1KVUA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Mechanistic roles of tyrosine 149 and serine 124 in UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 129
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kvuA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kvuA01
1WDKA 5TLSA 3VC7A 1EBUA 4ND5A 3WFIA 3EYWA 5DT9A 2B4RO 2Y1OA 3NV9A 3INRA 3PYXA 5DCWA 1H6AA 3G1TA 2GD1O 3DWFA 4IY1A 5I8WA 2R00A 5DN9A 5B37A 5JAZA 3E1KA 4BKRA 3AI3A 3C3XA 1B15A 2VHXA 4JP2A 3PJFA 5A4DA 2G0TA 3NT5A 6LDHA 3R0IA 3AY6A 4CMGA 3DEYX 3IP1A 3L4BC 4CQMB 5JY6A 5K0ZA 2O3SA 1Q7CA 4YT4A 2CFCA 3G1UA 4CM5A 4M87A 3ZU4A 5I8ZA 4R9SA 2YV1A 1MXFA 4ALIA 1EVIA 1GPJA 3F1LA 2DBRA 1PQWA 3RUDA 1GEGA 2C7GA 3VKVA 3ZNOA 3U4DA 2HRBA 3JYQA 5A3JA 3LSYA 1IHXA 1R0KA 3CE6A 5MGBA 2NNLD 1U8XX 5F5LA 4ZHSA 3FD8A 1SEVA 3SEFA 1NFRA 5EQFA 4CR6A 2OL4A 4CV1A 2WEKA 4TMFA 3S2FA 3HDQA 4B8WA 2AA3A 4CM6A 1I2CA 3MTGA 2J5RA 3NTRA 3OJEA 1LEHA 2G17A 1FF9A 3N7UA 3IKVA 4FJ1A 4R3NA 3A14A 4WOJA 4B4VA 4BKPA 4J7XA 1NWCA 4O63O 3KSDO 1P1IA 1X7GA 2AG8A 4ZQBA 5DULA 1MGOA 3QW2A 3RKRA 1X1EA 5KJ6A 1AHHA 3CSDA 3O4RA 3JQ7B 4J7UA 3SXPA 1P0CA 4EW6A 3OMLA 1XA0A 2AE1A 1BXGB 1PS8A 4E0BA 1XLTA 3OETA 5FI5A 5G0TA 1VJ0A 3PFWO 4DTIA 3GUCA 8ADHA 3V1UA 1PJBA 3SC4A 1YGYA 3GEMA 1E1MA 3PQFA 5CPBA 1WDMA 4ID9A 4XX0A 4G65A 2FWMX 4ILKA 4QT0A 4OKNA 4EI2A 4W99A 5ITWA 2FZWA 3CEAA 3GFGA 5L4SA 3AFNA 2DBZA 4QXMA 1SEPA 1YQXA 4QUKA 3EK2A 4R16A 2DTXA 4AJKA 3VZSA 1XU7A 2AQHA 4F6LA 2WYWA 5AVOA 4UUNA 1XEAA 4YAGA 1XQ1A 1U4SA 2YFQA 5ENDA 1DIRA 4FW8A 2W8ZA 1P9LA 5BR7A 2OBYA 2JD2A 4XJTA 1G0NA 1T1RA 2CZCA 4PIVA 2VHYA 5KKAA 2UYYA 4HY3A 2VRCD 5KVVA 1V3UA 4MP8A 3EVNA 2VHWA 1JWBB 4CLHA 1DBVO 3RFTA 2X0IA 1RM3A 5T8KC 2X58A 2C2YA 4EUEA 3H5AA 3ABIA 3K31A 1YJQA 3W4JA 1KYQA 4YJFB 5DOZA 1HDYA 3TWOA 2Y68A 5EIOA 4YXFA 2O3UA 4NNJA 2NU8A 3MJSA 4CMKA 2DPGA 2PGDA 3JD1A 3CUKA 2GN8A 3MZ0A 4DQXA 4OSPA 5H81A 3HDHA 1E1LA 2RCYA 5F5NA 1EK5A 4YWJA 1R0SA 3WGQA 5COQA 4O59O 1PJLA 2VYVA 1C3VA 2Y0EA 1FDVA 4MVJM 2Q2QA 2CMDA 2H63A 3PHHA 1LSJA 3F1KA 3CTMA 1DHRA 1JLLA 2ILTA 4K6FA 4B4OA 1XCBA 3EZLA 4XB1A 2QX7A 3RWBA 3V1YA 1AXEA 3DBLA 2J3IA 3ITKA 3KSZO 3PP8A 3DBRA 3NDRA 1M66A 1NASA 1SMKA 3DZGA 3E48A 1BXKA 3C1AA 2Q50A 4GX0A 1Q0HA 4IQ8A 2EV9A 4R41A 5F21A 1Q2XA 2PGJA 4A7PA 3HADA 5TSDA 2IZZA 3HHPA 3JYLA 1ZW1A 4B8ZA 2ZJ0A 3VPSA 1FMCA 2AQKA 2JL1A 2WDZA 2P9GA 4Y98A 1WDLA 3HN2A 2Q49A 2Q46A 3L6EA 3E03A 3ZH2A 1ZSYA 3S55A 1B2LA 4QECA 4TQGA 5H82A 4GGPA 4NDNE 4RDIA 1Z6ZA 2VWQA 3ZV6A 1RYEA 3GEGA 1LRJA 2IZ0A 4P38A 4Z6KA 3FN4A 1B0AA 2WYUA 5B4VA 3NT2A 4W9NC 4HKTA 3JQGA 3MOGA 2VOJA 3KYBA 4MVJP 4KTTE 1IYZA 4R51A 5JO9A 3DZKA 5DOVA 4DMMA 2Y67A 1ZUD1 3O03A 2JCVA 2PGLA 3GC6A 3V1TC 1UZNA 5MDHA 1LQUA 3IQDB 4KUGA 4PG4A 1FDWA 2OHXA 2VUSA 4JK3A 5JAQA 1LXCA 4U0KA 1PGJA 1IL0A 1GAEO 1ULSA 4HV4A 2QYSA 3KUXA 1DFIA 4J7CA 2ZB8A 4JJIA 4PLPA 2TMGA 5JAMA 2P91A 3BTOA 3DDNA 5CAEA 3W8EA 1AE1A 1N9GA 1T2AA 3LLVA 2AQ8A 4XWYA 1LNQA 5JLAA 4BS9A 3QP9A 1S7CA 3UN1A 1E5QA 1KERA 2BELA 2HJRA 2BRUA 3VH3A 5F1KA 4E21A 1NFFA 1NHGA 4J16A 3INGA 1U28A 3WGZA 3N58A 4GGOA 4XQ9A 4NJOA 1YS4A 4GMFA 1C1DB 4E5KA 3JCZA 3K9QO 1X0VA 1I3MA 3QWBA 4OAQA 1GUYA 1LUAA 1DPGA 4CR7A 3LYLA 3RBVA 4WLOA 4R3WA 4X54A 3TFQA 4YAJA 3LK7A 3PHIA 3H65A 4D46A 1GEEA 3TJRA 3ZWBA 4I5DA 4EYEA 3IP3A 3U3XA 5L95A 2VCYA 3C1TA 4BMNA 1E7MA 4I5EA 4DLBA 1NM5A 3M6IA 1TB4A 2HLPA 2B37A 4ZRNA 5T64A 2JKVA 4YRBA 3U49A 4AJEA 2D0IA 4GSLA 1UXJA 4J0EA 4FS3A 3NDJA 1YKFA 1P1RA 2HDHA 2A94A 2QZ9A 4IS3A 3ROQA 2A4KA 2C29D 3JD4A 1GZ6A 2G82A 3K8ZA 3ZU2A 4E33A 4PLTA 2NADA 2GO1A 4XIJA 5I7EA 2HUNA 3OQBA 4IMPA 3TNLA 3DB2A 1VE9A 1X15A 2CY0A 3FNFA 3LT2A 3GUYA 2OP0A 3D1LA 3ZHYA 3RU9A 1V9LA 3DC2A 3AM4A 3ON5A 2O7QA 1E7QA 2WE7A 4FBGA 2XPCA 1A27A 3WTBA 1QXSA 3ZWXA 1DDOA 1ENZA 1L7EA 4YJDA 4GSKA 1DIAA 2Y1FA 1LRKA 1ONPA 1TXGA 1ZXLA 3OEYA 3AI2A 4PLVA 3U4CA 3ONFA 1I3LA 3AFMA 1RWBA 1PQPA 3QSGA 1HT0A 2OP1A 3E18A 2EW8A 1IE3A 3RUEA 4BNIA 4R5MA 1GDHA 1WXDA 1I33A 2YV2A 3WGOA 3ONDA 2Y0DA 3P2OA 1LSSA 3C24A 4RPGA 3DQPA 5AXDA 2BGKA 3S2GA 3GGGA 4CUZA 5ITVA 5AOVA 3W1VA 3GY0A 2HRZA 2FRDA 3PTZA 1XR3A 3PGXA 3QVSA 4IM7A 4RL6A 4D43A 2I6TA 1I24A 1BVUA 1PEDA 3L77A 4B79A 4O0LA 2NVBA 2X8LA 2OBNA 2VUTA 4IIVA 5BSEA 4E2XA 4B4WA 2PFGA 3INTA 4MPDA 4TRNA 3GDFA 2DPHA 4A5OA 3ZWCA 1JWAB 3DBHA 4S3MA 1PS9A 2ZB4A 3DHEA 4B7UA 1YE3A 1E6EA 3GRPA 2E4AA 4CMIB 4DRYA 2X1HA 5A3VA 4E12A 3GZNA 4D3DA 4ZJUA 4GWGA 4WCDA 3ZWWA 1D1TA 1KVUA 4IDBA 4J91A 4D79A 2X4GA 1X7HA 3LT0A 1DJQA 2BH9A 3NJ4A 1PL8A 5DCYA 2D2IA 4DVJA 3TQHA 1E1KA 4BGIA 1MFPA 1ISHA 4C7JA 4J90A 1ISGA 4FFPA 4WEOA 3X2FA 4I8XA 1I3NA 4TVOA 1GQQA 4AJ1A 5LDGA 5CFZA 1V0JA 4A2CA 4PCVA 3GH3A 3GAZA 1CETA 2AEJA 3BMNB 1NP3A 2JD0A 3I5MA 4FPXA 5G0WA 3EC7A 1G6KA 1ARZA 1DLIA 2IE0A 1A4UA 3WSVA 1KEPA 1TVEA 1HDOA 4D42A 3NGLA 2GN9A 2G5CA 3LT1A 3AU9A 1XELA 5HTOA 4TKMA 4NU5A 3Q0EA 1NQTA 1J49A 1GZ3A 1QKIA 1YB1A 2PH5A 4R68A 3ROKA 8LDHA 3IOYA 4R1TA 2GN4A 4XR9A 1F8FA 1VRWA 2I67A 2DUWA 3UFXA 2HKIA 1UJMA 4OQZA 4DXHA 3WG9A 2Q1SA 4JX8A 1L7DA 3AW9A 4RPLA 2P68A 1UP6A 2IODA 3DFUA 1YB4A 2D8AA 5EQDA 4CM8A 4DGSA 5JAIA 3I6IA 3RC9A 1E3SA 4KDFA 4MINA 1FDTA 3GQVA 3JQFA 3MCVA 2YHIA 3OJOA 3WNVA 4PG6A 3PIIA 1UAYA 3WLFA 3JYNA 1ISFA 4MP3A 4PLCA 1Z74A 5CDTA 3GPIA 3LT4A 4CLDA 2EJVA 1Y9AA 1ENOA 1Z75A 3UAGA 2EWMA 4MP6A 3JQ9C 3VPXA 2E49A 4BKUA 3VOSA 3VPGA 3RD5A 1R37A 3W6ZA 4D7AA 3JQEA 1WZIA 3KM0A 1MUUA 4IJKA 2YHUA 4YA6A 2W98A 4WCFA 3U5TA 4HFMA 3OQ1A 3BAZA 3JYPA 2VRCA 4BNGA 1E3IA 1J6UA 1RM5A 2FR8A 1VLLA 3EUWA 1IPFA 1DC4A 1EE2A 2NU6A 4L74A 3SC6A 5KWEA 3FF4A 1EMDA 5A5EA 3W6UA 4UULA 1UDAA 3AWDA 3QRWA 1UZLA 1YBMA 3HN7A 1UUFA 2OORA 4J49A 4WK6A 2EKQA 3EHEA 2WM3A 4L9RA 4I9NA 2JHFA 4QO7A 4ALKA 5CDGA 2QRJA 2NU7A 3GA0A 1U3VA 1B8VA 5LCXA 2ZATA 1E0DA 1GQYA 4BO9A 4KUHA 2OXIA 3KETA 1U3TA 3RC1A 1CQJA 1Q0QA 2VTDA 2OOSA 2GR9A 1P1JA 3I23A 4DLLA 3NKLA 1UXKA 4HWKA 4MVJE 5JDIA 2PY6A 1E7SA 3QVXA 5LDHA 5CEEA 3JQBC 3AOEC 3MJTA 2PKQP 3WBBA 5CG1A 1MC4A 1BG6A 1Z7EA 4NK4A 2BI7A 3D3WB 4NJMB 4HUJA 4DPKA 4BNZA 1NQAO 2VUUA 1DC5A 1ZK4A 4EGFA 4M54A 1M2WA 3OICA 2EW2A 3WJ7A 3D3EA 4J4BA 2HMUA 3TFOA 3SLGA 2Y1DA 3BTVA 2FPIA 5A03A 4ESOA 3KHUA 2ZJ1A 3G17A 3VVCA 1CRWG 5KTKA 4UEKA 5DDIP 4BMVA 5ICMA 1IB6A 4BNVA 2ZYAA 3GNQA 3PK0A 3RI3A 4W82A 3RQSA 2Z1NA 2DU8A 2W2LA 4JQCA 4KQXA 4CLEA 1LTHR 3KRTA 4RLSA 4PLZA 4Z9XA 4YQZA 4F3YA 1R4NB 1E6UA 1NPDA 2BMAA 4IJUA 3K2BA 1YRLA 1JKFA 1WPQA 4OL9A 4EBFA 3LZ6A 1KIFA 4DIBA 4AL4A 1H5QA 4B3JA 2QG4A 3IUPA 5TNXA 5KJCA 2RH8A 4LCEA 3OM9A 3KEOA 3P7MA 4P8RA 4PLYA 4AVYA 4LMRA 2NWQA 2GF2A 4PZDA 1BDMA 4YDRA 3NDIA 2ET6A 1B16A 1LDMA 1S6YA 4PFJA 4CQMD 1DAPA 3X2EA 3WNQA 3GVXA 2Q3EA 4BNLA 1F06A 4YJGA 4RQUA 4RCVA 4DBZA 4HFJA 2NVUA 4XIYA 3UCFA 4OOEA 4K1LA 2DC1A 4IJWA 4IZIA 4BNNA 4FFRA 3I9NA 4E5YA 2AEMA 4IDGA 3ZWYA 4R1SA 1P33A 1PJQA 3I52A 4YYZA 3I9LA 1T2FA 4HFNA 4TRJA 5A9TA 4ONEA 2W90A 5KVSA 1XG5A 1O0SA 3A9WA 5JYDA 1BXZA 1NR7A 4TKLA 1UXHA 4RZIA 5CHEA 4YJHB 2FPGA 2I9PA 3H6KA 2IXAA 3AUAA 4BNHA 3O9ZA 4GI2A 3O38A 1HDRA 2PKQO 4O5OA 2Q1TA 3L6DA 1QP8A 4BKQA 3T4XA 4NBVA 4BB6A 1PTJA 5A5FA 1LI4A 1ZEMA 1QLHA 3BHMA 5AYVA 3NTQA 3WB9A 3RUCA 2O3TA 3LVFO 4PLFA 2BFOA 4MIYA 3QA9A 3FR8A 4XGIA 2C2XA 1A7AA 4H7PA 5G4KA 4O6VA 1LDGA 5FYDA 4EITA 4R1NA 1O8CA 4WASA 4BO7A 3V2GA 5C5IA 3JQAB 4E30A 3G0OA 1ZIDA 1PJ2A 3IJRA 3KO8A 4CMAA 4PRKA 2AEFA 1NHWA 1DHTA 3JQ8B 4GL4A 4ND3A 3ROPA 3R6DA 2X5KO 4YB8A 2J3KA 3IMFA 1UP7A 4RF5A 4EEXA 4HX5A 3GT0A 4CMCA 2ZTLA 2P4HX 1UR5A 3WYCA 5T67A 2IZ1A 2WYVA 2EGGA 2VYNA 4LVCA 3I9JA 3KB6A 2P4QA 3T7EA 1VL0A 3WQQA 2WTBA 4AFNA 4A03A 1UZMA 5JC1A 5A04A 3BTSA 1LSUA 3MWDB 1LDBA 3IIEA 3WQSB 3Q2IA 1MV8A 4WE3A 4F45A 4FC7A 4HFRA 2GGSA 1NFQA 5BQFA 5JW6A 2WD7A 4B7CA 1X14A 2FR1A 3BTUA 4C4OA 3MJVA 3HB4X 1TT5B 4RO0A 3DHNA 4FD3A 1BHSA 4YVFA 4AJLA 1HDXA 1T4BA 2YZ7A 4R54A 1Y5RA 1HSOA 3RKUA 3COSA 5JE8A 1DRVA 1QR6A 2FZEA 3BMQA 2YDXA 2CDAA 1HETA 1T25A 3UKOA 1BGVA 1JDJA 4LRTB 3RFXA 3U9LA 5AQ1A 1WZEA 1X13A 2O3RA 3D4OA 4E4YA 2D5CA 1PJCA 1Q0LA 2H5LA 3OBBA 4CMHA 4PLWA 1O5IA 1WMBA 3WGTA 1EBFA 3QWHA 3DAGA 1OZAA 2W2KA 4BIIA 4K26A 3LDHA 1ZFNA 3D7LA 3PWSA 4UVHA 1LLQA 3FR7A 1MG5A 5U4QA 1GTMA 3RUIA 3O26A 5JC8A 1BW9A 3RBXA 3A4VA 1DIBA 3UOGA 3W4KA 4Y8VA 3M1AA 1NBOA 2YV3A 4WLNA 3H3JA 5B12A 3GVPA 4PG5A 4I9HA 1QYVA 1ZKMA 4EEZA 3GGOA 3OH8A 2R00C 4BNWA 3DOCA 2VWHA 3K30A 2J8ZA 1RYDA 1Y9EA 5DP2A 2HU2A 2YY7A 1JKIA 3SX2A 1NXQA 7MDHA 1T4DA 3AUTA 5ES3A 3I3OA 4P22A 4GBJA 4CV2A 3ZHXA 4BGEA 2PZKA 1PZGA 1U1IA 1PZHA 4L0QA 1XIVA 1Y8RA 5AXBA 1PJ3A 1PGQA 4W7IA 4WLVA 2FP4A 3A28A 2JD1A 3AUUA 1YVEI 2VT3A 4TVBA 5IXYA 3WXBA 4W7HA 2X0JA 3EDMA 1E3WA 4XJSA 4E13A 3U62A 4MVJD 4GX2A 2ZIZA 3DZFA 4MKRA 4JLWA 3LQFA 3RSHA 4U0JA 5BSGA 1ZK1A 4OIMA 1ADFA 1GCOA 2IYPA 1UH5A 1Z82A 3ADPA 5CDYA 1EDOA 5TS3A 4EDFA 3E5RA 1EE9A 1NPYA 4BGUA 1B3BA 3PIDA 4A26A 4FR5A 3KXDA 1U7TA 4LCJA 2JHGA 4H3VA 1YH3A 3D3WA 2HK8A 2G76A 4JBHA 4M8SA 1XWFA 4MIEA 1D8AA 1C0LA 1Q7GA 2NTJA 4FOOA 3UH1A 1U5CA 3WYEA 1I5RA 1XYGA 2ZQZA 3ADOA 4D0RA 3G3EA 1I3KA 2X9VA 1I0ZA 3OIDA 4CM4B 4NQZA 4CV0A 4MIOA 3CH6A 1Y6JA 2LDXA 2I76A 2V6FA 4NBUA 3Q2KA 3FI9A 2E82A 1KVQA 3KYDB 4YT5A 3TOZA 5C7IO 3O8QB 3BMCA 1H94A 1A9ZA 5EN4A 1I30A 1JAYA 2E37A 1ZSNA 3HSKA 4PZEA 1LDYA 3BZUA 1LDNA 2ZCVA 1N8KA 3HWRA 4BVAA 5L51A 3H5RA 1R4NA 4YEDA 4BO4A 2HMTA 2JCYA 3ZWNA 2AQIA 3VH1A 4UVDA 2YJZA 1LLCA 4RLHA 3C8MA 5EINA 5T57A 4GLOA 2VZ0A 9LDTA 1C1XB 2EKLA 4R69A 2WWRA 3PQEA 4R4JA 4A0SA 4BQRA 4FFOA 2W2LD 3WIEA 1VC2A 4BO5A 1PJ4A 5KOIA 1GPDG 2A9FA 3FTNA 2QZZA 1EQ2A 1Y8QB 5JFOA 1CEQA 4KOAA 3GRKA 5A9SA 4J9VA 2IDZA 5TT1A 4CM3A 1CYDA 3ASUA 4K9DA 5B4TA 2QRKA 1DIHA 5EMHA 3IS3A 4HADA 1YJ8A 4EJ6A 2PZJA 2X9NA 1V6AA 1AUPA 4G81A 4Q3AA 1LLUA 3JD3A 3T7CA 2GLXA 4M86A 4BO2A 2VHZA 3FPLA 4LSMA 2ZKLA 2QYTA 3QVTA 4ZVVA 4RF4A 2GASA 2EHDA 1HDGO 1QORA 1R0LA 4AJ4A 1PJTA 4WKGA 5C37A 4BNFA 1VL8A 4U6SA 3IJPA 5T5QA 4YTEA 4ND1A 1ADGA 4WUVA 1CERA 1KY4A 1WP4A 4BO3A 3GG9A 4N7RA 5L3ZA 3WMXA 4CQLB 1LU9A 2O2YA 1YQDA 2Q1WA 5JDCA 3GHYA 4BHTA 4IUYA 1MLDA 2O3QA 3P2YA 4XQCA 1GYPA 1H9BA 3C85A 1O6ZA 2C59A 4XYEA 2DAPA 4II2A 3CMMA 2HO5A 5F1PA 5IXSA 4FIZA 3PJGA 3TDKA 3N74A 2Y99A 3GR6A 1K6XA 4PVCA 4XQEA 1JVSA 1QSGA 2H1SA 3ANMA 4S1VA 1Q7BA 3NTOA 3VAZA 3JD2A 1M6HA 1KEVA 1OFGA 2BI8A 1N7GA 2JCXA 5THQA 4ZGWA 1PGPA 4LK3A 3V5NA 1MG0A 3ZW9A 1VJTA 4DQUA 3F6YA 4I5FA 1GZ4A 5JMPA 4WNCA 2QRLA 3ZNPA 3WJAA 1ZBQA 1ZJZA 3PLNA 1O89A 5AXAA 3FRJA 1EFLA 4XYMA 4Q3NA 4D45A 1YWGO 3PLRA 4XYGA 4OSOA 4CQMA 3QV1A 2QW8A 2ZB3A 1P77A 3DFZA 1A71A 2H9IA 4JIGA 2NSDA 4J1QA 4CLXA 2VWGA 3WDSA 3H7AA 5KNLA 1YOVB 3IL2A 3C7DB 5TIIA 4WGGA 1TT5A 2PZLA 2VYND 4R1UA 4KWHA 2P5UA 3HE3A 4LVUA 3TOXA 1QYDA 4FDAA 1YXMA 1XU9A 1LJ8A 2PZMA 3TL2A 4CV3A 3I9KA 2B35A 3STHA 4DL9A 3B1FA 4Q3CA 1DRWA 4CM9D 3D4PA 1LBEA 1R66A 1MXHA 2RIRA 3CZMA 3JQCA 2PD3A 1C0PA 5F3RA 2PH3A 2I65A 2HCTA 2OO5A 5L9AA 4MDHA 4JGBA 4UVIA 4Q3BA 3WLEA 3MJEA 1ZO8A 3JQ7A 3PWZA 1D7OA 1BXGA 3WBFA 1ONNA 3V8BA 1KVSA 5JS6A 1HYEA 2Q1UA 4IXWA 3UW3A 4CUJA 4DIFA 3KYCB 1ENPA 1N1EA 2X5OA 2NLOA 1QRRA 4ND4A 1ISIA 1GUFA 1T2CA 2X9GA 3GVIA 4N5MA 2YQ4A 1ZMOA 3TZHA 2PD6A 3AU8A 3BMOB 3CZRA 6ADHA 1E7WA 3R1IA 3GVCA 4EUHA 2DVMA 1G0OA 3H5NA 1GQ2A 4KUEA 4IQ0A 3QWFA 3RUFA 1KBZA 4J9UE 5TGDA 2BD0A 3FNGA 5CEJA 3LF2A 3ZW8A 4MVJI 2NTNA 7ADHA 2ZK7A 1JQBA 3UUWA 4UVEA 5FEUA 4YPOA 2UVDA 3HUDA 3LC7O 1P74A 2AHRA 4FFNA 4Y67A 3V2HA 4B7XA 1H93A 4BO8A 3QHAA 4GMGA 1R15A 3I83A 3FSRA 1FK8A 2DKNA 3TF5A 1EVJA 2GZ3A 4IGFA 3WFJA 2CF5A 4BQPA 1GYRA 5IDYA 4EZBA 1WAMA 5K6AA 2YUTA 4OO3A 3K5PA 5HS6A 1LA2A 1C0KA 1X0XA 2RH4A 3OJ0A 1WLYA 5JCXA 1YL5A 4ALJA 3QVWA 3OHSX 5KVCA 3R3JA 3TZQA 2QQ5A 4YJFA 4INAA 5AXCA 2OUIA 3UICA 3Q9NA 1RM0A 3F9IA 2BFPA 4OXYA 1OC2A 5IN5A 5JBIA 5JY1A 1T24A 4WLFA 3WQRA 3NYWA 3F5QA 5G4LA 2BHLA 1HKUA 2IEBA 1VSUA 3CKYA 2P9CA 3ZWOA 1ZVMA 3E5MA 2HMSA 3GN1A 1ULUA 4Z0TA 3ORFA 4NHEA 4QTZA 4XQGA 4I5GA 1N92A 2PLAA 2H6EA 4M55A 1UXGA 3GNSA 4WLUA 3PJEA 4BL5A 4GX5A 1I32A 4GWKA 3KTDA 3KOUA 4EJMA 3D64A 1UAGA 3NJ8A 4Z0HO 5C7OO 3FNHA 1VPDA 5THKA 4CLOB 4D41A 3I4CA 1B3RA 2CVZA 1KC3A 4HXYA 4JCOA 5DBGA 5TF4A 1PIWA 2P5YA 3S8MA 3ENKA 1MC5A 4UUPA 1F14A 3U4HA 1PGOA 4ZN6A 1PSDA 1PX0A 1Z73A 4IMRA 2R6JA 5ER9A 2DT5A 5IZ4A 3ZNNA 1Y8QA 4QQRA 1KEUA 3AM3A 1EEHA 3P5SA 1ISJA 4FGSA 2FOIA 3RUAA 1CDOA 3LF1A 4L76A 4MVJA 3DMYA 3VHRA 1H6DA 3K73O 3ZCXA 5IAAA 1ISMA 4JN6B 3WGYA 2Q4EA 3LC1O 5JMWA 3OA2A 2FMUA 1QYWA 3H8VA 4ALNA 5DCUA 4ZQHA 3P19A 4E31A 3OQ6A 1A4IA 4IIUA 3I9MA 5DZSA 2YFHA 2GUGA 3GZ4A 3PXXA 1EQUA 2C0CA 1KS9A 4NH4A 1KETA 4R01A 1HE3A 2Y05A 4E2YA 4BNYA 2O7SA 4MVJG 1V8BA 3MWEB 1D4FA 5FWNA 3WR5A 1LSOA 4OOFA 4ZA2A 3DAPA 3ZV5A 4PGFA 2GZ1A 3H9EO 4MVJF 3DHYA 5GMOA 4Y9DA 2HQ1A 4TWRA 4XDYA 5IZCA 5FF9A 2NACA 1IZ9A 3FCOA 4IZHA 1K5HA 2I3AA 1ZEJA 3B1KA 2NVWA 2O3JA 1HLDA 5GY7A 1I36A 2R2GA 4K6CA 2QIOA 2GN6A 1HDCA 2AE2A 1LX6A 2FSVA 2Y1CA 1C1DA 3EMKA 2GYYA 1E5LA 1HDZA 1OOEA 3JQFC 4TRMA 1WVGA 3FTPA 1JN0A 2B83A 1HE2A 4U8GA 1Z7BA 2NTVA 2FN7A 4B3IA 5HS4A 4RPHA 4Z9YA 2XOXA 4IGEA 3RC7A 3SBOA 4U6QA 4AJNA 2A35A 3VTFA 1FJHA 2UUPA 1VM6A 1BSVA 2DBVO 2I5PO 2AG5A 4RF2A 3WYBA 1LDEA 4GH5A 4DPLA 2RBEA 3MJ4A 4YRDA 3LC2O 2OFPA 1J4AA 3F47A 4WCFC 3SLKA 2ZYDA 4DYVA 3JV7A 3R3SA 4Z0PA 4BNTA 2Z5LA 4OXKA 4JROA 4R5HA 4BKOA 1RM4A 5HWSA 3IC5A 1IY8A 1K89A 2AXQA 3QQPA 1W0CA 2DLDA 2VOEA 3B20A 3NAQA 3NEPX 1I8TA 4JNKA 4YAIA 2O4UX 5HM8A 3KV3O 4CMJA 1E6WA 4KP7A 4PRLA 3HDYA 3ZV3A 2DQ4A 3Q11A 3DBLB 3CPSA 2B0JA 1PS0A 3GAFA 5H83A 3DBRB 3PHJA 3OJLA 3PPIA 3TZCA 4YAEA 2B5WA 3EZYA 3F46A 3K92A 3RJ9A 3ST7A 4XB2A 2UUOA 5JDIC 5I9NA 1P1HA 1B8UA 4CL3A 4HNHA 3AM5A 3FWNA 2HJSA 2VZ8A 2CD9A 2V6BA 1F0YA 2CVOA 3TSCA 3OSUA 4FFLA 5TX7A 1J5PA 3DO5A 3T4EA 3ZNQA 1GYQA 3NT4A 4IQGA 3E6AA 4QFDA 1LQTA 3ZGYA 2Y1GA 4GVLA 1X1TA 2GSDA 4CM7A 4I9UA 3VDQA 3WMWA 3AJRA 3C7CB 5IN4A 4OQYA 1BRMA 4NK5A 3KLPX 4DLAA 1GV0A 2X23A 3DMTA 1V3TA 2WE8A 5KKCA 1SCUA 4RVFA 3U09A 2CDCA 1EVYA 2C7VA 3NGXA 1JW9B 4CMIA 2AMFA 5BSHA 1HF3A 1HE5A 3I9OA 1BDBA 3DONA 1RKXA 3HFGA 5L53A 4Y6PA 3OIGA 5L7WA 3ASVA 1ZK3A 3GVHA 4DC0A 5ILGA 5KCZA 4TZKA 5A02A 4JP3A 4XZ3A 5EESA 4DREA 3WSWA 1DLJA 1A7KA 1NPTO 3GOHA 4NPCA 3WIDA 1EUDA 1ADCA 4IJVA 5TJ9A 2GCGA 1N5DA 5BNIA 5C7LO 2F1KA 5C3MA 1GUZA 1V3VA 1BVRA 4MO2A 3BMNA 4AJOA 4F6CA 4BUCA 4RV9A 1XDWA 4CM9A 2JAPA 4J0FA 2SCUA 3E9NA 1XQ6A 3ZHBA 1E7YA 4GKVA 5JPIA 3RU7A 4URFA 1UP4A 5HRUA 4J4HA 2Y1EA 3KEQA 1I2ZA 3L4SO 4RVGA 3ZU3A 2X7HA 4Z9FA 3PDJA 4BO0A 1G1AA 3PEFA 3OFSA 4NU6A 3VH4A 2ZQYA 5JXWA 2PNFA 2PD4A 3K2EA 4UREA 5CG2A 4R9RA 1YQGA 3BHIA 1W73A 3L9XA 4TROA 1VL6A 1H2HA 1P1KA 2NM0A 3QJ5A 2C82A 5BSFA 2XXBA 5ER6A 3H2ZA 1PR9A 4K28A 5IDQA 4ZICA 1IHYA 4NZ9A 4OM8A 4XGKA 4BGVA 1YBAA 3Q9UA 1A72A 2EKPA 3KZVA 4CLOA 2UV8A 3DMTC 4GKBA 1T2DA 2YQ5A 1U4OA 1N7HA 1JA9A 2NUAA 5L7YA 4P4LA 3RVDA 5T8KA 5GZ3A 1K6JA 5ILOA 4QFCA 3CIFA 1SAYA 3VPFA 3H3FA 3QIVA 1ZH8A 1FDSA 1TT7A 1ZJYA 2O2SA 2DFDA 2X5JO 4L4RA 4PLHA 4PVDA 4CJXA 4CR8A 4UAGA 1HEUA 3H9UA 2IEDA 2CSUA 4IBOA 1XGKA 4KWIA 2JAHA 1QG6A 2YW9A 1H0KA 2BFMA 4LGVA 1VI2A 1E1NA 1P31A 5G0UA 4NFYA 5A1TA 2VTEA 1NWHA 4TRRA 4QSMA 2B5VA 3HZZA 2VT2A 4B3HA 2I3GA 3D5TA 4BNMA 4MKXA 1PL6A 1R12A 3AI1A 4RQTA 1F8GA 2XXJA 1SB9A 4ALLA 5IDWA 1IPEA 2Y93A 2HSDA 2D59A 3AY7A 4BNUA 3RCBA 4AJJA 5CDUA 3CXRA 3ZZNA 1M6WA 1DEHA 1RJWA 3VVBA 1HWYA 1W4ZA 3PWKA 3DBHB 1PL7A 4RDHA 1DFHA 1H9AA 5L40A 3W8FA 4UUOA 3OP4A 5G0VA 2EGHA 1SC6A 3BXXA 3GZNB 1HL3A 1PU2A 5I9LA 1GU7A 4PN3A 4DC1A 4PG7A 5IJZA 4BNKA 5G0SA 2P9EA 3MTJA 4GQAA 2BLLA 4RZHA 1GD1O 1PGNA 4NJMA 4OGWA 4PZCA 3ZWAA 3JQDA 2FPPA 4FFMA 4JBIA 4WNIA 3UVEA 2B4QA 4ZU3A 4WOKA 4E2ZA 5ICSA 5JSFA 4IS2A 1BMDA 4J3FA 2EP5A 2VNSA 5DNAA 4JXKA 2EG9A 2ZTVA 2JFFA 3DXFA 4CODB 4WECA 4W9NA 3Q3CA 1JU9A 1HXHA 2EJWA 2D1YA 4NMHA 4UEOA 4ND2A 4RVDA 1GL3A 1NVTA 3CMCO 5JCJD 3EW7A 1Q1NA 2RAFA 3PQDA 4Q39A 5FFFA 1DC3A 1FDUA 3VDRA 2F00A 1ZXBA 1HSZA 4YT2A 1OI7A 1GV1A 1Y5MA 3RBZA 3DZHA 2V7PA 3H9JA 3WICA 5CPFA 4M1QA 1HLPA 1SOWA 5COAA 4ZQGA 3V2UA 1LLDA 4FJ0A 1OAAA 5L7TA 1K3TA 3ETEA 1VSVA 3QY9A 4BV8A 1U9JA 5IFLA 1ZK2A 1HE4A 2G1UA 2ZTUA 2X0NA 1NYTA 1U2GA 3JQ6A 3GF4A 3JYOA 1GADO 4GVXA 5HA5A 1IZ0A 4G5HA 3PRJA 4HNGA 1MX3A 4DYDA 4XD2A 4MOWA 2J5QA 1TA4A 3ICCA 1ADBA 1PR3A 3WS7A 2EEZA 1D3AA 5G2OA 3GEDA 3OA0A 4LMPA 3H9GA 4NIMA 4J4TA 4NFSA 3UGKA 1R4MB 4CM8B 4P4GA 2NV6A 3H4VA 3FPCA 3F3SA 3OJFA 1B26A 1UDCA 2YHIB 2VN8A 3ENNA 4RVHA 5DBFA 2WMDA 4H16A 4E5PA 4PLGA 5TC4A 1P45A 5B4UA 1U8FO 5I7VA 4IXTA 3DTYA 3QVOA 1KOLA 3A06A 5BT9A 2E48A 2POQX 4J6FA 4TZTA 5A9RA 3LU1A 2GNAA 5GZ1A 3AK4A 5DF1A 3ZWMA 1E7RA 2J6IA 4NBRA 1LC0A 4JBGA 1GFSA 4FOSA 1DC6A 1PJSA 4YJHA 1QYCA 4DMLA 1VKNA 3OIFA 2NU9A 3KBOA 1EDZA 2DFVA 1M75A 3IDSA 4WCFB 4KQWA 4EUFA 2ZCUA 4XYLA 3RIHA 4NBWA 2EERA 3L0DA 3S2IA 1NVGA 1KVTA 1EVZA 1QV6A 2PKRA 3FHLA 3Q1LA 4LISA 4RPJA 1SPXA 2PA3A 1Y1PA 2AW5A 2FHSA 3QLJA 3HQ4O 3QWAA 2CNBA 3PZRA 3ZI0A 3ZV4A 3VZRA 2EXXA 4AJ2A 1P44A 5BNFA 1AGNA 1DJNA 4N5NA 3UCXA 2Z95A 4BNXA 4M89A 4UUMA 2GRAA 2O50A 4OMUA 3TRIA 1NR1A 2V65A 3JQAA 3VKUA 4FB5A 3C7AA 1VKOA 2V6MA 2GERA 1DXYA 5KVQA 1J0XO 1MFZA 2PV7A 3ETDA 4CLRB 3JQ8A 5J23A 4RF3A 3ICPA 1O95A 4P4NA 3RFVA 4FN4A 1YO6A 2Q2WA 2GPTA 4H15A 4Q9NA 5T6BA 4RJTA 3ETGA 3MJCA 1AN9A 4KMSA 1F17A 2FR0A 2I66A 3WGIA 3L6OO 3KSUA 3KVOA 4ZRMA 3DOOA 3ONEA 5KJ1A 3B1JA 2OMEA 4BMSA 5F1OA 3ANNA 3B6ZA 5L45A 3WGHA 4IDFA 2B36A 4QX6A 5ENVA 4DA9A 2J3HA 3UF0A 4L4XA 4J43A 3OF2A 4ROSA 1AXGA 4XCVA 1ML3A 3RAJA 4WEQA 1ID1A 2O48X 4GPD1 4I08A 1NQOA 3PI7A 4Z3DA 4I1IA 1DFGA 4CMEA 2JFHA 3I1JA 3PVZA 3PYLA 1HZZA 3C1OA 5DP1A 1BTOA 2Q45A 1XKQA 4Q3DA 4AJHA 1DOHA 2ZTMA 3AY3A 4L4SA 4C7KA 1Y81A 2VHVA 3FBGA 1H2BA 1JAXA 3GDOA 4FC6A 1NNUA 5JDCC 3TZKA 1SOVA 4UEJA 4ALMA 2Y0CA 1TLTA 4EJ0A 5KIAA 3S1LA 2C20A 2CF6A 2Z1MA 3DR3A 4E5MA 2CVQA 1E3JA 2J5KA 2NQTA 3VPHA 1YB5A 3PDUA 2P2SA 2PK3A 4JJGA 3RASA 2HMWA 4YJGB 1MB4A 4YBZA 2NVUB 5TJHA 3H2SA 4NG5A 4GAEA 4DWVA 1EUCA 2VNAA 1P0FA 2FSSA 2Q99A 2NQ8A 4FGWA 3RJ5A 2HAEA 4E6PA 1A9YA 3M1LA 3TPCA 1YL6A 1ONOA 3DTTA 5CDSA 1PZEA 1JTVA 1ZSVA 1K2WA 3OECA 3PZBA 1QMGA 1JVBA 4CL8A 3W4IA 1HYGA 1ENYA 3CINA 3DAFA 5KJFA 1ORRA 4J1NA 4N18A 4AICA 3G79A 4RVSA 3IUSA 4KTVE 3JD0A 4CM1A 4J1TA 3E9QA 4RPKA 1YONA 4D44A 1YBVA 3HJAA 2DTDA 1W6UA 3WGGA 1M67A 3TN7A 3D4NA 1YDWA 3H9QA 4CMEC 5JO0A 1HRDA 5G4KB 3FBTA 2GZ2A 2DTEA 2VZ9A 4PG8A 4NBTA 4QO8A 1CJCA 1NQ5A 1N2SA 2Q4BA 3GG2A 2X86A 2YDYA 2IYOA 1TI7A 4J2HA 3GFBA 1UDBA 4NI5A 4F46A 4G2NA 1W8DA 5GZ6A 2V6GA 4BNJA 3JQ9A 2XF8A 2BGLA 4M49A 1R6DA 3BA1A 3W8DA 4QEDA 1K6IA 4D0SA 4A73A 4YAKA 1DIGA 1P1FA 3TZ6A 1LC3A 1C14A 1YL7A 1F12A 4MJLA 1PZFA 4LW8A 1FXSA 1U5AA 2A92A 3AUSA 3L9WA 4XRRA 1M76A 1WWKA 1U3WA 2RHRA 3QWIA 2C5EA 4OKIA 2UDPA 4XEHA 5K9ZA 1K0UA 5ADHA 2CUKA 2Y66A 4AG3A 4CM4A 3RC2A 5BNTA 2I99A 1C0IA 3M2PA 2HK7A 4DUPA 5JNLA 3F4BA 1XHLA 5U1PA 3KYDA 3O8QA 1IOLA 2X0RA 2EF1A 2VRBA 2X6TA 3GPDG 3ITDA 2WJPA 3EGOA 5DBIA 2FY8A 5TRTA 4DBVO 1YDEA 2WD7B 2X22A 3RUHA 5IF3A 1EFKA 4W4TA 4XKJA 1UXIA 2J3JA 4TSKA 3OEWA 3ZHZA 4YACA 2E6UX 3PHLA 1CIVA 1ZNQO 2YYYA 3BMQB 5CP8A 2EP7A 1VJ1A 4LSWA 4LN1A 1DRUA 3JQBA 2PR2A 3AOEA 2DUUA 3M2TA 1C1XA 3DL2A 1TEHA 1WNTA 3G49A 1E3EA 3GLQA 4NFHA 4OXNA 4JJFA 2D3TA 3DZIA 3KLMX 2W2KB 3S2EA 1NAIA 3FNEA 4KDEA 4A27A 3SJUA 5A06A 5FI3A 2BFAA 1R4MA 3UXYA 1BW9B 4IINA 3E8XA 5K6AC 1O9BA 5L4NA 1I2BA 2VYVD 3I4FA 2PTGA 2PWZA 3Q6IA 4HP8A 4GLLA 3U4IA 1B7GO 3A1NA 4B4UA 5COBA 5A05A 4IPTA 1V35A 3PFFA 3VH2A 3FWZA 1KVRA 1T2EA 1P3DA 1NX6A 3GN2A 2GDZA 3WWZA 3E9MA 3LLSA 5TT0A 4BB5A 2RHCA 1QYXA 4XRGA 2DBQA 1L1FA 3GMDA 4CQLA 1OBFO 3D5QA 4YRAA 1OMOA 4OJNA 1XSEA 4YCAA 1Y8RB 4NR0A 5LC1A 4RORA 1U2DA 4N54A 4DIOA 1H6CA 2W4QA 4RGBA 1GCUA 1WMAA 4MVJH 1HZJA 3BIOA 1SB8A 2BGMA 2TMDA 5JCJA 3WX0A 2ZB7A 1E77A 2HK9A 3EAGA 5KJEA 5TQVA 3GMSA 1E3WB 3ZWPA 3WWYA 3QE3A 3UHAA 2QHXA 5EJ2A 3UCEA 3PHGA 4Q3EA 3MEQA 3K96A 2B4TO 3JTMA 1QLJA 3PGJA 1EZ4A 1SO8A 1U7HA 4CLRA 3JSAA 3GHHA 4E3ZA 1Z45A 1KY5A 3WTCA 1DAOA 1AHIA 1PWXA 2IXBA 4OYRA 3NRCA 4IDDA 5L4LA 3ZU5A 3I6QA 5B1YA 4HBGA 3SJ7A 3DZBA 5CEFA 3IKTA 3EY4A 1GY8A 5EPOA 3TL3A 3JQAD 1MP0A 3ROMA 4IDCA 1OC4A 2B69A 1NAHA 5EERA 4DQVA 3VZQA 1Y7TA 4RVUA 1ZMTA 2VWPA 1KEWA 4ZQFA 1KC1A 1PWZA 3VZPA 1IULA 4L73A 4ZD6A 4E2WA 1JKJA 4U7WA 3U0BA 4BOYA 1B14A 2C07A 3GDGA 1YOVA 4A10A 4E32A 1E3LA 3GK3A 1DO8A 1RPNA 2WSBA 3BMCB 4Z3KA 2O4CA 4CPDA 3BYZA 3F4LA 2XAAA 1U3UA 2O23A 4BV9A 1NTOA 3HNPA 4W6ZA 3D0OA 4J2OA 4XR4A 4XDZA 3B70A 3EVTA 5JYEA 4XGNA 1ZZEA 3HG7A 4MKZA 3GNTA 3PYMA 3DZJA 3RROA 1SBYA 1EUZA 1T26A 2DM6A 4WJZA 3MOIA 2JJYA 3ANLA 3ZWVA 3E82A 4FJ2A 2IRWA 4II3A 4L75A 4OH1A 3F5SA 1H6BA 5HBRA 1O94A 3DBVO 3HB5X 3AOGA 4WPGA 2C54A 2D4AA 3VTZA 5IZCC 2UAGA 1B8PA 1DB3A 4Y6SA 2JFGA 3HDJA 4E5NA 5I7FA 1CF2O 5A9SB 3ULKA 1GR0A 2D5AA 1X7DA 1EK6A 3L4BA 1BWSA 3ZDFA 4BO6A 4XA8A 3NUGA 3PJDA 4O1MA 5EL0A 1E92A 2ZYGA 1PQUA 4BO1A 4YR9A 5U9CA 4N5LA 3L07A 3KYCA 1A5ZA 1HYHA 2LDBA 1SNYA 3HFSA 4FCCA 3JQGB 3K6JA 4FSHA 2HMVA 2CDBA 4OHUA 3SVTA 3BMOA 2OGUA 4U5QA 4YT8A 1WW8A 4D3FA 4LRSB 4J1SA 4WLEA 1HTBA 1QV7A 1R16A 2C5AA 4IDAA 2BKAA 1CQIA 5IG2A 1MA0A 1LRLA 2VQ3A 4KZPA 1SZJG 1NVMB 5I9MA 1IUKA 3DOJA 4Y6RA 3ZN2A 4AJIA 4UVGA 4CMBA 4D3SA 3WOHA 4FQ8A 1ZK0A 2EIHA 4GX1A 4CUKA 1I01A 5IDXA 2WD8A 1D1SA 1CWUA 1N9GB 2BF7A 1N1GA 3NX4A 3BHJA 4ITUA 3IAHA 5I7SA 4ZQEA 1DSSG 4YQYA 4IDEA 4AJPA 4DPMA 9LDBA 1T1SA 4XYBA 1I10A 3GGPA 4L8VA 2Q2VA 1ZCJA 2OZPA
chains in the Genus database with same CATH superfamily
1JEOA 1OXBB 4OUDB 4PC1A 4YRRA 1QFMA 1IQRA 2GCEA 3C6KA 1A7JA 3I6BA 1F48A 1BDIA 3JASB 3ASYA 2B4RO 1F0PA 2Y1OA 4F2GA 3H1GA 2IHZA 1WU7A 3KTAA 3PB3A 3DWFA 5I8WA 4LGMA 4I81A 1GDDA 5DN9A 1YAJA 4KXNA 2W4IA 3TTYA 4MUNA 5AJYA 2PNJA 3AI3A 3ANYB 4UQOA 3RHTA 2BT4A 1F1BA 2RHWA 4W5OA 2P9QA 4G0ZA 1VBNA 1A96A 3TR0A 1UC9A 3E2MA 1F2DA 3R0IA 2I6UA 4UM5A 1P2DA 1FSZA 3AY6A 3EIXA 3K5HA 4MGZR 4TX1A 4CMGA 4CQMB 1VIAA 2QNRA 1Q1EA 3J81k 1A69A 1SC1A 3ZK7A 2ECPA 2GCNA 1FVOA 4JT8A 4M87A 5I8ZA 1KDRA 2J7PA 4I50F 1MXFA 3V4VB 1OWLA 5I3CA 2ADMA 3I0ZA 5IM4A 4U2CA 4RTPA 2DBRA 4LF9B 1OZGA 1GEGA 2V45A 1DAGA 1PD1A 1QUEA 3ZNOA 3D3NA 1IHXA 3E0QA 2PJZA 3OZBA 5MGBA 5AICA 2Z3VA 2NMVA 4AWAA 1M2FA 3G9QA 3PSAA 4Q1VA 1B93A 4F4IA 4NS4A 4CR6A 2W2OA 4FGZA 2ZM6B 3C8UA 1K5DA 3UJ9A 4WZ6A 1ZVQA 3F6EX 3HLKA 1ZXXA 2HLDD 3H9CA 3OJEA 4PPNA 1FVHA 4XUDA 2X1VA 5IC6A 4EJSB 1FF9A 2AW3A 2CXOA 2P5TB 3N7UA 5DNWA 3ZKAA 4R3NA 3KHKA 1DS6A 3O8BA 3U2QA 5FOQA 2LKCA 4B4VA 4J7XA 2UZ0A 2ZRHA 4O63O 5TV2A 3KSDO 1KEZA 1XNGA 1X7GA 1CUXA 3A1DA 4QU9A 4UU1A 3VX4A 3HXOA 4PWZA 1TL7C 1GFWA 2GJ9A 1UPFA 3LCRA 1JQKA 5DULA 4ASUD 1Y4ZA 4PW0A 3K32A 3QW2A 4I2NA 3RKRA 2WMNB 1FNNA 3PD0A 2EJTA 1XI2A 3CSDA 3RJMA 1DWPA 4EW6A 1Y6QA 3L7IA 4E5VA 1HT2E 2B5OA 3IA7A 1BXGB 3PEUA 3DAYA 5HCUA 1XLTA 2FN8A 3FDJA 3OETA 4M37A 5G0TA 4ZJPA 3VJMA 3FE2A 5FPQA 1JL3A 8ADHA 2XCOA 5MFZA 2CVPA 2QTAA 4P5EA 1SWWA 4BWVA 5ICCA 2QD1A 1WDMA 3JZDA 4ID9A 3AR4A 5H7XA 5ILQA 4ZI7B 4EAQA 5EHZA 1T6NA 1YZKA 3SIRA 3IKMB 2WSIA 4W99A 1GGJA 3ENWA 3GD7A 1KU6A 1WTCA 3JAWA 3N76A 4QLAA 4R71A 5L4SA 1J09A 1BO6A 3IBYA 2DBZA 4LOJA 4PM4A 4EY6A 4QUKA 3IUYA 4NEQA 3CJQA 4DLKA 2BYTA 2GBFA 2YBEA 4YJ2F 2UYGA 4C1NA 2MYTA 1XU7A 2CLSA 2HBRA 1VHDA 2WUDA 2F1HA 3KE9A 3PNPA 4JUAA 3T6KA 2HA6A 2PH7A 5DXFA 2BKXA 4PEVA 4XVCA 3HXQA 3SM3A 2OAEA 3EVAA 4K88A 2CBGA 5TPWB 4CT0A 1CRZA 3D8SA 2UZ1A 3FMIA 5KNBH 4X9XA 4RE5A 3V1KA 4DQDA 1GQSA 3M6FA 1HT3A 1M8GA 4QGGA 1I7LA 5B3AA 5I4KA 4UMFA 2WZDA 2V5UA 3M4JA 5FADA 1TQ2A 4RE6A 4TPKA 4R1OA 5BR7A 2JD2A 3NHJA 3QU5A 5EKTA 3L93A 1MABB 1T1RA 1EFPB 3A11A 1FXWA 3AG5A 1XEFA 4LJRA 3UT6A 4BXOB 3ESQA 3U16A 4RAOA 2H0QA 5KKAA 4ND6A 2YXDA 3WIOA 5KVVA 2LIPA 4Q19A 1XCMA 5CCDA 1TMYA 3PPXA 2VHWA 3CONA 2DH5A 5IPFA 3K1TA 2A0KA 2QN9A 4EEKA 4HUTA 2JIOA 4ARCA 5FA8A 1Y7HA 1IONA 4UARA 3OX4A 4V0NA 2PX2A 2ZPAA 2AJ8A 3W4JA 1K3UB 3LYHA 3TWOA 4FSDA 2XMSA 2R6DA 3MGKA 1QH1A 3MJSA 2GD0A 4V0ME 3A3KA 4M53A 3KKOA 1Z6QA 2BDTA 4LRYA 4ZYVA 1DQZA 4DV2B 3HDHA 3BK2A 3U7RA 4D5EA 2VP0A 2E1PA 4YWJA 1R0SA 4B6OA 3G0HA 3E9ZA 4RKFA 3WGQA 1FJGB 1R6BX 2YICA 4NDZA 4NOLA 3ELDA 1PJLA 4DIMA 1G8YA 2Q0SA 2VYVA 1E6KA 4LJ7A 2D7DA 1UAAA 3KYJB 3T5CA 2YINC 2QM3A 1RBMA 2CMDA 1EXDA 1YZUA 4W5WA 5KINB 1LSJA 3DTNA 3F1KA 1AV6A 2IDKA 1G8PA 1SBHA 2AN5A 2ATVA 4HDMA 3CTMA 1CUSA 1JLLA 3DDWA 4GBMA 9GPBA 2PL5A 3BF7A 4TS4A 1D2RA 1TU3A 3ISJA 4K2AA 1AK1A 4JFRA 3L1JA 3R7SA 1ZR4A 1AXEA 2NUTB 2HF9A 2X2PA 3ITKA 1M2JA 3K09A 3PP8A 5FFMA 3WZMA 4D8VA 4XVUA 3IUMA 2GBPA 2HZBA 1QG0A 3MMNA 4G09A 5EJ7A 4FOLA 2AR9A 4LRXA 3MFYA 1N2EA 1Q0HA 3COVA 2EV9A 3HJHA 3NBYC 4GX0A 3RYHB 4A7PA 4E22A 1S8NA 5EYPA 421PA 4KRGA 1G64A 2GK6A 1CUCA 1G8JA 1L4BA 2IYVA 2FEWB 3CNBA 3FFTA 3M5PA 4IIJA 2ZJ0A 2JI8A 3D3JA 1DO2A 3DOIA 3PQ4A 1FMCA 2AQKA 4YJ3A 3VPSA 5INTA 4AF7A 2P9GA 2NW6A 4R2LA 4F2HA 2QX8A 2BR4A 2Q46A 4MWGA 3SYMA 5AQEA 3IFSA 3O9VA 4GGPA 3VDNB 2HXYA 1K08A 1FUIA 1RYEA 1Y8AA 3AIIA 2J9FB 3GEGA 4YV0A 4P38A 3AB8A 4KXVA 5AVXA 1XXLA 5HYVA 1PSWA 2QLJA 3BD8A 3NT2A 4RXMA 4ZAZA 4W9NC 4PYNA 3MWGA 4PRZA 5JCOC 1SXHA 2HHAA 2O2JA 3C14C 4KTTE 5JO9A 1E1CA 4DMMA 2Y67A 3W2HA 1TM2A 3A4LA 1ZUD1 4AY2A 5LWQA 2PGLA 3DR5A 1UZNA 1WHTA 3FZQA 3IOMA 2GKSA 4PG4A 4CT4B 3QPWA 3IT3A 2C4WA 2VUSA 3ETNA 4Y2TA 5JAQA 3IIIA 5AH0A 2CNWA 5ALSA 4AU1A 2O1SA 2NGRA 2JGDB 2R86A 1ULSA 1IL0A 4C22A 4F4CA 4LQLA 4YGYA 4J7CA 4YUVA 3N6XA 4OHOA 4H0CA 1V71A 1W1IA 3BCRA 3FUUA 3BTOA 2QRVB 5F76A 5HRCA 3HKEA 1E4EA 1T2NA 2HWYA 3P2JA 5CAEA 3W8EA 1T2AA 2ZR7A 4Y2RA 2PBLA 3IBFA 1BMTA 2AQ8A 5F2KA 1CYEA 1WA5A 4PYIA 1P75A 1STOA 1LNQA 4XWYA 3UATA 5IBCA 5EMLA 3QP9A 1OFTA 1S7CA 3UN1A 4OJQA 2BELA 2IE8A 2QXYA 2BRUA 3KOMA 4M1KA 1BJKA 4QOHA 3SDSA 3FM9A 3MELA 3EIUA 4CDMA 2W6JD 2J6CA 2VH5R 1DT3A 3LIPA 3INGA 2W9XA 4J16A 3N58A 4J3JA 1FNBA 5C53B 1XDDA 2LBPA 4RZQA 4WK0B 5F35A 3ILHA 3WGNA 3CVOA 4YUYA 3QWBA 4JXXA 3IRUA 4YP0A 4RNCA 1NF8A 1DC7A 4YLYA 1SXJA 4AB1A 2EYQA 1K6EA 5LD2C 4PZZA 3OCUA 1I51A 2Q27A 1BXRA 3A4IA 3IGFA 1QCYA 2VNIA 5KQRA 4YAJA 1EVQA 2ZJ6A 4A8JB 1X19A 1P5RA 1VDZA 1KZ6A 4KQ1A 2WA1A 4NEGA 4OFZA 3ZWBA 4XD7A 3EEYA 4L78A 1DARA 5M5BA 2F90A 2ZZNA 3IP3A 3K72B 2BJWA 2JGFA 5IAOA 2G72A 1FRVA 1FCJA 1SJ9A 2PYDA 3LX8A 1LWNA 3PHBE 5BT8A 2WAYA 3S4YA 3QPUA 1E7MA 2IXFA 1SVLA 3IP7A 3DHWC 4CKCA 2GEJA 4V1CI 1PWYE 2RHLA 3AP2A 5E0OA 3RYCA 4YRBA 5T64A 3ASZA 1KTVA 2JKVA 2UZIR 3PXBA 4NPAA 1W36B 4UBJA 2A57A 3U49A 1M1NA 2COKA 4IDQA 2WW8A 1C50A 1D6NA 4BNDA 4EO7A 3T1TA 4W9RA 4FS3A 3KPJA 2AMLA 1NLYA 1QFZA 1ND5A 1YKFA 1CJKC 2E4UA 2A94A 2CMHA 2OLKA 2IHTA 1RJ9B 3FUWA 4JR2A 1G8FA 4KGDA 4Q34A 1JJ7A 3O0TA 3ZU2A 4Q7LA 2NADA 4XIJA 1DCFA 3KPYA 2HUNA 1KZ9A 3GOQA 4MPJA 1RD4A 2CY0A 1P2UA 3LAWA 3FNFA 3G0BA 3K94A 3LT2A 2CLFB 5FTKA 5FBVB 3KPVA 3K6KA 5FFNA 1SC3A 1V9LA 4PYMA 1OTHA 2EFHB 3DC2A 4J0HA 4LHWA 2O7QA 1E7QA 4TMVA 1H8ED 3LPNA 5L3SA 5K20A 3ZWXA 5KKNB 4FMCF 1DDOA 1KK0A 2GPJA 4YJDA 2PS9A 2FKAA 2PJDA 1LRKA 1ONPA 1TXGA 1ZXLA 3PV0A 1WR8A 4RXUA 1KKMA 1I3LA 1CV2A 3QEJA 1PQPA 1QE0A 3QSGA 5DX8A 1XKLA 3PNSA 3FPJA 5CT8A 4DA8A 2EW8A 1IE3A 3EZXA 3RUEA 3GJ0A 4G0PA 4GXTA 4NCIA 4HS4A 1XZKA 1UADA 2CJXA 1ACMA 2Y0DA 1RZUA 4M9CA 1V1RB 3DO8A 5FQNA 1OH7A 1FS4A 3DQPA 3S2GA 1H42A 4KXLA 4MQLA 4U2KA 1ZHHA 1Q20A 4GE0A 5I7HA 5ITVA 2FUG1 3K05A 3PGXA 4FUTA 4IM7A 2RBKA 4L6CA 5HFAA 1NMEA 4KQ9A 4YQEA 1QRAA 1JAHA 5ALQA 1MTZA 2VKQA 2OBNA 1S01A 5AOCA 2N1BA 1V4NA 1D07A 1FFDA 1H0RA 2VCHA 4IWXA 4FUQA 4B4WA 1U0GA 1UMBB 1X39A 4E2XA 1SCUB 4MPDA 3INTA 6REQB 1JLMA 2Q8PA 2DPHA 1GGHA 1RI4A 1JWAB 1S2DA 2YN4A 2MYUA 3DP9A 5EXDA 3DHEA 1QQTA 4PGMA 1E6EA 3GRPA 2D06A 3WI7A 4PO8A 3GZNA 3H75A 4GKKB 5HKAA 4ICIA 4HGOA 5LUBA 4FZ5A 4ZJUA 2I8LA 4GWGA 1C9DB 4U3JB 3WXMA 3ZWWA 1KVUA 5DM0A 3SHTA 2JLVA 3KX2A 1C80A 1T36A 1QIKA 2PL3A 4NICA 3HO1A 2BH9A 5DCYA 1W7AA 2H7CA 2D2IA 4HSGA 3FKSD 3R5KA 4WZAB 1HQKA 1XZHA 2D6FA 2O2HA 4HQLA 3ZJYA 1L4HA 2OILA 1GT6A 2JAOA 3BKWA 3ORSA 3NALA 3UJDA 4WHMA 2UZ4A 4NVRA 3TO5A 4B3GA 2IP1A 2CYCA 1GQQA 5DE3A 4AJ1A 4KWCA 2P3SA 3M4XA 5H3HA 3EWIA 4JC8A 1T0UA 1XUOA 2VO1A 3ROEA 1W5EA 1C41A 2Z5VA 5K05A 4HAOA 4CTOA 1UEXC 3IQHX 1E79A 3I5XA 1CETA 1UT6A 1FU8A 2QX9A 3E9DA 1UC4B 1MAHA 1XL1A 3PFIA 4RHEA 2IGBA 2XMBA 5G0WA 4Y2XA 1NV8A 3E9CA 2QAGB 1ARZA 4V0KA 1PR4A 2IE0A 3U40A 4EQ6B 3E5NA 4FBLA 3WSVA 1VDMA 3HYTA 2QTZA 1ZWKA 4BVHA 3NBKA 2GN9A 3I62A 2LTAA 2WTMA 8OHMA 4MQ6A 3AU9A 1R00A 1XELA 3LUFA 2PKXA 3LYUA 1VG9B 3VNBA 3LFTA 2R1TA 4LSGA 1WF6A 3QFRA 4URYR 3RIYA 1J49A 1GZ3A 1Y1KE 4IVNA 4JUFA 4R68A 3ROKA 3RRYA 5D6NA 8LDHA 4IUCS 5HQ3A 1M5RA 3C97A 1JG3A 3BSWA 1F8FA 4PNHA 2I91A 4RH1A 1L7NA 3DA8A 3QU9A 4OQZA 1EFVB 1I4LD 1RSZA 4DXHA 5LSAA 4M8IA 1L9KA 4OB6A 2IODA 3DFUA 1GFIA 1E3SA 1UQTA 1DJPA 2Y77A 1S96A 1I1OA 2GCPA 3K1AB 3OJOA 1ISSA 4UPDA 2FFAA 2B8EA 5G02A 4E88A 4I46A 4AO6A 1ISFA 1YZQA 3NC1C 4MP3A 5DYNA 1Z74A 2PSEA 4L02A 4X62B 2EJVA 4CIWA 4G8JA 2A6PA 2I4IA 4B2PA 2O8FB 3FDFA 4ZALA 4C14A 2WSLA 2GZMA 2YVQA 2VAMA 1UJCA 4KXYA 1NBWB 2XB2A 1R7RA 3VOSA 4HJXA 4GKAA 1R37A 4D7AA 3JQEA 1WCYA 4M38A 1WZIA 1YFJA 2YHUA 5BYBA 4YA6A 1E64A 1N3BA 1ZVKA 2W98A 3AJDA 3QELA 4WCFA 1COWA 5CNMA 2QX4A 2W48A 3OQ1A 5K0FA 3JYPA 2VRCA 3IE1A 1RVV1 1VG0B 1AF4A 2XYPA 4FFVA 1AXRA 4MPTA 1RMYA 4Y0NA 1DC4A 3L8CA 3OKFA 3BF8A 4NENB 5JH7F 4B2LA 5CCBA 3ELUA 3W6UA 1FUUA 5D01A 2X8WA 2VSNA 3QRWA 4N48A 2HU7A 2GEBA 3TTWA 3A1EA 1T9HA 4WK6A 4J49A 3HKCA 3MRSA 2RC5A 4L9RA 2HK6A 3BCHA 2I7DA 2P62A 1PTKA 4W5TA 2YNMC 4FD2A 2LCIA 4OLFA 2QRJA 4DIEA 4EYKA 1U3VA 1B8VA 1E0DA 1GQYA 3KETA 2HV9A 4KUHA 3SSOA 3ZW7A 3FJ1A 3G2KA 3GBPA 1GTVA 1CQJA 1IEVA 1U94A 1H0SA 2GR9A 4ZI5A 4ZMRA 5LYJB 4FGUA 3S0JA 3I30X 3DT8A 3NKLA 2NUBA 5FO1A 4CF6A 3CN7A 3IYLW 1XVVA 3QVXA 4QUAA 2E3JA 3PL5A 3AOEC 3EGVA 4XOUA 1HMYA 3EGWA 4MQEA 4NQRA 3MJTA 4AWXA 1Y48E 3TTSA 1IU9A 1LBTA 1ZN8A 2GAJA 4JB8A 1TOAA 1V6SA 3HUTA 3N5KA 1MHTA 2ZGVA 4NG4A 5T4FA 4A82A 4PSCA 2FPPB 4UBMA 1E0JA 1S2LA 4BNZA 4DPKA 1TCAA 1NBIA 2HIMA 4TV9F 4FFWA 1X1QA 1VPWA 3OICA 3D3EA 1KAEA 1II0A 3T5TA 5C1OA 4E5UA 2XMCA 2IYLD 2WOOA 2FW8A 1D5CA 2Y1DA 2BJHA 3O1IC 5AW5A 2WJWA 4O2RA 5F5XA 2XUGA 3NIDB 1JSXA 5CM2Z 1E1RD 5HKOA 2AJTA 2XB9A 2J9GA 5FI0B 2P2DA 2BE9A 3IA2A 1PT9A 3N8NA 4GDMA 1ZONA 3CRNA 4B48A 4UAUA 1SA0B 4MAFA 4W82A 1IJEA 1IXRC 1MJGM 1XD2B 3TL6A 4JQCA 1Y1QA 1QF7A 1LTHR 2MSCB 4RLSA 3S70A 1BQEA 3FTEA 1JKMA 2YV5A 3H5IA 1L5MA 1JE1A 3TMYA 3HBAA 1R4NB 1NPDA 4I99A 4J0IA 4JNCA 4UZSA 2BMAA 5FAXA 2ATXA 2QPOA 2CYBA 1JKFA 1G3IA 1UM9B 1WPQA 4OL9A 4Q3LA 1KIFA 2QDXA 1H5QA 1VYTA 3AJ8A 4JI8B 2QPAA 2VS1A 1RLIA 5E3IA 3AR5A 3Q3JB 4FYIA 1L1RA 2RHJA 3HCRA 3K35A 4NCXA 1QOPB 4P8RA 3SG0A 4PLYA 4AVYA 4QT4A 1WSBA 4F1KA 1CUFA 4WERA 2NN3C 3NDIA 1B16A 3KQYA 3LDAA 4TYYA 4CQMD 1D5WA 2DR2A 2PAAA 1KDVA 4D9KA 3R44A 1XNRB 1Q14A 2O54A 2ZG6A 3IEKA 4PC3A 2JLRA 2B20A 1F9EA 1W93A 4LX0A 1C7EA 2IOFK 2HV8A 3AESB 4RIGA 4YNBA 4DQ0A 3FRIA 1DRKA 2VJPA 1Y80A 3FPAA 4X1IB 4X1YB 1TAUA 5ALRA 2D0PB 4BNNA 3OFNA 1HOXA 4F6RB 1ECLA 2Z9BA 2IBMA 3I9NA 4F7WA 3I04M 2AEMA 4PX2A 5BWCA 3RWOA 4R1SA 4WWHA 1P33A 5CJPA 1NBAA 2VQFB 1T2FA 3IIKA 3P45A 2ZE6A 3QF4A 7REQB 2XYRA 2M6KA 5IEJA 3BGWA 3OO0A 5HRAA 2OZEA 2Y92A 5JYDA 4OP3A 4G1MB 1C9JA 4CT5A 5KB3A 1GVHA 2JJ1D 4RZIA 1PFQA 1FBNA 1M6VB 5CHEA 4C7VA 5AVYA 2FPGA 4FQ7A 4YYEA 2IXAA 3AUAA 4D8UA 4UBNA 5ESDA 4ENVA 3NVMB 4TYWA 2I2XB 3AR7A 2EFJA 5E1OA 2PKQO 4F11A 4KQKA 1TRHA 4BAUA 2AN9A 5GONA 4NBVA 1RWXA 4BB6A 3QK7A 3V4RA 4N01A 1ATIA 3BERA 3N2YA 4N5DA 5AYVA 4F0JA 1R6XA 4RK5A 3DLBA 2IHBA 3QE9Y 4XGIA 2VCEA 3FR8A 2Y9PB 1A7AA 1HA3A 3SFTA 4EITA 1ELOA 1UMDB 2XI4A 1ZU4A 2I2AA 4LJKA 4JC0A 1Y3BE 3NEYA 3UAOA 5LD2B 1FNMA 4IHAA 4N1AA 1B76A 2Q41A 3JQQA 3G0OA 1PJ2A 3OLVA 1DHTA 1YCHA 3JQ8B 4KC0A 4LE0A 4GL4A 4MYDA 3ROPA 5A2GA 3CNOA 3DKRA 1OLOA 2J3KA 1Q3TA 4RF5A 3AETA 3EFBA 5BYJA 4CMCA 3FZNA 1KSGA 2ZTLA 4PX9A 5KYNA 2FPKA 3SY8A 4MX8A 1OLUA 4TTRA 3QXJA 1UR5A 4OP1A 1FFWA 1GSAA 2J41A 4C0SA 2VYNA 2QE7A 1ISRA 4AO8A 4JKOA 1AG9A 2P4QA 3T7EA 1IXZA 4P92A 2BSQA 3V32A 5FUYA 3ZHTA 5A04A 2FKNA 1LDBA 1QDUA 3IIEA 5F77A 3AZQA 5JSKA 4FFBA 3TI9A 1MV8A 4WE3A 2ZKIA 4P7KA 5KTSA 4HFRA 5CBPB 4D56A 1KSFX 5TPZD 3UB3A 4P81A 1X14A 3TCNA 2A59A 2FR1A 4MNTA 3TLGA 2R44A 4C2TA 3RRXA 2ORYA 4ZXFA 3VPBA 5IC4A 4D26A 1TT5B 2ZJ4A 3T3HA 3BWBA 3U37A 1HDXA 3K1YA 5H0IA 1IATA 2ZUTA 1HSOA 1WUKS 4QDKA 2OQIA 1N2GA 3BMQA 1XWIA 4WZAE 3RYFA 2YDXA 2YMPA 4BP9A 1WF3A 3AR2A 3M6XA 4HAUA 5CRIA 2C5FA 2XTZA 3X1KA 2CYAA 1SD5A 4AS3A 2WB4A 1FFXA 1OXTA 3ILYA 5HF6A 5LBUA 4L7QA 2D5CA 1KQ3A 4WW0A 1HR0B 1XAGA 4TTPA 4CMHA 1SCNE 3HACA 4LFCB 4Q48A 5B2EA 3AR8A 1PK7A 2AR7A 1EBFA 3WGTA 1RXVA 3IMKA 5AJVB 5E2IA 3CB4A 1IK6A 3B51X 3LDHA 2C4NA 2MMCA 4KLAA 5ALMA 2NYRA 4FZRA 1JH8A 4NE2A 3C45A 3SQWA 4YP5A 3UXMA 2ZWMA 4HGZA 3WRVA 4HDSB 1YU9A 1HG0A 1X8JA 1J8QA 1K97A 1XYVA 1BW9A 4Q66C 3A4VA 5E7JA 1OROA 3GLKA 3TLEA 3WISA 1DIBA 4R81A 1NBOA 1KTIA 4V0SA 3HYLA 3L79A 4WLNA 1D6MA 1CZKA 5ALDA 3BJIC 4XFDA 5FUWA 3P9YA 4OU5A 2OY0A 3RAEC 2O07A 1BCRA 1US8B 4EEZA 3L1HA 5LMZA 1ZOLA 2R00C 3LRXA 2H4YA 2IIBA 4LXUA 2QKYA 2UZAA 2WPDD 2R6CA 3K30A 1DJOA 3ZZUA 3QBJA 3RS7A 4QD3A 5C8DA 3CRMA 4GWLA 4NNOA 1KEEB 4MLPA 5LOVB 1W0JD 1PFGA 1N7IA 3QVKA 3F5MA 5KSWB 3SQOA 3KQKA 3AKYA 3I3OA 1DWQA 4P22A 3BXZA 4C29A 2R47A 3REQA 4CV2A 3ZHXA 1T3SA 3ILSA 1N4AA 3HXTA 2ZEJA 3NNDA 3UOAB 1LS1A 4O4LB 1E2NA 4EHFA 2RKOA 1EDDA 1PZGA 1VCOA 1QGDA 1B8OA 1Y3HA 3HBJA 3SSAA 1PZHA 1UKYA 3MS7A 4L0QA 3GLUA 4BGDA 1PJ3A 1PGQA 3IXMA 2YOHA 3QOWA 2PN1A 1G5QA 3QFHA 2V7VA 3AUUA 4W7IA 4YP1A 5F52A 5JD3A 2ZR9A 2YQZA 3MSCA 4BQSA 3CVUA 3FYCA 3BS4A 2VJQA 3AYZB 2XXAB 3KOOA 4DEVA 3K70C 3C43A 3L3BA 5JSUA 1G3RA 1E3WA 2VK2A 3ZJTA 4LJSA 1RHRA 1KP9A 5E8RA 2H2GA 1WB9A 5BV7A 3GP3A 2MYNA 1L7AA 2C78A 4KNVA 2CDNA 1RWQA 5I7AA 3MT7A 1Z82A 3S7TA 1ZRMA 4LECA 4U7GA 5TS3A 3KKPA 2PYIA 5K3BA 1QVRA 3V4LA 3V9AA 4C4SA 3E5RA 3T52A 4G25A 3EDOA 3KZCA 4WOCA 5DGCA 3VSCA 4BGUA 4DADA 2BFDB 1NN3A 4P3OA 5JZSA 3UBMA 2JHGA 4U7TB 1SUEA 4BX9A 3THRA 4KN6A 5KMGB 4LG1A 4F71A 1TIKA 1D8AA 4B31A 3UH1A 1OPRA 3L05A 4G89A 2TS1A 4Z4QA 2ZQZA 2V3VA 3ADOA 1JYEA 3EXAA 3G3EA 3A6LA 5TEVA 2X9VA 1I0ZA 2NVOA 3OIDA 4X8LA 3JAKB 4ER0A 3I8XA 2HCFA 3G5LA 1P0IA 3CH6A 2NNWB 4YUWA 2LDXA 4NBUA 2V6FA 1XEXB 3Q2KA 2DSNA 3TMAA 2E82A 5HJEA 4MA5A 5ICGA 5AVRA 1R3DA 4WNYA 2G6TA 4BN5A 1XRPA 4C03A 5EN4A 1ZN9A 3BRSA 3R0ZA 3HSKA 2V3WA 4PZEA 3PT9A 1ZIOA 4GZLA 4DB2A 5C4GB 1CY7A 3V8RA 1JSRA 3KYIB 4PWYA 3UC9A 5JG7A 2L19A 1U81A 3F98A 2BTOA 2ZYIA 3NM4A 4MA0A 1RU3A 3RVBA 2JCYA 3EC2A 4ZI3A 1JEYA 3VH1A 4MSUA 3NAMA 3QUCA 3C8MA 3AEXA 4CN9A 4KBYA 2VT7A 1Z4OA 3EF0A 4DG5A 2VZ0A 1I7PA 4LS3A 4LZPA 5IHPA 1C1XB 1NQWA 2WWRA 4JNGA 5AJWA 2FWAA 3IBGA 4E1VA 4A2QA 2RGWA 5FWYA 4Y3UA 1DX6A 1VHJA 1GPDG 2A9FA 4IO0A 4TV8A 5K1ZA 2BFBA 1Y8QB 5JFOA 1CEQA 2R60A 3Q5EA 5A9SA 1CR4A 4O4JB 1H2XA 4INJA 1SVUA 2GEVA 1DTEA 1ZQ1A 2ONZA 4K9DA 3C39A 5B7QA 2QRKA 1DIHA 1OTYA 3IUJA 2REQA 2IBSA 1L8XA 2Q1XA 4FXOA 4HADA 5EMHA 5EJAA 4ZC1A 4EJ6A 5UKDA 1W36D 1V6AA 1XMPA 3VR4D 3MB8A 1LLUA 3ZGLA 3JD3A 4CIXA 3AF2A 4YJKA 4PXYA 1MZVA 4RV4A 1ZGJA 4M86A 3EGDA 3U31A 1BVYF 2NO1A 4QUBA 3T7SA 3DFKA 5DLEA 4AP9A 5KTMA 4M1SA 3B8HA 2OBBA 2Z08A 2FWPA 3A3NA 3OO1A 4DG9A 1V8DA 1PYGA 2LV8A 2BFFB 2Q6LA 3N8GA 4WKGA 3FVWA 4U6SA 4ZGGA 2R8YA 5J5VA 3WHPA 5IU6A 2XGOA 4ARZA 1CUIA 3DULA 3IDFA 2D2FA 3GG9A 4IDUB 3L2OB 3SBXA 3F2IA 1M1ZA 1GZSA 1ZOOA 2ZANA 2OT3B 1LU9A 2VDJA 4B87A 1EBBA 1O7JA 2OXCA 1TLFA 4IUYA 1MLDA 4IOLA 4KWTA 1XZFA 1H9BA 3HWSA 1NGSA 2EJUA 2I3BA 2QVXX 2XADA 4ZOLA 4EW3A 4GFDA 4NZYA 5EVCA 1NLMA 2E89A 4WN9A 4C05A 3CR7A 1YQTA 4YMWA 4F5YA 3RF6A 3PJGA 2COEA 5L3QB 1IQPA 3ND8A 3PBKA 1NQUA 4EYQA 2XQFA 3H8WA 4B40A 3AVOA 2CXRA 1AK2A 4I6EA 3N74A 4P3NA 5JJ5A 3OOEA 5LZ2A 2HBQA 2FUCA 4IMIB 1G2IA 3QKIA 4Y2PA 4CIAA 1S1CA 4S1VA 2OC4A 3R3XA 3SVZA 1XZQA 3JD2A 1VKRA 1X6VA 3DYIA 3ND5A 4CEJB 5THQA 2DR3A 1MG0A 1V1MA 1B8NA 1PR2A 3KFVA 1T5SA 3F6YA 4DBLE 4NOJA 1GKLA 3FOBA 5F1YA 5BN1A 2QRLA 3MYRA 3ZNPA 1ZBQA 1N2IA 5BRAA 1D4AA 4N5IX 5AXAA 3FRJA 4XYMA 1YWGO 3PLRA 4YUXA 4OSOA 3DFZA 3PGA1 1QZZA 1A71A 2RI0A 1C30A 4RHCA 3ZUGA 2CHFA 2CL6X 3NOXA 5JRDS 1MJNA 3VU1A 1JHRA 4AY5A 4Z2AA 5EJEA 1KJIA 5TARA 4KODA 4X8OA 4HWOA 1YOVB 3WC4A 2XEDA 3C7DB 3SOPA 2FFJA 5TIIA 1II8A 4GPTA 3V55A 4C9BA 2JFNA 1NN0A 2PEYA 1TYEB 3HRKA 1A9OA 5AT1A 3ERCA 1BCSA 1K92A 1H22A 3IMEA 1W581 4RMHA 5KX5B 2RK6A 1XU9A 3MWKA 4FNAA 3TL2A 2F7SA 5JTTA 2B35A 2VAVA 1UFOA 4DL9A 1QK4A 2WVGA 4L27A 4LC9A 3KAKA 4Q3CA 3IAFA 3G6WA 4CM9D 1M2GA 1E4VA 1RAFA 1R66A 2DE0X 3CEMA 3EAQA 3JQCA 2C83A 1E0KA 3BSSA 3L7OA 4F12A 5K7SA 1C0PA 3AI7A 5F3RA 4BBPA 4V3CA 2PUVA 2VH1A 4LQ4A 4ZKEA 3OTWA 4HWSA 4LWPA 4MDHA 3VRHA 5L9AA 3JAMA 1O97C 1ZO8A 3PFCA 3SC2A 3WYGA 4ACBA 1J23A 4BWFB 3JARB 3WBFA 4OJYA 1XQ9A 3V8BA 3RLIA 2ERYA 4M1TA 2JJMA 4F8EA 5JS6A 1NNSA 1EKXA 2YVLA 2UYQA 4IXWA 4LQCA 2OKGA 3GXBA 5I01A 4BVKA 2W6QA 1COZA 4P0TA 3HUEA 4DIFA 3KYCB 1N1EA 2X5OA 1AA9A 1KY2A 2NLOA 3KQTA 3PQCA 4GRDA 4ND4A 1GUFA 1ORHA 3GVIA 1FQJA 3HJBA 3A7DA 2ATEA 3M9XA 4JUIA 1YS6A 4L6IA 2PD6A 1OVGA 1Z5VA 3AU8A 2PTHA 3BMOB 3GPBA 4HDQB 4IYJA 4TKUA 5BV0A 3FAZA 2C7PA 1C81A 5CVCA 4BX0A 5CA1B 3AILA 5E4JA 4S2EA 3H5NA 4DLYA 3MXOA 1X1BA 5FUBA 3RUFA 1KBZA 4WMLA 5TGDA 2BD0A 1BEUB 4BLUA 1SIUA 4OYHA 5CEJA 3LF2A 1JSLA 2FEPA 2BAGA 2ZWPA 3P0RA 4MH0R 2HT1A 1JDBB 3RC3A 4X20B 3E15A 3GJRA 1JR3E 2BKUA 2G28A 2IYQA 3GJSA 4UVEA 4G5SA 4CEHB 1UFRA 2Z1DA 1ZS9A 3HUDA 2P8SA 3BILA 2AHRA 3CO0S 5H3LA 4OX9B 3GCDA 4NYMQ 3RS2A 5KNBD 5HIAA 4DDWA 2D1SA 2PLRA 2VL7A 3ICQB 2JCSA 4L0CA 4ZI7F 5BWNA 1E66A 1FSFA 3TF5A 1E1QD 1EVJA 1UKVY 1L7RA 1VXRA 1R4ZA 2R5WA 2BM9A 4CCSA 5B3JA 1GYRA 1RT9A 1WAMA 1PT8A 2IOQA 4X95A 5K6AA 2Z8XA 1LI5A 4LI3X 2FG7C 1CTQA 4PZPA 3CTPA 3DL4A 1RZRA 2I2WA 3K5PA 5EPEA 1C0KA 4BX2A 1QTQA 1WLYA 2HRCA 4LZOA 4LBWA 3H2JA 1WBDA 2IYAA 5DHTA 2AYXA 1ORWA 2CVFA 2C04A 3KTAB 3LECA 3VO9A 4YPFA 2RJNA 1MOZA 3R3JA 1YBFA 1M9NA 3R0QA 3BBLA 4TYPA 2QQ5A 5J1SB 2SHKA 4LJ5A 4Z5XA 5AXCA 1DZ3A 2NSHA 3AB7A 4CKXA 1RLUA 3FSJX 2BFPA 3H5LA 4ZZ3A 5JISA 5JBIA 4WLFA 4OP2A 4HH3C 2BHLA 1HKUA 1CX9B 3CKYA 1WX1A 4BZWA 2KX7A 3MHTA 4PSVA 1Y4AE 2PGIA 3GN1A 4WH0A 2VSQA 3AVTA 3DMFA 4Z0TA 4HAXA 4TYMA 1GNRA 4I6GA 4LOIA 3I8OA 2BZ1A 2SNIE 4XQGA 4YMVA 3U6BA 1N92A 4URZR 4JHXA 3EXEA 3GNSA 2ATCA 4HQOA 4KB5A 5D00A 2PUAA 4WLUA 3ES9A 4BL5A 3CZPA 2WTUA 2GH1A 4BOYA 1H9CA 4DA7A 3NJ8A 2GZRA 3KQOA 3ID6C 3JZIA 3DE7X 5CIQA 3R09A 5DIZA 5C7OO 2HSZA 3CVXA 3COPA 3U44B 1PW5A 2CVZA 1KC3A 4PZLA 1DCTA 1EI9A 5TF4A 3TQQA 2P9ZA 3EGEA 2DSTA 3MRXA 4DHEA 1MC5A 2BBOA 1EA5A 1ZGCA 4R2IA 2OAP1 4AP5A 2V59A 3NS7A 1F14A 1SBCA 2F3QA 2WAAA 4CDRA 5BN4A 1Q0PA 1TVKA 3W2IA 2Y0PA 2FCRA 1UBEA 1Z0DA 4TOIA 2R6JA 2GWRA 3P0IA 1OAOA 621PA 4TMWA 2L2QA 1KEUA 4JZYA 2PMWB 2R6AA 1RTTA 4TQ9A 3AM3A 4WJKB 5DI9A 1J00A 3A1WA 3KKEA 1M73E 1ZW6A 3DBIA 4FGSA 3VYTB 3Q7SA 1CDOA 1Y5NA 4KFRA 4L76A 3H1AA 2AI3A 2QGFA 3I2FA 4R40A 4PIPA 1Z36A 1H6DA 3VHRA 5IAAA 2QB5A 2XTAA 2Q5FA 3QLVC 4JN6B 3UJHA 3NTXA 2A0FA 2K87A 2R5FA 2WT4A 3AMVA 3H2KA 4LY9A 4ZYUA 1QYWA 5CT4A 2EL7A 1XZBA 3RK4A 1U90A 3UMRA 4DMUB 1EFRD 1VP3A 3DW1X 2J3LA 2P2YA 4NZNA 3RFCA 3JAWB 2PEZA 4N7BA 4K9OA 5EMJA 3A32A 1GT91 2AJBA 1OASA 2OXFA 3GZ4A 1V41E 4KFTA 5AUQA 3VPDA 1P39A 1KS9A 3ZG6A 5ALGA 2GEUA 4EI9A 3C5VA 4ML3A 4C0WA 3IULA 4BNYA 4BX3A 2H4JA 2E1RA 3DB1A 2VT6A 1KZ7B 3Q6NA 4F85A 2O7SA 4MVJG 1V8BA 1K06A 2DOKA 1SOMA 2UZ1B 3KXPA 4QJ5A 1T9GS 2WU8A 4OOFA 1EZ1A 1JHAA 1RAGA 1XROA 3ZV5A 1JLRA 3RDPA 4CIDA 3NOVA 4Y9DA 4DYHA 3QNWA 4ARSA 2CMFA 4KKVA 3AEUA 3L0IB 3NHPA 4D97A 1IZ9A 4JOBA 4KQMA 4LYYA 4IZHA 4JASB 4HTFA 5AK5A 1LBSA 2NVWA 1Q77A 1CUWA 1ORVA 1TJPB 2FPXA 2O3JA 3IHKA 5FEMA 5TQJA 3ZEIA 2A78A 3IOBA 4G5FA 4AT1A 2P9TA 3HCPA 3HYRA 2W6NA 3F0TA 4QYTA 3EXFA 1C1DA 2QSUA 1R0ZA 4HDNA 1U80A 3CW9A 3FI0A 3L0PA 1IIRA 3DCIA 3DMDA 3Q40A 3UENA 4CGYA 1HE2A 1Z7BA 4KJXA 2NTVA 5B36A 1AZLA 1VCMA 1X1DA 2DPXA 3B2NA 4RHUA 4C6TA 5DM70 3MMXA 3PXAA 3SBOA 2VP6A 4HBZA 3JPYA 2W70A 1ZD2P 1ND6A 2CNKA 1FJHA 1WY7A 1P7YA 1VM6A 2J9XB 4ZQCB 2FEOA 2O2GA 3JTEA 1M74A 3SMQA 2DBVO 3TUIC 1CUAA 3PDIA 3KWLA 1QH1B 1YI8A 3M1YA 5E2AA 4M0EA 4PPYA 4CHGA 1LDEA 4GH5A 3LP8A 4J94A 5DV9A 3WYAA 4F06A 3G0IA 4QA9A 3AV0B 2V5AA 4DPLA 3MJ4A 4HPJB 4C01A 4CTNA 2FW7A 1O95D 5B1HA 1YCGA 3ZVLA 3LC2O 1SKYB 2PUDA 2GLUA 3F47A 2F17A 2ZYDA 4DYVA 1P4SA 1K68A 2AG1A 2VPZA 4KLRA 4KLNA 2FF5A 1RWKA 3I2JA 3LI2A 3LQ4A 3OIWA 4U5XA 4N8DA 4Z0PA 1UKCA 3LUHA 5EZ5A 2FR8C 3TOSA 4BKOA 5HWSA 1P0QA 3FCUB 4EUNA 4IW3B 2H9AA 2X1LA 4BZPA 2F3TA 4RC9A 4ENTA 1L4GA 5I4BA 4QNMA 2CB9A 3ER6A 3EQ9A 4HDMB 2VXYA 4KH0A 2WJVA 3MUEA 3NEPX 3GLIA 2Q3MA 2YJ5A 1NUSA 3VR3D 1UWVA 2OORC 2P27A 2XVYA 4NPHA 4QYSA 3HDYA 4UEQA 4H1WA 5CB4A 4OSEA 4DSNA 3TJZA 3Q11A 1GCIA 5H83A 1PS0A 3R7WA 3DWEX 2EWWA 3VTAA 3D81A 1DTSA 5DGIA 5HBGA 1NVKA 4YAEA 4F9GA 4F92B 3K92A 3RJ9A 3IPXA 3I6YA 4S35A 2UUOA 3O93A 5EYPB 4NEHB 2XZDA 3FWNA 4IIJB 2YTZA 3K6RA 4JJ7A 2V6BA 1XTRA 4YJ3B 4UDYX 1ZISA 1DBRA 4FFLA 5C34B 1MW8X 1J5PA 1TM5E 3MFQA 2VF2A 5E1MA 1G1MA 2PX4A 3ZNQA 3OZVA 2II6A 3NT4A 2G6BA 2CBXA 2DQKA 4YR7A 4QRE<