1KW1A

Crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-gulonate 6-phosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
publication title Homologous (beta/alpha)8-barrel enzymes that catalyze unrelated reactions: orotidine 5'-monophosphate decarboxylase and 3-keto-L-gulonate 6-phosphate decarboxylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 84
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2002-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kw1A00
1X1ZA 4XQ6A 1OFEA 5F4XA 4MZ8A 3W70A 5AFDA 4FX8A 3NAVA 4IXXA 3IRDA 4IOTA 1B4KA 3W7RA 3T55A 3BG9A 3ZFHA 1T0OA 1OX6A 3LHTA 3OBKA 3PS7A 3W2JA 2BLEA 3CC1A 2CZ5A 3CU2A 4MOZA 1D9EA 3SGUA 4DF2A 4UFJA 5BOOA 3GIYA 4GXMA 4KFOA 1DQXA 4R33A 3HGOA 3P81A 3TMQA 3HPSA 5E93A 4QSHA 1TJRA 1EWDA 4R7JA 4N6FA 4C1LA 1PVNA 1KM6A 4MZ1A 1KLZA 3E96A 3UZJA 1V7YA 5CKSA 3WK0A 4CCCA 4QISA 3TXZA 2QCDB 4Z1CA 2C3ZA 1VS1A 3N34A 4LVAA 3P7YA 4DBEA 3DI0A 2H8XA 1SZNA 3L9CA 3PWAA 4DXVA 1SO5A 2ZTKA 2C1HA 4CLMA 1NF7A 3HG2A 2QJIA 3WK3A 3C2VA 1ICQA 4JDYA 2C18A 2OCZA 1LTDA 4LY8A 3B8DA 3MYPA 1EP3A 1W5OA 3G1VA 3I7RA 4FNQA 3L0NA 4WJEA 3QW4B 1AG1O 3LBMA 1FWRA 1IXNA 1X1OA 1HUVA 1KTBA 4JX5A 3CLMA 2QAPA 2V0TA 3QZEA 2CZDA 3QFEA 5CZJA 1IIHA 1QDSA 4TX9A 1FCUA 5AYYA 3LLDA 3LBCA 4RCXA 3W22A 3M43A 3MYOA 4GUJA 2V30A 1FCQA 1JRBA 1VCFA 3QF0A 3NYZA 3R89A 1ME8A 3DFQA 2V5LA 1YDNA 5DBTA 5D02A 2NUXA 1QCWA 3EXSA 3W2LA 1O5KA 1NF0A 5DCDA 3GR7A 3ZWTA 3LXBA 4UFLA 1KTNA 3T78A 3W3OA 4H4IA 1VYPX 4LC6A 4MVAA 2QCEA 3F4NA 2A2IA 1C9DA 3VKJA 2OT0A 2TSYA 2QJHA 1UB3A 3PULA 3GK0A 3BARA 3R2GA 4HT3A 2OX1A 3UWWA 3NPXA 3A22A 1H7PA 3OVPA 4MFDA 1XBXA 3CEUA 1EP2A 1KFEA 1YTKA 2ZZ6A 1SPQA 5FEWA 4UTUA 3QC3A 5DY3A 4DBDA 4UFHA 4LU0A 5D38A 1FUYA 3C4UA 2DP3A 3DKJA 3RNDA 3NQ7A 5FEZA 4LVDA 4JYDA 1X6UA 2JGYA 2ZRWA 4K38A 2YFNA 1Z48A 1WX0A 2E1DA 1JCJA 1ADOA 3LHUA 1Y0EA 1XUUA 1TPVA 4JEQA 3G22A 4JN6A 1S5TA 4QITA 3O8AA 3BO9A 1I2PA 3W7IA 2A85A 2YCEA 4HNNA 2VEKA 1VLWA 1OX5A 3M5VA 2CLMA 3KVLA 1K7XA 1R2TA 4H3DA 4AHQA 1KM4A 1YXYA 2YSWA 1A5AA 1MEHA 1OFBA 1RV8A 4IX0A 4CNPA 1A5CA 1ZHAA 1XBVA 4FX7A 3R8RA 3IIOA 4QQ3A 1J5TA 5IBXA 4M5PA 3B0VC 3SECA 1AL8A 1EP1A 3MJYA 3GX9A 4IGHA 3CQ0A 3PG9A 4O14A 4BF9A 5DXYA 4NX5A 3OHIA 3BW2A 3A21A 4HIBA 1GTHA 1LLZA 3MP3A 3HIJA 4Y96A 1R47A 4JTTA 3DHFA 2NXIA 3U6WA 5F2LA 1G4PA 4MYAA 5K4ZA 1SW0A 4AB4A 4ZQNA 1KFCA 4KFNA 1C8VA 4PCFA 4JX6A 3W07A 4UNLA 3S9YA 5AHEA 3UD6A 2RDUA 3DGRA 3I65A 4FNRA 3LV5A 1RPXA 3S5ZA 3S5NA 4XKYA 3G0SA 2Y7EA 4PODA 4POCA 2CFFA 4AWUA 2R91A 1L9WA 4R34A 4LNYA 1I2QA 4N6EA 4OBTA 3LTPA 3L5LA 4OHQA 4XWUA 1IXOA 1XXXA 2DJLA 3WJWA 2P10A 2VELA 1GG1A 5L6UA 3FA5A 4ICNA 4JDBA 3QRHA 5C6MA 1KM1A 3E9AA 3EEGA 3ANYA 4HKPA 5LGZA 3FLUA 3EX2A 3DZ1A 3NZ1A 3HG3A 1O94A 1D3GA 1SUXA 2QUUA 2CU0A 4B5NA 4JX4A 2Y7DA 3O15A 1QR7A 4LVGA 1P5BA 7TIMA 3TC7A 1G7UA 4FXSA 4A22A 4DO5A 1K7EA 2LLEA 4LC8A 1P1XA 3UWVA 3KFTA 1SZEA 3EX1A 4CQAA 3O6YX 4YL2A 3EWBX 2H6RA 4FX6M 3F1QA 1VCVA 4K37A 1W56A 1KBJA 3KVKA 3FKRA 3F4WA 2YW3A 4MY8A 1H62A 3QPZA 1KV5A 4MJZA 1OK4A 2C15A 4BI6A 4LT9A 4N9BA 4ZQPA 3HG4A 4O4WA 4UR8A 2W0UA 1QPRA 1ICSA 3FFSA 4WXZA 5TIMA 5FF7A 4K8EA 1DOSA 3HGJA 1TPFA 1A5BA 5HWNA 3W2NA 1DHPA 3CM4A 3PBUA 4HPJA 5AC8A 3M44A 4HNVA 3VE7A 2VOMA 3UNDA 5G1YA 2J9YA 3LCXA 2C19A 1DV7A 4QNEA 2Q8ZA 1GQNA 4EF8A 4N02A 4BK9A 2QR6A 3W7GA 4NX0A 3O6CA 3UXAA 2QCGA 4E2BA 4UTWC 5LHFA 4IJBA 1TYGA 2NV1A 3I7QA 3SI9A 3S1VA 4CCDA 3P80A 2CLFA 3IV3A 4IPIA 1TPB1 1TQXA 2X2GA 3IGSA 5J5DA 3SZ8A 3VI2A 3NQDA 3TIMA 4NJHA 3CEPA 1PV8A 2QCNA 3NA8A 2NUYA 3LX9A 3B06A 1JULA 3G18A 2GJLA 3TAKA 5C5YA 2ATSA 3CB8A 3MBFA 5T26A 5EY5A 1BWLA 3C2FA 4W9TA 4M6QA 3K30A 3W7NA 3GLCA 3ATZA 5H2ZA 1MEWA 1ZFJA 3VCRA 5CZSA 3PUOA 2VEMA 4IMCA 1TQJA 3S1WA 3IIPA 4LW7A 3R13A 1PE1A 5EMUA 2ZBTA 4ALDA 1R2SA 3NL3A 3KOFA 1S3HA 3KRUA 4K7VA 4RXFA 3NQAA 4M19A 5BRBA 3GDTA 1W8SA 1SZGA 2YX0A 3LTYA 3LB0A 3ABOA 1TCDA 3HG5A 1UCWA 1IF2A 1Z44A 3T44A 8TIMA 1I4NA 1YXDA 2EF9A 1VHCA 4UTTA 3I6RA 3L65A 3LRMA 2ZCGA 3C6CA 1UUOA 4JS3A 1RQEA 4N9CA 3SW6A 4L4MA 3GDMA 3LI0A 1BEUA 3LCWA 4O50A 3P8JA 1DJNA 5K7JA 3MWAA 3OIXA 1EUNA 1XFBA 2WNQA 3HGSA 1SO3A 3W9ZA 1OYAA 3C2RA 1B4EA 3TQ0A 3W7DA 1LROA 1PL9A 3L67A 5F2IA 3L21A 3W74A 4N2YA 3LCHA 1B57A 5E1QA 1JRCA 3W1PA 5KSWA 1MSSA 5D33A 1C29A 3BV4A 1RZMA 4UMAA 3D0CA 1XI3A 4K39A 2TRSA 3W75A 5KZDA 4UR7A 1QOQA 1GZGA 1LBFA 2C13A 4GUIA 3SFKA 3C0JA 2QAFA 4M7TA 3TKFA 1G69A 1N7KA 1H1YA 1H63A 3L5MA 5LNWA 1Q6OA 2QDGA 2WNNA 2VFDA 1QPNA 2EKCA 1Q45A 1DVJA 1I8JA 3ATYA 3W7MA 2VFHA 5AHLA 5D2YA 4Q4KA 3T7VA 3W2UA 3A24A 4LRSA 1JVNA 3BG5A 3DFPA 3HBLA 4NQ1A 1GTEA 3QYQA 4QM1A 1J4EA 1GOXA 3ZWSA 2AQWA 2GQ8A 1TV5A 2NV2A 3P74A 4IMDA 3QW3A 2WV8A 4U28A 4ZVJA 4XUGA 1W3TA 1H51A 2WQPA 2YZRA 3GXNA 2FPVA 5D32A 3B0UX 3IIZA 2GVLA 2QJGA 1AMKA 2ZRZA 2PC4A 1UASA 3P84A 3VNDA 3GKAA 1HO4A 2WSYA 3HOJA 5FEXA 4PFMA 4G1KA 4OE7A 3UPWA 5I3GA 1ICPA 1KM0A 3Q37A 4WY0A 1TB3A 2QCCA 5K9XA 4M6VA 3LXAA 4XKYB 4HPXA 1NVMA 1DORA 2WKJA 3QQ0A 2Y6ZA 1MEIA 4CNOA 3UYCA 3ELFA 6ALDA 1OJXA 4KWVA 1SZFA 4TR9A 3MW7A 4JR5A 2Z1BA 3DFNA 3W7LA 2R8WA 4K36A 1M5WA 1OX4A 3W1NA 4JY8A 3QSRA 3FJ6A 2B0MA 2ZRYA 4QAIA 2KZHA 2EHHA 1X8FA 3I7SA 4O15A 4JY9A 1H50A 1VYRA 2ALDA 2DJXA 4NNCA 1OABA 1S5WA 2ISWA 5CSRA 2WPBA 2NXGA 1ZY9A 3WK1A 1QMLA 3W7HA 1A50A 3GYEA 3C52A 3ZR4A 2PE4A 4FHAA 2DZWA 2PRHA 5BMXA 1K3UA 5K9DA 4WOQA 5IBXC 3UWUA 2FDSA 4JGDA 2JK2A 1TREA 4UTIA 5F2MA 4CNNA 6TIMA 4ADUA 3G1YA 4OT7A 3UWYA 2Y7FA 4UFMA 1FCVA 2DORA 2VKZG 3PBYA 4ZMGA 1HO1A 4EWND 3W1RA 4A3UA 3N14A 3RU6A 2GVJA 3YPIA 3DXIA 3BK0A 3TFCA 2GOUA 2VFIA 1VQTA 3KRSA 5G2IA 4HNUA 4DQWA 2ZZ1A 5EKYA 1PS9A 4JTJA 3T40A 2I9EA 2DZXA 3TJXA 3N2MA 1W5MA 5LNRA 1PCKA 3KXQA 1LBLA 5D37A 5LNUA 5CPNA 2YFOA 2Y89A 1F6KA 3NL6A 5A5WA 1YTDA 4O57A 3RK8A 1FWWA 3LRLA 2XN0A 3U8GA 2E6AA 3M16A 1XDLA 3LRKA 3NQGA 5GVJA 3CIWA 5G2WA 4OU1A 4AH7A 5CPMA 1DBTA 5I3IA 4NXSA 5F1VA 2CLKA 1DL3A 3TQVA 4GUHA 4JNMA 1LDCA 5DBUA 5D09A 5KTLA 2ZTJA 3M47A 3E0IA 3C2OA 5LSMA 5G1TA 2B4GA 4A29A 3M5YA 3BGJA 3EX6A 4Z1BA 3UPBA 1XUZA 3TQKA 3UQNA 2ISSA 5KZEA 2CLLA 1YDVA 4Z1AA 1XC4A 1R30A 2Y85A 3W7PA 1ZALA 4UTKA 3TW7A 2NLIA 4MUZA 5AB3A 5BMWA 5KINA 5IM51 2V81A 4EOUA 3TCEA 2ZA3A 1U83A 3HF3A 2E6DA 2FLIA 3B05A 3FIGA 5U7SA 1YADA 2FTPA 1G4EA 3EWXA 1H7XA 3N9SA 1LOQA 3LOTA 5F4WA 4R53A 2WNZA 1OHLA 4Y90A 3UWZA 5G2HA 3NO5A 4WD0A 2FPTA 1O5XA 4H6KA 5CG7A 1VZWA 2R14A 3R5EA 5EPDA 2Q3RA 1FBAA 3DU0A 1ZNNA 3NL2A 2NZLA 2XFWA 1LBMA 1W0MA 4S2CA 5BNKA 3ABSA 1XBYA 1KFJA 2G97A 3STEA 2BX7A 3W1MA 1OK6A 4LS2A 4CQ8A 4JXCA 3MI2A 1FCBA 1TPUA 3ABRA 3KRZA 3HGRA 3IGUA 3PUEA 2QCHA 4IMFA 3C2EA 2FB2A 4YMZA 2NWSA 4UNKA 3T4CA 4DPQA 3N2XA 4S2BA 3TAOA 5KITA 1TO3A 4UFKA 1JUKA 1H60A 4RLIA 4MY1A 2B7QA 3NOEA 3TROA 1G4TA 4AWTA 3O63A 3L0GA 4IWWA 3GAYA 2RHGA 1IIGA 3HQ1A 3BG3A 4MZYA 1GYLA 4JTIA 4FXRA 4TMCA 1Z41A 4YWIA 2HS8A 3LHZA 1MZHA 4ZQRA 3SIZA 2HS6A 3MO7A 3RF9A 1EX5A 1KW1A 2JKAA 1AK5A 1UJPA 1KA9F 1WYIA 2VFEA 4BWLA 4N4PA 4AF0B 1CI1A 5D2VA 2YYTA 3NEVA 2E6YA 1H7WA 1HTIA 3I68A 2ZFAA 4UUIA 4O12A 1G4SA 5DN1A 1SO4A 4I7VA 3PBWA 4NU7A 4PEKA 4JTKA 2TPSA 3PG8A 4LUIA 4RZ4A 2VC6A 3W6YA 4ORIA 4GNJA 1L6YA 4UC5A 5DCEA 2RDWA 4XZ9A 1KFLA 1H7OA 3QMSA 2GUUA 5L9FA 1EA0A 4IMEA 1TSIA 1F6PA 3W7KA 1JJKA 1TRDA 1LOSA 2DU2A 1TV7A 1EIXA 3W88A 3P62A 1K8YA 3OA3A 1LZOA 1ONRA 1JQXA 1K8XA 4O16A 4I9AA 3NNTA 3QEZA 4WUIA 4I7UA 3H53A 5AHNA 2J9ZA 2Y62A 1GG0A 4YCOA 3SR7A 2X1TA 4XTDA 2ISVA 5AC7A 4JIPA 2C0AA 1LRNA 3MP5A 3PB0A 1WA3A 4QNWA 3NZRA 1Q3NA 3M0ZA 1N8FA 1KFBA 2NXHA 2X1RA 1JCLA 1KM3A 5F4SA 3FEMA 3DAQA 5AHIA 2CLIA 3R12A 4WZHA 4KKXA 5EBUA 3LHWA 3SGZA 5HUPA 3TK7A 4K7YA 5D2WA 1OF6A 3QJAA 1M7PA 2O7QA 3L68A 2FIQA 5MHBA 1W5PA 1H7RA 1QO5A 3P5ZA 2EAWA 1HG3A 4NZJA 1H1ZA 1QAPA 1GJPA 3C56A 3G1XA 4U4MA 4O1BA 4UTLA 2WO5A 5D30A 3PSVA 1XBZA 2FFCA 4CQ9A 1B9BA 2CLHA 1VGAA 3TH6A 5LZLA 1V5XA 3W7JA 4AHPA 4LS0A 2X1UA 4D2JA 3W1TA 5C2XA 3STGA 4GUGA 2PURA 3GZ3A 5CZ0A 4JIQA 2UV8G 3MHFA 3NPWA 2V5BA 4RR4A 1TRIA 3PB2A 5K4XA 4NUWA 3TSBA 1TTIA 4X2RA 4ZQMA 3M5XA 3DKLA 4ADTA 1WXJA 4ML9A 5EL1A 3Q94A 4X22A 3U2OA 2BXVA 4WY0F 3HB9A 1VR6A 3IIXA 1PHQA 1W3NA 4LUJA 4NT0A 1XM3A 3DHDA 4FIQA 1TPH1 4N9EA 1L6WA 3BLEA 5F1UA 1DKWA 4EIVA 2F84A 3PAJA 3M5ZA 2Z2UA 1GVSA 2ABBA 1RQBA 3Q58A 1CW2A 1N55A 1MO0A 1VYSX 1F76A 2G95A 3PF3A 1XCFA 3LTSA 2O7SA 4IMGA 2GQ9A 5FESA 3TMLA 2GJNA 1LYXA 4JTSA 2E5CA 4O13A 2CLOA 2G5WA 3S0CA 4WX2A 4MLJA 1PHWA 1AW5A 3GVGA 1GT8A 4L4LA 2DZPA 1W37A 2A1YA 4ZL1A 3A5FA 1ML1A 3W76A 4AAJA 2YW4A 2X1SA 4S1FA 1K02A 3P82A 3TV8A 3P61A 5U4NA 4DPPA 3IVUA 4OQVA 2I1OA 3O1NA 1FQ0A 1QNVA 4IPJA 5KMYA 1B3OA 1EUAA 3KVMA 1JCYA 3AO0A 5C54A 3NQFA 1OFRA 2A6NA 3DFSA 2XN2A 2J6XA 3O16A 2DZUA 5KZMA 5LNSA 2JKEA 1SSDA 1WBJA 1AW1A 2WSRA 3CHVA 3QPYA 4NXKA 2A7PA 2E5BA 1EPXA 3SY5A 1ZENA 1EEPA 3TJLA 4O8RA 3CWNA 1FXQA 1ZAIA 2PRMA 1Q6RA 4AVFA 2ZZ4A 4E0CA 1L6SA 1VC4A 3QMRA 5FF2A 2C14A 4MFEA 1QOPA 5HULA 4WQ6A 3KX6A 4GBUA 1FY6A 3DFTA 1YXCA 4MKNA 3F03K 3NL5A 2VFFA 1ME7A 3O6DA 3STFA 1G7VA 2ZRVA 3G0XA 3UXDA 2RH9A 5CGQA 2V2CA 3EWUA 2BZNA 1GPWA 3UZ5A 1PIIA 2BWGA 4PL1A 2I14A 1ZJIA 2V2HA 3TXVA 4RZ6A 2J27A 3NQCA 1TPDA 4X3ZA 2HSAA 1FDYA 2B7OA 2AGKA 1U5JA 5K9CA 5CZTA 2OMAA 1KFKA 2QCMA 2ZZ5A 2QF7A 3VFLA 1RQHA 1TIMA 1EWEA 2H90A 3G3MA 3G1FA 2W6RA 4A2RA 1SSGA 4LV9A 2E5DA 2H8ZA 3NM3A 1YDOA 2OZ0A 4AWSA 2ZA1A 2Y7GA 3LHVA 2Y61A 3LLFA 1JCMP 1GYNA 1KM2A 5HR6A 2ZRXA 1K7FA 2NX3A 5LNVA 3WJSA 1VHNA 4JYFA 2OT1A 4M7SA 4UMBA 4OWGA 4UMCA 3LCGA 1WAUA 4LTSA 1P0NA 1S5VA 3N9RA 3TU9A 1TPEA 1F7BA 4A2SA 4ZZ9A 4MIMA 4OGZA 3TUUA 4LS1A 1OVDA 2WJZA 4O0KA 3TA6A 3TW6A 1NSJA 3M41A 3ABQA 2QCLA 3N19B 4GUFA 2CZEA 3C3NA 4Y6GA 3VE9A 4TIMA 4NNBA 3ZS4A 5D2XA 3W73A 3V75A 3THAA 2Y63A 3L66A 1JR1A 3TX9A 4BI5A 4GRSA 3PVFA 4YLWA 1FWSA 5LGXA 1ME9A 3GDKA 5C55A 3GNNA 3B03A 2A7RA 2A21A 3TSMA 3W1AA 2YXGA 4NJIA 1WOAA 2YYUA 4Q33A 3W1UA 1OFQA 4C1KA 3GXPA 4NZFA 1WDWA 1L2UA 1LCOA 4PA8A 1GWJA 1OF8A 4X9SA 3G3DA 1GVOA 4GJ1A 4OV4A 4ZQCA 1ALDA 3O05A 1GVQA 3OVRA 3LDVA 2Y88A 4TO8A 2B7PA 1YLVA 4PTNA 4DO4A 1FDZA 1IGSA 3LERA 3B04A 3MI6A 1WBHA 4PH6A 4BWLC 1EB3A 1SQ7A 3USBA 4YXGA 4HN4A 1Q6LA 3W1XA 2VENA 5FEPA 4N4QA 1G67A 3WFAA 4ONVA 1HFBA 3W1QA 4UCGA 3LM7A 5DLCA 1M7OA 3NM1A 2Z0IA 2ZA2A 1KM5A 3NQMA 3NDOA 2Q3OA 2A7NA 3GDLA 1ZAJA 2J9XA 2NWRA 1T96A 3MP4A 4RXGA 2FJKA 4EF9A 4J9JA 1TTJA 3DI1A 4QIUA 3EKZA 3W83A 5HJLA 1R46A 1KTCA 3LGEA 3O07A 3EXTA 3EB2A 1QPOA 5A8GA 4O1CA 2ZYFA 4FB7A 1CX9A 3GR8A 4Y9AA 5BW6A 2BSLA 4NJJA 2ZZ2A 3NQEA 4NJKA 3GNDA 3DH7A 1SO6A 1TPWA 3W1LA 3W72A 3S6DA 4RX0A 2DZTA 3TSDA 3BLIA 4Z0JA 2VXNA 3MBDA 2CLEA 1VLIA 4RZ5A 2HTMA 3OEXA 1RVGA 4JD4A 3SSJA 1A53A 1YYAA 3H55A 3RLUA 4Z08A 4JTLA 2E77A 1RD5A 1XDMA 4WXYA 3W84A 1W1ZA 4MPQA 2TMDA 4N9DA 5I3FA 3WJZA 1XKYA 4DELA 3W85A 2ZQ0A 2Z6IA 1TTQA 1YTEA 3QQ1A 5EYWA 1O60A 5AHMA 3G1DA 3EXRA 2JKPA 4BR1A 2AAMA 3GDRA 4IQLA 2DZSA 1I2RA 2X30A 4FEZA 3BW4A 3HO8A 1BTMA 3BPWA 5ABTA 5CPOA 1P4CA 1I45A 1OFOA 1YPFA 4RK8A 1TJPA 2VEIA 2CW6A 3CWOX 3MI3A 1H5YA 3MHGA 3EWYA 4FNPA 4GWEA 4O54A 1VPXA 3GXTA 3N73A 1JUBA 2YR1A 4E2DA 4O19A 3E49A 2XN1A 3N3MA 1TV8A 1H61A 1K03A 3RMJA 5AYZA 3CTLA 1THFD 1FWTA 3FJLA 3GKFA 5DY2A 3PM6A 3LCFA 3EWWA 3L5AA 3M1ZA 4UXDA 5EA9A 3DBPA 1TTPA 2GQAA 4JTEA 4Z1DA 3SJ3A 4O10A 2V8ZA 1KBIA 2E68A 4GFSA 1O95A 4O0ZA 2J24A 2G96A 5LKYA 4UIOA 3B4UA 5J5RA 3BW3A 4XBSA 4O1AA 3W71A 5G4WA 4TMBA 3W86A 1OG0A 4WOZA 3MMTA 4O52A 5F2GA 4MLRA 2ATMA 2GPTA 3IVTA 3M7WA 1W3IA 1Q6QA 3S1XA 2F7FA 2JBMA 3CPRA 4YCPA 1KV8A 1X7FA 4P2VA 1JCNA 4UTTC 2YDAA 3LI1A 3HMJG 4QJ1A 2PRLA 4RV8A 1SR9A 3W7OA 3S5YA 3L0KA 1LLWA 3RFAA 3PC0A 2DZVA 3FYPA 1QWGA 3KVJA 3G8RA 3THQA 3NQVA 1M6JA 3QM3A 1GVFA 4WY0B 2QKFA 4XTIA 3IVSA 4RKAA 1DJQA 1F5ZA 5SWUA 2BTMA 5FF4A 3O06A 4DF1A 1GEQA 4ADSA 5AOUA 4Y8FA 1UBSA 2A6LA 3L2IA 2RKXA 5HINA 5FF3A 4FF7A 3G24A 3TC6A 2QEZA 3A9IA 2RFGA 3IEBA 4PL2A 1UUMA 3NXFA 1J2WA 3NGJA 3S1UA 1VH7A 3P5YA 4ZQOA 4O17A 2QCFA 2Q8LA 5DELA 2QCDA 1TMHA 4LVFA 1OX4B 2QUTA 4IX2A 1JCXA 1NFBA 4JTFA 2ZZ3A 3P67A 4NVTA 3P8IA 4NJGA 1WV2A 3V1PA 1SU5A 2EPHA 3UY7A 1T99A 1LRQA 2E09A 4JYEA 4K6AA 3MHUA 4MJMA 1FX6A 3PUDA 3MUXA 3G1SA 3DENA 1QO2A 2P0OA 4Z0SA 3EX3A 2C16A 2ZZ7A 4O4VA 2GVGA 1XL9A 1GVRA 3C61A 4JTGA 3LCLA 2YPIA 5FF0A 1DQWA 3G1HA 4HHPA 4EVZA 1BWKA 1OYCA 2HMCA 3PSWA 1T8XA 3QSTA 4K8HA 3A23A 4IXHA 4UTMA 1H7NA 1LP6A 2IQTA 3RLVA 4O28A 1OFAA 5CSSA 5D04C 3Q2DA 3WJYA 1PCWA 1WOBA 2V82A 4UFIA 3BLFA 4KWWA 3W7CA 4ORMA 3PR2A 4FIRA 3IIVA 3TFXA 3NR0A 1G6CA 3STCA 1F05A 2NUWA 3CT7A 5HUOA 2NX1A 3W87A 1W5QA 2Z6JA 4KFPA 4O11A 5CPLA 1D3HA 2ABAA 3W7EA 1OYBA 2Y70A 4PC8A 3G0UA 2J88A 4E38A 4HNTA 3FS2A 5HWJA 3UY8A 3HPZA 3HPXA 3LHYA 4JICA 3TDFA 4LV4A 1JQVA 3WK2A 2TYSA 1P0KA 2NX9A 1HL2A 2PCQA 2R94A 2FQIA 5LHEA 5H91A 1QPQA 2A5HA 1FXPA 2WSQA 4DEFA 2ZRUA 3TNOA 4RJEA 2JGQA 3GAKA 4LVBA 4P61A 1WQ5A 4GC4A 5I3KA 1NEYA 4DO6A 4JTHA 1VJIA 3TE9A 5FI8A 5HQEA 3INPA 5HNRA 5AHFA 3W2MA 4LOCA 5I3HA 2OJPA 4A21A 2QUVA 2A0NA 3NQ2A 5K3VA 2QDHA 4I7WA 3EWZA 5DXXA 2A4AA 4HSOA 2H3BA 4BFAA 3WJXA 4O18A 3S8HA 4HSNA 3FOKA 4MY9A 4M6PA 2WOQA 1IXQA 1QFEA 3CIXA 3JR2A 1JUEA 3HJZA 4BI7A 1SFJA 3DFOA 3LXCA 5HMSA 1I2OA 1LRTA 1F2JA 3BVJA 5D05A 4LRTA 1I2NA 2YGYA 4AHOA 1IXPA 1SFLA 1SW3A 2W79A 5D03A 1W54A 4FO4A 3W7QA 3QH2A 1ZAHA 3AJXA 2EGZA 4O1DA 3E12A 1A5SA 5TQLA 4GE8A 1YPIA 2CZFA 4UTJA 4CCEA 4AMAA 5DCBA 5I3JA 2V9DA 3NQ6A 3OVQA 3LCIA 1Z42A 2D73A 2H3DA 3EKLA 4DF0A 1TPC1 2ZDRA 3OG3A 5AYXA 4MYXA 3M6YA 4FNTA 3P60A 1NAL1 2FPYA 4IUOA 3GB6A 3NPUA 3G1AA 2CWNA 2C6QA 4NNAA 1AW2A 4LWWA 1W5NA 3S42A 5HR7A 1F74A 3TR2A 1BKSA 3FKKA 5AN7A 3FYOA 3KHJA 4XBKA 5TBOA 5AC6A 1R2RA 4JTUA 3G8EA 2X16A 2B7NA 5E0KA 1OFDA 1AL7A 4TU1A 1VRDA 1KLYA 2RDTA 1FDJA 1FWNA 2P1FA 3E02A 3QMTA 1W31A 1OFPA 2FB3A 3JRKA 4O53A 3PY2A 1F73A 3EX4A 5D2TA 1ZCOA 2E6FA 3C8FA 3IGXA 5HWMA 1LORA 4UTWA 4AXKA 1O4UA 1K8ZA 5G4EA 4AEOA 4AF0A 3NPVA 3JS3A 4Q32A 3W23A 3M9YA 3W2KA 1MXSA 1SW7A 3LV6A 3NVTA 1E51A 4OV9A 3S5OA 1LOLA 4FNSA 4UTHA 3NG3A 3KAOA 1RR2A 4FNUA 3B0PA 3NQ8A 1VCGA 2VEPA 2VFGA 3BGGA 2V2DA 5G5IA 3UWQA 5K2ZA 3A5VA 3PBVA 3H54A 1LM1A
chains in the Genus database with same CATH superfamily
1X1ZA 2A3EA 2HISA 4YTRA 4IXXA 4Q4QA 4IOTA 3VNMA 2DSZA 3T55A 2D3NA 2XGZA 4XUYA 4IL0A 3SO7A 3TZFA 3R10A 3WQ4A 2NQ5A 1E56A 2G3JA 4FALA 4DY1A 3CASA 4D71A 1FH9A 2WB5A 3GG8A 2CZ5A 2KAUC 4INFA 4GVGA 3SGUA 2OQHA 5BOOA 5DMMA 3LG3A 1DQXA 1AD1A 1W9XA 4ZTXA 3HPSA 4V28A 4WLCA 3WQGA 4QR6A 5E93A 1NM9A 4MNMA 1TJRA 3A12A 4C1LA 2V5JA 1PTAA 1XRVA 3UZJA 4E8DA 1YDYA 1V7YA 5CKSA 4CCZA 3WK0A 4CCCA 3VK5A 4KGLA 1UD6A 1YNQA 2H8XA 3QHMA 4CLMA 3EOSA 1U1HA 2QJIA 3IJIA 2ZICA 4EXAA 4A3RA 4HNCA 3MB9A 3TTEA 4LY8A 3MYPA 1W3JA 3PBGA 4QROA 5LA1A 1MW0A 4V1XA 3HJEA 4WJEA 9XIMA 3PFMA 3QW4B 2HE5A 3WL1A 1SFTA 2DUXA 1HUVA 2VX4A 3DFHA 4AWEA 2OEMA 2V0TA 1CBGA 1UUQA 2XWDA 3SDOA 2E67A 4ZSTA 2XIIA 3AALA 3GBDA 3A13A 2WJEA 4ECLA 2JEPA 2AQOA 4FA3A 1FCUA 3M0IA 2HBVA 3M43A 4LCSA 2O55A 4ATLA 2HK1A 1KXTA 1FCQA 1X6NA 4GJJA 3QF0A 3R89A 1RPKA 2BVWA 1FVPA 5DBTA 3QR0A 4QJ5B 4W87A 2G4JA 1QCWA 3EXSA 2F6XA 3U9IA 1O5KA 1NF0A 5DCDA 1NIUA 3ES7A 3HQPA 2CKSA 3ZWTA 1KTNA 2A3HA 3F4NA 1ODUA 4IIEA 2TSYA 1BG4A 1JF5A 4JIIX 3GK0A 3R2GA 1TA3A 3UWWA 1REQB 4MFDA 3ZJ6A 3CL8A 3CEUA 4I90A 4YNGA 3TN4A 2ZZ6A 4HYVA 5FEWA 3QC3A 5A6SA 4UFHA 5AVNA 5D38A 4Q6JA 3RNDA 3JU2A 3SN1A 1EFZA 3APYA 4K38A 3N6HA 1WX0A 4JFSA 4S3KA 1ADOA 3MKKA 2Y2WA 2VGFA 1XUUA 3G22A 4JN6A 1WO2A 4CEXC 3OQ8A 2JEQA 3BO9A 4YVPA 1W1A1 3WLKX 2REQA 2CEQA 1R2TA 1A3WA 1IGWA 1DTUA 3M0KA 4L1XA 5CC6A 1KM4A 3CNYA 5CZKA 3LZ3A 2QJNA 2YSWA 4I8DA 4DWSD 3NVDA 1JG9A 4IJCA 4CNPA 1FWGC 1XBVA 3QZ6A 3FDKA 1GKPA 1JPMA 3B0VC 3Q65A 1EP1A 3WQ6A 4GABA 1YRRA 2UBPC 4BF9A 2PDYA 3APTA 3M6DA 1A3HA 3FAWA 2QNEA 1EHAA 5A6BA 1KCKA 3OHIA 2A3LA 1ISYA 4LAZA 4PMYA 1QNPA 3HIJA 3SEPA 5A8NA 4JTTA 4DBSA 4LAUA 4BA0A 4MYAA 5K4ZA 3ZR6A 3TYDA 3NDZA 1SW0A 1BPLB 4OJYA 2FHCA 4LB4A 1IZCA 2G50A 4I5UA 3WN6A 2RDUA 3I65A 1OIFA 1AQMA 3S5ZA 2ZX7A 1HKWA 4AWUA 3PTDA 4C60A 5FCZA 1R6WA 2FJUB 4LNYA 2J7HA 2Z25A 3LU2A 2QV4A 5CG0A 1XXXA 2P10A 1GG1A 3FA5A 2YJQA 3QRHA 1KM1A 3E9AA 2X7VA 3EBVA 1TX0A 4HKPA 3BMXA 1XINA 1SUXA 2QUUA 3DYOA 4JNZA 4A8IA 2CU0A 2DSKA 3BAJA 4JZ5A 4LVGA 7TIMA 1JGMA 3NFUA 3WUBA 1V3IA 3VU2A 1XRFA 2D0GA 4YL2A 3AUOA 1Z89A 3GC5A 1LL6A 3BZJA 2YLLA 1B3WA 2YL8A 1I1WA 1H62A 1FWEC 1O6IA 3URNA 1UQYA 2NVAA 4A8RA 2PAJA 4GH3A 4WXZA 4S3FA 5TIMA 5FF7A 1DOSA 1TPFA 3WLQA 4CD6A 1DHPA 4XKMA 3PBUA 4HNVA 2J9YA 4K68A 2OWXA 1RALA 2C19A 3BZGA 3WLTA 3E2QA 2Q8ZA 2QR6A 3WL0A 2YDRA 2QCGA 5LA0A 3AMGA 1TYGA 2NV1A 1PTDA 4KW2A 2CLFA 4DAFA 4HK5A 4TV5A 1ZJHA 3WQCA 1AVAA 3MSRA 3LX9A 2IUZA 4QG9A 3MC5A 2AQVA 4ACYA 4Z2HA 2ATSA 4GIYA 1YHTA 1O12A 2ICSA 2XH0A 2CC0A 1C92A 4HU4A 3ATZA 1MEWA 3VCRA 3GYCA 1TQJA 2YXOA 4CQDA 1GVIA 1NFGA 4ZOCA 2X05A 3R13A 4JFUA 2YOCA 2E8YA 3T2QA 1V6UA 4OOZA 3J7HA 3KOFA 1NP0A 4M19A 1W8SA 1SZGA 1R0MA 1TCDA 1IF2A 1Z44A 2Y4SA 2IPFA 1YXDA 2VL4A 4TVDA 2WHKA 3I6RA 3L65A 2I5IA 1UR1A 3PK7A 3OO2A 4JS3A 1K9TA 3UVAA 3SW6A 1XGEA 3WNOA 4H8NA 1S2AA 3LI0A 1BEUA 3LCWA 4HCHA 4O50A 4XB3A 1PPIA 4LY4A 4XZIA 4FR1A 1Q2RA 1XC6A 3HGSA 3W9ZA 3C2RA 1B4EA 3LMZA 3TQ0A 1LROA 1PL9A 3L67A 3EA1A 4HTYA 3L21A 3W74A 3CLWA 4W7VA 3WH7A 4HPNA 4DNMA 1GOQA 1Q63A 4UMAA 5C9RA 4GVFA 1XI3A 3CWHA 1BG9A 3KBMA 2V68A 2WHMA 1JPHA 2VNCA 1LBFA 3AZSA 2C13A 1O5QA 4W86A 3B8VA 1H1YA 2A3CA 3BAKA 1ITCA 1OC5A 1Q45A 1I8JA 5DT5A 3T7VA 5A6TC 3KBVA 3UFYA 1RXOB 1LQAA 4LRSA 1JVNA 5MKGA 1TR1A 1POJA 2WVVB 1FFRA 1W3KA 3KL3A 4QM1A 3N2CA 4M1RA 2AQWA 2QDEA 4DJFA 4KEVA 4ZVJA 1H51A 1EOMA 5HQMA 3FHQA 3CQKA 3GXNA 2FPVA 4X0NA 5D32A 3H7UA 1V6VA 2GVLA 3UXKA 2E25A 2ZRZA 2PC4A 1UASA 3P84A 4CEUC 2YBTA 4GIAA 4QAWA 4PFMA 1DIKA 4FZIA 3UPWA 1ICPA 1KM0A 4P7QA 1EOKA 4BF5A 2QCCA 1PZ0A 1TX2A 1H5VA 2XSXA 2VDHA 1NVMA 1EHNA 2WKJA 3QQ0A 1MEIA 1JDFA 9CGTA 2VZSA 3ELFA 1OQFA 2GJXB 4PTMA 2Y24A 4KWVA 4WGHA 4JR5A 2Z1BA 1M03A 3UETA 3UJFA 5AZ0A 3E0FA 2XM2A 2R8WA 4K36A 4JNYA 2VGBA 4ZTYA 4AXNA 2VX5A 2AL1A 4NNCA 1OABA 1QHZA 2ISWA 5CSRA 2FHFA 3RILA 2NXGA 2E4TA 3WK1A 3W7HA 2EO7A 3ZR4A 1UWTA 2DZWA 3H24A 5K9DA 1X1NA 4WOQA 4X0VA 3UR5A 3UWUA 3B3DA 4W5UA 1TREA 3BJFA 1VBHA 2PDQA 1ZBWA 1CB7B 4UBPC 4FXFA 2EG6A 1GK8A 4JAWA 2Y7FA 4UFMA 1FCVA 3ORWA 3PBYA 2YB4A 1T8QA 3YPIA 2GOUA 3RX2A 2BOEX 1VQTA 4HNUA 2YCIX 3URAA 5EKYA 3T40A 4NILA 1RP9A 3TJXA 1XLCA 2R1MA 5I7GA 2V67A 3N13A 3FAXA 4PUMA 3WUEA 5CPNA 3VD9A 1F6KA 5A5WA 3SN0A 3LMYA 3RK8A 3LRLA 2FHBA 3WBXA 3E1F1 5GVJA 5G2WA 3N18A 4AH7A 2O0TA 3MMWA 3JW7A 2CITA 1DL3A 1LL4A 5FJJA 1JPIA 4YVVA 4IZGA 2ZTJA 5JBDA 3A3XA 1RBOB 2B4GA 4YTQA 2XIOA 4Q8PA 3LYEA 3M5YA 2XSAA 3BGJA 1V08A 2BHUA 1W9PA 4QDWA 1R30A 2Y85A 3W7PA 1ZALA 3WLLA 4PUNA 2CHNA 2GWGA 5AB3A 2V81A 3BCFA 2E6DA 2FLIA 3IJ8A 5CCZA 4DHGA 3F2CA 4XZLX 2X0SA 3LOTA 4R53A 2WNZA 4Y90A 3NO5A 3IUIA 3TTOA 1VZWA 3N3TA 5CBIA 1NELA 3NL2A 3S3GA 4GISA 2NZLA 3U7BA 1E4NA 4HB7A 4H7ZA 1Z69A 1AZ2A 1HKJA 1LBMA 1W0MA 5BNKA 5BU9A 3ABSA 1WUFA 2G97A 2BX7A 1UKQA 3LZ5A 1OK6A 4M3PA 4CQ8A 1FH7A 3SBFA 2BGNE 4NG3A 1UP3A 3ABRA 3HGRA 3IGUA 2CHRA 4LUTA 3PUEA 1E6PA 4IMFA 1UJQA 3FW6A 3IARA 1PJ9A 3PUGA 5JIWA 3GQYA 1XCWA 4S2BA 1HVQA 1RJQA 3TAOA 1JUKA 1H41A 4J3SA 3TROA 4FP1A 3U7VA 2D0FA 3T42A 1US3A 1ZRQA 4X63A 4O1FA 1GPFA 4CNSA 3CL6A 4MZYA 3E0WA 4JTIA 4TMCA 3LHZA 3SIZA 3KW3A 1AK5A 3FEQA 1Y5XA 1NDWA 2PDXA 1WYIA 3N12A 1CI1A 2YYTA 4HA3A 4I3GA 5BOFA 2YDSA 2WMGA 4UUIA 4AZBA 3T6CA 4J40A 1W2PA 3GVRA 1P48A 4GNJA 3D5HA 1L6YA 4UC5A 1UH2A 1KFLA 3QMSA 1H09A 7PTDA 2GUUA 1EA0A 3TNBA 2Y8UA 4EX4A 4IMEA 3AICA 2HVOA 2VMFA 3GE7A 5ECVA 1CGVA 3GXMA 3IGHX 2DU2A 4YS1A 1TV7A 1UOZA 4KWOA 3TW9A 2W67A 3OA3A 1M3UA 1G1YA 1UQZA 1GHRA 4O16A 3UU0A 2PP0A 5EB8A 4H2HA 1U30A 3NNTA 3QEZA 2WANA 2VP8A 3H53A 2J9ZA 4F66A 2YA0A 4GQGA 4L65A 1Z32X 3I6TA 4G5DA 3UESA 2ISVA 2E28A 4OUEA 4WJXA 3SADA 3ITTA 2Y8KA 3T05A 1CPUA 3V0SA 3ZVHB 5M2FX 5AYBA 1N8FA 1S3TC 1BSIA 4HK6A 1JZ4A 1KFBA 2NXHA 3IUDA 2X1RA 3CV6A 4HMDA 1E6XM 2D23A 2BS9A 1JCTA 2TODA 2WCGA 4WZHA 1ZL1A 5EBUA 4BF7A 7ODCA 5DANA 1ZS2A 3FVMA 1M7PA 2O7QA 4CVWA 3CBWA 2FIQA 1P43A 1QO5A 3ABZA 4P7OA 3CAVA 3P5ZA 3ARZA 1QAPA 2RDXA 1GJPA 3C56A 3AI0A 1KRCC 1IEQA 1XBZA 4ROPA 1W17A 1K77A 7ENLA 3UG4A 1A0DA 3RXZA 3WKZA 4LS0A 1OADA 4E4FA 1W3LA 1KCLA 3STGA 2PURA 1A5NC 3A64A 3S2JA 3MHFA 4AY7A 2XFFA 1RY8A 1XYMA 4RR4A 1TRIA 3PB2A 3CH9A 1TTIA 4X2RA 4DB7A 1Q6GA 4YTTA 4B3ZA 4D8AA 2BXVA 1QNQA 2PWUA 2ZWZA 1REQA 1IHIA 3LPGA 1EDGA 1XM3A 3DHDA 1W9UA 2FZMA 2WBGA 4LUSB 4N9EA 1L6WA 2OXNA 4LBSA 5HOSA 2V3EA 3PAJA 1FP8A 2Z2UA 1V8EA 3LS9A 4FXJA 1VENA 3Q58A 1CW2A 3QYSA 1N55A 5FOOA 3PJWA 2G95A 1MI3A 3LTSA 3WDRA 2O7SA 2POTA 3FVDA 3TYUA 1TFVA 2I16A 3VKCA 3TMLA 1PKLA 4YIWA 2G5WA 3GVGA 1TJ0A 3ZIZA 3CAQA 3AROA 2BHYA 2A1YA 3P6LA 3W76A 3ZM8A 1J0ZA 3P82A 4A3YA 4E8CA 3P61A 2GOKA 1C9WA 1DWJM 1FQ0A 3OGVA 4F40A 3KS6A 3VX1A 1IT8A 1Q2SA 3AO0A 3KP0A 1OFRA 2A6NA 4DIAA 3DFSA 3O16A 2W63A 5LNSA 3HMCA 5F7UA 3AWNA 3CHVA 5IHSA 1CZ1A 1QU4A 2A7PA 2NT1A 4E8GA 1ZENA 3QV7A 4O8RA 3AMCA 3FXGA 3V7PA 2PRMA 1Q6RA 3RPTA 2E9BA 2ZZ4A 1UKTA 1TZ9A 2C14A 5HULA 4GBUA 2PC8A 5REQB 3S5SA 3GTHA 3FSTA 3DFTA 4H9YA 1FFQA 3F03K 2VFFA 2ZRVA 3CHCA 3BSGA 4QE5A 1GONA 3LNMA 1XYCA 3EWUA 5J04A 2CBVA 3UZ5A 2ESCA 4PL1A 1GOOA 3VMOA 4TOQA 4REQA 3NQCA 4RZBA 4EXBA 1FDYA 4AW7A 3L4WA 4GBDA 1U1UA 2YB1A 5CZTA 4F0SA 3VFLA 1TIMA 1EWEA 4NZCA 2H90A 4J7RA 2W6RA 2GJRA 5ABEA 1VFMA 3ID7A 3V18A 1TJ1A 3NM3A 3H2NA 4IL2A 2Y61A 4D6IA 1LT7A 1KM2A 3WDPP 1K7FA 2NX3A 3VOJA 1JZ6A 5IDIA 4BQ2A 3WJSA 1A4LA 4AD1A 4JYFA 1UP2A 4OWGA 4UMCA 3LCGA 1UWSA 3CZ8A 1F7BA 1VFLA 4A2SA 1ISXA 4MIMA 3TUUA 1S2UA 3QTPA 4MDPA 4QJ4B 3TW6A 2QCLA 3NSXA 2JQXA 1VFUA 2NQHA 3KOYA 4AC7C 4NNBA 4B5VA 3R94A 3L66A 4GRSA 5JUVA 4Q4PA 3TN5A 1FWSA 4IP4A 4M80A 4YYCA 4IJRA 5LA2A 4MAZA 2A7RA 3KBJA 2I5GA 4JCMA 1WOAA 2YYUA 2YL6A 4IHCA 4TX6A 4GI6A 1GGOA 1P0DA 3N25A 4HU8A 2GSJA 4X9SA 1AH3A 1R3RA 1ZP3A 4ZQCA 1CT5A 3LSCA 2WKGA 2VZTA 1FWHC 3WF3A 4PTNA 1A3XA 4DZHA 5IHRA 3B04A 1WBHA 4BEQA 1SQ7A 3AHXA 4BWLC 3USBA 1WZLA 1TMQA 4N4QA 4L56A 4HK7A 4WDTA 4UCGA 1D7KA 2Z7KA 3PWGA 1TV3A 1UZDA 2Z0IA 1KM5A 3NQMA 3NDOA 2VD9A 3KTXA 4RXGA 3VYLA 4J9JA 3KUMA 3THUA 1UHVA 3E0VA 3DI1A 4KCTA 2OSYA 4QIUA 4GC3A 5HJLA 1R46A 3GXDA 4MPKA 1TCMA 2NW0A 5M5DA 2WC4A 3EXTA 1KB3A 2G37A 3GR8A 1KXVA 5BW6A 1CB2A 3BMWA 2ZZ2A 3W1LA 1IR1A 3E0LA 3S6DA 4RX0A 3TSDA 3BLIA 1V79A 2VXNA 4RZ5A 4M82A 2PTZA 4QFUA 4O0QA 1GUVA 1RVGA 4QBXA 3RO8A 4F9DA 3KHDA 1BXBA 4CNUA 3BURA 1A53A 1CNVA 3RLUA 4Z08A 4L6DA 3EPMA 2AAAA 1XDMA 4WXYA 3W84A 1E5JA 1W1ZA 4BQ4A 2GDVA 3WUFA 3MQTA 2Z6IA 2Q71A 2SFPA 5EYWA 1DJXA 2PA6A 4MAVA 2G3FA 2OR2A 3DN5A 2AAMA 2CETA 3BC9A 5CC5A 2PWEA 2DZSA 1M04A 1E0TA 3RR4A 3KWSA 3GUWA 3SCWA 3BPWA 5ABTA 1L8PA 4P8XA 1HP5A 3QN3A 1I45A 1OFOA 1YPFA 4RK8A 1TJPA 4DUOA 1CTNA 3CZJA 1W2VA 4PYSA 1WZMA 3MHGA 3EWYA 4FNPA 4UOZA 1VPXA 3OLEA 1JNEA 3EGJA 4O19A 3H70A 2R1PA 1V7AA 1H61A 3CTLA 4NSBA 1MUWA 3FJLA 3LN3A 3VKKA 5DY2A 3LCFA 1N8WA 4R7WA 1B2YA 3K4WA 3L5AA 3M1ZA 3HPAA 1T40A 4UXDA 4JQ1A 3OIHA 2WVVA 4H9MA 2PDMA 4IPPA 4Z1DA 3U48A 3SJ3A 4O10A 1J93A 1A5OC 3SRDA 4GFSA 4G7EB 4O0ZA 2J24A 2G96A 2RJHA 4ZENA 3UG3A 4XBSA 4DZ5A 3W86A 1XLKA 4WOZA 3KCLA 1SMAA 5A3HA 4O52A 1CXFA 5JIPA 4MLRA 3XINA 3IVTA 4QQUA 3HQNA 3M7WA 4HHMA 1DE5A 1Q6QA 3S1XA 4KERA 2JBMA 1KV8A 1A5KC 5D9PA 4DJDC 3HMJG 4DBWA 3L0KA 3FYPA 1OCBA 3E2SA 3THQA 4DYKA 3NQVA 4HOZA 1BLIA 1O1ZA 4WY0B 2GJXA 3LGDA 4AZIA 4C5ZA 4ZO7A 1MDLA 1UBSA 2A6LA 1FRBA 5CBJA 3TONA 2PDCA 3A9IA 2XH2A 2X0HA 1UUMA 4UQ9A 4QSFA 3S1UA 1BGGA 4ZQOA 4DJEC 3HU7A 3WH9A 5BCAA 3N1AA 1RA5A 1V77A 4IX2A 3THDA 4IFRA 1OGSA 4MB5A 1MNSA 4NJGA 2HNHA 1CENA 1F8MA 4C6LA 2EPKX 2FVLA 4K6AA 2GZXA 4W5ZA 4MJMA 3PUDA 5IOBA 1VJZA 1XLFA 2X7WA 2PDLA 3KM8A 3AIVA 3DENA 4KETA 2D2HA 1X98A 2P0OA 1A5LC 1Q4WA 2GJPA 4AUBA 2IKJA 1W8GA 1XL9A 1GVRA 3C61A 4UNIA 5FSEC 4YTSA 2P0IA 1DQWA 1XR2A 2Z1XA 5C9WA 5D9MA 3HFYA 5HAOA 5C0QA 5FL0A 4HHPA 4EVZA 3SUSA 3GD6A 2VD8A 1E3XA 4IXHA 1LP6A 3RLVA 3UF9A 1OZQA 1OWQA 3Q2DA 3SSZA 5HPCA 4UFIA 3RM4A 5ABGA 3AXIA 4C7FA 1PWMA 1B3VA 1LLOA 5HUOA 3W87A 5CPLA 3H22A 2ABAA 3B8TA 1WDQA 1TWZA 3PBMA 4HA1A 3G0UA 2WKLA 4HNTA 2EEXA 3FS2A 4L9YA 1FKWA 1B3XA 1JQVA 3K4DA 1HJVA 2TYSA 1P0KA 3NZPA 3WDHA 1HL2A 2PCQA 4PMXA 2QPXA 1EH9A 2BHZA 1QPQA 3TNOA 1JXJA 4RJEA 3VM5A 3WMSA 4P61A 4JTHA 4F9JA 4PMRA 4CUCA 2BBFA 5HQEA 5AHFA 4QG6A 3MWCA 5I3HA 2QUVA 4I7WA 2A4AA 5T9BG 4H00A 2WM1A 3R0KA 3CAKA 4O18A 1FOBA 2QYGA 3CZLA 4H8VA 3GHUA 4B91A 5EFDA 4GI4A 2OZ8A 2JALA 1JUEA 4BI7A 1OM0A 1SFJA 3BVJA 3MCOA 4KIRA 4M8UA 1EF3A 3H6OA 1W54A 1CGTA 4GQRA 1D2KA 3E12A 3WQWA 4GE8A 4MHBA 3CZEA 3F7JA 5I3JA 2V9DA 1Q65A 1AH4A 1Z42A 4B4HA 3OTRA 3VNKA 1QT1A 4DYJA 4Y7EA 3OG3A 3GNRA 4FNTA 3BAIA 1VRXA 4EE9A 2I17A 1J10A 1AW2A 2WK2A 2HBXA 1W5NA 3AC0A 1F74A 1BKSA 5AN7A 3FYOA 3KHJA 5AC6A 1B0IA 4JTUA 1TUXA 4QCEA 3KDNA 3WMBA 1OFDA 3W38A 5A8QA 1DWFM 3QMTA 1W31A 4IT1A 1F73A 4K3ZA 1DPMA 5HWMA 3OU8A 3JS3A 4Q32A 4UQBA 3LV6A 3S5OA 1Z6KA 2WJFA 4UTHA 4KWUA 2J7GA 4M29A 2PDBA 3P3BA 3PHAA 2V2DA 4S3DA 5G5IA 1RD6A 3ZZ1A 3OHMB 3A5VA 4D6GA 4MB3A 3H54A 1B3ZA 1LM1A 4JKKA 1EDTA 1OFEA 3W70A 4MZ8A 2WM0A 3NAVA 1HGWA 4XAYA 3SM0A 4AISA 1B4KA 3H4WA 4HA4A 3VGDA 3WD1A 5DRCA 2PLJA 2WMKA 3ZFHA 4Z1YA 1RJRA 1T0OA 1OX6A 5EMLA 3LHTA 3PS7A 4XAZA 3BSMA 1W1IE 2OSWA 3CC1A 3VC5A 3WNLA 2Z1SA 6TAAA 1FWBC 5DMNA 1KC7A 2OVLA 3CO8A 4KFOA 1O66A 4R33A 3UA4A 3LQGA 1WKYA 3EEZA 1EWDA 4JN7A 1PSCA 2ZUVA 4I9TA 2R1KA 5EMYA 3ZVHA 3WQ8A 5HK4A 3QR3A 5TAOA 2C3ZA 3N34A 2PTXA 1TG7A 3DI0A 1SZNA 3L9CA 3PWAA 4DXVA 1BAGA 4UTFA 4UQEA 2C1HA 5B80A 3WK3A 2PS2A 4UQDA 3C2VA 2C18A 1LTDA 1RHCA 3B8DA 1WXZA 4I5RA 1D3CA 3V5FA 1W6TA 3I7RA 1F6YA 2VJXA 2OU4A 4Q8TA 3IJQA 3WD4A 1AG1O 1FWRA 1X1OA 1MXGA 4JX5A 2ZXQA 2QAPA 3CLMA 4NYUA 1WP6A 3QFEA 4DRSA 5CZJA 5I0DA 4TV6A 2QT3A 2IPWA 3W22A 3UCDA 5HA7A 3W26A 3I10A 4CQBA 2OEJA 4EK7A 2XSBA 2MNRA 4QTGA 1YDNA 3O0KA 3RPMA 3FGCA 4D1IA 5I24A 4LF1A 1B54A 1HJSA 1BQCA 1J6PA 4GYPC 3W28A 4J3XA 3W3OA 2ZX9A 3EWCA 4H4IA 4W8LA 3FY1A 2QCEA 3BICA 3EMZA 4KBXA 4LUSA 1C9DA 1EIBA 3VKJA 3GBEA 1JD9A 2QJHA 2ASHA 4NZ1A 4RDVA 3BARA 3WNPA 4HT3A 3B9AA 1H7PA 1PBGA 1XBXA 3VM7A 1XQKA 3GFYA 4OZOA 1A0EA 4C6QA 5DY3A 3CUFA 3OVGA 2AKMA 4ZA0A 4JYDA 1I0BA 1XIDA 2WW5A 4LJ3A 5E9AA 2YFNA 1YE6A 1PKYA 1PB0A 2BODX 2E1DA 1IQ8A 3CL7A 3ZQ9A 1TPVA 3BQ6A 4JEQA 5CC7A 1R5YA 3W7IA 2A85A 2VEKA 1OX5A 3WD3A 3M5VA 2CLMA 2CNCA 4J2MA 5E5CA 1LJYA 4AHQA 4GI8A 4DUVA 4P7LA 1DWGM 2PWGA 1LQ2A 3KBSA 1A5AA 3ITGA 2OQLA 4JCLA 4DWSB 4DM1A 1ZHAA 4GKTA 1XH0A 4KQNA 4FX7A 1FWAC 4E2OA 1J5TA 4RNIA 4DXKA 3CUZA 3QPEA 3DX5A 1IT7A 3K5XA 5FJUA 1OCNA 4IGHA 1M7XA 3KEHA 5REQA 3OZYA 4RDZA 2BY3A 4NX5A 3WEOA 2DUAA 1EPVA 1MNZA 3BW2A 1U22A 1EXBA 4PB3A 4HIBA 4PMJA 1LLZA 2GK1A 2O92A 3IWPA 2DW6A 3MP3A 4IGMA 4Y96A 1R47A 3DHFA 3U6WA 4G1NA 1L2QA 4PFHA 3A47A 5AKQA 1Q6EA 3V1HA 2JE8A 3CHFA 1C8VA 4XVDA 3R25A 4JX6A 1C8YA 4UNLA 3AS0A 5AHEA 1UKOA 3DGRA 4FNRA 3LV5A 2X2YA 1RPXA 5TNVA 4HPHA 1XIGA 3WEMA 3TA9A 4PODA 2ZUNA 2CFFA 4R34A 4N6EA 1E70M 4OBTA 3L5LA 1A47A 2YCKX 2DJLA 3WJWA 1IZJA 1M68A 4ICNA 5I2UA 3ANYA 3BOXA 3EX2A 2POZA 3EOOA 5FJTA 4L9XA 1D3GA 5IXEA 1AUSL 2BXZA 4KH2A 3O15A 4DWSC 4XSLA 3UP8A 1P5BA 3AIRA 2XH7A 3WLRA 1K7EA 1K6WA 1C8QA 4FAMA 1RLCL 1SZEA 4GACA 5FA5A 3R8GA 3WCZA 4CD4A 4KS0A 3ARYA 4I6VA 3M07A 3LM3A 3QPZA 3R7MA 3B9DA 5FL1A 1NFPA 1YX1A 4ZQPA 1KRAC 3M0XA 4UR8A 2QQ6A 1QPRA 2G0WA 2I57A 1B5TA 1A5BA 1CXIA 2PUZA 1KGUA 3W2NA 3CM4A 2ZE3A 4HPJA 5AC8A 3M44A 3QFWA 2J7CA 3UNDA 5G1YA 5E09A 1KQZA 2XHYA 1DV7A 4N02A 3RN6A 5CGMA 3UXAA 4E2BA 4UTWC 5LHFA 4PUWA 4U2ZA 3I7QA 3C86A 3RHGA 4ZR8A 3IV3A 3M0HA 3QY7A 3VI2A 3NQDA 2GVEA 3QV6A 1Z3NA 3SCTA 2J78A 2NUYA 5G4HC 3VTRA 1VBGA 3B06A 2GJLA 3CYVA 3G18A 4PUJA 3TAKA 5C5YA 1D8WA 4XK2A 3PWIA 4LEFA 1HJXA 3CZGA 3C2FA 3SQLA 3KL5A 2YCJA 5H2ZA 4NYYA 3F4VA 2VR5A 2FVMA 3IIPA 4KESA 4LW7A 5EMUA 2ZBTA 4ALDA 4XAFA 4RXFA 1U1JA 3NQAA 5BRBA 2YX0A 3LTYA 3HG5A 1OY0A 1VHCA 2VT0A 1ISZA 1TA3B 1E6RA 2NQJA 5DT7A 1BQGA 1UUOA 1DXIA 1JGIA 4FI4A 2QUNA 5FKYA 4URIA 1G5AA 1DJNA 3OGRA 4PRRA 5K7JA 3MWAA 3M0MA 3BMVA 4LAMA 1OYAA 3W7DA 2EPLX 5F2IA 4YJ5A 4GJIA 3LNPA 3LCHA 2R1LA 3GG7A 1GQLA 3EA2A 3AIBA 1B57A 1JRCA 3W1PA 5KSWA 4F0KA 2YDQA 1MSSA 4EPEC 4DJEA 1DJYA 3QC0A 1RZMA 4S3BA 4JL2A 2ON3A 1L6FA 4L1WA 4QLLA 4UR7A 2WMFA 3QXBA 3JZUA 2QAFA 2PSNA 1UG6A 2CWXA 3A4JA 1QK0A 5LNWA 1Q6OA 2WNNA 2EKCA 4S3GA 4HOXA 3ATYA 1S1PA 1V0MA 3GHSA 2VFHA 5D2YA 3VIIA 2X40A 1EQCA 3R58A 4GO8A 4DX3A 4M56A 1VEMA 3BG5A 3DFPA 4NQ1A 3DBNA 1GTEA 4JHOA 1J4EA 1PX8A 2OG9A 3HQOA 1TV5A 2NV2A 4IMDA 3BGAA 2WV8A 3TWBA 4U28A 3GG0A 1QBAA 2PDKA 3RG6A 2WQPA 1LQ0A 4CD8A 7XIMA 1KGXA 2YZRA 3IIZA 2QJGA 1AMKA 4UQAA 3VNDA 2WSYA 3GG1A 4C6MA 3AFBA 4OE7A 4WY0A 1WNOA 1U33A 4KEZA 5GNXA 2TAAA 1CLXA 3IJLA 1A5UA 3UYCA 2INFA 3CQIA 2GGEA 3W27A 2XG9A 1SZFA 5CJ5A 3P2VA 1M5WA 1UMYA 4JY8A 4IF2A 3LGGA 2VVNA 4QAIA 1Q4NX 3NXLA 3I7SA 4WJ8A 1VYRA 2HDJA 2CLPA 1S5WA 2G3NA 4Y9NA 2VURA 1A50A 2GGHA 5D8WA 4FHAA 1EF2A 3B8WA 3BCJA 4US5A 2XGBA 4JIRA 4YPJA 3PZUA 4TXEA 2CXEA 3PPHA 1XPGA 4UTIA 2EG7A 5F2MA 4CNNA 4IQEA 3BAWA 6TIMA 4ADUA 4YYFA 4NAFB 5I09A 2DORA 2VKZG 1JFXA 3E6EA 1K70A 2QDDA 4OKDA 4FLRA 3W1RA 3FSUA 3TFCA 1WDDA 3GXIA 3BTNA 3KRSA 4DQWA 5FJOA 3ICJA 2ZZ1A 4FOUA 4IIGA 3SN4A 2ACSA 2CERA 4OFCA 3N2MA 2DUZA 5LNRA 3KXQA 2DT3A 3M46A 1LBLA 2BASA 3BWWA 3GW3A 1MUMA 5EMKA 1DIEA 3NL6A 3ZXWA 4NP7A 1EBHA 5T8GA 2XUCA 3UCQA 4LH8A 3V0TA 1GJUA 4WR3A 3U8GA 1EJ7L 1XDLA 5I5RA 3USZA 3OLGA 3CIWA 1PEZA 1V02A 1DBTA 5I3IA 2E1WA 4V33A 4QGCA 4GUHA 4JNMA 4MWAD 1AD4A 1CLKA 2INZA 1E5NA 1V3MA 3M47A 3VIFA 3RR1A 4PZVA 3ZVIA 4P7NA 5G1TA 4D72A 1HIZA 4GCXA 2JFEX 1OBAA 2FGLA 2OGYA 3EX6A 3SQSA 2ISSA 1VEOA 5KZEA 4PR4A 4Z1AA 1AMYA 1XC4A 3F4CA 1S2VA 3CV1A 1UIPA 4MUZA 5I78A 1JYVA 2J79A 4ZB2A 4ZO9A 3TCEA 2F6KA 4WKAA 4C65A 1U83A 3LY0A 2DIJA 4PRTA 4PMDA 5U7SA 1YADA 2FTPA 2BMBA 3T0AA 1G4EA 3N9SA 3QBUA 4CD7A 2GWNA 2OWWA 2FPTA 4H6KA 5CG7A 2DVUA 3KBWA 2Q3RA 4C6OA 1ZNNA 1M65A 4HJWA 1EO5A 4S2CA 8CGTA 4F8XA 1KXQA 3ABXA 2Z29A 2DT2A 4LS2A 4UZSA 2HRWA 2QMKA 3MI2A 1TPUA 1W1PA 1WAWA 3RUBL 2QCHA 2PPGA 2QMJA 1NWUA 4J35A 3PNZA 3T4CA 4DPQA 5LIXX 2UZ9A 5E6YA 4GFIA 4RLIA 4MY1A 2B7QA 2OGJA 3O63A 3LK6A 3DIPA 3GAYA 4HSHA 3KZSA 4XD6A 3SB0A 3BG3A 3C0SA 1GYLA 3OLIA 1PKNA 4YWIA 3VIHA 3UJEA 2WCAA 1XISA 1E1CB 1EJXC 3MO7A 1EX5A 1KW1A 8XIAA 3ITXA 1OD0A 3L23A 5D2VA 1Q7ZA 1H7WA 3I68A 2ZFAA 1SGJA 4O12A 4QG8A 4CQCA 2WXDM 3FN9A 1S46A 2VC6A 3W6YA 1W91A 2BFGA 3A4AA 3TJ4A 4AIEA 4B5WA 2RDWA 3XISA 1UW9A 3F2DA 5L9FA 5D4YA 1TSIA 1F6PA 1GKRA 2PF8A 2V3GA 3AUJA 3W7KA 1TRDA 3EOEA 2Z1VA 1P0EA 1GNXA 4TTGA 3PZIA 1CGUA 3VGEA 4AVOA 2Y62A 1GG0A 3NSMA 3APGA 4YCOA 2X1TA 2PBOA 1OG6A 2Q6ZA 5HPOA 3SUVA 1FHLA 5GJPA 5AC7A 4JIPA 2C0AA 5DX7A 5FAGA 3TYZA 3R6IA 2WLYA 3M0ZA 5A6LA 4ERGA 5JXQA 4G6CA 1JCLA 3BOLA 3DAQA 5AHIA 3R12A 4ZB0A 4ZFCA 2OZ3A 3SUUA 4P8VA 4HPGA 4PE8A 1WZKA 2J4GA 4Q7NA 2X8RA 5MHBA 2FKPA 4GXWA 2BGQA 5E6ZA 4DJFC 4EKJA 1H1ZA 2EXOA 3G1XA 4U4MA 4O1BA 5DQPA 4UTLA 1WDRA 5D30A 2WZMA 2CLHA 3TH6A 4D6FA 4MF4A 2J8GA 4D2JA 4IGNA 4ZE5A 4GY7A 4V2XA 2JF7A 2PODA 1UH4A 5CQ1A 3TTYA 1U5VA 4WEVX 4B5TA 4NUWA 3TSBA 1HW6A 4ZSUA 2VZOA 2XIBA 1WXJA 3Q94A 4X22A 2HCVA 3HB9A 1XLBA 1YMYA 4H6EA 3GWQA 1W3NA 2PEVA 2W61A 2FZNA 4EIVA 2VQUA 3M5ZA 3PPGA 1GVSA 4Q7IA 1XSKA 2ABBA 4RV3A 5I07A 1XIBA 1ZP4A 3FK4A 5T9CE 1RY0A 3SCUA 2GQ9A 1G94A 3VOGA 1TELA 2GJNA 3E38A 1J2BA 3PJXA 2E5CA 4O13A 3L12A 3S0CA 2NQLA 3RGTA 1W1TA 3MA8A 1AW5A 3THCA 2OLSA 1XIJA 3WMLA 4ZL1A 3A5FA 5E9XA 1UD5A 3VIOA 4AAJA 3L7RA 2YW4A 4S1FA 3ZR5A 4PSPA 1K02A 5A2CA 3GTNA 3TV8A 3BJSA 3VDGA 4DPPA 1IZKA 3O1NA 4H8UA 1MFVA 1QNVA 5G1MA 4HN8A 3RM9A 4RW3A 3V0UA 2J6XA 2V5KA 3UW6A 5KZMA 1WE5A 1SSDA 1WBJA 1AW1A 2IPJA 4R27A 4NXKA 2VR4A 1POKA 4GD0A 1RUSA 3SY5A 2X41A 1BVZA 3TJLA 1EZ2A 1OC7A 1FXQA 1ZAIA 1IWAA 1QNSA 1V6XA 1L6SA 1VC4A 4B15A 1BWVA 4A3QA 1JD7A 4AVNA 4JFTA 4DWDA 2XFYA 4XAGA 2RH9A 2V2CA 2OTDA 3RPDA 1C7TA 1Q13A 1PIIA 2BWGA 4PUKA 2WVTA 2I14A 1VAHA 1KO0A 2J27A 2HSAA 2AGKA 2OOFA 2XYLA 2OMAA 1KFKA 2QCMA 2QLYA 2J66A 4LBUA 4TVCA 3M64A 2DY3A 5C70A 4UWMA 1QRQA 1SSGA 4S23A 2AKZA 4JKMA 1YDOA 2DH3A 1HL8A 2PZNA 1CXLA 1XLGA 9RUBA 1XS2A 1Y5WA 3Q4DA 4DXXA 1PXGA 3CO4A 4GQQA 1P0NA 1S5VA 3TU9A 1TPEA 1ENUA 4NIRA 4XZMX 4ZZ9A 1UYQA 1OVDA 3IANA 3UZXA 3GNOA 2WJZA 3TA6A 2OWCA 1NSJA 3M41A 2H9AA 1DP0A 1K9EA 3BDKA 4GUFA 4HMNA 1O68A 1HKVA 4KT2A 4Y6GA 4AZ5A 4X2PA 4AIBA 4FS9A 3ZS4A 5D2XA 4KMQA 2WVUA 2Y63A 3TX9A 4BI5A 4YLWA 3PVFA 4RE3A 3SAZA 5LGXA 1ME9A 5DEZA 4UQCA 3GNNA 4AZHA 3NURA 4I6KA 2A21A 3TSMA 3RJYA 1KD0A 4UZUA 2YXGA 4NJIA 5A94A 4MUPA 2P8BA 3NSNA 4Q33A 2DW7A 3SRKA 2BG5A 5A69A 4JPGA 3WLPA 3WZ0E 3W1UA 2FZ8A 5D9OA 2JIEA 3GXPA 4C1KA 1Z9AA 3DEQA 1L2UA 4PA8A 1ZZMA 2XINA 4HYRA 4OV4A 4YN5A 2VCBA 1SYTA 1XYZA 2GGIA 3LDVA 2Y88A 4MKVA 3WQ5A 3LD5A 2B7PA 1YLVA 4DO4A 5M03A 3SY1A 3N2OA 3MI6A 4PH6A 4IPNB 3ZLGA 3TN3A 4HN4A 3II1A 1Q85A 1Q6LA 1JZ5A 3KZPA 3F5JA 1QI5A 3WFAA 4ONVA 4OOUA 3L2LA 4U31A 1M7OA 5LIWX 4P7RA 2ZIDA 2XVNA 1TZZA 1HJWA 2A7NA 3GDLA 1E73M 3MP4A 3DERA 2FJKA 1E4IA 5C7HA 4EF9A 2ZC8A 3T0DA 3ARTA 1I1XA 1X6LA 3EKZA 3LGEA 5IRPA 1Y65A 3AIQA 1QPOA 3EB2A 4O1CA 2ZYFA 3UJRA 4A6GA 4Y9AA 2BSLA 4NJJA 3NQEA 4GYKA 1OEPA 1SO6A 2IW0A 1V51A 2DZTA 2FYMA 5DMYA 4Z0JA 3MBDA 2WMJA 3B40A 3T07A 1OGBA 2HTMA 4P8UA 1ZBVA 3EMQA 3AQUA 5EMJA 2WLZA 4ZE4A 3H55A 3WDQA 3FHAA 3EYPA 4HD5A 2TMDA 3NWRA 1XKYA 2ZQ0A 1DWHM 4PSRA 3UZWA 4H9UA 3ZOAA 1UOKA 1ZLPA 8RUCA 5JBEA 3VNLA 2JKPA 3PZVA 3VIPA 2E3ZA 3RJXA 2OB3A 4IQLA 4B5XA 3BW4A 1HQTA 3AXMA 1F3XA 1P4CA 3L4ZA 1NARA 2E8ZA 2VC5A 4PMVA 1HN1A 1MQQA 2HV5A 2CW6A 1UR3M 4GIEA 1H5YA 4KCWA 1SZRA 4GWEA 1R3WA 3PPFA 2G3MA 3VX0A 2DDXA 4WF7A 2VOTA 3B9EA 5HQLA 2XN1A 1K1DA 1IEWA 1T41A 1TV8A 1K03A 3N04A 4UR9A 1THFD 4XO7A 3UWEA 3W24A 2J77A 2GGGA 3TYBA 3U5YA 2Y1HA 5EA9A 4JTEA 2DT0A 4Q4SA 3GH4A 2V8ZA 4M51A 1AZ1A 3WBAA 1O95A 3IJDA 3GFXA 3WG6A 3B4UA 5J5RA 3BW3A 1S2WA 3W71A 4BJHA 4IFKB 1OG0A 2C91A 4F4RA 3MMTA 4Q7BA 1I6NA 2ATMA 4JHMA 3AXXA 1E55A 2XJ7A 1W3IA 1ZU8A 2F7FA 3CPRA 4YCPA 4LNCA 1JCNA 4UTTC 4KEUA 1A5MC 3GC2A 2D24A 4REQB 3RFAA 2OKTA 3KVJA 1H49A 3QM3A 1GVFA 1AODA 2OEKA 2QKFA 3IVSA 4RKAA 1F5ZA 2E9MA 4HTBA 2BTMA 3O06A 4GG9A 5AOUA 4RNJA 1E9IA 4Y8FA 2YCLA 3W6MA 1B31A 2GYIA 4YTUA 5HINA 5FF3A 3DC8A 3G24A 3GO2A 4D6HA 1GEHA 5GQBA 4RE2A 2RFGA 5ABHA 2PP3A 1J2WA 3UBPC 1VH7A 1S2CA 2XVPA 5DELA 2QCDA 1TMHA 1ISWA 1V3HA 1Z8AA 1NFBA 4JTFA 4AEEA 4NVTA 5CPQA 1WV2A 3UY7A 4Q8OA 1NH6A 1IR2A 3MUXA 2FTWA 3SGGA 2Q09A 3G1SA 1CXEA 1JZ2A 1QO2A 4H8HA 2OO6A 2XTKA 4NAFA 3S6TA 4JTGA 3LCLA 1ADDA 3E5BA 5CGTA 1A80A 3UNTA 1J0HA 4P5UA 2PDHA 3BXWA 3DG6A 3VKDA 1XIHA 3PSWA 1T8XA 5B7YA 1R9YA 3S46A 1PIGA 1XIFA 2PDFA 4K8HA 1V0NA 4PMZA 1ODZA 3A23A 2PTYA 3NZQA 4O28A 3WJYA 2O9PA 2V82A 4JTRA 4AU0A 1OZMA 1JI1A 4QRNA 1XP3A 1RCQA 1OT1A 3IIVA 3NR0A 2ZUTA 1UD2A 2NX1A 4JQ2A 4AY8A 3UVIA 4NY2A 1W5QA 4RPPA 1D3HA 3W7EA 1JEZA 3S9IA 2J88A 1R3SA 2BDQA 4M1BA 3S2LA 4DM2A 4ACZA 3HPXA 4JICA 3TDFA 4ENLA 4F0RA 3N15A 3CS2A 8XIMA 1GW1A 2NX9A 2R94A 4AD3A 4C7DA 3D3AA 2A5HA 2D2JA 3SCRA 4GC4A 1Q5MA 5I3KA 4FLQA 1NEYA 1VJIA 3LUTA 4ICCX 5FI8A 4Y8EA 2F9RA 2ZVRA 4A21A 1MW2A 3NQ2A 2QDHA 3JUGA 2PWFA 3EWZA 5DXXA 4HSOA 2H3BA 1IEVA 3WJXA 1CGWA 4WSJA 4GINA 1L8NA 3VIMA 1X7IA 5BWFA 1QFEA 5I3DA 3CIXA 3HJZA 1Q8JA 4H6RA 5HMSA 2PDGA 1F2JA 5D05A 2ZC1A 4LRTA 1I2NA 2YGYA 4AHOA 1IXPA 2CBJA 2W79A 3PTMA 3W7QA 1ZQ5A 3AJXA 3VKBA 4O1DA 1TJ2A 1A5SA 1YPIA 4DZAA 4CCEA 3ZT7A 1IWPA 3LCIA 3EKLA 4DF0A 4HOWA 1J5SA 4IP7A 3C8NA 2IKHA 2FPYA 5A8PA 3G1AA 3S42A 3ECQA 5TBOA 1TMLA 1OC6A 4J3WA 5E0KA 4TU1A 1FP9A 1VRDA 5JH1A 1UMLA 1FWNA 5CAKA 3TQPA 3WDIA 2FB3A 5T91A 3JRKA 1E1CA 3PY2A 1ZCOA 1VB9A 2V5DA 3TZNA 7REQA 4PTVA 2OX4A 3K8KA 1O4UA 4AEOA 5GNYA 3RDKA 2WWDA 3OP2A 1MXSA 1SW7A 3NVTA 3QLLA 4DUWA 3CUIA 4KRTA 1UR9A 3NG3A 4QXIA 3R43A 1RR2A 3EWDA 4U3CA 2VFGA 3UWQA 2CZVA 5JQ9A 3WLOA 3IJ6A 4Y9PA 4XQ6A 3SCSA 5LXEA 4DLFA 4YHEA 2ANUA 2A3AA 3T0CA 3IRDA 3H12A 4FR6A 3W7RA 1PX4A 3N17A 2VRJA 3GUGA 3EPNA 3D47A 2XZ9A 1GVEA 1V0LA 2YLAA 2W62A 5HANA 4KRZA 3AIWA 4XX6A 3W2JA 5CEWA 2BLEA 1J01A 2PD5A 4AQLA 3VNYA 1TE1A 4DF2A 4UFJA 4GXMA 4F3HA 3HGOA 1CWYA 3P81A 2CPUA 3TMQA 1HKIA 1GCYA 3OA5A 1ITXA 4QSHA 2XIJA 5BU6A 1XICA 1KM6A 1UWUA 4MZ1A 3E96A 2J8TA 4QEEA 3B8SA 1EA9C 4QISA 3TXZA 4Z1CA 4H7CA 4LVAA 1A49A 3P7YA 3W82A 4IQJA 1E9LA 4HP5A 5CLWA 4CGTA 4JHZA 1R87A 3COTA 2ZX6A 3HG2A 2I7GA 1CGYA 2W3ZA 5A8OA 1WDPA 1ICQA 1MFUA 4JDYA 4PUUA 1G01A 1KBBA 1VFOA 5CC3A 5BROA 4JEJA 1W5OA 2QPUA 3CUHA 3G1VA 4FNQA 3DUGA 4HMCA 2EBNA 3DECA 3L0NA 2Z1KA 1NWSA 4E4PA 3FCPA 3QZEA 3ZMRA 3W02A 4BEUA 2VC7A 1IIHA 3CYJA 1GKQA 1J0KA 2ISFA 5AYYA 3LLDA 1BVWA 3MYOA 5LIUX 1BYDA 5JU6A 2V30A 1JRBA 1VCFA 3TEVA 1ME8A 3DFQA 3E2VA 2V5LA 1AQHA 5D02A 4X9YA 4HGXA 2WC7A 3AXHA 4W89A 3LXBA 1XG4A 2AL2B 3T78A 3RAOA 4MVAA 1VYPX 4LC6A 2P76A 3H7VA 5EMMA 1GQKA 1UB3A 4IISA 3WH5A 4CU8A 3PULA 5I77A 1C8XA 4RPQA 3NPXA 3A22A 5HMDA 3OVPA 3TTSA 3TP4A 1EP2A 2BVTA 1KFEA 1YTKA 1M41A 3MUIA 5MF5A 1SPQA 4ZFMA 3GS6A 2EPOA 3F4DA 3BAXA 4UTUA 1JYXA 4LB3A 3PN8A 1LUCA 2WHLA 4LU0A 3DYMA 3EZ4A 3C4UA 3NQ7A 3V36A 3UA3A 1X38A 2PGWA 3VVGA 1FTXA 3KOZA 1FH8A 3LHUA 1Y0EA 1HXJA 1S5TA 1MW3A 4QITA 3O8AA 4JFVA 4HNNA 3E5PA 4FOJA 3W53A 3WNMA 1K7XA 1XCXA 4H3DA 4BKNA 3K8LA 2J7BA 4LCRA 1H0GA 3MY9A 4IX0A 4FLOA 1SFSA 3GIQA 4JIEA 2R9RA 4B5UA 3VKAA 1BYBA 1EBGA 3T8LA 5IBXA 2BNJA 4M5PA 1AL8A 4Q3MA 3O2LA 4EAYA 1FWCC 4O14A 3UGRA 2QHAA 3RCYA 5TF0A 5DXYA 3CAWA 1C7SA 5IFPA 2XDFA 3A21A 4Q8VA 7CGTA 1S38A 1ADSA 4CN1A 1GTHA 2DSUA 3CJPA 2V69A 3D3FA 1E72M 1KFCA 2XGIA 1P6CA 4KFNA 5C7VA 2BXYA 3EOUA 3W07A 3WUGA 4EXQA 3GU2A 3K46A 3UD6A 4Y9MA 3S5NA 4XKYA 1TV4A 5DRIA 2R91A 2PDWA 3S4TA 1IXOA 2VELA 4LXFA 3RU8X 1RVKA 4JDBA 5C6MA 3SURA 1ZJAA 4HCDA 5LGZA 3FLUA 4WGXA 1M7JA 3DZ1A 3HG3A 2F8QA 4B5NA 4JX4A 1DJHA 1J0YA 2Y7DA 3C0LA 3PJTA 3TC7A 1G7UA 4FXSA 4GNVA 2LLEA 3G6MA 3EWBX 2OLAA 2H6RA 2UY3A 1KBJA 4B3KA 3KVKA 3WFZA 1E0VA 3F4WA 5A2AA 4MY8A 4S39A 1F4AA 1KV5A 3VIJA 3R4IA 4GGBA 4BI6A 4LT9A 1BXNA 3HG4A 4O4WA 4Z17A 4MTVA 2W0UA 3L4YA 4LYPA 1ICSA 5BOEA 4K8EA 1F61A 3HGJA 3VD3A 1QW8A 1PYMA 2GLKA 4IFOA 5HMEA 2OOGA 2PU0A 3HM7A 6PTDA 3LCXA 4B3LA 4GQBA 3MKVA 1PTGA 4NX0A 2WZTA 4ML4A 4GZJA 1D8CA 5E0CA 3SI9A 3GIPA 3S1VA 4CCDA 3P80A 4IPIA 1TPB1 4R7OA 2X2GA 3S83A 4W8BA 3IGSA 5J5DA 1C91A 5A95A 4ROQA 3QOMA 3HFTA 4ZOEA 1PV8A 2EQDA 1R9ZA 4Z2KA 1TVNA 4L4OA 2QCNA 1UPPA 2YBVA 3NA8A 4XVEA 1OIMA 3G77A 5T26A 3VGHA 2ADAA 5EY5A 3WYZA 1BWLA 4IIFA 2GGJA 5CPTA 3B4YA 4M6QA 3K30A 3W7NA 3XIMA 4E6MA 2YKKA 4MSSA 1ZFJA 3FGCB 3PUOA 4IMCA 3S1WA 3S2MA 2VC9A 2WJDA 3WF1A 1PE1A 4MNKA 3PFRA 2OZTA 3NL3A 1CDGA 1H1NA 1S3HA 4W7WA 1AA1B 3WQDA 1GVYA 3GDTA 2NSOA 5JMUA 3BSHA 3LB0A 1JAKA 3ABOA 1V93A 1UR0A 4XO6A 2EF9A 4UTTA 3WENA 3FA4A 3LRMA 3MSDA 2ZCGA 3C6CA 1RQEA 4N9CA 4KWSA 4L4MA 3GDMA 4Y2WA 3RLGA 3MJMA 3PAOA 4OBSA 1WKEA 4C6KA 2IMRA 3OB8A 3AYVA 1EUNA 5AY7A 1SO3A 3I4EA 1QWKA 1ZSXA 3BCDA 1HJUA 1W9BM 3CUJA 3OZMA 3GC4A 1I9CB 4J4KA 4PBFA 5D33A 1N8IA 3BV4A 3D0CA 3O6AA 4ZCWA 1RLDA 3LBOA 2TRSA 1XGZA 3AHYA 4ZBCA 3AYTA 5KZDA 1QOQA 4IP5A 3SFKA 5DO8A 4ZO6A 4M7TA 1G69A 1N7KA 2VRKA 4JQ4A 4HNLA 2PMQA 4H83A 2QDGA 3TOPA 2VFDA 1QPNA 2BGSA 3VC6A 3QOKA 3CZKA 1B1YA 3STPA 3H2FA 4MG4A 5CAHA 3LPFA 1F4HA 4J27A 4Q4KA 2C0HA 5TD4A 3DHUA 4XIMA 1E0XA 3A24A 5B7ZA 4AZCB 1UD8A 3MMDA 4IFKA 3QYQA 5I02A 1TIWA 2YZ5A 3P74A 3BLDA 4RE4A 2GK1B 4QEHA 3W6LA 1WZAA 3IRSA 2D20A 1ZGDA 4C6JA 3HOJA 2FFIA 4WKFA 3GNPA 1EGZA 5I3GA 2YXXA 3Q37A 1PO9A 4H01A 4OVXA 5K9XA 1C90A 1V6TA 4JOMA 3SJNA 1RSCA 4HPXA 1DORA 1MYRA 3GXFA 1XX1A 1EC9A 2BY0A 2DGAA 3CQJA 3VDBA 2NVDA 4TR9A 3DFNA 2BOFX 3REQB 1XIMA 3IUHA 5C2GA 4CNTA 4GK8A 3FJ6A 2WVSA 1E1FA 1V6WA 1X8FA 1BTCA 2BY1A 2WPBA 1VFFA 3IAPA 1QMLA 3GYEA 2C1GA 1YNYA 4C6EA 3C52A 3GW0A 3TC3A 1IEXA 2PRHA 3WQEA 1GZ1A 1J12A 1FKXA 3QHOA 4JGDA 3GRIA 1UWAA 3W29A 1RCXB 2PDUA 4AZ6A 3MANA 3OW1A 3H8AA 4RNHA 4D6DA 3G1YA 4OT7A 4J2PA 1G9HA 2RGMA 1E0WA 4ZMGA 1DYSA 4EWND 4B90A 4A3UA 4TUFA 3AU2A 4MDOA 3RU6A 2EPMX 1WPCA 2GVJA 3VNIA 2EG8A 2VFIA 4DO7A 5BXTA 1NOUA 3BL3A 5G2IA 1NOWA 2DZXA 3MDUA 3KP1A 3EA3A 2Y5SA 8A3HA 1ISVA 5LNUA 3U2CA 2Z4GA 4X61A 4NAEA 2NLYA 4PB4A 4B92A 1EJWC 4O57A 4L64A 2PLCA 4Q4OA 3LPPA 3LRKA 4LFYA 3NQGA 2G4FA 5CPMA 4NXSA 5F1VA 2CLKA 4NI8A 1LDCA 1MDRA 2RJGA 5DBUA 4MWAB 1QUMA 1LWHA 2WNWA 3C2OA 3A3WA 5FAJA 3NEHA 2W92A 3WF2A 1R9XA 4F79A 3E74A 3TQKA 2CLLA 1YDVA 4KPLA 1S2TA 1TZ7A 1F07A 2NT0A 4UTKA 4MM1A 2BOGX 5IM51 3PPCA 4EOUA 3ZJKA 3HF3A 3B05A 5CSYA 3EWXA 2DPEA 4YVXA 4C91A 1LOQA 2XZ7A 4M24A 3A6OA 3QKZA 1OHLA 1DJGA 3VNZA 4F2UA 4CU6A 2R14A 3N9KA 3R5EA 1FBAA 3DU0A 2UY2A 3QLDA 3BJTA 3VD5A 1RP8A 3ALFA 2QV5A 2HWGA 2BVYA 3WEZA 1UC4A 1XBYA 1KFJA 3VZZA 3W1MA 3SCVA 3TWAA 1XLEA 3VIGA 3PZQA 3BLKA 3KRZA 3LA4A 2F2HA 4GGHA 3T4WA 3RITA 2DSWA 4WVXA 3ITCA 4YMZA 3H4XA 3LENA 3SY8A 3AISA 1CXHA 2YA2A 4W93A 5KITA 1TO3A 3G6LA 1GW9A 1EJRC 3NOEA 1PZ1A 4C6FA 2GVYA 3L0GA 3WLMA 2VUYA 4MWAC 1IIGA 4H41A 4ZODA 3HQ1A 3K2GA 5EFFA 3GU9A 1Z41A 3URQA 1YBQB 3ZSTA 1ZPTA 1O7AA 2HS8A 4ZQRA 1PDZA 2HS6A 4H19A 4YWSA 4LGXA 3OJGA 2BP1A 4U3AA 3N2BA 2MUCA 4CN4A 3WELA 3SFWA