1KW4A

Polyhomeotic sam domain structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
DRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLRLKEKHLVNAMGMKLGPALKIVAKVESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SAM domain of polyhomeotic forms a helical polymer.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords Polyhomeotic
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2002-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1kw4A00
5J8YC 2L5YA 1UCVA 2KG5A 3BS7A 2EAOA 3TADA 2JV3A 2KE7A 2F44A 1V38A 1DXSA 2QARB 2QB1A 2DKXA 3K1RB 4IS7A 1LKYA 2E8NA 1RG6A 3BQ7A 5JU5A 2K60A 2QB0B 5F3XB 4NL9A 3HILA 2K4PA 1WWVA 2Y9TA 3BS5B 2ES6A 3KKAA 1V85A 2F3NA 4PZOA 2QARA 3SENA 2E8OA 2EANA 1SXDA 2KIVA 1SV0A 1PK1A 1OXJA 1X9XA 5L1MA 4PZNA 2EAPA 1SXEA 3KKAC 1COKA 1WWUA 2E8MA 2KSOB 5JTIA 2ESEA 4RQMA 3IDWA 1OW5A 1F0MA 4NL9C 2E8PA 2GLEA 3TACB 1SGGA 1LKYB 3SEIA 2KSOA 2KMDA 2DL0A 2QKQA 2Y9UA 1Z1VA 2FE9A 1B4FA 2DKZA 1PK1B 2B6GA 5KNIA 2LMRA 1JI7A 2D3DA 2EAMA 1UQVA 2QB0A 4RQNA 1X66A 1SV0C 2LPEA 1B0XA 3BS5A 3H8MA 5JRTA 3TADC 1X40A 2F8KA 1KW4A 1SV4A 4NJ8A 5J8YA 4MHVA 2YTUA 2D8CA 1PK3A
chains in the Genus database with same CATH superfamily
1NJXA 5EWEA 1NK8A 2AQ4A 1L8OA 1UCVA 9ICUA 3M6ZA 1FO4A 4M6WA 4QNLA 1U48A 4DWIA 1PZNA 3PSIA 5JU5A 3JPOA 4B9VA 4ECSA 1UA0A 4QIWF 1QSLA 4FO6A 8ICRA 3C5FA 1WWVA 3H4DA 3C2KA 1RPLA 1KFSA 4DSFA 4FBTA 9ICCA 1KTQA 4PPXA 1AROP 8ICBA 4C4SA 2EANA 1XNSA 2FMQA 2NRVA 2DUYA 1ZQHA 2ZJ5A 4UB3A 5AKYA 1BNPA 3DV9A 2JEJA 5KG3A 1J2MA 3AEVA 2JHDA 3AU2A 2DWQA 2KMDA 1SIJA 2KEYA 3WK4A 3MR5A 3OSPA 3L3FX 2HOQA 2DKZA 5AKHA 4IRKA 4F5PA 2AQ0A 4ED8A 2HVHA 2HOFA 2EAMA 3Q8QB 2YMLA 3RJHA 4ECWA 2DGZA 1HEKA 2WTFA 2F1HA 4PJ0U 4YR2A 4Q44A 4ECZA 2JH1A 3KFUF 4NXZA 3KHLA 3PW7A 2W9MA 3PW2A 4FZLA 4F4YA 4M0AA 1XU4A 5KFPA 4DQIA 2QLTA 1B22A 4G3IA 1TAQA 4QWCA 4M9NA 3L4PA 4PGXA 3AN1A 4IQWA 4C4RA 2DKXA 2VANA 2YX8A 3M9MB 2MRLA 4EX7A 2ZTCA 3BQ7A 4EBCA 4TUPA 4Q8FA 2G5HB 3TFSA 2HMXA 2QB0B 3M9NB 2H5XA 2ZUDA 4EYIB 4CF5A 4PGQA 1DGJA 2P6RA 3F5EA 9ICSA 8ICWA 3WKEA 4F71A 4BWMA 1KLNA 2A1JA 5KFTA 4M2YA 5CWRA 4F5OA 1RZTA 2XIDA 5L1MA 1K1QA 4I27A 3NVZA 4QZDA 2NO4A 2YB1A 2E1FA 3WKDA 3HJEA 2KSOB 4C8MA 5TZVA 2IOFA 4PHEA 3IV6A 4C8NA 2G09A 8ICPA 2MU2A 5KFKA 5DLFA 9ICLA 4QWAA 1B4FA 5ALHA 4YP3A 4DOBA 4KITB 2PFPA 3BJYA 2C22A 4R66A 5CP2A 1IV8A 4DQRA 3Q8RB 5ALJA 1LVHA 3KHHA 2XCPA 3KOOA 4YQWA 1HUZA 4DL7A 3H8SA 7ICJA 5L1JA 5HP4A 1BGXT 4J9RA 3TAQA 3JPTA 4J9QA 1L3TA 4YVZA 2C2EA 4EEYA 4DFMA 4RQ3A 3PV8A 1O03A 1QTMA 5AI8A 4F4ZA 5CEHA 1X9MA 4DL3A 4JWNA 1DGSA 4PH5A 2NRTA 5B5EU 1TK5A 3QNMA 2JV3A 5J0RA 3MFIA 8ICKA 1TAUA 4UAZA 2AH5A 5ALIA 4PHPA 1SKSA 4UB4A 5KFRA 4KLDA 4CRXA 2K4IA 1UA1A 2OEHA 3T5KA 4DL6A 4RNOA 1QQ6A 4EX6A 4KTQA 4QZ8A 3NGDA 2W7OA 5DB8A 2CRXA 1QSYA 4KLHA 4Y2TA 5KFDA 4TQRA 5KTQA 7ICHA 3RB3A 2F8LA 5ALYA 2KHQA 2MSNA 5KG4A 3OJUA 3BQ0A 1XO1A 3BDPA 1BNOA 5KL8B 2IHNA 3GZFA 1COKA 4IL6U 3F2CA 2WF5A 2PFQA 3IHQB 4ED6A 4G9BA 3SAHA 3KHRA 1D8BA 5ALPA 3WK5A 4TQSA 8ICZA 5J2JA 3RJJA 3UPQA 1L5UA 5DG7A 3QUCA 4O5EA 5AKEA 3ZDAA 1ZQKA 2ASJA 2NYVA 3UXPA 4DFJA 1BVSA 3PNCA 4FE3A 4RUAA 4ED7A 3TADC 2WAQC 4QZCA 4ED0A 3RBEA 1FFVA 4KLGA 2I9GA 5DQIA 5J0YA 2CXYA 2R8IA 1KSPA 2R8KA 1V97A 4C8OA 2P35A 4P0QA 1SWWA 5KFSA 4EBEA 1ZQLA 5J8YC 5DBCA 3IG5A 2C2RA 3GDXA 1RQLA 2ZXHA 2OCEA 4IR1A 7ICUA 1MN8A 2GH1A 2KJ9A 2ZTEA 4NL9A 5ALEA 3RH5A 1C7YA 4I29A 2LBOA 3FYHA 3N7RC 4YG2A 4I2AA 5D49A 5IIIA 2ZG6A 3QE9Y 5AI9A 5J2EA 5AI0A 2KJ8A 1X6JA 9ICBA 3T5LA 3QUQA 4F5QA 3C2LA 4GC6A 3ISCA 4RNMA 5KFEA 3IDWA 3SQIA 4NL9C 4J9MA 4Y2PA 8ICGA 3ONNA 4F72A 2AJQA 4USAA 3F53A 4F50A 4ED1A 1FEZA 2NRXA 5IIOA 4Y2JA 4DSIA 4B9TA 1U45A 1D9FA 3IRUA 1ZQTA 5KFUA 2Y1JA 1X66A 7ICGA 1KQQA 2G07A 2AGQA 4KLFA 3NRZA 4I2GA 1YT3A 4IR9A 2RP5A 2FLNA 4EZ9A 7ICPA 5KFXA 4KLMA 8ICYA 2BPCA 3AU6A 5DGBA 2RLTA 1N56A 4MFAA 5F9NA 3OJSA 3T79A 4QW9A 1YZ7A 5J2AA 2M0NA 4KN7A 3TADA 4UW9A 1KDHA 2KE7A 4C8LA 5AM4A 4MF2A 3RAQA 1WYGA 2E8NA 3AM9A 1S10A 3FAHA 1L7NA 2J6SA 5DDYA 2BPFA 2HHVA 2KKPA 3M1YA 2KK0A 2ES6A 3RR7A 2ZUBA 1X6IA 2DQNB 4Y2QA 5KFCA 1NK0A 5L1LA 3KZIU 2F2AB 4F4XA 5DDMA 2XGQA 5EE9A 3KD3A 9ICQA 3LWLA 3Q8PB 1NK7A 4RQ8A 4PHDA 4JWMA 2F1IA 1WWUA 5KFMA 3NTUA 2EH9A 2CPRA 1NOMA 2E8PA 4GIBA 8ICFA 5KFFA 2HHSA 2K4EA 2F76X 1T3QA 1ZQBA 3SR6A 3LDAA 3QZ7A 1ZQVA 4KLSA 9ICOA 3PVXA 2W03A 1ZETA 2F77X 4F5RA 1JRPA 1A6SA 1NNLA 5KT7A 3N28A 3O0FA 4RQ2A 1WCLA 2KZZA 1ZOLA 1B0XA 4RPYA 2A3VA 1NK4A 3S6JA 3D6JA 2LHTA 5JRTA 5L9XA 3MR3A 3RB6A 1Q8KA 9ICJA 1ZQFA 1D8LA 4EZ6A 5IIKA 8ICTA 5DQHA 1WUDA 1ZQMA 2BQUA 5F9LA 2PXIA 3BS7A 2RHFA 1ZQJA 4YD2A 2HHTA 1BPBA 4YXMA 3IM1A 2F44A 3ZDBA 4ECTA 1U9LA 2RDIA 3M7DA 3RJFA 4C8KA 7ICQA 8ICSA 4QZEA 1D8YA 2G5IB 2W11A 4AP9A 3V7JA 4BDPA 2BR0A 1NK5A 2W7PA 1ZQYA 5G5HA 4AYBC 4CF3A 4YMMA 2HW3A 2R8JA 2YB4A 1QCKA 2LYBA 1ZQWA 3OGUA 2V4RA 1V85A 3KBBA 4IQUA 1XWLA 3ISBA 3VC8A 4PZOA 1KFDA 3OTQA 3SENA 2DBYA 4FZNA 1ZD3A 2KVSA 2JH7A 2XY7A 4UB5A 1KRPA 4NWIA 3NVYA 1TFRA 3MGIA 4DQSA 1RM6C 1Q3VA 1P7DA 5KFLA 1JX4A 3SEIA 4I2JA 2DL0A 3AMZA 4M9LA 5KFBA 2PFNA 2EDUA 3TANA 2HCFA 3HRDD 9ICIA 4GLXA 4ECRA 9ICEA 2JMGA 4QZBA 1BPZA 5IILA 2WAQF 2GOLA 5J29A 5GTHU 4J9SA 2IBKA 2W04A 4F8RA 3CP8A 1MQ2A 9ICXA 2H3VA 2PMZC 3C21A 2PI5A 5C0YA 3RJIA 3TI0A 2K8AA 3ICXA 1UT5A 1T3NA 4P2HA 3I1YA 4YFKA 3GU3A 3BQTA 1NJYA 3SAFA 5AK3A 2D6FC 2J6TA 3TARA 4RT2A 5HR6A 1X2IA 1L7MA 1N5XA 2V4QA 2WFAA 4GXJA 1JIHA 1DXSA 3T5HA 5ALNA 3UXOA 4BXOB 8ICJA 3Q8SB 2WF8A 1ZQDA 1BPEA 4ECUA 1SKWA 2GWSA 4I2BA 5ALSA 1Z1BA 1MC8A 2WHEA 3MBYA 1PVRA 1ZD5A 4RQ4A 4NLZA 3WKAA 5AM0A 2ZJ8A 4RQ7A 3K75D 4O0IA 3UM9A 1TV9A 3C29A 3RB0A 4I2EA 1ZRMA 4DL2A 4OCZA 4O3NA 2OM6A 3LVVA 4KLEA 1L8LA 5EE3A 3J81j 1VDVA 1EXNA 3MFHA 3KZXA 4X5VA 4OJPA 4PZNA 4WJ3B 3QYPA 5CJ7A 2UVRA 4K4HA 3HKZC 2HSZA 2PI4A 4LZGA 2HVIA 3NASA 5ALGA 4M6WB 4RUCA 4Q43A 5ALUA 1ZQRA 3ALRA 3TACB 1F44A 5KG7A 2R8HA 2AU0A 2FE9A 3G6VA 1PUZA 4F3OA 5L1IA 5HNKA 3LVWA 1X9SA 4CNQA 1LV5A 1ZRNA 5DKWA 1N60A 4B9NA 2EZXA 4BWJA 3QX7A 5ALOA 4NLGA 4ZOHC 2XCAA 3QU7A 4FBUA 2LPEA 5DLGA 3GV8B 1Q3UA 1HUOA 4I2DA 1Z00B 2MUTA 4Q45A 4TUSA 2YTUA 3QU9A 2D8CA 3ZDEA 4FS1A 5D4BA 3RH4A 4NLKA 4O3SA 2WF9A 4NLNA 8ICHA 3C28A 3MC1A 1XSLA 1H38A 3H8JA 2ZIVA 4JK1A 5AKKA 3JPNA 2Q0ZX 4DF4A 5B66U 2QB1A 4Z6FA 1GO3F 4JV0A 3H8WA 5AI4A 3BQ2A 1URJA 5ALZA 2YMPA 8ICNA 1SL0A 8ICVA 2FDRA 9ICRA 1ZJNA 4UBBA 4DSLA 2DPIA 2W9BA 3SMVA 5AICA 1IG6A 4U6PA 5H2FU 4O5CA 4RZRA 1L3VA 5ALKA 1JROA 4F5NA 8ICOA 3EWAA 4UB8U 2FPLA 4MFFA 4YXJA 4PL2A 5DQGA 2ZIUA 5AM3A 4JV2A 5AM2A 2I5HA 4Y2XA 2YMQA 1U4BA 4DSKA 9ICHA 1MSWD 4JB3A 5ALFA 5KFHA 3DEEA 2BGWA 2BCSA 3PR5B 8ICIA 2KTQA 1ECWA 3C1ZA 4Y2SA 5ALXA 2IOFK 3GIIA 2VJ4A 5A0LA 1RXWA 3RRGA 4QZFA 2XC9A 2B6GA 5KNIA 3ZDCA 4J9LA 1JI7A 4RPXA 3LWMA 5J2BA 1IIPA 5J2CA 1ZD4A 2KIWA 3BS5A 1KKXA 3T5JA 3ZI4A 2BQ3A 1QLNA 3H8MA 4QZIA 5J0OA 3MR2A 3GIMA 4ECYA 1ZQNA 3RH6A 1T8EA 3D2NA 1SL1A 4P4PA 5KFAA 3AL0B 3U26A 1CEZA 1MQ3A 4B9MA 3UMGA 1TVAA 1J97A 1D9DA 1ZQSA 3D2QA 5KG0A 3A0BU 3M6KA 2KP7A 1ZQPA 4P4MA 2CN1A 3QEBZ 3M8SA 3I76A 5HR7A 4DOCA 1JALA 3B0XA 1ZQQA 5J2IA 3AUOA 3Q8KA 4F4KA 2LI6A 3V7LA 1IXRA 3F2BA 1N63A 2DF4B 4DLGA 1BPDA 1SB3C 5AI6A 4IQTA 3OSNA 4CCHA 5AHXA 2HDOA 7ICEA 3C23A 2EAPA 2HHWA 3MGVA 2A1JB 2ISPA 3QUTA 2C28A 3MDCA 2K8CB 9ICTA 5J0SA 5T14A 2KD1A 3FDSA 2VJ5A 3LK9A 2A19A 2MA1A 2KSOA 3HX0A 4MEXA 5KFIA 4MEYA 5TISU 2K89A 2ZXIA 3TFRA 2XICA 2ZIXB 5E79U 3HPOA 2JZBB 5DB6A 5EWFA 1ZQZA 1T4GA 8ICLA 4RQNA 1BPXA 4IRCA 7ICIA 9ICNA 9ICAA 2A1AA 2KVCA 4KLJA 4XRHA 9ICMA 1RYRA 4M9JA 4R65A 3F2DA 4O9MA 4I2IA 1JUDA 2YQEA 3B0YA 4XUSA 3PR4A 1TKDA 3MGHA 1RYUA 2W3RA 1N61A 5CB1A 2IHMA 4B9LA 4ED2A 5J2HA 5KL1B 3IG8A 4DL5A 1ZQOA 7ICMA 4IS7A 2W8KA 1ZQUA 4R8UB 2W43A 4QWDA 9ICFA 3PMNA 1QQ5A 2XY6A 2EQYA 3OHAA 1COOA 3EPIA 2BZFA 2ZUCA 1DOQA 3PSFA 5HMMA 2HBLA 1U49A 7ICVA 2R18A 4UB2A 4I2CA 4RPZA 4UARA 4BXOA 2KN7A 1SXDA 4US9A 2WF6A 3CRXA 4GC7A 3N4MB 2W9BB 4UBCA 4OJLA 3KKAC 3BZKA 5IIJA 2E3TA 3H0LB 1CUKA 3NVVA 1S9FA 4DEZA 1SZPA 3VCBA 2ZJAA 3UXNA 1NKBA 5L1KA 2WB1F 2FI1A 4YD1A 1ZQGA 4KLIA 2HHQA 3MR6A 4KLQA 4US8A 2FJ6A 4NM1A 9ICKA 3PSPA 7ICRA 3NVWA 2XGPA 2V9WA 2ZIXA 4OJ6A 4I28A 3SAGA 1NI3A 5G5GA 4BJQA 4DSJA 4I2HA 1QH9A 3SZ2A 1NZBA 3AQFA 4Y2RA 3T3FA 4UB6U 1RDFA 2Y1IA 2VA8A 3JPPA 4QZ9A 2EZZA 2FLPA 2ISOA 1XS9D 4ELVA 1ZQIA 1VLBA 5KAIU 2P66A 2B0CA 5ALTA 5AIBA 1MA7A 2G08A 2J6UA 4ECVA 2HOIA 1NKEA 1L3UA 4R64A 4NM2A 4C4TA 2BPGA 1WG8A 1DRGA 1QSSA 1N5WA 2BCVA 5AM1A 1TE2A 4OJOA 3D2SA 2G06A 5CR0A 2NRWA 2O6KA 4LZDA 3EUB2 4DO9A 3PZPA 2G0AA 8ICAA 9ICWA 3QU4A 4NV0A 4RQ1A 3PW5A 2IMWP 2XO7A 7ICSA 3CW2C 3RR8A 4ED3A 4JV1A 3KTQA 4J9PA 4TUQA 4DLEA 2AGPA 2HI0A 4ECXA 5KFVA 1PK1A 2HBJA 3WK8A 1ZXIA 5DB9A 3PW0A 1SXEA 3ORYA 1JXLA 3BQ1A 2HHXA 2ATLA 3PMLA 2OWOA 4EENA 7ICOA 3SYZA 4J9NA 2KFZA 1SGGA 3HP6A 3PO4A 1F5SA 3GQCA 3THVA 5CHGA 2QKQA 4QZGA 2Y9UA 2E1EA 4LVSA 2KHVA 4DQPA 1XSPA 2IOHA 5AKZA 3GIKA 1U47A 3K4GA 2AXTU 2YN4A 2FPKA 5DBBA 2ZTDA 3ETLA 2LMRA 2KJ5A 1K1SA 3QU2A 1L3SA 2BCQA 3WKBA 1KFTA 1LB2B 3NUQA 2FLLA 1AQ6A 2KFNA 8ICEA 4ECQA 2AHOB 3HW8A 5EE1A 2JXJA 2K8BB 1SV4A 5KFQA 2MUTB 4MF8A 3H4BA 3WKCA 2KNJA 5ALVA 1ZQXA 2JR5A 3ZDDA 4FFDA 1UHUA 5DBAA 2B21A 3QZ8A 3H0RB 3C5GA 3PX6A 9ICVA 3HWTA 1V38A 3ZD9A 2RQ5A 4B9SA 1LKYA 5AKJA 4Y2VA 2Y0SC 4QWEA 2C2DA 5KG2A 4E0DA 2WB1C 5F3XB 3CYMA 5ALRA 2Y9TA 4RNNA 1S0VA 1KEJA 3RTVA 5AK5A 4F4WA 3KKAA 3N97B 2W3SA 3RJKA 1SWVA 4BGDA 4O5KA 4F2SA 4F2RA 2E8OA 8ICQA 3L5KA 1NZPA 1QQ7A 2NRZA 1XC9A 3R9KA 1TK8A 4OJ5A 5D46A 2ZIWB 1F0MA 5J0TA 4GXIA 4ZH4A 7ICLA 5GTIU 3N7SC 1ZYQA 1S5LU 5KFJA 1Z1VA 2R8GA 5IIMA 2H3IA 2GO7A 4RQ5A 3I28A 1S0OA 2ASLA 1NKCA 3JPQA 2XY5A 2EZYA 3GIJA 3UMBA 4OO1J 9ICGA 3SV4A 4YCXA 3MDAA 1S77D 1V9PA 4KLLA 4CGZA 4B9UA 4NJ8A 5J8YA 3E58A 2XI9A 2ODGA 8ICMA 2WF7A 4JUZA 4O3OA 1ZQEA 1ED1A 4YMNA 1UT8A 3RBDA 3SD7A 2L5YA 4KLOA 4CF4A 3UQ2A 5BOMA 2DFLA 4TURA 5AI5A 2YY6A 1FIQA 3K1RB 1A77A 4QW8A 1FFUA 3GV5B 4K4GA 4EEKA 4DSEA 1L7PA 5DG8A 2JRZA 1BPYA 3F5AA 4PHAA 5EWGA 2P6UA 5EE0A 3BS5B 3BZCA 4RQ0A 4JMUA 1YZ6A 5ALLA 4UAWA 5J2FA 3M9OB 2QARA 4YN4A 3EZ5A 4LJXA 2HHUA 5KFNA 3OPXA 2VA2A 4QZHA 4P0PA 5ALWA 5ALQA 4P0QB 4FZMA 4YMOA 3ZD8A 3H40A 5KT4A 4RQMA 2LYAA 3QUBA 4R63A 5KFOA 1OW5A 2BKEA 5JUMA 4NY8A 2JEGA 2W9AA 1L6NA 4O3PA 4O3QA 4Y2YA 3IP4B 2JZBA 1WCNA 3A0HU 5KG5A 3GFKB 2Q4TA 3WK9A 4DFPA 1UPHA 2NO5A 4C0ZA 4UAUA 1UQVA 2QB0A 3V6JA 3K1ZA 1SV0C 4KX5A 4UQGA 4EYHB 4IRDA 3EYZA 3RFAA 2N1RA 4ELTA 1K5OA 1X40A 2H3QA 2OYYA 3EW9A 5HMLA 4F93B 3FC4A 4YR3A 5J0PA 4RU9A 1ZQ1C 5ALDA 3DDHA 1SL2A 1Z3EB 2ZIVB 5KG1A 2PMZF 3RJGA 2KG5A 4UAVA 2MAXA 4BUGA 2W9CA 4BX9C 3ISDA 1DK2A 3FM9A 1KL9A 4Y2UA 2ZIWA 5J0UA 1OUQA 7ICKA 3H7IA 3WU2U 2Z7JA 1RG6A 4DFKA 4C7YA 2ALZA 5AKXA 4M9HA 3UQ0A 3OHBA 3NRWA 1A0PA 4GFJA 1TAMA 5ALMA 4R8UA 5J2DA 2PFOA 5KT6A 1HIWA 4NLBA 1JN3A 1ZJMA 1T7PA 4P0PB 4KN4A 3GILA 4DQQA 4PL1A 4XQ8A 5AM5A 1PVPA 4RT3A 2ESEA 1S76D 2OXOA 1Z4OA 4NLCA 4QWBA 5AK4A 4UATA 3V6HA 1DK3A 5KAFU 7ICFA 2LM1A 4F91B 3LYSA 3G6XA 4KX3A 4DL4A 1PK1B 2M9NA 1RXVA 4RQ6A 3HT3A 3JPRA 4UAYA 4OD0A 2I6XA 1T94A 2BCUA 2LM4A 2XVTA 5C5JA 1ZQCA 3PO5A 2E5SA 4DS5A 4QZAA 1M6YA 1C20A 1SKRA 5CRXA 2HBMA 5J2KA 4CDGA 1NJWA 2F8KA 3EPGA 4IC9A 4M9GA 4ACOA 2FMSA 5HHHA 1RYSA 3ETRA 1TK0A 3RAXA 3WK7A 4DFDA 2KICA 3SV3A 1SV0A 1PK3A 4XA5A 3PW4A 1S97A 2F1JA 1Y88A 1Z19A 2VIXA 1XO0A 3G6YA 1NK9A 3QU5A 4Z6CA 2BCRA 4M04A 3H0MB 4MFCA 3HKZF 5AKLA 3ED5A 2ASDA 4DOAA 2FMPA 3GV7B 3V72A 7ICNA 3PSTA 2YMMA 5K4LA 2UVWA 3PX0A 2VKQA 2KZMA 4ELUA 1ZD2P 1N48A 4J9KA 3C2MA 3PY8A 4GXKA 3RB4A 3Q8LA 2Y0SF 8ICCA 2K4HA 3KHGA 1CRXA 4O3MA 5HHIA 2RRDA 5AKGA 4QIWC 3UMCA 3B9JA 4DCCA 4KMOB 3E2EA 1IM4A 4PGYA 4KMUA 4B6JA 5CA7A 4I2FA 3V6KA 4QJFB 4ICAA 2W54A 2JGAA 4EBDA 5EOZA 5BPCA 1KBUA 2BDUA 1N2XA 2HBKA 1J2NA 5BOLA 1L7OA 3M8RA 4J9OA 3QEAZ 4IQVA 1O08A 1XSNA 8ICXA 2KZ3A 5KT2A 1ZQAA 4CE6A 1JMSA 2W8LA 3N7PD 2OHFA 2H3ZA 1CI4A 4DF8A 8ICUA 2AGOA 2LKYA 4C80A 2UVVA 5KT5A 2W9CB 1KN5A 2EAOA 5KFZA 2H3FA 2W55A 7ICTA 5DGAA 2QARB 2PKEA 4HYKA 2LYHA 2KOBA 9ICPA 2VA3A 2JEFA 5DB7A 2K60A 5KFYA 5FP0A 2BHNA 5J0WA 5AKIA 4FS2A 4O3RA 5AK6A 3CNHA 3HILA 2K4PA 4KLUA 3TKAA 2ZIUB 3E0FA 2I1QA 3NS1A 1X42A 1N62A 3RJEA 1VJ5A 2F3NA 4C7ZA 2JEIA 2KIVA 2KKVA 3RRHA 3IN5A 4Z6EA 1NJZA 2NV3A 3RF9A 1OXJA 1X9XA 1Z4NA 3AQEA 4HAIA 5KFGA 2KV2A 1RQNA 1S8OA 3JPSA 2RDJA 3C1YA 5AIAA 4J03A 4KLTA 3WK6A 1SZHA 3SI8A 2E8MA 5JTIA 1Q46A 2FPMA 5DG9A 1JXEA 2GLEA 5KT3A 1S0MA 1PVQA 3TAPA 1LKYB 5KFWA 4UB1A 4AYBF 1HJPA 3MABA 2IA6A 4U7CA 3QXGA 1S0NA 1NK6A 2BQRA 2OH2A 4A8EA 2D3DA 4P4OA 1A76A 4EELA 5J0XA 3TQ1A 1Z00A 3PX4A 4Q8EA 1B43A 4UASA 3Q8MA 5J0QA 2UVUA 5IINA 1KW4A 4K4IA 2BDPA 4F92B 3V7KA 4DS4A 4Z6DA 2DPJA 4MHVA 5J2GA 4M47A 4YR0A 5KG6A 1X9WA
chains in the Genus database with same CATH topology
5J8YC 2L5YA 1UCVA 2KG5A 3BS7A 2EAOA 3TADA 2JV3A 2KE7A 2F44A 1V38A 1DXSA 2QARB 2QB1A 2DKXA 3K1RB 4IS7A 1LKYA 2E8NA 1RG6A 3BQ7A 5JU5A 2K60A 2QB0B 5F3XB 4NL9A 3HILA 2K4PA 1WWVA 2Y9TA 3BS5B 2ES6A 3KKAA 1V85A 2F3NA 4PZOA 2QARA 3SENA 2E8OA 2EANA 1SXDA 2KIVA 1SV0A 1PK1A 1OXJA 1X9XA 5L1MA 4PZNA 2EAPA 1SXEA 3KKAC 1COKA 1WWUA 2E8MA 2KSOB 5JTIA 2ESEA 4RQMA 3IDWA 1OW5A 1F0MA 4NL9C 2E8PA 2GLEA 3TACB 1SGGA 1LKYB 3SEIA 2KSOA 2KMDA 2DL0A 2QKQA 2Y9UA 1Z1VA 2FE9A 1B4FA 2DKZA 1PK1B 2B6GA 5KNIA 2LMRA 1JI7A 2D3DA 2EAMA 1UQVA 2QB0A 4RQNA 1X66A 1SV0C 2LPEA 1B0XA 3BS5A 3H8MA 5JRTA 3TADC 1X40A 2F8KA 1KW4A 1SV4A 4NJ8A 5J8YA 4MHVA 2YTUA 2D8CA 1PK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8Y C;  2L5Y A;  1UCV A;  2KG5 A;  3BS7 A;  2EAO A;  3TAD A;  2JV3 A;  2KE7 A;  2F44 A;  1V38 A;  1DXS A;  2QAR B;  2QB1 A;  2DKX A;  3K1R B;  4IS7 A;  1LKY A;  2E8N A;  1RG6 A;  3BQ7 A;  5JU5 A;  2K60 A;  2QB0 B;  5F3X B;  4NL9 A;  3HIL A;  2K4P A;  1WWV A;  2Y9T A;  3BS5 B;  2ES6 A;  3KKA A;  1V85 A;  2F3N A;  4PZO A;  2QAR A;  3SEN A;  2E8O A;  2EAN A;  1SXD A;  2KIV A;  1SV0 A;  1PK1 A;  1OXJ A;  1X9X A;  5L1M A;  4PZN A;  2EAP A;  1SXE A;  3KKA C;  1COK A;  1WWU A;  2E8M A;  2KSO B;  5JTI A;  2ESE A;  4RQM A;  3IDW A;  1OW5 A;  1F0M A;  4NL9 C;  2E8P A;  2GLE A;  3TAC B;  1SGG A;  1LKY B;  3SEI A;  2KSO A;  2KMD A;  2DL0 A;  2QKQ A;  2Y9U A;  1Z1V A;  2FE9 A;  1B4F A;  2DKZ A;  1PK1 B;  2B6G A;  5KNI A;  2LMR A;  1JI7 A;  2D3D A;  2EAM A;  1UQV A;  2QB0 A;  4RQN A;  1X66 A;  1SV0 C;  2LPE A;  1B0X A;  3BS5 A;  3H8M A;  5JRT A;  3TAD C;  1X40 A;  2F8K A;  1KW4 A;  1SV4 A;  4NJ8 A;  5J8Y A;  4MHV A;  2YTU A;  2D8C A;  1PK3 A; 
#chains in the Genus database with same CATH topology
 1NJX A;  5EWE A;  1NK8 A;  2AQ4 A;  1L8O A;  1UCV A;  9ICU A;  3M6Z A;  1FO4 A;  4M6W A;  4QNL A;  1U48 A;  4DWI A;  1PZN A;  3PSI A;  5JU5 A;  3JPO A;  4B9V A;  4ECS A;  1UA0 A;  4QIW F;  1QSL A;  4FO6 A;  8ICR A;  3C5F A;  1WWV A;  3H4D A;  3C2K A;  1RPL A;  1KFS A;  4DSF A;  4FBT A;  9ICC A;  1KTQ A;  4PPX A;  1ARO P;  8ICB A;  4C4S A;  2EAN A;  1XNS A;  2FMQ A;  2NRV A;  2DUY A;  1ZQH A;  2ZJ5 A;  4UB3 A;  5AKY A;  1BNP A;  3DV9 A;  2JEJ A;  5KG3 A;  1J2M A;  3AEV A;  2JHD A;  3AU2 A;  2DWQ A;  2KMD A;  1SIJ A;  2KEY A;  3WK4 A;  3MR5 A;  3OSP A;  3L3F X;  2HOQ A;  2DKZ A;  5AKH A;  4IRK A;  4F5P A;  2AQ0 A;  4ED8 A;  2HVH A;  2HOF A;  2EAM A;  3Q8Q B;  2YML A;  3RJH A;  4ECW A;  2DGZ A;  1HEK A;  2WTF A;  2F1H A;  4PJ0 U;  4YR2 A;  4Q44 A;  4ECZ A;  2JH1 A;  3KFU F;  4NXZ A;  3KHL A;  3PW7 A;  2W9M A;  3PW2 A;  4FZL A;  4F4Y A;  4M0A A;  1XU4 A;  5KFP A;  4DQI A;  2QLT A;  1B22 A;  4G3I A;  1TAQ A;  4QWC A;  4M9N A;  3L4P A;  4PGX A;  3AN1 A;  4IQW A;  4C4R A;  2DKX A;  2VAN A;  2YX8 A;  3M9M B;  2MRL A;  4EX7 A;  2ZTC A;  3BQ7 A;  4EBC A;  4TUP A;  4Q8F A;  2G5H B;  3TFS A;  2HMX A;  2QB0 B;  3M9N B;  2H5X A;  2ZUD A;  4EYI B;  4CF5 A;  4PGQ A;  1DGJ A;  2P6R A;  3F5E A;  9ICS A;  8ICW A;  3WKE A;  4F71 A;  4BWM A;  1KLN A;  2A1J A;  5KFT A;  4M2Y A;  5CWR A;  4F5O A;  1RZT A;  2XID A;  5L1M A;  1K1Q A;  4I27 A;  3NVZ A;  4QZD A;  2NO4 A;  2YB1 A;  2E1F A;  3WKD A;  3HJE A;  2KSO B;  4C8M A;  5TZV A;  2IOF A;  4PHE A;  3IV6 A;  4C8N A;  2G09 A;  8ICP A;  2MU2 A;  5KFK A;  5DLF A;  9ICL A;  4QWA A;  1B4F A;  5ALH A;  4YP3 A;  4DOB A;  4KIT B;  2PFP A;  3BJY A;  2C22 A;  4R66 A;  5CP2 A;  1IV8 A;  4DQR A;  3Q8R B;  5ALJ A;  1LVH A;  3KHH A;  2XCP A;  3KOO A;  4YQW A;  1HUZ A;  4DL7 A;  3H8S A;  7ICJ A;  5L1J A;  5HP4 A;  1BGX T;  4J9R A;  3TAQ A;  3JPT A;  4J9Q A;  1L3T A;  4YVZ A;  2C2E A;  4EEY A;  4DFM A;  4RQ3 A;  3PV8 A;  1O03 A;  1QTM A;  5AI8 A;  4F4Z A;  5CEH A;  1X9M A;  4DL3 A;  4JWN A;  1DGS A;  4PH5 A;  2NRT A;  5B5E U;  1TK5 A;  3QNM A;  2JV3 A;  5J0R A;  3MFI A;  8ICK A;  1TAU A;  4UAZ A;  2AH5 A;  5ALI A;  4PHP A;  1SKS A;  4UB4 A;  5KFR A;  4KLD A;  4CRX A;  2K4I A;  1UA1 A;  2OEH A;  3T5K A;  4DL6 A;  4RNO A;  1QQ6 A;  4EX6 A;  4KTQ A;  4QZ8 A;  3NGD A;  2W7O A;  5DB8 A;  2CRX A;  1QSY A;  4KLH A;  4Y2T A;  5KFD A;  4TQR A;  5KTQ A;  7ICH A;  3RB3 A;  2F8L A;  5ALY A;  2KHQ A;  2MSN A;  5KG4 A;  3OJU A;  3BQ0 A;  1XO1 A;  3BDP A;  1BNO A;  5KL8 B;  2IHN A;  3GZF A;  1COK A;  4IL6 U;  3F2C A;  2WF5 A;  2PFQ A;  3IHQ B;  4ED6 A;  4G9B A;  3SAH A;  3KHR A;  1D8B A;  5ALP A;  3WK5 A;  4TQS A;  8ICZ A;  5J2J A;  3RJJ A;  3UPQ A;  1L5U A;  5DG7 A;  3QUC A;  4O5E A;  5AKE A;  3ZDA A;  1ZQK A;  2ASJ A;  2NYV A;  3UXP A;  4DFJ A;  1BVS A;  3PNC A;  4FE3 A;  4RUA A;  4ED7 A;  3TAD C;  2WAQ C;  4QZC A;  4ED0 A;  3RBE A;  1FFV A;  4KLG A;  2I9G A;  5DQI A;  5J0Y A;  2CXY A;  2R8I A;  1KSP A;  2R8K A;  1V97 A;  4C8O A;  2P35 A;  4P0Q A;  1SWW A;  5KFS A;  4EBE A;  1ZQL A;  5J8Y C;  5DBC A;  3IG5 A;  2C2R A;  3GDX A;  1RQL A;  2ZXH A;  2OCE A;  4IR1 A;  7ICU A;  1MN8 A;  2GH1 A;  2KJ9 A;  2ZTE A;  4NL9 A;  5ALE A;  3RH5 A;  1C7Y A;  4I29 A;  2LBO A;  3FYH A;  3N7R C;  4YG2 A;  4I2A A;  5D49 A;  5III A;  2ZG6 A;  3QE9 Y;  5AI9 A;  5J2E A;  5AI0 A;  2KJ8 A;  1X6J A;  9ICB A;  3T5L A;  3QUQ A;  4F5Q A;  3C2L A;  4GC6 A;  3ISC A;  4RNM A;  5KFE A;  3IDW A;  3SQI A;  4NL9 C;  4J9M A;  4Y2P A;  8ICG A;  3ONN A;  4F72 A;  2AJQ A;  4USA A;  3F53 A;  4F50 A;  4ED1 A;  1FEZ A;  2NRX A;  5IIO A;  4Y2J A;  4DSI A;  4B9T A;  1U45 A;  1D9F A;  3IRU A;  1ZQT A;  5KFU A;  2Y1J A;  1X66 A;  7ICG A;  1KQQ A;  2G07 A;  2AGQ A;  4KLF A;  3NRZ A;  4I2G A;  1YT3 A;  4IR9 A;  2RP5 A;  2FLN A;  4EZ9 A;  7ICP A;  5KFX A;  4KLM A;  8ICY A;  2BPC A;  3AU6 A;  5DGB A;  2RLT A;  1N56 A;  4MFA A;  5F9N A;  3OJS A;  3T79 A;  4QW9 A;  1YZ7 A;  5J2A A;  2M0N A;  4KN7 A;  3TAD A;  4UW9 A;  1KDH A;  2KE7 A;  4C8L A;  5AM4 A;  4MF2 A;  3RAQ A;  1WYG A;  2E8N A;  3AM9 A;  1S10 A;  3FAH A;  1L7N A;  2J6S A;  5DDY A;  2BPF A;  2HHV A;  2KKP A;  3M1Y A;  2KK0 A;  2ES6 A;  3RR7 A;  2ZUB A;  1X6I A;  2DQN B;  4Y2Q A;  5KFC A;  1NK0 A;  5L1L A;  3KZI U;  2F2A B;  4F4X A;  5DDM A;  2XGQ A;  5EE9 A;  3KD3 A;  9ICQ A;  3LWL A;  3Q8P B;  1NK7 A;  4RQ8 A;  4PHD A;  4JWM A;  2F1I A;  1WWU A;  5KFM A;  3NTU A;  2EH9 A;  2CPR A;  1NOM A;  2E8P A;  4GIB A;  8ICF A;  5KFF A;  2HHS A;  2K4E A;  2F76 X;  1T3Q A;  1ZQB A;  3SR6 A;  3LDA A;  3QZ7 A;  1ZQV A;  4KLS A;  9ICO A;  3PVX A;  2W03 A;  1ZET A;  2F77 X;  4F5R A;  1JRP A;  1A6S A;  1NNL A;  5KT7 A;  3N28 A;  3O0F A;  4RQ2 A;  1WCL A;  2KZZ A;  1ZOL A;  1B0X A;  4RPY A;  2A3V A;  1NK4 A;  3S6J A;  3D6J A;  2LHT A;  5JRT A;  5L9X A;  3MR3 A;  3RB6 A;  1Q8K A;  9ICJ A;  1ZQF A;  1D8L A;  4EZ6 A;  5IIK A;  8ICT A;  5DQH A;  1WUD A;  1ZQM A;  2BQU A;  5F9L A;  2PXI A;  3BS7 A;  2RHF A;  1ZQJ A;  4YD2 A;  2HHT A;  1BPB A;  4YXM A;  3IM1 A;  2F44 A;  3ZDB A;  4ECT A;  1U9L A;  2RDI A;  3M7D A;  3RJF A;  4C8K A;  7ICQ A;  8ICS A;  4QZE A;  1D8Y A;  2G5I B;  2W11 A;  4AP9 A;  3V7J A;  4BDP A;  2BR0 A;  1NK5 A;  2W7P A;  1ZQY A;  5G5H A;  4AYB C;  4CF3 A;  4YMM A;  2HW3 A;  2R8J A;  2YB4 A;  1QCK A;  2LYB A;  1ZQW A;  3OGU A;  2V4R A;  1V85 A;  3KBB A;  4IQU A;  1XWL A;  3ISB A;  3VC8 A;  4PZO A;  1KFD A;  3OTQ A;  3SEN A;  2DBY A;  4FZN A;  1ZD3 A;  2KVS A;  2JH7 A;  2XY7 A;  4UB5 A;  1KRP A;  4NWI A;  3NVY A;  1TFR A;  3MGI A;  4DQS A;  1RM6 C;  1Q3V A;  1P7D A;  5KFL A;  1JX4 A;  3SEI A;  4I2J A;  2DL0 A;  3AMZ A;  4M9L A;  5KFB A;  2PFN A;  2EDU A;  3TAN A;  2HCF A;  3HRD D;  9ICI A;  4GLX A;  4ECR A;  9ICE A;  2JMG A;  4QZB A;  1BPZ A;  5IIL A;  2WAQ F;  2GOL A;  5J29 A;  5GTH U;  4J9S A;  2IBK A;  2W04 A;  4F8R A;  3CP8 A;  1MQ2 A;  9ICX A;  2H3V A;  2PMZ C;  3C21 A;  2PI5 A;  5C0Y A;  3RJI A;  3TI0 A;  2K8A A;  3ICX A;  1UT5 A;  1T3N A;  4P2H A;  3I1Y A;  4YFK A;  3GU3 A;  3BQT A;  1NJY A;  3SAF A;  5AK3 A;  2D6F C;  2J6T A;  3TAR A;  4RT2 A;  5HR6 A;  1X2I A;  1L7M A;  1N5X A;  2V4Q A;  2WFA A;  4GXJ A;  1JIH A;  1DXS A;  3T5H A;  5ALN A;  3UXO A;  4BXO B;  8ICJ A;  3Q8S B;  2WF8 A;  1ZQD A;  1BPE A;  4ECU A;  1SKW A;  2GWS A;  4I2B A;  5ALS A;  1Z1B A;  1MC8 A;  2WHE A;  3MBY A;  1PVR A;  1ZD5 A;  4RQ4 A;  4NLZ A;  3WKA A;  5AM0 A;  2ZJ8 A;  4RQ7 A;  3K75 D;  4O0I A;  3UM9 A;  1TV9 A;  3C29 A;  3RB0 A;  4I2E A;  1ZRM A;  4DL2 A;  4OCZ A;  4O3N A;  2OM6 A;  3LVV A;  4KLE A;  1L8L A;  5EE3 A;  3J81 j;  1VDV A;  1EXN A;  3MFH A;  3KZX A;  4X5V A;  4OJP A;  4PZN A;  4WJ3 B;  3QYP A;  5CJ7 A;  2UVR A;  4K4H A;  3HKZ C;  2HSZ A;  2PI4 A;  4LZG A;  2HVI A;  3NAS A;  5ALG A;  4M6W B;  4RUC A;  4Q43 A;  5ALU A;  1ZQR A;  3ALR A;  3TAC B;  1F44 A;  5KG7 A;  2R8H A;  2AU0 A;  2FE9 A;  3G6V A;  1PUZ A;  4F3O A;  5L1I A;  5HNK A;  3LVW A;  1X9S A;  4CNQ A;  1LV5 A;  1ZRN A;  5DKW A;  1N60 A;  4B9N A;  2EZX A;  4BWJ A;  3QX7 A;  5ALO A;  4NLG A;  4ZOH C;  2XCA A;  3QU7 A;  4FBU A;  2LPE A;  5DLG A;  3GV8 B;  1Q3U A;  1HUO A;  4I2D A;  1Z00 B;  2MUT A;  4Q45 A;  4TUS A;  2YTU A;  3QU9 A;  2D8C A;  3ZDE A;  4FS1 A;  5D4B A;  3RH4 A;  4NLK A;  4O3S A;  2WF9 A;  4NLN A;  8ICH A;  3C28 A;  3MC1 A;  1XSL A;  1H38 A;  3H8J A;  2ZIV A;  4JK1 A;  5AKK A;  3JPN A;  2Q0Z X;  4DF4 A;  5B66 U;  2QB1 A;  4Z6F A;  1GO3 F;  4JV0 A;  3H8W A;  5AI4 A;  3BQ2 A;  1URJ A;  5ALZ A;  2YMP A;  8ICN A;  1SL0 A;  8ICV A;  2FDR A;  9ICR A;  1ZJN A;  4UBB A;  4DSL A;  2DPI A;  2W9B A;  3SMV A;  5AIC A;  1IG6 A;  4U6P A;  5H2F U;  4O5C A;  4RZR A;  1L3V A;  5ALK A;  1JRO A;  4F5N A;  8ICO A;  3EWA A;  4UB8 U;  2FPL A;  4MFF A;  4YXJ A;  4PL2 A;  5DQG A;  2ZIU A;  5AM3 A;  4JV2 A;  5AM2 A;  2I5H A;  4Y2X A;  2YMQ A;  1U4B A;  4DSK A;  9ICH A;  1MSW D;  4JB3 A;  5ALF A;  5KFH A;  3DEE A;  2BGW A;  2BCS A;  3PR5 B;  8ICI A;  2KTQ A;  1ECW A;  3C1Z A;  4Y2S A;  5ALX A;  2IOF K;  3GII A;  2VJ4 A;  5A0L A;  1RXW A;  3RRG A;  4QZF A;  2XC9 A;  2B6G A;  5KNI A;  3ZDC A;  4J9L A;  1JI7 A;  4RPX A;  3LWM A;  5J2B A;  1IIP A;  5J2C A;  1ZD4 A;  2KIW A;  3BS5 A;  1KKX A;  3T5J A;  3ZI4 A;  2BQ3 A;  1QLN A;  3H8M A;  4QZI A;  5J0O A;  3MR2 A;  3GIM A;  4ECY A;  1ZQN A;  3RH6 A;  1T8E A;  3D2N A;  1SL1 A;  4P4P A;  5KFA A;  3AL0 B;  3U26 A;  1CEZ A;  1MQ3 A;  4B9M A;  3UMG A;  1TVA A;  1J97 A;  1D9D A;  1ZQS A;  3D2Q A;  5KG0 A;  3A0B U;  3M6K A;  2KP7 A;  1ZQP A;  4P4M A;  2CN1 A;  3QEB Z;  3M8S A;  3I76 A;  5HR7 A;  4DOC A;  1JAL A;  3B0X A;  1ZQQ A;  5J2I A;  3AUO A;  3Q8K A;  4F4K A;  2LI6 A;  3V7L A;  1IXR A;  3F2B A;  1N63 A;  2DF4 B;  4DLG A;  1BPD A;  1SB3 C;  5AI6 A;  4IQT A;  3OSN A;  4CCH A;  5AHX A;  2HDO A;  7ICE A;  3C23 A;  2EAP A;  2HHW A;  3MGV A;  2A1J B;  2ISP A;  3QUT A;  2C28 A;  3MDC A;  2K8C B;  9ICT A;  5J0S A;  5T14 A;  2KD1 A;  3FDS A;  2VJ5 A;  3LK9 A;  2A19 A;  2MA1 A;  2KSO A;  3HX0 A;  4MEX A;  5KFI A;  4MEY A;  5TIS U;  2K89 A;  2ZXI A;  3TFR A;  2XIC A;  2ZIX B;  5E79 U;  3HPO A;  2JZB B;  5DB6 A;  5EWF A;  1ZQZ A;  1T4G A;  8ICL A;  4RQN A;  1BPX A;  4IRC A;  7ICI A;  9ICN A;  9ICA A;  2A1A A;  2KVC A;  4KLJ A;  4XRH A;  9ICM A;  1RYR A;  4M9J A;  4R65 A;  3F2D A;  4O9M A;  4I2I A;  1JUD A;  2YQE A;  3B0Y A;  4XUS A;  3PR4 A;  1TKD A;  3MGH A;  1RYU A;  2W3R A;  1N61 A;  5CB1 A;  2IHM A;  4B9L A;  4ED2 A;  5J2H A;  5KL1 B;  3IG8 A;  4DL5 A;  1ZQO A;  7ICM A;  4IS7 A;  2W8K A;  1ZQU A;  4R8U B;  2W43 A;  4QWD A;  9ICF A;  3PMN A;  1QQ5 A;  2XY6 A;  2EQY A;  3OHA A;  1COO A;  3EPI A;  2BZF A;  2ZUC A;  1DOQ A;  3PSF A;  5HMM A;  2HBL A;  1U49 A;  7ICV A;  2R18 A;  4UB2 A;  4I2C A;  4RPZ A;  4UAR A;  4BXO A;  2KN7 A;  1SXD A;  4US9 A;  2WF6 A;  3CRX A;  4GC7 A;  3N4M B;  2W9B B;  4UBC A;  4OJL A;  3KKA C;  3BZK A;  5IIJ A;  2E3T A;  3H0L B;  1CUK A;  3NVV A;  1S9F A;  4DEZ A;  1SZP A;  3VCB A;  2ZJA A;  3UXN A;  1NKB A;  5L1K A;  2WB1 F;  2FI1 A;  4YD1 A;  1ZQG A;  4KLI A;  2HHQ A;  3MR6 A;  4KLQ A;  4US8 A;  2FJ6 A;  4NM1 A;  9ICK A;  3PSP A;  7ICR A;  3NVW A;  2XGP A;  2V9W A;  2ZIX A;  4OJ6 A;  4I28 A;  3SAG A;  1NI3 A;  5G5G A;  4BJQ A;  4DSJ A;  4I2H A;  1QH9 A;  3SZ2 A;  1NZB A;  3AQF A;  4Y2R A;  3T3F A;  4UB6 U;  1RDF A;  2Y1I A;  2VA8 A;  3JPP A;  4QZ9 A;  2EZZ A;  2FLP A;  2ISO A;  1XS9 D;  4ELV A;  1ZQI A;  1VLB A;  5KAI U;  2P66 A;  2B0C A;  5ALT A;  5AIB A;  1MA7 A;  2G08 A;  2J6U A;  4ECV A;  2HOI A;  1NKE A;  1L3U A;  4R64 A;  4NM2 A;  4C4T A;  2BPG A;  1WG8 A;  1DRG A;  1QSS A;  1N5W A;  2BCV A;  5AM1 A;  1TE2 A;  4OJO A;  3D2S A;  2G06 A;  5CR0 A;  2NRW A;  2O6K A;  4LZD A;  3EUB 2;  4DO9 A;  3PZP A;  2G0A A;  8ICA A;  9ICW A;  3QU4 A;  4NV0 A;  4RQ1 A;  3PW5 A;  2IMW P;  2XO7 A;  7ICS A;  3CW2 C;  3RR8 A;  4ED3 A;  4JV1 A;  3KTQ A;  4J9P A;  4TUQ A;  4DLE A;  2AGP A;  2HI0 A;  4ECX A;  5KFV A;  1PK1 A;  2HBJ A;  3WK8 A;  1ZXI A;  5DB9 A;  3PW0 A;  1SXE A;  3ORY A;  1JXL A;  3BQ1 A;  2HHX A;  2ATL A;  3PML A;  2OWO A;  4EEN A;  7ICO A;  3SYZ A;  4J9N A;  2KFZ A;  1SGG A;  3HP6 A;  3PO4 A;  1F5S A;  3GQC A;  3THV A;  5CHG A;  2QKQ A;  4QZG A;  2Y9U A;  2E1E A;  4LVS A;  2KHV A;  4DQP A;  1XSP A;  2IOH A;  5AKZ A;  3GIK A;  1U47 A;  3K4G A;  2AXT U;  2YN4 A;  2FPK A;  5DBB A;  2ZTD A;  3ETL A;  2LMR A;  2KJ5 A;  1K1S A;  3QU2 A;  1L3S A;  2BCQ A;  3WKB A;  1KFT A;  1LB2 B;  3NUQ A;  2FLL A;  1AQ6 A;  2KFN A;  8ICE A;  4ECQ A;  2AHO B;  3HW8 A;  5EE1 A;  2JXJ A;  2K8B B;  1SV4 A;  5KFQ A;  2MUT B;  4MF8 A;  3H4B A;  3WKC A;  2KNJ A;  5ALV A;  1ZQX A;  2JR5 A;  3ZDD A;  4FFD A;  1UHU A;  5DBA A;  2B21 A;  3QZ8 A;  3H0R B;  3C5G A;  3PX6 A;  9ICV A;  3HWT A;  1V38 A;  3ZD9 A;  2RQ5 A;  4B9S A;  1LKY A;  5AKJ A;  4Y2V A;  2Y0S C;  4QWE A;  2C2D A;  5KG2 A;  4E0D A;  2WB1 C;  5F3X B;  3CYM A;  5ALR A;  2Y9T A;  4RNN A;  1S0V A;  1KEJ A;  3RTV A;  5AK5 A;  4F4W A;  3KKA A;  3N97 B;  2W3S A;  3RJK A;  1SWV A;  4BGD A;  4O5K A;  4F2S A;  4F2R A;  2E8O A;  8ICQ A;  3L5K A;  1NZP A;  1QQ7 A;  2NRZ A;  1XC9 A;  3R9K A;  1TK8 A;  4OJ5 A;  5D46 A;  2ZIW B;  1F0M A;  5J0T A;  4GXI A;  4ZH4 A;  7ICL A;  5GTI U;  3N7S C;  1ZYQ A;  1S5L U;  5KFJ A;  1Z1V A;  2R8G A;  5IIM A;  2H3I A;  2GO7 A;  4RQ5 A;  3I28 A;  1S0O A;  2ASL A;  1NKC A;  3JPQ A;  2XY5 A;  2EZY A;  3GIJ A;  3UMB A;  4OO1 J;  9ICG A;  3SV4 A;  4YCX A;  3MDA A;  1S77 D;  1V9P A;  4KLL A;  4CGZ A;  4B9U A;  4NJ8 A;  5J8Y A;  3E58 A;  2XI9 A;  2ODG A;  8ICM A;  2WF7 A;  4JUZ A;  4O3O A;  1ZQE A;  1ED1 A;  4YMN A;  1UT8 A;  3RBD A;  3SD7 A;  2L5Y A;  4KLO A;  4CF4 A;  3UQ2 A;  5BOM A;  2DFL A;  4TUR A;  5AI5 A;  2YY6 A;  1FIQ A;  3K1R B;  1A77 A;  4QW8 A;  1FFU A;  3GV5 B;  4K4G A;  4EEK A;  4DSE A;  1L7P A;  5DG8 A;  2JRZ A;  1BPY A;  3F5A A;  4PHA A;  5EWG A;  2P6U A;  5EE0 A;  3BS5 B;  3BZC A;  4RQ0 A;  4JMU A;  1YZ6 A;  5ALL A;  4UAW A;  5J2F A;  3M9O B;  2QAR A;  4YN4 A;  3EZ5 A;  4LJX A;  2HHU A;  5KFN A;  3OPX A;  2VA2 A;  4QZH A;  4P0P A;  5ALW A;  5ALQ A;  4P0Q B;  4FZM A;  4YMO A;  3ZD8 A;  3H40 A;  5KT4 A;  4RQM A;  2LYA A;  3QUB A;  4R63 A;  5KFO A;  1OW5 A;  2BKE A;  5JUM A;  4NY8 A;  2JEG A;  2W9A A;  1L6N A;  4O3P A;  4O3Q A;  4Y2Y A;  3IP4 B;  2JZB A;  1WCN A;  3A0H U;  5KG5 A;  3GFK B;  2Q4T A;  3WK9 A;  4DFP A;  1UPH A;  2NO5 A;  4C0Z A;  4UAU A;  1UQV A;  2QB0 A;  3V6J A;  3K1Z A;  1SV0 C;  4KX5 A;  4UQG A;  4EYH B;  4IRD A;  3EYZ A;  3RFA A;  2N1R A;  4ELT A;  1K5O A;  1X40 A;  2H3Q A;  2OYY A;  3EW9 A;  5HML A;  4F93 B;  3FC4 A;  4YR3 A;  5J0P A;  4RU9 A;  1ZQ1 C;  5ALD A;  3DDH A;  1SL2 A;  1Z3E B;  2ZIV B;  5KG1 A;  2PMZ F;  3RJG A;  2KG5 A;  4UAV A;  2MAX A;  4BUG A;  2W9C A;  4BX9 C;  3ISD A;  1DK2 A;  3FM9 A;  1KL9 A;  4Y2U A;  2ZIW A;  5J0U A;  1OUQ A;  7ICK A;  3H7I A;  3WU2 U;  2Z7J A;  1RG6 A;  4DFK A;  4C7Y A;  2ALZ A;  5AKX A;  4M9H A;  3UQ0 A;  3OHB A;  3NRW A;  1A0P A;  4GFJ A;  1TAM A;  5ALM A;  4R8U A;  5J2D A;  2PFO A;  5KT6 A;  1HIW A;  4NLB A;  1JN3 A;  1ZJM A;  1T7P A;  4P0P B;  4KN4 A;  3GIL A;  4DQQ A;  4PL1 A;  4XQ8 A;  5AM5 A;  1PVP A;  4RT3 A;  2ESE A;  1S76 D;  2OXO A;  1Z4O A;  4NLC A;  4QWB A;  5AK4 A;  4UAT A;  3V6H A;  1DK3 A;  5KAF U;  7ICF A;  2LM1 A;  4F91 B;  3LYS A;  3G6X A;  4KX3 A;  4DL4 A;  1PK1 B;  2M9N A;  1RXV A;  4RQ6 A;  3HT3 A;  3JPR A;  4UAY A;  4OD0 A;  2I6X A;  1T94 A;  2BCU A;  2LM4 A;  2XVT A;  5C5J A;  1ZQC A;  3PO5 A;  2E5S A;  4DS5 A;  4QZA A;  1M6Y A;  1C20 A;  1SKR A;  5CRX A;  2HBM A;  5J2K A;  4CDG A;  1NJW A;  2F8K A;  3EPG A;  4IC9 A;  4M9G A;  4ACO A;  2FMS A;  5HHH A;  1RYS A;  3ETR A;  1TK0 A;  3RAX A;  3WK7 A;  4DFD A;  2KIC A;  3SV3 A;  1SV0 A;  1PK3 A;  4XA5 A;  3PW4 A;  1S97 A;  2F1J A;  1Y88 A;  1Z19 A;  2VIX A;  1XO0 A;  3G6Y A;  1NK9 A;  3QU5 A;  4Z6C A;  2BCR A;  4M04 A;  3H0M B;  4MFC A;  3HKZ F;  5AKL A;  3ED5 A;  2ASD A;  4DOA A;  2FMP A;  3GV7 B;  3V72 A;  7ICN A;  3PST A;  2YMM A;  5K4L A;  2UVW A;  3PX0 A;  2VKQ A;  2KZM A;  4ELU A;  1ZD2 P;  1N48 A;  4J9K A;  3C2M A;  3PY8 A;  4GXK A;  3RB4 A;  3Q8L A;  2Y0S F;  8ICC A;  2K4H A;  3KHG A;  1CRX A;  4O3M A;  5HHI A;  2RRD A;  5AKG A;  4QIW C;  3UMC A;  3B9J A;  4DCC A;  4KMO B;  3E2E A;  1IM4 A;  4PGY A;  4KMU A;  4B6J A;  5CA7 A;  4I2F A;  3V6K A;  4QJF B;  4ICA A;  2W54 A;  2JGA A;  4EBD A;  5EOZ A;  5BPC A;  1KBU A;  2BDU A;  1N2X A;  2HBK A;  1J2N A;  5BOL A;  1L7O A;  3M8R A;  4J9O A;  3QEA Z;  4IQV A;  1O08 A;  1XSN A;  8ICX A;  2KZ3 A;  5KT2 A;  1ZQA A;  4CE6 A;  1JMS A;  2W8L A;  3N7P D;  2OHF A;  2H3Z A;  1CI4 A;  4DF8 A;  8ICU A;  2AGO A;  2LKY A;  4C80 A;  2UVV A;  5KT5 A;  2W9C B;  1KN5 A;  2EAO A;  5KFZ A;  2H3F A;  2W55 A;  7ICT A;  5DGA A;  2QAR B;  2PKE A;  4HYK A;  2LYH A;  2KOB A;  9ICP A;  2VA3 A;  2JEF A;  5DB7 A;  2K60 A;  5KFY A;  5FP0 A;  2BHN A;  5J0W A;  5AKI A;  4FS2 A;  4O3R A;  5AK6 A;  3CNH A;  3HIL A;  2K4P A;  4KLU A;  3TKA A;  2ZIU B;  3E0F A;  2I1Q A;  3NS1 A;  1X42 A;  1N62 A;  3RJE A;  1VJ5 A;  2F3N A;  4C7Z A;  2JEI A;  2KIV A;  2KKV A;  3RRH A;  3IN5 A;  4Z6E A;  1NJZ A;  2NV3 A;  3RF9 A;  1OXJ A;  1X9X A;  1Z4N A;  3AQE A;  4HAI A;  5KFG A;  2KV2 A;  1RQN A;  1S8O A;  3JPS A;  2RDJ A;  3C1Y A;  5AIA A;  4J03 A;  4KLT A;  3WK6 A;  1SZH A;  3SI8 A;  2E8M A;  5JTI A;  1Q46 A;  2FPM A;  5DG9 A;  1JXE A;  2GLE A;  5KT3 A;  1S0M A;  1PVQ A;  3TAP A;  1LKY B;  5KFW A;  4UB1 A;  4AYB F;  1HJP A;  3MAB A;  2IA6 A;  4U7C A;  3QXG A;  1S0N A;  1NK6 A;  2BQR A;  2OH2 A;  4A8E A;  2D3D A;  4P4O A;  1A76 A;  4EEL A;  5J0X A;  3TQ1 A;  1Z00 A;  3PX4 A;  4Q8E A;  1B43 A;  4UAS A;  3Q8M A;  5J0Q A;  2UVU A;  5IIN A;  1KW4 A;  4K4I A;  2BDP A;  4F92 B;  3V7K A;  4DS4 A;  4Z6D A;  2DPJ A;  4MHV A;  5J2G A;  4M47 A;  4YR0 A;  5KG6 A;  1X9W A; 
#chains in the Genus database with same CATH homology
 5J8Y C;  2L5Y A;  1UCV A;  2KG5 A;  3BS7 A;  2EAO A;  3TAD A;  2JV3 A;  2KE7 A;  2F44 A;  1V38 A;  1DXS A;  2QAR B;  2QB1 A;  2DKX A;  3K1R B;  4IS7 A;  1LKY A;  2E8N A;  1RG6 A;  3BQ7 A;  5JU5 A;  2K60 A;  2QB0 B;  5F3X B;  4NL9 A;  3HIL A;  2K4P A;  1WWV A;  2Y9T A;  3BS5 B;  2ES6 A;  3KKA A;  1V85 A;  2F3N A;  4PZO A;  2QAR A;  3SEN A;  2E8O A;  2EAN A;  1SXD A;  2KIV A;  1SV0 A;  1PK1 A;  1OXJ A;  1X9X A;  5L1M A;  4PZN A;  2EAP A;  1SXE A;  3KKA C;  1COK A;  1WWU A;  2E8M A;  2KSO B;  5JTI A;  2ESE A;  4RQM A;  3IDW A;  1OW5 A;  1F0M A;  4NL9 C;  2E8P A;  2GLE A;  3TAC B;  1SGG A;  1LKY B;  3SEI A;  2KSO A;  2KMD A;  2DL0 A;  2QKQ A;  2Y9U A;  1Z1V A;  2FE9 A;  1B4F A;  2DKZ A;  1PK1 B;  2B6G A;  5KNI A;  2LMR A;  1JI7 A;  2D3D A;  2EAM A;  1UQV A;  2QB0 A;  4RQN A;  1X66 A;  1SV0 C;  2LPE A;  1B0X A;  3BS5 A;  3H8M A;  5JRT A;  3TAD C;  1X40 A;  2F8K A;  1KW4 A;  1SV4 A;  4NJ8 A;  5J8Y A;  4MHV A;  2YTU A;  2D8C A;  1PK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...