUUA 3G1UA 2NADA 4XWYA 4R1SA 5IF3A 3TOZA 4EUFA 2OO5A 3ETDA 5A9RA 3TJRA 3NYWA 4JGBA 4BNNA 1V3VA 4YAKA 4UVHA 5DOVA 1DRWA 1P0FA 4ZN6A 5B4VA 4EI2A 3SC6A 1ZXBA 3F5QA 2B37A 3ITKA 4Z0PA 4FGSA 3WSVA 1RYEA 1IL0A 6ADHA 1LJ8A 4U7WA 3AY7A 1U8XX 3H5NA 3O8QA 4CLRB 1F14A 1H94A 3GGGA 4H15A 3ROPA 1NHGA 1E3WB 1WDMA 3IIEA 4PZCA 4W6ZA 4E2YA 4YACA 1FDTA 2VRBA 4Y8VA 1JW9B 1W8DA 1GZ3A 5L4NA 1T2DA 3CTMA 4E5KA 2B36A 3AFNA 1RM0A 1EBUA 3HFSA 1Y8QA 3JQCA 2P68A 5A5FA 1LDMA 2I65A 3HB4X 2VT3A 3G17A 1SBYA 4GWGA 4KQWA 1C1DB 3I4CA 4YQZA 1MB4A 2YUTA 5JYEA 3EW7A 1ADGA 1ZMTA 5F1KA 4XQCA 2O7QA 3KZVA 2J3HA 5G4KB 1QXSA 1H0KA 4J2OA 3DBRA 5DN9A 1A72A 2AQHA 4R9SA 4P38A 3CINA 4YXFA 3IUSA 1UZMA 1WMBA 1RM3A 4LRTB 1L7EA 3IQDB 1SB9A 4QO7A 5B12A 1EVIA 3PZBA 2PKRA 4OQZA 3OQ6A 5C7IO 1MP0A 4FDAA 1DB3A 1G1AA 1GZ6A 4BMVA 4MVJG 3HDYA 1K3TA 2IODA 3OBBA 4FC6A 2Q3EA 1V0JA 3VPSA 3JQEA 1NQTA 5C3MA 4J91A 4BKRA 4FIZA 4GI2A 4QFCA 3AOEC 1JWBB 2B4TO 3K9QO 3E1KA 1E1KA 1R4MB 1P0CA 4NHEA 1LC3A 3RUDA 1JAXA 5ICSA 1VL0A 1LRJA 2VNSA 1ZZEA 5JNLA 3PGJA 2BGKA 4TMFA 5LCXA 4IGFA 4YJFA 4MIEA 3LYLA 1O8CA 1HDGO 3PDJA 3VPGA 4EYEA 2E37A 1RYDA 3DZHA 1SOWA 5EN4A 3DAFA 2Y1CA 3F5SA 3DTYA 1E1LA 4GX5A 1FXSA 2HMUA 3DQPA 4M54A 5L40A 4BGEA 1B3BA 2JAHA 4IZIA 5F1PA 3VTFA 2G0TA 1ZSVA 3GVXA 2HCTA 2AXQA 1F17A 2Y1GA 2IZ0A 2X9GA 1YJQA 3GNQA 1HRDA 2ZCUA 1ULUA 3GG2A 1KVUA 1YKFA 3Q1LA 4W7HA 1U1IA 1J0XO 3OH8A 3O38A 1LDYA 2C5AA 3VOSA 3NTOA 4GL4A 3GHHA 4XIJA 2I3GA 3JYLA 1M6WA 2BELA 1BW9A 1X14A 4U6QA 3VZQA 1SOVA 4E2ZA 1G6KA 2JD2A 2BLLA 4WLFA 3BMCA 4R5MA 5AXBA 2B0JA 2RHRA 3BMOA 2OXIA 1KEWA 1P9LA 5LDHA 3JCZA 4L73A 3QVXA 3ZNOA 4ZICA 2NQ8A 4QO8A 5I9MA 3LF2A 3M6IA 3DFZA 2PZJA 3VPHA 2CZCA 1YOVA 4FSHA 3DO5A 5HA5A 5K6AA 3KYDA 1KOLA 4CV2A 2YW9A 1BRMA 4IQ8A 5DT9A 3RC2A 4F6CA 4J1QA 4B7UA 4EJ6A 3H2SA 3ZWNA 2ZTUA 3NV9A 3WYCA 3AY3A 5TSDA 3WQQA 5L7TA 4DWVA 3X2FA 4OMUA 2C29D 5LC1A 4NQZA 4BMNA 2CDAA 3JQAD 5IZCA 2BFMA 2Z1NA 3MJCA 1PJ2A 4NFSA 1GQ2A 2JCYA 5ES3A 2IEDA 4J4TA 4M86A 1ENOA 1VC2A 2O3TA 2VWQA 4H16A 1DIHA 1QG6A 2ZCVA 4ZU3A 1WW8A 1LBEA 4AL4A 1LSSA 4WNIA 4YRBA 4FOOA 2DLDA 1W0CA 4C7JA 3KUXA 3KO8A 1P1RA 1MG0A 4P4LA 5KTKA 2NSDA 2NVUA 4CR6A 1ZEJA 3NKLA 5T64A 3GHYA 1YE3A 1ZK3A 5EIOA 4ALNA 3HDQA 1V3TA 4K6CA 4G81A 2X86A 2Y0DA 1FDWA 2VRCD 4II2A 4R3WA 3SXPA 2V6MA 3FNEA 4KUHA 3C7CB 5JAQA 4RJTA 3OHSX 4OYRA 2HKIA 3ZU2A 3GN2A 3IDSA 1DIBA 5CDGA 1D8AA 1AGNA 4NIMA 4NK5A 2V6FA 4NK4A 4EUHA 3DOCA 2B35A 2D8AA 5JAMA 4R1UA 2O23A 2Q2QA 2W4QA 4CMGA 2X9VA 2BI8A 3C1TA 2DBQA 5BNFA 1GY8A 3HZZA 4HBGA 1HDXA 2HAEA 1A9YA 4Q39A 4YJDA 3ANMA 3QIVA 3RBZA 1GDHA 4CMBA 4NBWA 3ASVA 4Z0TA 4PIVA 2ZKLA 4L4SA 3W1VA 2PGJA 5U1PA 4NH4A 2Y1OA 3LVFO 5K6AC 5JMWA 4EDFA 5JDIA 2TMGA 4D0SA 1JQBA 1RWBA 1GPJA 3WGTA 4CPDA 4BNTA 3RUEA 3U4CA 1HF3A 1B0AA 4CLEA 3JQ8A 2W2KA 1UAGA 5IZCC 2ZYGA 1HT0A 5AVOA 1C0LA 3FBGA 3RFVA 3OA0A 3RKRA 4XJTA 2FPPA 3JYQA 1X7HA 2UAGA 2IE0A 1LSUA 4JN6B 4D3DA 4A0SA 5EQFA 3CSDA 2VYND 5C37A 4AJ2A 4EW6A 1ZXLA 3GEMA 3GGPA 2ZQZA 1DAOA 2NU8A 3UFXA 1LLUA 2O2YA 3CZRA 4BKOA 1CERA 2DT5A 3GPIA 5I9LA 1WZIA 3PQEA 3KETA 1U4SA 4Z3DA 1LDNA 1VKNA 5KJCA 4QXMA 2Z95A 2HRBA 1BVUA 3ZCXA 4D7AA 4TKLA 5KCZA 4EITA 2B69A 3L6OO 1ZW1A 3PXXA 1PWXA 3CUKA 3PWZA 4ND5A 4GGPA 4HV4A 1I3KA 2Y0CA 1IUKA 3KSZO 4CMIA 4B8WA 2Q45A 3HWRA 2VYVA 1NQAO 4IDCA 4MVJE 4AJOA 4FJ1A 5JLAA 1UJMA 4BO9A 2EV9A 1B8UA 1LI4A 4CQMB 3NDIA 2JHFA 1DHRA 2P9GA 3JQ9A 3WX0A 1HXHA 4CMEA 1MXHA 5TT0A 1SMKA 5JAIA 4TSKA 4O5OA 4PZEA 3ZWWA 3BIOA 3K2BA 3G1TA 4JLWA 3CMMA 4R01A 4UEKA 2GGSA 2I5PO 1JN0A 4BO8A 4CM7A 4CM8A 4XRGA 1VPDA 4O1MA 5ER9A 3MJTA 2AQ8A 3NT2A 5TGDA 5IZ4A 1ID1A 1E77A 2DU8A 2CSUA 3HDHA 3MJSA 4IJUA 4GKBA 3PJEA 3QQPA 4TRRA 1PJ4A 2QHXA 1U8FO 1MUUA 4ZVVA 3AM3A 5FI5A 1HSOA 3NAQA 3HQ4O 3FI9A 5JDIC 4GPD1 4I5FA 4XEHA 2O3RA 1MC5A 2V65A 1DSSG 4J90A 4CJXA 4BO4A 1U5AA 5A9SA 1QYVA 1JDJA 4UEOA 4CR7A 4ZJUA 3D3WA 3WS7A 2Y93A 2WYVA 2DBVO 2E82A 4L0QA 1O89A 3LC1O 3LLSA 4Q3NA 3B20A 3DEYX 3WLFA 1MX3A 3GC6A 1T24A 3BMNB 1H9BA 4DLBA 1HL3A 3DOJA 1U2GA 3LQFA 1KVQA 4B7CA 1DFIA 2BFPA 5ICMA 5JAZA 3MTJA 5FFFA 1Q0HA 5TX7A 5I7VA 1DO8A 1M75A 2PH3A 1GQYA 4I08A 2Z5LA 3GNSA 3BMQA 3GAFA 4AFNA 2VWHA 2Q1SA 1PGPA 4CL8A 4U8GA 4WUVA 1EVZA 3IJPA 4AICA 4DIFA 2JD1A 3D64A 2D1YA 1V35A 3DZGA 1AHIA 2BFOA 1Z6ZA 3GGOA 3N58A 3ADPA 4H7PA 4RLSA 5G2OA 5ITVA 4EJMA 2OBNA 4LK3A 4YB8A 4IQGA 4KMSA 4UVEA 4BGIA 4MIOA 3U9LA 3JQ9C 4CLOB 4CMEC 3L4BA 1ZK1A 2PGDA 1E7MA 5ER6A 4BMSA 1PQWA 3ZHBA 1E7RA 4PLWA 4DUPA 2V6BA 4MDHA 1WDLA 1XSEA 3LC2O 1CYDA 3GRPA 1I3NA 2GO1A 2EHDA 3I52A 1T25A 4NR0A 3NGLA 3WNVA 4DC0A 4WEOA 4NBRA 2ZATA 4TWRA 4CV1A 3F4BA 3VC7A 1R4NB 4E21A 1HYHA 1E1NA 4NZ9A 3H8VA 1O9BA 4ALKA 2G5CA 4BNKA 4XR9A 3HN7A 3Q2IA 4EZBA 4ND3A 2E6UX 1E6EA 1LRKA 5IFLA 2HMSA 4QT0A 5T67A 1U3VA 4B4VA 1E7QA 3JQGB 1V6AA 3OIDA 3S55A 2QYSA 4L9RA 1SEVA 3EAGA 1YVEI 1LTHR 3GG9A 2EKPA 1I30A 1K6IA 5BSEA 3QVTA 1P1KA 5ILGA 1LDBA 1E1MA 2BD0A 5JXWA 1KYQA 3DZBA 4U5QA 3HUDA 1GUFA 3TZQA 3U62A 1Z75A 1O6ZA 1I5RA 3BTVA 4IS3A 1NQOA 2Y66A 3WTBA 4ND2A 1UP4A 3RFTA 2IZZA 3CXRA 1UXHA 3I23A 2B83A 2UUOA 1CQIA 1M2WA 4YR9A 2OHXA 4AJIA 1DIAA 2WSBA 4EEZA 1DLIA 5KVQA 2UUPA 4FN4A 3F9IA 1OOEA 2EF1A 3D3EA 4UAGA 4YJHB 5AQ1A 4JXKA 3DDNA 2A4KA 3WGGA 1CDOA 3OMLA 3RWBA 3K5PA 3ZWAA 2C7VA 4WCFB 4J9VA 1VLLA 4IIVA 5CDYA 1YB5A 3PHLA 5G0VA 1QRRA 3VZPA 1TLTA 2H9IA 5CFZA 5EJ2A 1ISHA 4O59O 1R0LA 1BTOA 1H93A 2AQKA 3JQAB 3RUCA 3ZV3A 3L4BC 4A10A 2WWRA 3QV1A 3I9MA 3H9UA 4FC7A 1I01A 5EL0A 1WNTA 3IOYA 3WR5A 1K89A 4RCVA 3NDRA 3C24A 4H3VA 5G0TA 4CMKA 2LDBA 1MC4A 3GFGA 3CKYA 3QP9A 5A06A 5C7LO 3ABIA 4CUZA 1Z7EA 2J8ZA 5JSFA 5A1TA 3ZU5A 3DHYA 5L7WA 3ZGYA 2FOIA 4WLEA 1P45A 3JD4A 3WXBA 3ZN2A 3AI1A 4IJWA 1KY4A 1X0XA 1YQXA 2VHYA 2PY6A 3OF2A 1GAEO 2D5AA 3D5TA 2CD9A 1T4DA 2XAAA 3FPLA 4RORA 4QSMA 5G0SA 3COSA 1MG5A 2C07A 2GUGA 3OECA 3PLRA 4MVJA 4B4UA 2HLPA 1X1TA 1YDEA 1TT5A 3RFXA 1CEQA 4E5YA 1Y5RA 1EUDA 1WMAA 2PTGA 1HDYA 1K0UA 1P44A 3Q9UA 3X2EA 3VHRA 1IY8A 1BXGA 2AQIA 2RBEA 5DCWA 5L53A 3TF5A 1EFLA 2W8ZA 2EGHA 4GVLA 5AXDA 2WYWA 2ZTVA 4JNKA 4CM6A 1BVRA 5ENVA 1BDMA 1ZNQO 2A9FA 3NJ8A 4WNCA 4YJGB 1HLDA 2YQ5A 3F1LA 5ILOA 1FF9A 2YJZA 4ND4A 3TZHA 4UUMA 5BT9A 4A5OA 4WLVA 1WAMA 4WKGA 1LLDA 4P8RA 4IS2A 4AJKA 4U0JA 3DONA 1VM6A 1DHTA 5TJHA 2CNBA 3P19A 4D3SA 5CAEA 4WCFC 2Y99A 4YT8A 4JP3A 2J3KA 1UXIA 4NJMB 2Y67A 1LSJA 1B26A 1Q0QA 4ALIA 2WD7A 4Z9XA 1DRVA 3Q0EA 5B1YA 4K6FA 2D4AA 5KOIA 4WK6A 4IDBA 3V2UA 1PJBA 4MVJM 2Q99A 3WYEA 4R3NA 3ZWOA 2A35A 4CMAA 3AUAA 1P31A 4MIYA 1Z7BA 1X7GA 3M1LA 4BO2A 1DC5A 2Y1EA 1IB6A 1NXQA 1RJWA 1PU2A 1E6WA 2WYUA 2VWGA 3EC7A 4BO6A 1A71A 4WOKA 2B4QA 2D59A 2GN6A 1B16A 4Y6RA 4GMFA 4IY1A 4XR4A 4WJZA 1M6HA 1O94A 4LSMA 3DHNA 3T7EA 4G65A 2NU9A 2BGMA 2FRDA 3EY4A 2P5UA 4R1NA 5CG1A 2JHGA 3N74A 1QSGA 3DBLA 1AN9A 3WFIA 1MFZA 1ISFA 2C0CA 4I5GA 4INAA 1SO8A 1BMDA 1X0VA 3KYBA 4RDIA 4BO1A 5ITWA 1KC1A 5K0ZA 1N92A 1I0ZA 4BO3A 1KVTA 1A9ZA 4ZD6A 4HUJA 4DBZA 2C7GA 4IUYA 2QYTA 3ZH2A 2C82A 4XGIA 1R37A 2G76A 3C7AA 4LISA 1N2SA 4RF5A 3SEFA 1K6JA 4NPCA 3I9JA 4BS9A 4HXYA 9LDTA 5KJ6A 4FGWA 2ZTMA 3UCEA 2G82A 4CLRA 1EEHA 1R15A 3D4OA 3JTMA 4PGFA 4EGFA 1E3WA 2D2IA 2PZLA 3EHEA 3R3JA 1N9GB 3TZCA 3E9NA 5L9AA 3IC5A 2GASA 3OIGA 1QYCA 5BQFA 3H3JA 3QWIA 5THKA 4OSOA 5B4TA 2X0JA 1IPFA 4TROA 1TT7A 4UVIA 4E0BA 4K1LA 1FMCA 3P5SA 2AE1A 4YAJA 2YDXA 4A2CA 4PLYA 2VUSA 5TNXA 1J4AA 3UGKA 3FPCA 4XB2A 3ENNA 1EMDA 3UXYA 1C1DA 2O50A 4RV9A 4IGEA 1XELA 1BG6A 3Q6IA 4GAEA 3NRCA 2VZ0A 5G4KA 3I3OA 4YCAA 2PV7A 2J3JA 2W2LD 3ZV5A 3OSUA 2DC1A 5A3JA 5DOZA 5EINA 5TF4A 2H5LA 4FOSA 3DMTA 3MEQA 4YBZA 1NNUA 2FN7A 3BTUA 1KEUA 4CMCA 3BHIA 2JCVA 3W4IA 3HN2A 4RVFA 4FB5A 2AW5A 5HM8A 1B15A 3QSGA 1UDCA 3GR6A 3R3SA 4E32A 4DC1A 3PEFA 3PHGA 3GUCA 4PVDA 3EMKA 5I7FA 4PFJA 1MGOA 5T57A 3FN4A 4HWKA 1Q7CA 4I5DA 2XXJA 3SVTA 2TMDA 4UUPA 4A03A 1S6YA 1R4MA 4Z0HO 1HLPA 4GQAA 4I8XA 5H82A 4I9NA 3F1KA 3F47A 4RGBA 1CQJA 1BDBA 2VZ9A 4G2NA 5TRTA 3U4HA 4DQVA 4RLHA 4ZQGA 3RJ5A 4MVJH 1ARZA 3DZJA 1UDAA 2QQ5A 4DMMA 3VH4A 1C3VA 4MKXA 5HS6A 3QWFA 3UICA 3C85A 3JYPA 3NEPX 1HETA 2UYYA 4GBJA 2PK3A 2X0NA 2VWPA 5HWSA 2H6EA 2JAPA 3HFGA 3IMFA 4NG5A 4Q3AA 3ONEA 4PLPA 4XX0A 3INGA 3UW3A 1Z74A 2VOJA 4WGGA 3RU7A 3LLVA 1I32A 3STHA 2HU2A 2DBZA 1PIWA 3OJLA 1U7HA 4IDDA 1SC6A 3PGXA 3VKUA 1UH5A 5FWNA 2Q4EA 4W7IA 4R4JA 4ZGWA 2YV3A 1Z82A 3VH2A 3LT1A 1NWCA 1PJ3A 3ZHXA 5IG2A 4DGSA 4A27A 4M1QA 5CEFA 1I33A 1CJCA 4J1SA 1ZSYA 1D4FA 1V9LA 4TZTA 3HJAA 1J6UA 1DRUA 4R54A 1H6BA 1A4IA 3WGZA 3TFOA 3FTPA 1GUYA 3ZU4A 3PI7A 3E5RA 3VH3A 4HX5A 4RPGA 1HKUA 1LNQA 2X1HA 3ZNQA 4UVGA 1EE2A 5TT1A 3QWHA 1N7HA 5BR7A 2E48A 3DMTC 2BI7A 2IDZA 5DF1A 2X23A 3E8XA 4FS3A 2ZB3A 3PQDA 3G3EA 2BGLA 4P4NA 1WVGA 2GRAA 3IJRA 3R0IA 3L07A 4Q3BA 4TRJA 2CDCA 3W4JA 2JL1A 2VHVA 4CQLB 4DREA 3IUPA 1PTJA 1UR5A 1I8TA 3ETGA 1VI2A 4QECA 4JP2A 4YTEA 5L3ZA 2DKNA 1PS0A 4XQGA 1VL8A 3Q3CA 3PFFA 3WNQA 5TJ9A 1W73A 4Q3CA 2DTXA 1O5IA 3PJGA 3ZHZA 1I2CA 4CV0A 3LK7A 4MKZA 1YB1A 2PKQP 5IXSA 3E6AA 4GX1A 3JYOA 1T1RA 2NU7A 2OUIA 3Q11A 5KNLA 4L4XA 3NUGA 4HP8A 4E13A 3MWEB 2ZJ1A 4MOWA 4JROA 2WD8A 1V3UA 2DQ4A 2ET6A 1CIVA 4BNWA 3AY6A 3EGOA 4BUCA 1P33A 3H9GA 1S7CA 2O4CA 1NPYA 2PD4A 1UZLA 3PRJA 3TN7A 1UDBA 1DC3A 4XYBA 2QZZA 3OM9A 2PA3A 2ZQYA 1NM5A 3AI3A 5A3VA 4R1TA 4FR5A 4WPGA 4ZRNA 4MVJP 3TPCA 4BNYA 4HKTA 4U6SA 4RDHA 3WOHA 5F21A 4MO2A 2X6TA 3LZ6A 4DA9A 3DC2A 2GN8A 1JAYA 4XA8A 4P4GA 5IAAA 1ONOA 4J6FA 2X5JO 5I8WA 3A4VA 5KVVA 3MJEA 5H81A 3FF4A 1HDZA 4J4HA 4MJLA 1YJ8A 2XF8A 2BFAA 3GZ4A 1WWKA 3A9WA 1E3JA 9LDBA 1WXDA 3QVOA 4NFYA 1HDOA 3DZFA 1I3MA 3PIIA 5L4LA 3GN1A 2P9CA 4KZPA 4E2XA 3AUSA 4J43A 5A02A 3KSUA 2UVDA 3PWKA 4DL9A 3EZLA 2WMDA 4RZHA 3OJEA 1F12A 1VE9A 4ALLA 4OSPA 4BQRA 4XQ9A 4K28A 2CF6A 1ENPA 2IYOA 4WCDA 1UXKA 4PRLA 4YRDA 1DEHA 1T4BA 4OAQA 3U5TA 2Z1MA 2C5EA 2YY7A 1T2EA 3ZNNA 3DBVO 1B8PA 4R69A 4BO5A 3T4XA 1A7AA 4GLOA 4LVUA 1KERA 4M8SA 1ZK4A 1KVRA 1AE1A 1XLTA 2GCGA 3W4KA 3H65A 1HDCA 4J2HA 3WBFA 4YPOA 1IE3A 3ICPA 5JCJD 1YWGO 2AEFA 5A05A 4XB1A 3TL2A 3RSHA 1Q7GA 3BAZA 3Q9NA 4ZQFA 4CUKA 4D44A 4FJ2A 1W4ZA 3RCBA 4CLXA 1CWUA 3NT4A 3GVIA 3QVSA 2R00A 4OH1A 3LT0A 2F00A 5COQA 5L51A 4NU5A 4OHUA 1GUZA 4AG3A 4CM9A 1GYQA 3VVCA 4MP6A 4E31A 4FFOA 2ZIZA 4J49A 3GT0A 3ONFA 1XR3A 5TC4A 1K5HA 1Y1PA 5DCYA 1JKJA 1WP4A 2HUNA 4Z9FA 4J0FA 3S1LA 3WMWA 4JIGA 4OL9A 5A9TA 1LSOA 4J16A 1J49A 2X0IA 3I9NA 1EUZA 4LMRA 3KYCB 3ZWBA 3V1TC 3VAZA 4YWJA 2Q4BA 2V6GA 5DCUA 3I4FA 4XIYA 1I2BA 2OP0A 4FW8A 1OFGA 3LU1A 4CQMA 4E5NA 2YHIB 5DULA 3QHAA 3DWFA 4FQ8A 1Y9AA 4Y6SA 4UUOA 3GMSA 3PYXA 4DVJA 2EIHA 3LT2A 1E3EA 1N7GA 3CMCO 3MTGA 4X54A 4XRRA 1PZFA 3WJAA 2VN8A 2X9NA 4Y67A 2EW8A 4KTVE 3S2IA 4BQPA 1D7OA 4YT4A 1VJ1A 1U3TA 1F0YA 1W6UA 4OM8A 1LU9A 1DJNA 1H2BA 3F6YA 5JO0A 1K2WA 1NFRA 3ENKA 3W8EA 1IZ0A 3H5RA 1XDWA 3I6IA 3PP8A 3O03A 1G0NA 1QV7A 1VJ0A 1BHSA 2XOXA 3GPDG 3MCVA 1P1HA 3JYNA 3PHIA 4Z6KA 3MOGA 2EW2A 5C5IA 2NTVA 5I9NA 3IL2A 1GYPA 3OQ1A 5EQDA 1GU7A 3FRJA 3FR8A 5ADHA 2VQ3A 4OXKA 4XD2A 4A7PA 1R16A 1ZMOA 2IXBA 4N18A 1GV1A 4IXTA 2NWQA 1TVEA 5JY6A 2H63A 4J7CA 4LGVA 5GZ3A 2WJPA 1EZ4A 3I5MA 2GYYA 4N54A 4OGWA 3BMNA 2NTJA 2X4GA 1MA0A 3C1OA 1F8GA 2NTNA 1R6DA 3FSRA 2R00C 3GVCA 5B37A 1C1XB 3DZKA 4YYZA 1PR9A 4E3ZA 4L8VA 4YQYA 3FNFA 3K6JA 1B7GO 1R66A 3UVEA 4YAIA 3D4PA 3WGHA 2HK9A 3ASUA 4ALJA 2OBYA 1H6DA 1P77A 1Q7BA 2I67A 4NI5A 4UULA 1N5DA 4BNVA 4ZHSA 3CZMA 5U9CA 2FP4A 1OMOA 1NVTA 4LRSB 5L45A 1LEHA 4QTZA 4BV9A 1L7DA 4HNHA 2Y0EA 3HG7A 4NDNE 1B8VA 2ZB7A 4S3MA 3NX4A 4DXHA 5TLSA 3GDOA 5KKAA 3FNHA 1PL8A 4IXWA 4MVJI 4CLOA 8LDHA 5IN4A 1YRLA 4IDFA 1U7TA 1NX6A 4M49A 2WDZA 2DBRA 2A92A 3E03A 4IJKA 3FBTA 4TRMA 1DFGA 2QRLA 2ILTA 3RKUA 1WDKA 3M2PA 2AE2A 4BB5A 3GH3A 5EMHA 3VPXA 4E5PA 5L95A 1O95A 3ICCA 3PLNA 3T7CA 1R4NA 2EGGA 2V7PA 3MZ0A 1VRWA 1ZK2A 3H4VA 1IHYA 3ETEA 5COBA 3ZI0A 4CM5A 3G49A 4G5HA 3V1UA 3JQGA 1H2HA 2Q2WA 3AK4A 4R5HA 5JO9A 3OJOA 3ZU3A 5ENDA 5G0WA 4IMPA 3VDQA 1N1GA 4GVXA 4N5LA 4OQYA 1E7WA 4E4YA 3DMYA 3A06A 3JQDA 2RH4A 3H7AA 3HB5X 4IMRA 4XGKA 1PGQA 3K96A 1QLHA 2Y1DA 3IKVA 3LT4A 5KVSA 2O7SA 3PWSA 2GSDA 3O26A 4C7KA 4JBGA 2PD6A 5DNAA 4DPLA 3GOHA 2ZYDA 4CV3A 1VKOA 4IJVA 4XYGA 3DBHB 4BNJA 1O0SA 2GNAA 3P2OA 1JLLA 2BH9A 3JSAA 3BA1A 1SZJG 2FSSA 2VOEA 4CLHA 2PKQO 1I3LA 4BNXA 1JVBA 2OMEA 4CMHA 1IHXA 4YJHA 1H6CA 2IXAA 4OOFA 1MV8A 2ZK7A 2J5QA 3E48A 1ZK0A 2CDBA 2GR9A 3TQHA 5JBIA 4URFA 2P4HX 3PDUA 4WCFA 4B3IA 4KOAA 4S1VA 2EG9A 1GPDG 4KTTE 4OOEA 1NFFA 3D0OA 3JQAA 3O4RA 1NPTO 3OEYA 3ZW9A 4BNGA 4D0RA 2FPGA 3DXFA 3WGIA 1HYGA 5CG2A 3F3SA 2CUKA 3AU9A 1XKQA 1UUFA 2NQTA 3QW2A 1LXCA 3TDKA 1QKIA 1UP6A 2ZB8A 4BNHA 2E4AA 3GZNB 2GPTA 5JMPA 3INRA 1ENYA 4HFJA 3AFMA 3VZSA 3WYBA 4DLLA 4B3HA 4PG6A 4PLVA 4CL3A 5A04A 1EQUA 1U28A 3I9KA 1XU7A 4YVFA 3WWYA 2BKAA 3LSYA 3EUWA 2WEKA 1G0OA 2VUUA 2JJYA 3IAHA 3RVDA 3L9WA 4ROSA 4F3YA 3JQ7B 2VRCA 5F1OA 3EK2A 1XHLA 4J1NA 2EWMA 3WBBA 1ZKMA 5DDIP 1ISJA 5BSFA 5T6BA 3JD1A 3JQBA 2DTEA 2FR8A 1ORRA 3I9LA 2GLXA 1IZ9A 3AW9A 4BGUA 4N5MA 3G79A 1NVGA 4B7XA 2G1UA 4MP3A 2PD3A 2YV1A 5KJ1A 4BHTA 4Y6PA 2OFPA 4DQUA 3E9QA 4PVCA 4JJIA 2J3IA 5JW6A 3ON5A 2PNFA 4DYDA 2ZTLA 5DZSA 3UKOA 3ZWCA 3A28A 4YJGA 2X58A 3RBVA 5CEEA 2O3SA 4PLFA 2FY8A 3K30A 3RD5A 2EKLA 3MOIA 1QYDA 2Y05A 1FK8A 3KVOA 3MJVA 1TEHA 4J9UE 4OJNA 5GZ6A 5KJEA 4YRAA 4CM4B 5MDHA 2P2SA 4FD3A 4KWIA 3QA9A 5HTOA 4GWKA 1NP3A 1XYGA 3M1AA 2Q1TA 4DPMA 1OAAA 3KV3O 4HFNA 4TVOA 5CP8A 1XIVA 2D0IA 4NJMA 3GVHA 4XZ3A 3H2ZA 5EESA 1Y8RB 3UF0A 4RVHA 2QZ9A 1PEDA 1R0SA 1B3RA 1RM4A 1KETA 3CE6A 3FR7A 4I9UA 3RUAA 5DBGA 4MPDA 1DC4A 4M89A 4YDRA 5T8KA 1H6AA 4WLNA 3RC9A 1FDUA 1Z45A 3KEQA 1VJTA 1E0DA 1MFPA 2JCXA 1HE5A 5L7YA 5JS6A 1U9JA 3H3FA 2CF5A 3ZWVA 3DB2A 3RI3A 3ZWYA 1RKXA 3QLJA 4PG4A 1IOLA 2VYNA 3PHJA 4IZHA 2FR1A 3E82A 3ZV4A 3U0BA 5KVCA 4GLLA 1LDGA 2OORA 4RVSA 3WIEA 3M2TA 2HJSA 3AUTA 4WOJA 3UUWA 4Z3KA 4MP8A 4W99A 3ZHYA 4W82A 4ID9A 1LQTA 4IDGA 5JFOA 1ZO8A 4KDEA 1DIGA 3D4NA 4RPKA 1CRWG 3AOGA 1U2DA 3BTSA 3KB6A 3L6EA 3O9ZA 4RVUA 4D45A 3TOXA 1B2LA 1ML3A 1D1SA 1E7SA 3PQFA 4ZRMA 1ZSNA 3ZW8A 1ADCA 3AM4A 5AXCA 3GF4A 4AJEA 5KIAA 3JQBC 2XPCA 2R6JA 3PHHA 3OFSA 4LSWA 3WFJA 2F1KA 3L9XA 2X8LA 4A73A 3RBXA 3B1JA 5DBFA 1P1IA 2VYVD 3R6DA 4UREA 1H9AA 4W9NA 5G0UA 4RF4A 3H9JA 4EEXA 1T2CA 3NTRA 5DP1A 3WGYA 2G17A 1Q2XA 1EFKA 3QVWA 1N9GA 4B8ZA 5LDGA 4LCEA 3AU8A 5JY1A 1UXGA 4E12A 3CEAA 3PJDA 5K9ZA 1ADBA 3WGOA 4QUKA 5T5QA 1NVMB 1Y6JA 4JJGA 4IM7A 2O4UX 1I10A 4RQUA 4PG8A 1LC0A 2I66A 4Q9NA 3S2EA 4HNGA 3Q2KA 1Y7TA 2NV6A 2O48X 4BVAA 4CUJA 4N7RA 4YAEA 2QIOA 1BXKA 3GEDA 3GQVA 4BGVA 3OJ0A 2RH8A 5HBRA 4Y9DA 3ZWXA 4LN1A 3O8QB 5IDQA 3UOGA 1UXJA 1NBOA 3U49A 2PLAA 4HADA 3V8BA 3WMXA 2FPIA 2DPHA 4DPKA 1BXZA 3PYMA 1OZAA 1DXYA 1EE9A 1KEVA 4TQGA 4EJ0A 4RPJA 5T8KC 4NMHA 1EVYA 3C7DB 1LDEA 2AEJA 2NLOA 1Y8QB 3B1FA 2JFFA 1LLCA 2EP5A 2OZPA 5DP2A 1QYWA 3WDSA 3TFQA 1B14A 1U5CA 4KWHA 4E30A 1L1FA 2P9EA 4OXYA 1SB8A 1UAYA 4IPTA 1M76A 1PR3A 5CEJA 1DDOA 5I7SA 3FNGA 2NUAA 2VT2A 4GX0A 3DBRB 1HE3A 3GNTA 3HDJA 3NT5A 4TKMA 3UCXA 1EQ2A 2O2SA 2P91A 1NPDA 1GCOA 2GD1O 2Q1WA 3G0OA 4Z9YA 4C4OA 2I3AA 2JFGA 1GQQA 1ZBQA 4I1IA 2AG8A 4QX6A 4AJ1A 1PGJA 1YQGA 4BNFA 3F4LA 1GTMA 2FMUA 3KOUA 3GY0A 4JQCA 5MGBA 4ALMA 2DFDA 5IXYA 2BMAA 3CIFA 4W9NC 2IRWA 1EUCA 1T2AA 1HEUA 3VTZA 5THQA 4D41A 2Q49A 1DAPA 3H5AA 2BHLA 4R16A 4J1TA 4AJJA 4PN3A 4CMJA 3AWDA 2DM6A 4YJFB 3SC4A 3L77A 2Y68A 2Q1UA 5FYDA 4ZQEA 2GZ3A 1AXGA 3PVZA 5FF9A 3I83A 1PZGA 1YONA 1SCUA 1I2ZA 4YEDA 4KDFA 1XA0A 2B4RO 5AXAA 2JKVA 2PGLA 2X5OA 2YV2A 4GH5A 5IDYA 1HDRA 1EDZA 1GCUA 2P5YA 2PZMA 1ONNA 1R0KA 4BB6A 1GEGA 4AVYA 5TIIA 5KWEA 1NAIA 4PLZA 4YAGA 1OC2A 2FZWA 2EJVA 1LA2A 1C0PA 2GZ2A 5CHEA 4RPLA 2JFHA 3TL3A 4BO7A 1MXFA 3JQ6A 1YBVA 3KSDO 4PRKA 3SLKA 5JYDA 3KLPX 1Q0LA 3K31A 1BW9B 4NBTA 3D7LA 4XKJA 4CQLA 3S8MA 1ZUD1 3DFUA 2C20A 3VKVA 1NAHA 1E5QA 1C0IA 1FDVA 3K8ZA 3BMCB 3WICA 2YHUA 2DAPA 1YH3A 3BXXA 4OO3A 3BMOB 3TSCA 3TRIA 3WLEA 3TWOA 1E92A 4OXNA 3RC7A 3QRWA 3L4SO 2IEBA 1YQDA 4FJ0A 2GZ1A 2FZEA 1TI7A 3HADA 2X5KO 1QYXA 5HRUA 1EBFA 5F3RA 1XQ1A 1YOVB 5CPFA 4DMLA 2OOSA 4ZQBA 3TZ6A 2UDPA 4O63O 1XGKA 3KYDB 4BNUA 1N8KA 1NHWA 2DUWA 3UHAA 1E5LA 3ST7A 4HY3A 1XEAA 4RO0A 4F46A 1A27A 1JU9A 1D3AA 1XWFA 4JBIA 4ZA2A 3CH6A 4BL5A 1QORA 3EYWA 3HSKA 4MVJF 4DYVA 3GFBA 2QRJA 3ROQA 3KLMX 3RUIA 1E3LA 4GMGA 5COAA 4RF2A 4XJSA 1P1JA 4LVCA 4J4BA 2P4QA 1T26A 1ZH8A 3GUYA 4AJHA 2LDXA 5U4QA 4WLOA 5L4SA 4KQXA 4YA6A 2VNAA 3QWBA 2DUUA 1JVSA 3FHLA 1TXGA 2XXBA 2OP1A 2O3UA 2EEZA 2W98A 4J7XA 1JWAB 1J5PA 4DLAA 3JQFA 5B4UA 3RUFA 4IDEA 1TB4A 3PIDA 2EJWA 1RM5A 3ROMA 1XG5A 3KEOA 3U3XA 4FFRA 3W8DA 2HSDA 3WB9A 3IP3A 2NVUB 4DIBA 2VUTA 4LMPA 4UVDA 1Y5MA 3I1JA 3TZKA 3W6ZA 1NASA 2PFGA 4HFMA 1DC6A
chains in the Genus database with same CATH superfamily
3WLTA 4BUZA 5HHTA 1PK8A 1UWCA 1GFWA 1O08A 1RMTA 1W4LA 2WWTA 4KNVA 4U3JA 1NYRA 1R0WA 1TRHA 3B6ZA 4D81A 5EJ9A 2VSXA 1A98A 1UM9A 5TGTA 5CDSA 5L3SA 1N9KA 2QPLA 5FKJA 2X0RA 2RHCA 3ZHVA 5IYZB 4R71A 3HXLA 3DWIA 4JJFA 1CJVC 2ANCA 2I8AA 3G13A 4JS0A 1ZM7A 4L9AA 1HZZA 1SPXA 4Q3DA 4U7HA 4ZOBA 1S9HA 3EGDB 3N2KB 3OWXA 4HS9A 2W70A 3GAZA 2XT0A 2IV3A 4CCYA 2VHWA 4PR3A 4Y2VA 4ZPXA 2J67A 4EJSC 1X77A 3HV0A 4Q16A 4D79A 4XYMA 2X2PA 1EK6A 3HJNA 2D5BA 1XLUA 2IPMA 2E21A 1JZSA 2PZKA 4OY3A 2A0UA 2LIPA 4LSGA 5A5EA 4HRVA 1RPZA 3PEUA 2H0AA 4I66A 5GADl 3W34A 2QVCA 1CB0A 1FTYA 3TTUA 3PCRB 5SZHB 1GYRA 4FBMA 1Q2UA 5EMKA 1HRKA 3DHWC 3FNRA 4O6VA 5GV7A 1NYTA 2JIMA 3ZY6A 1M0TA 3E2MA 1DQSA 2C2XA 2RCYA 4I1UA 4KZKA 5BW5A 4IDUA 5F5XA 3WLJA 2WG1A 4F4DA 1M6VA 2B5WA 2J5RA 1FSGA 4FFBB 2JLQA 1CRQA 2JI7A 2VFAA 2W90A 4XD7A 3TTXA 2XY4A 3L7CA 5C8YB 4P7FA 3U3KA 3NDJA 3NVMB 4DLWA 4ENUA 4K9DA 1ZLXA 3NYIA 4U7DA 1YHZA 3F7MA 1XZPA 3CX6A 3R0XA 3FI0A 5LBTA 4R2IA 3A9RA 2DETA 2QP9X 2SKDA 1I36A 4GX2A 1DFHA 4EFNA 1GPAA 1W88B 2QE7A 2FHSA 1Y9ZA 4ZYTA 5F7OA 1AD2A 1B0PA 2IELA 2R8EA 4IKEA 2WVAA 2Z9DA 2FPPB 3KYCA 3Q7EA 1INLA 3GMDA 2GK6A 1YNSA 2XNCA 4H7JA 4IDAA 4KX5A 4U9UA 2H3HA 1Z88A 2OILA 3INTA 3WLNA 3K32A 3R9XA 2J1LA 3IJ5A 2D5IA 1RVDA 4I4NA 4DJDC 2H4HA 1VPVA 3E9EA 1G2PA 1MAWA 3JQFC 2D1SA 3GVPA 4FT2A 3TGLA 2NVBA 5LQSA 5JDCA 2UKDA 5IN5A 1L8QA 2FR0A 1W47A 4Y2YA 3HHPA 4D02A 1U2EA 4LHSA 4G1EB 3D43A 4I3FA 4W5JA 1E2HA 1HT2E 1RAEA 3FUCA 1NBMA 4R1OA 2QRVB 4RZIA 3V00A 1KEZA 3G7NA 1ODJA 3CVOA 2Z2XA 2PL9A 3VDRA 1QUFA 1PSDA 4ZXPA 3S2FA 3C14C 4XTRA 1PJQA 2GD2A 4JDPA 3VO1A 3W1EA 2F64A 2B5VA 3HPQA 2CXXA 2PXXA 3WGNA 1WCWA 3WGLA 1M1YA 4CMIB 1I7PA 2BGIA 4HLQB 4UFPA 3DBIA 3HJCA 5JROA 3M89A 2OMKA 3CXUA 2DHDA 1LLQA 3KM0A 2BEUB 3MXTA 1PWZA 4U7JA 2G1JA 1DUIA 3VSBA 2Z6AA 2Z8YA 3A1TA 1WPQA 4RK1A 3T41A 4BVGA 2PZGA 2IJGX 4D9FA 1MNAA 1R74A 1UXOA 1F8YA 4MLZA 4F91B 3PXCX 1KJYA 5H83A 4FBGA 2F90A 1J2YA 1T0BA 3E9MA 1Q0TA 4TXJA 3ZHQA 3PUIA 3JAKB 1S01A 4CM8B 2V4ZA 2ZIVB 4IEIA 5K4GA 4GM0A 4UBNA 1YO6A 3O4GA 3EEOA 1C4KA 1Y48E 3HKBA 3CX3A 1JXMA 3MA0A 4ZRDA 3S2GA 2DOKA 2I1WA 1XU9A 2C5HA 5TS2A 3RIYA 4K6KA 4TVBA 3VZDA 4A6DA 1QAQA 1ZIDA 3L7DA 4NRDA 3ZV7A 4CL2A 3R3VA 1QP8A 2N1BA 4KV7A 1Z4KA 3P8ZA 1CYEA 4UU7A 2H4JA 4XLLA 1WDWB 4B4DA 5CX1B 2N1MA 3TOVA 3TUIC 1SXJB 2OC9A 4MINA 1ZGHA 1N2GA 2PX0A 2WILA 2C58A 4G1MB 1DGQA 2E89A 2WFMA 1FVXA 1Z15A 1HZJA 2BMVA 4NL4H 1Y6QA 4RD2A 1OC4A 3F49S 1F8FA 1U3WA 2FOXA 2Y3IA 4NEQA 5AKIA 4E03A 5IC4A 3L6DA 4ILKA 4NV0A 2WT8A 3D3WB 2HXSA 4MV3A 3RJZA 5C35A 5JD6A 3V1YA 4ARVA 1YA6A 1BMQA 2B98A 4TRNA 3Q5GA 4LHXA 1BS1A 1GFSA 2DJ5A 4FFPA 3FTEA 3F6BX 4DJJA 2IEZA 3UT5A 1LF5A 4PAMA 2Z8YM 1R27A 2CVPA 4UTRA 1SIBE 4YMLA 2LBPA 1FW6A 1VLMA 1XD9A 2XWSA 1KJ9A 4IHJF 1LBTA 3ANLA 1YR7A 1JKIA 2DR0A 1N2OA 3N0RA 4WEQA 3MPUA 4X91A 4EG1A 4L74A 4LVOA 3OJFA 1PWHA 3BMQB 4MW6A 4BBPA 3KFLA 1E3TA 1U7PA 1VB5A 4ONEA 4JT9A 3TO5A 1KI9A 4ZT4A 1YAJA 5F7JA 5TVKA 4CHTA 2NO6A 3OPYA 1IRXA 2PH7A 1DNPA 3LUDA 2Z2JA 4R8MA 2NQ2C 4ZVSA 4EW1A 3QVGB 1A76A 5JXIA 2XHEA 3OZIA 3RU9A 5JWOA 2A1TS 5BV1A 1NUQA 1SJ9A 3X1MA 3BK7A 1Z2NX 3OPVA 3R7LA 2JZNA 3U7JA 1L7MA 5CLHA 3ANTA 4OIMA 4B3XA 1HFKA 4OTZA 1DIRA 1PS8A 5HM6A 1CK4A 2HADA 1X1AA 5HS4A 2GJ9A 5FBVB 5ICCA 1IXSB 2RSLA 4YQFA 3BYZA 1U4OA 2EJTA 2WTBA 5KTMA 4NU0A 4PZAA 1ZUHA 4NEGA 4QAJA 3FTNA 1IZYA 2XD9A 4HQOA 3LLUA 1BJRE 1FVOA 3AR4A 4JWKA 4DOMA 3TD9A 2XOKA 5KKCA 5JC8A 1EWKA 4JBXA 4JH0A 4NBUA 4Q7LA 1PGOA 3M6XA 4DMGA 5AUOB 2FFRA 3K92A 5A03A 3WA7A 2PUWA 1X70A 4XTCS 1V8BA 3I2KA 2VDJA 4C20A 1P1CA 4XM1A 3NAGA 2ZBFA 1AG9A 4V39A 4X64B 3FCAA 5JARA 2CVHA 2OD2A 5DI9A 2FWMX 2GNPA 2VYCA 1X7XB 1ZRNA 3OFND 5DGIA 3QX7A 4IQFA 4DT1A 1NUTA 2A4MA 2QRPA 4HVAA 3I2IA 5LQKA 1MDFA 1V43A 3K0AA 5AM1A 1E6LA 2H1SA 2WKPA 1YZGA 3AG6A 3TLZA 3WZ2A 5AW3A 5K8LA 1E3IA 4OLAA 3II6X 1D6JA 1OIXA 2XE4A 3AR8A 4IIBA 1A96A 3KKZA 3KQWA 3U7EB 4L5YA 1YMUA 1YK0A 1P75A 2PS1A 1S1CA 2PBRA 2Q9AA 1TCVA 4N5IX 4CDMA 3CLTD 3CNHA 4LVNA 3OETA 2AD5A 4FYVA 4EAQA 2W58A 4PLTA 1C7RA 1NJFA 2BP7A 3GDHA 4WOPA 1NY6A 1IXZA 1OFTA 1ZIYA 3PIRA 4PZZA 1EUQA 2Y2VA 4C6HA 1PS9A 5ELLA 1GL9B 2F59A 3G5UA 2P90A 4E33A 1BD4A 1DG1G 1XMJA 1M7BA 4F3TA 1UBOS 2G4VA 3D2AA 3TDMA 1TUEA 2WZBA 4L0CA 1ECBA 4I9GA 4BJ5A 2FZCA 4BV3A 4W4TA 4WERA 4AMGA 3PDIA 2OCPA 3ILYA 4OQLA 4ZZ3A 2QW8A 1GNSA 4OYYA 1M5RA 1MO4A 1BHQ1 2ZU6A 2AG5A 1JKFA 4BWYA 4KQ6A 3LPMA 3F46A 5DIFA 4YP5A 3HCWA 1V16B 2PWZA 4N49A 5C7OO 1IY0A 2I7TA 3DMPA 1PL6A 3MF4A 2KYRA 3A6JA 2YN4A 3GA0A 1DQZA 1GNLA 3K73O 1V11A 2VHCA 2WZCA 3OP4A 4MW0A 4NNJA 4MKIA 5FP0A 1XDBA 1SCNE 2CWWA 2WNIA 1UBUS 2C84A 3JD0A 3DFFA 2Q8NA 3DC7A 3QVUA 2OENG 1Z4NA 1EA5A 2QZSA 3O83A 3AETA 1QFXA 1VG9B 3F73A 2PGAA 4YCMA 4TN5A 3FFWA 2AZTA 1GAJA 5E1BA 1PUIA 1EXDA 1ISMA 1CQPA 1KH1A 1ZU5A 1EG2A 1JG1A 3HH8A 5JD4A 1NMSA 1WCIA 2W6OA 1JA0A 1TU3A 1W36D 2CVOA 4IXDA 4RIIA 4WD3A 1Z2CA 4EYSA 1EGQA 4Y6GB 3UNXA 3DMNA 1I7QB 1YE8A 4WA8A 3TIXB 4A36A 4DN6A 5K8TA 2RJNA 4I5EA 2GTIA 3ZGLA 2QUHA 5JPIA 3BGSA 3KTDA 4ESHA 1BHO1 4MLCA 4Y2SA 2WWWA 5CH3A 4OA5A 4L07A 4Z7QB 2D6FA 4L7VA 1QO0A 2O14A 5JE8A 1K97A 4DTIA 2NIPA 1OTYA 4DTCA 1I3OA 3M6UA 3OA2A 4FYXA 4BV8A 1RZRA 1THMA 3DH0A 2P30A 4JODA 4NFHA 2JH9A 5H16A 4B0OA 2I4OA 5EJIA 2G07A 2ZZMA 3DFKA 1FZTA 4AJLA 2W2NA 1HKHA 4RZ2A 4JLOA 3CCCA 3T9CA 3RIHA 5BRAA 3P9IA 1W36B 2EQBA 3MUFA 5AM3A 4H4EA 1JT2A 3EZNA 3SKXA 2AXNA 1D6NA 2OGUA 4HGRA 3DXXA 1KEPA 4ZVKA 3SYRA 3IO3A 5J4YA 2XLCA 2I76A 4O4JA 3VAAA 4C6RA 2ODEA 1NXTA 2XYRA 3R8CA 3DE6X 3VPFA 2BV3A 2XDWA 3AF4A 4H7DA 5AHXA 4JJZA 5KOHB 4D3FA 4EAAA 4FPXA 1ZGCA 2B6NA 4GPBA 3EPPA 1Z6XA 1KC3A 1DUSA 2IHJA 1F06A 4J6EA 4KQJA 5JMTA 1NF9A 2G7MC 4FFLA 3TLGB 1Y81A 1UDRA 4N76A 4CI9A 3GLGE 2XEXA 3HE3A 5BN4B 3CRVA 3ZK8A 3N3AC 3IDAA 4WQMA 1RT9A 2PHZA 5AJUA 3SLRA 1YS9A 1RYBA 2EZ9A 3STYA 4CTJA 4JOCA 2VJDA 3R75A 2UYHA 5DMXA 1QGUB 1TMGE 3HBAA 3VSDA 1FFHA 2PYZA 4M1SA 1XCBA 3DDSA 4JLDA 4TMWA 3PD1A 4Y3UA 5EEHA 1Z08A 2AIRA 4PRYA 2FPOA 4PXAA 1JGTA 4MI1A 3ERCA 4XDYA 3TH5A 3D6NB 3DZ8A 4DUGD 1G21E 1VIMA 2QLTA 3KLBA 3KPWA 4JY7A 4KUEA 4ZQHA 5E7IA 3NORA 3JD2A 4M7PA 3DL2A 1P6QA 1UBEA 2ZT7A 2WB4A 3IP7A 3QXXA 3E61A 2VHXA 5ALIA 1JMVA 4CM9D 2IX3A 3AB7A 4LECA 4OI4A 3THXB 4V3BA 4C1BA 3GYGA 4QYIB 2HT6A 2DWCA 2C4TA 5FI3A 2WE8A 3FYDA 3ANNA 3LHKA 1L7PA 1SIOA 1XU4A 3DMDA 4KCGA 2BE9A 2PH5A 1QZ3A 1RQGA 1QZZA 3ONDA 4JIMA 5ALDA 3TNLA 1JEYA 5B5SA 2CVZA 2XMBA 3CUVA 3VQTA 1WZEA 3B1VA 3ROKA 1LKZA 2OV3A 2QF7A 2NU9B 3BEDA 1RQLA 1Y9JA 2YHAA 4RMIA 4Q9HA 4WL0A 5ILQA 2YN2A 2D2VA 3NM6B 1X7DA 3GJ3A 4LBZA 3FWZA 2PGOA 2PKXA 2C54A 2Z30A 2BFBA 3AOEA 2AMVA 3GLVA 3P9PA 2BRUC 4Q6BA 3G1UA 1PHPA 5E8RA 4W1QA 5FWAA 4DJTA 1FFDA 5CH5A 4EX6A 1AURA 4TM7A 5ALQA 1D2EA 4BYMA 1D5WA 3ETDA 1NW8A 2J3EA 3EQ6A 4QGHA 1R7RA 1TM7E 1PFGA 3FB4A 1OROA 4JGBA 4BNNA 4PAGA 2BM1A 3S5UA 2ICAA 4UVHA 2ZRPA 1V7ZA 1DRWA 2PAFA 3HM2A 2WIJA 4PC3A 5MHTA 3UMMA 2AFRA 2Z83A 2B37A 2AFIA 5FBKA 1GG2A 4H3KB 1PHRA 1FFBA 3WSVA 1PVVA 3FZQA 2FMHA 6ADHA 2OV2A 3AY7A 1U8XX 4PXSA 3M4JA 1S8NA 4LE1A 3N1UA 5C8ZA 3BJIC 1UQRA 2IZOA 4IV0A 1KQPA 1G98A 2GCIA 1NHGA 2HREA 4W6ZA 3R7NA 4PZCA 3IHKA 4E2YA 3A31A 1S7GA 1XQ9A 1EYZA 3N5CA 2NO0A 3OOSA 4G4GA 2YWBA 3RYIA 3ZE8A 4AU1A 2BHSA 4DEVA 5L4NA 2PRSA 1MOZA 1UWVA 4WHMA 4G8CA 3SZUA 3VGPA 2QQEA 1XPJA 4QPDA 1BCRB 4ZI7B 1PD1A 5TPWB 3GROA 3HYTA 3KELA 3CVWA 1SELA 1Y8QA 3UJHA 2YNMC 5A5FA 4CKZA 2I03A 3DDZX 2BGJA 2YCLA 2F62A 3MCTA 4GWGA 3FMIA 3H0EA 4DSOA 5CVDA 3VPBA 1VBNA 4CG0A 2YUTA 5B7NA 2PUGA 1E2BA 1ZMTA 4W1SA 1GPWB 3CWCA 1L5RA 1Z8NA 2DUMA 3KKOA 5G4KB 4FEEA 4LS3A 2OPHA 4QPCA 3CH5A 1QXSA 1UBTS 2CHFA 5JANA 2FWIA 2O5VA 3QYAA 4W7SA 2F43B 1CR6A 2CFIA 2OKCA 4RTQA 1CNEA 2WMYA 3AJ9A 1NRXA 3HYCA 3TECE 3T54A 2GHIA 3KU4A 1FYVA 2IPXA 1KZ7B 1L7EA 2R68A 3IQDB 3TYXA 5JZOA 4QO7A 2ZFUA 4L6AA 1DG3A 2NT3A 1W8IA 4PQEA 3C3DA 1N6KA 3W5HA 4LDAA 1P0QA 2CDNA 3CF2A 2FRDC 4YO7A 4CT0A 3GRZA 3BH6A 4B80A 2G9VA 1U9IA 3E0XA 4O29A 3T1HB 4J91A 3GU3A 1YVDA 1UPXA 3AEXA 1Z0FA 2QORA 2B4TO 3UAZA 3TB4A 3HFJA 4ETWA 2VTBA 5K2OA 2HEGA 3E1KA 1AMUA 4NHEA 1LC3A 1G41A 4GMXA 4UOZA 3O7WA 1OWOA 1NN3A 1PJAA 3NBUA 5EKUA 3TX2A 3UV3A 3PGJA 2A2ZA 2R751 2AG6A 3KALA 2JJ1A 4YJFA 2FP3A 5B3AA 4B2IA 3PGMA 1KP9A 2PPLA 2XDAA 3FPFA 4EQ6A 4W1PA 1E1CB 3UJNA 5IAJA 2V45A 4HPXB 2E37A 2H5IA 4KO1S 2J6HA 3DZHA 4WUTA 4X5OA 1SOWA 2QBYB 3DAFA 3F5SA 1ML4A 5DYNA 3DTYA 1E1LA 2R7NA 2HMUA 3ESBA 3DQPA 3MMZA 1N3YA 3PF9A 1OE0A 1B3BA 1CZNA 1XE3A 2JAHA 4I5IA 4ND8A 4G0WA 2ZYWX 2WICA 5DXJA 1D4AA 1LCIA 2MYNA 3Q5EA 4A16A 4EMSA 1MB0A 1PFVA 2HWWA 1JBKA 2AXQA 5BWCA 1I6KA 2CXTA 2WWVD 4IHJB 2PNJA 1HT3A 1ULUA 2JI4A 4QGSA 2LV8A 3KJZA 1SHZA 1VZ3A 4ZCLA 3UMVA 4QATA 5NLLA 3E22B 4K5QA 2J32A 5JZBA 4JASB 4BVFA 4BP8A 3GHHA 2C9DA 1GTVA 4XIJA 3JYLA 2NUTA 1XMSA 2ZI9A 1M6WA 3FIJA 5C8DA 3I9V1 1BW9A 2IHBA 2QJTA 3EPRA 4FEYA 1SOVA 3ED1A 3UATA 3JVDA 1P5JA 2G6BA 3VZQA 1CD5A 4CEHB 1S9DA 3CVUA 2CLOB 1LBSA 4M36A 4RC9A 4DC9A 4IIEA 5KTSA 1TU0A 1P4RA 3GJ0A 3LWDA 4JENA 4B74A 2I9KA 5AXBA 1GTG1 1QF7A 2VZLA 5J58A 2HPAA 3QZUA 2OXIA 4G5GA 4CKEA 3WZLA 4ZI2A 2VTVA 3JCZA 4GIBA 1NN0A 3QVXA 4JBYA 4P5DA 5KZMB 3QFTA 4JVOA 3ZNOA 2BJVA 5A5DA 3H1GA 4RSRA 2OSVA 3M6IA 2OXTA 2P41A 1YOVA 3G82C 1TU4A 2EFCB 1QF9A 3D8HA 1XKXA 2AMLA 3MSXA 3OO1A 1KP3A 2R9VA 4DZZA 5K6AA 2H08A 3NIGB 4ZDWA 2QEQA 2YW9A 1ZH4A 3AJ8A 1BRMA 2XYVA 3GMIA 3RC2A 4P3XA 2AKYA 4J1QA 2DB3A 2I2CA 3H2SA 2YRXA 2ZTUA 3NV9A 2D0DA 3WYCA 2BMJA 1P6UA 3G9UA 2IS6A 5TSDA 2PL1A 5JD5A 4E07A 2HNAA 5DNDA 2HJ9A 1QRDA 1KFCB 2C29D 2IUFA 2ORED 2HHCA 4NQZA 4PYQA 4IOJA 1RP7A 2OGWA 4RIGA 5JALA 1Y5IA 2YWFA 2BFMA 3U13A 2Z1NA 2C3OA 2Z09A 5IUJC 1PJ2A 2VNKA 2PS3A 1GQ2A 2JCYA 1JFTA 4KE8A 2IEDA 1G21B 5ES3A 1V8PA 1VC2A 4JI1B 4DXAA 2O3TA 5I01A 1WW8A 1HPLA 1KRHA 3F5DA 4XPIB 2FUG6 4WNIA 4YRBA 3R44A 4JA0A 4L08A 1YRYE 4WXPA 5EMJA 3T1QA 2Z57A 3CNQS 2Q4RA 3KUXA 1NU6A 1XD2A 1P1RA 1UWLA 3BVPA 4CI0B 2HTEA 3QMWA 4O4IA 4P4LA 1WZUA 2KPOA 2NSDA 2P2ZA 1EEXB 2NVUA 4FNMA 1ZEJA 3L7OA 4Q18A 4U2EA 3AEYA 1QCDA 1KAMA 2MSKA 2C78A 4E21A 1S96A 1L4FA 3PCTA 4ALNA 2LUOA 1YIOA 2C7BA 4NYIQ 3RSGA 4CG1A 1V3TA 2IBSA 3DKKA 5EAIA 2OCIA 5FOWA 2VRCD 4FGLA 4JUCA 4EUKA 5BWOA 2XQIA 3EQ2A 3AVWA 5CXSA 5FQOA 3K1TA 4RESA 1L6RA 3FNEA 1FCJA 4MROA 5JAQA 4RJTA 1EZ1A 4FI3C 3IE0A 2F3UA 2FUCA 3W7VA 2QXYA 3N7AA 3GN2A 1F6WA 4AXXA 1DIBA 1MF7A 1M1XB 3NLLA 2PQMA 5CDGA 5A2QA 1SUWA 3JASA 3IURA 4EYOA 3W2TA 2V6FA 4NK4A 1E58A 3KPYA 1U02A 2IVFA 3EXEA 2GPWA 5JAMA 4CGZA 1G3UA 1CTQA 4R1UA 3MCWA 5AJHA 4JLBA 3UH0A 2A0FA 5IHPA 4CMGA 1EVLA 4V0LA 3WMGA 2DBQA 4EVRA 3IP9A 2GBPA 1TFUA 1HDXA 2CB0A 1URPA 1U2TA 1G5RA 3CRNA 3OM0A 1A9YA 4Q39A 4CMBA 3IT2A 2O1SA 1H0SA 1GDHA 1SOUA 2QU7A 4KYVA 4NBWA 3ASVA 4Q12A 4QQNA 2YCBA 1KDOA 1JJFA 4PIVA 4Z0TA 4L4SA 4R0NA 5EIEA 3FFBA 1TJ4A 2PGJA 5EZ5A 3W1VA 2GEJA 2MU1A 2OKGA 2QN6A 1JQBA 5AOBA 3W5CA 4E5VA 3KFXA 4GZMA 3HDTA 3PUXA 3A4YA 1CVIA 3I92A 5FWYB 4MR7B 4GRIA 4EA6A 3O82A 5GGYA 4R8RA 2FQ1A 2O8DA 3CPEA 3QKUA 1B0AA 4P9NA 5JVDF 2WJZB 421PA 2W6ZA 4X1YA 3ZE1B 3DUFA 4LXXA 4DR4B 5IZCC 5DV9A 3FBGA 3AESA 3KKKA 4CFYA 3EWAA 4F72A 1RADA 1GZ5A 4XJTA 3EXHA 4BMYA 3QOYA 3LXXA 4M46A 3NDBB 4P34A 1ZH2A 2QTWB 2UAGA 4NJEB 2IE0A 2R6ZA 1N25A 1FJ2A 3B82A 3QUQA 1SHLA 1T9BA 3MWDA 4EW6A 5AUPB 3IAM6 1MORA 3OE1A 3GGPA 2CLDX 3IBGA 2R8RA 2O2YA 3LDFA 2HWYA 3OTGA 1GGVA 4BKOA 5HZGA 2QI9C 1W4BA 3NHKA 3BZWA 4LRWA 2BC9A 4MA5A 4EKNB 3KETA 1B43A 1JKJB 3N7TA 1LDNA 3P26A 5KJCA 5KVAA 4QXMA 1IHOA 3QU5A 2HRBA 3LGAA 1JS1X 3UB2A 3TEMA 4B44A 3IO5A 4S1PA 3R3WA 4JR1A 2B3TA 1JHYA 4TKLA 2EFGA 2ZEJA 1SWVA 1Z6AA 3E9CA 3FLAA 3L6OO 1K6EA 4LOAA 4EITA 4C2UA 4P2BA 1Q74A 2ISCA 3KAJA 3PWZA 4OB7A 1CZHA 2HDOA 1R2QA 1I3KA 3KSZO 2A1UB 1RPJA 3H1BA 3DV9A 4MVJE 4BO9A 3RVJA 3VJKA 3NDIA 2QX9A 1XDZA 4B3FX 1Z8FA 2OCAA 2B4KA 2P9GA 3G5AA 3AEQA 4EPXA 3RAFC 3U9TA 1V95A 3T5TA 3MINB 2XQFA 1OYYA 4X6UA 2Q6LA 4GR4A 3B38A 4NV3A 4O5OA 2B78A 4TSKA 3ZD9A 5BMOA 5AW1A 2AYYA 2P69A 2VK4A 1YVUA 2GGSA 4WZAA 3ZL9A 1GARA 4XRGA 3E3NA 3K8OE 1R6TA 2QLBA 4Q1VA 2AQ8A 3NT2A 4MV9A 4E4TA 5IZ4A 1JWLA 5F9HA 1E77A 2DU8A 2CSUA 1G59A 2JH8A 4GKBA 3OZUA 4AMBA 1PJ4A 1E20A 1C29B 1T0IA 2QHXA 3OT5A 3K8QA 2ACEA 1KI2A 1R0ZA 3CZ4A 1Q84A 3AM3A 1B42A 1I51A 2KM1A 4D9NA 1OZFA 1NNI1 1W46A 2C2GA 1NVVR 2PANA 2PX8A 4LYDA 3SM3A 3AJAA 5LNK6 1G2OA 3BAFA 3VAYA 2ATCA 2ZU0C 1PUXA 2Z8ZA 2XMRA 4CJXA 1VJGA 3U3JA 1QVZA 3OKFA 4QGBA 5DTMA 4H2DA 2H1CA 1EBBA 3DCIA 3E7FA 3QJYA 4YRPA 1ZVKA 3DVSX 4IIGA 4DDMA 2HXGA 1O89A 3JR3A 2YJGA 1N2IA 3B20A 3QFSA 4G5YA 4QBGB 2GHTA 4GYJA 1SBZA 4NZPA 4XCXA 3GC6A 3STVA 4M0DA 3L0BA 4JKOA 3L0PA 4KXUA 1PUJA 5HX7A 1RE0A 3DOJA 5JFTA 2Z1DA 3LQFA 2XVAA 2BN4A 5FA6A 1VHTA 3STXA 5AKJA 1F1JA 1U81A 4QYMA 2CNWA 5IJ9A 3T3OA 3KJIA 1TAGA 1C7IA 2YJTD 3HNOA 3EUFA 4PC7A 4X90A 5FPKA 5JRDS 1MB2A 2ZROA 4AFNA 2IU3A 4TKZA 3X1YA 1UMBB 2IYEA 3MS7A 5BR4A 2R7AA 2P9YA 5JIBA 3Q6NA 5DHTA 1NULA 1TGYA 5C46F 3D64A 3VUFA 4B6JA 4IJ6A 4ENRA 1M6YA 3DZGA 3HFRA 4MQFA 5FTMA 2BFOA 1I7DA 3N58A 2OVFA 4YB8A 5AI6A 1ULAA 1Z5VA 3MJFA 2H1WA 4HWSA 4IQGA 1KK3A 2IITA 3DYBA 3O4JA 4FDMA 4KMSA 4MIOA 3ZKWA 4XGQA 4M88A 2GCEA 3BB3A 3L4BA 2RC5A 3NWPA 4FUQA 3LQ2A 3FAKA 1E7MA 3H0CA 2Y4NA 4IWYA 5ER6A 3WADA 1PQWA 1X2BA 3PUVA 3EWNA 2CXOA 1Z6QA 2ZVDA 4PLWA 2ZZNA 4EK9A 1AT1A 1WDLA 4BZZA 1CYDA 4OG2A 3P27A 4S1NA 2IC5A 4ZAFA 3UEOA 5C80A 3I42A 4P7KA 1RR6A 4DIEA 3BT7A 2QZ4A 3JRWA 2CKDA 3WYAA 3NGLA 3JWPA 2AH5A 5D3KA 1OX4B 4RHYA 1K9SA 4WEOA 3T0GA 3QPDA 1P4SA 2BTQB 1QONA 2P75A 2ZSFA 2OCKA 1JTEA 1HYHA 2ZJOA 3PRHA 4B32A 4I1PA 1YRWA 4XR9A 5DM70 3Q2IA 2YMLA 1P7PA 4IH1A 4QT0A 3WHLA 3ZHRA 1OY1A 3DCYA 4EHJA 3FYUB 4ZZIA 5C9ZA 3K09A 1KTIA 3T1YB 4B4VA 3EQZA 2JW5A 4EL0A 1V6AA 3C6KA 1KJIA 3OIDA 3S55A 1XZ8A 1H42A 4L9RA 3PHBE 1YVEI 5DHPA 1TZ2A 3Q72A 3V48A 3ZJVA 3D81A 1S8OA 4X85A 2WSSA 1TADA 2Y8EA 3TRDA 4XASA 3T52A 3NM5A 5BSEA 1NG9A 1Y4DE 4G8JA 3MAAC 1E1MA 3QG1A 3UMRA 1CZRA 2BD0A 1KYQA 4KU4A 2W71A 5KSPA 1RXWA 2D54A 1OD6A 1Y1RA 1GUFA 4QG3A 2AJTA 1QZXA 3OQNA 5LKAA 5CLQA 1I5RA 3BTVA 4IS3A 2Y66A 3WTBA 4KE7A 1GGHA 4D0GA 1G3RA 1JHDA 2YWDA 2IZZA 3QTLA 4D97A 1Z3IX 4P0QB 3AVQA 3SX0A 3IVCA 2UUOA 1PNQA 4UJ5A 1P2FA 1ZESA 4YR9A 5CT6A 1ZIPA 2I7CA 4EEZA 1DLIA 4KWTA 5KVQA 1UBFA 2GYUA 1NI4B 4FN4A 4ZEWA 3CEJA 3D3EA 5FXMA 4WJLA 3KKPA 1LW7A 1U2SA 1VLJA 4JXKA 4RS4A 4XSHA 2V98A 2QGNA 3DMRA 4AN4A 4ND6A 1CLUA 3HYNA 4D74A 1WVIA 3IXQA 3RWBA 1RMYA 2WIKA 1C30A 3GJZA 4E09A 2C7VA 2V1UA 2QI9F 4J9VA 1X92A 1VLLA 4IIVA 2W43A 4PYNA 3EIXA 1YB5A 3WMEA 5ALSA 1ISHA 5ULLA 2Y1LA 1H93A 1ISPA 1FU7A 3AVYA 4ZT5A 1LWOA 3UTDA 2XRYA 3K72B 1WP9A 4UCWA 1DT5A 3CFYA 3WR5A 3U40A 3DEAA 1SVWA 1WKCA 2BKUA 1R5JA 3EB9A 4PAOA 4X1IB 3EFBA 4Z8XA 1XNQB 2DUJA 1KK0A 4G8BA 1UBMS 4XWKA 3R6TA 5CT9A 5B57C 4YCBA 1OYOA 4FKBA 3MELA 3W7BA 4UAJA 5A06A 1G5FA 3QP9A 2MSCB 3GLIB 1YCFA 3ABIA 4CUZA 2J8ZA 4B0PA 2RGCA 5A1TA 5L7WA 2PUVA 4LJ7A 4FSDA 4WLEA 1P45A 2ODPA 3JD4A 4K8RB 3ZN2A 2QQFA 5K09A 4J8PA 3FJOA 1C9DB 2QNIA 4IJWA 1IU9A 1YQXA 1ZUWA 3I8OA 2ACVA 2XGOA 2ZIEA 3ILVA 2CD9A 4BX8A 1SUPA 3RYTC 5JQGA 1JT9A 2ZS7A 2B2NA 3HB9A 2R79A 5EUCA 3U7RA 5DJ5A 3OECA 2HLPA 4RJKA 5AM2A 1YDEA 3RFXA 2Z4SA 3WRWA 4DCMA 3JXEA 4MQ4A 4YRQA 5E7JA 1EUDA 4P84A 5JD3A 2V4MA 3W3AA 4HWRA 4ZIRB 4BRSA 3H8SA 1MAUA 1P44A 1Y1SA 3Q9UA 3X2EA 4Z86A 4H0NA 3RVMA 1DJOA 4H17A 3HY4A 1D5CA 2XLBA 1BXGA 4HNTA 4REOA 3LY5A 2W8ZA 4GVLA 2EGHA 4XUEA 2FPUA 2AZDA 3A1DA 5DIZA 2MSWA 4HAIA 2HIAA 5AVSA 4YJGB 1ORIA 1XL0A 1OQAA 4C0JA 4MDFA 4YYEA 1FF9A 4AROA 3CQ9A 4FK8A 3IBFA 3REOA 1EWQA 5JJLA 1F0KA 1QC5A 3OLWA 3FA2A 4YI5A 1Z0UA 4TS9A 4A5OA 1WAMA 2I80A 2OE2A 5GONA 1NDHA 3EIUA 3Q7SA 3G59A 3HUUA 3RWMB 4AJKA 4U0JA 1GA6A 1ZD9A 2PZEA 2EIXA 3VXKA 1DV2A 3OU7A 3PC8A 5KNDH 1W85A 1PV2A 3IEPA 1USKA 4WCFC 3A6DA 1VYTA 2QPAA 1P0MA 3L2OB 4JEUA 2BSAA 4D7AA 4C4XA 4XD7D 1C8BA 2EHJA 4Z9XA 3VKHA 2DFLA 3Q0EA 5B1YA 3CX7A 3R76A 2RHOA 1TEZA 3OUUA 4IDBA 1T4GA 1PJBA 2RAUA 3HCCA 2DGDA 1Y82A 3IERA 3WYEA 1XVIA 1T4CA 5CM2Z 2A35A 4Q9DA 1KE1A 2O19A 3AY0A 2G06A 2J4CA 3AUAA 1IJKA 1X7GA 1Z7BA 1BS9A 1R8YA 1DC5A 2J7KA 5EP2A 4QT4A 4E5SA 2QE7D 2X2FA 3DE2X 3S0JA 4UBIA 4AD8A 3GLSA 1YDMA 1A71A 5CHYA 4LFCB 5K8UA 2B4QA 2IXGA 2D59A 2GN6A 1QO9A 4P08A 1B16A 3ETCA 3FMFA 2QX4A 1GN8A 1JR3E 5ED0A 4XR4A 3SQOA 3ZWDA 2BSQA 4WJZA 1M6HA 4MTCA 5LD2C 5FPYA 3QW4B 2FRDA 4N5MA 1L4YA 2J3LA 2WIGA 1WTAA 3G9XA 4PW0A 4R1NA 5IWAB 1ZCBA 3N74A 2X7JA 3Q3IA 4GBED 3OQHA 4J75A 4LJYA 5HCNA 1QVWA 4PGMA 3LFUA 2BMDA 1UK6A 3D59A 2Q3FA 3RLFA 3BWEA 3LNCA 3QEBZ 2NSJA 5IM5A 3ZBQA 3HS3A 2R4QA 5HVNA 5K0ZA 1NBMD 5JVDB 3IT0A 3G2JA 4ITRC 4K87A 4IUYA 2B0CA 5KS2A 2HQSA 4TYWA 1FXWA 4ZT7A 5C5DA 1N2SA 1IHUA 2SICE 3E0QA 4N47A 3ZX5A 4ML3A 4KLZA 3I9JA 4L4UA 1E61A 1L5KA 2WINI 9LDTA 4FGWA 3NAMA 2OVBA 3GJ6A 3ZIUA 2C88A 2G82A 1K7XB 1ZI6A 1EEHA 4RZ3A 4GP6A 3EQ8A 3G2HA 3R7FA 4EGFA 5JFGA 5LM3A 2LCFA 3AKZA 1JIJA 4BE7B 3EHEA 2ADFA 2XW6A 3ND5A 3NBYC 4I46A 4M9SA 4QSHA 4F9FA 2IW3A 5MFPA 1NBIA 1T8SA 1FL9A 4UNRA 2P7IA 1QYCA 3P0FA 3K0FA 2UUBB 3H3JA 5THKA 3A58B 4YXWA 1EFVA 4OSOA 5B4TA 1IPFA 1XTJA 1M1NB 4TROA 1XX6A 4MQBA 5IK2D 4JYZA 4K1LA 1QAMA 1FMCA 2J46A 5EE1A 1OB5A 1W25A 3HKCB 4QYSA 1EK1A 2OYCA 5J5CA 4MYDA 3TD6A 4CT5A 4CEJB 1EHCA 3ENNA 5TF0A 1VSQA 3VHLB 5HCIA 4AKEA 4ETMA 2O50A 2REBA 5D6NA 5BSUA 3RS5A 4H77A 4GEKA 2ZVQX 3JU3A 5KREA 3LDGA 1ORDA 3F78A 1B6TA 3H8WA 2BHRA 1OW3B 2VZ0A 1L6IA 1SK9A 1T8RA 2ZBQA 1G7CA 2WSYB 1N2CE 3NUQA 2EWWA 2XIQA 3E23A 4YCAA 2PV7A 3KJQA 3ZV5A 1XV5A 1VBFA 3D6MA 5DOZA 5BN5B 5A3JA 1O87A 2RG7A 3ENQA 2VH1A 4DCNA 1Z83A 1SZCA 3V4OA 5EUMA 2Z2IA 4S1WA 4Y2GA 5TQ2B 4HAVA 3IQFA 4KQFA 5DNWA 3SIRA 5JZSA 3TSAA 1IHPA 1RYHA 2G9ZA 1KMIY 3LMKA 2QDXA 3LX8A 2VUHB 2YWXA 3HN2A 2AW5A 3NC1C 4KFRA 4V0RA 7YASA 5HKKA 4NYJR 1UDCA 2BCGY 1Y7PA 4OQNA 4DC1A 1L8AA 3TSOA 5HZKA 3PUKA 5EXXA 2PUJA 2ZJYA 1S2NA 2EKZA 1M2VB 3KTOA 4KAFA 3HU1A 4UKDA 4ZAWA 1D2MA 3ICWA 2PM8A 1YUMA 1Q1EA 4X62B 1CV2A 4I5DA 2XXJA 3L8CA 1ZGAA 3MVEA 4LUCA 4X20B 4MEJA 4V02A 1CY8A 1HLGA 4Y7DA 4RGBA 3TLXA 1BDBA 1E8DA 1K8QA 1M9NA 3AHJA 1KZHA 3VM6A 5FB3A 3RJ5A 2OM2A 1ARZA 1IVNA 1E2GA 1VKRA 2RGUA 3O2JA 4DMMA 4FHEA 3BB1A 2FVYA 1GNRA 4MGZR 4MKXA 4HH3C 2WU0A 3SC2B 4M7OA 4OATA 2NG1A 2O20A 1O4WA 2O52A 3IVRA 2BUCA 3JYPA 1XOIA 4M7RA 4YNBA 3KWLA 4WESB 5AI0A 3SJZA 1L8LA 2XB8A 3KLOA 4HLUA 1X1RA 2VWPA 5KX5B 1EUCB 3HFGA 1I9GA 4OHWA 4Q3AA 2OHJA 3A32A 2JVIA 2VEDA 4M8IA 5DI3A 3STHA 1I32A 3QXJA 1P9OA 1NDUA 3P4YA 3E3AA 1MO2A 4QOSA 1EI9A 1OR8A 1PIWA 3OJLA 1R4AA 3UUFA 3HKDB 2QMEA 3VKUA 2I2FA 2IYQA 3LRXA 3SYTA 5TDHA 3LBAA 3K1AB 3BG5A 4Q1FA 4UXIA 2XOKD 1Z82A 3LT1A 1PJ3A 1JDBC 4YUZA 3Q9SA 4G0YA 1SCUB 2K4MA 1P7ZA 1NLFA 3B78A 3I30X 4A27A 5CEFA 5GVSA 4EKGA 1CJCA 3OP1A 4QG7A 2C3YA 1N6OA 1RSZA 2YXEA 3AGPA 4TZTA 4HG2A 1J6UA 3K35A 3TR5A 2BJWA 1A4IA 3CURA 4F8EA 2B9EA 3FTPA 2JAOA 2GB4A 2HF2A 3KJFA 4CW7A 2IUUA 3RYFA 4I8IA 4EH1A 3VH3A 4IXMA 5CDFE 3D4IA 3HWSA 4NEHB 3R41A 3UGTA 4DIMA 2MDTA 2X1HA 2FYTA 2ZKIA 3DAYA 4QTXA 5TT1A 1SXQA 3QWHA 1R6XA 1BE6A 3CNBA 2XI4A 1VCHA 3DMTC 3GW8A 4I50A 3URMA 1YA4A 1T6XA 2X23A 5TMEA 1ZD3A 1WO8A 2XECA 2ZGVA 1UJNA 3L07A 4TRJA 1KO7A 2QP4A 2OBLA 3DT6A 1QANA 4EGAA 1K7YA 2ZQ5A 3LCRA 2JGMA 1PFUA 5EJFA 2FU5C 1QFSA 3BGIA 4P31A 2JGAA 4DREA 1H3NA 1I8TA 2A8YA 3N75A 3TR6A 4NCAA 5E4JA 3F3KA 3LUGA 2DKNA 3LCUA 5CJ2A 5IC5A 1O5OA 3W04A 2J0EA 4K88A 3IUEA 3MRTA 4Q3CA 4L3OA 5KTTA 1O5IA 4PSAA 3GWGA 1N5LA 3P4XA 1E5VA 4HD8A 5JJKA 3PBKA 4DV6B 4HXEB 1RLTA 3HGTA 3LK7A 2Q2OA 1YB1A 3NRJA 4WINA 3PGVA 4PNEA 3JYOA 2NU7A 3OLQA