1KX4D

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4D00
3REKA 3LELB 5B2JB 1S32A 2FJ7B 1P3GB 1TZYC 2NZDD 3R45A 5DNMB 1P3AC 3WKJC 3W96A 5GT3A 1P34A 3LZ0B 3X1TD 4Z66A 1M19B 3W97B 4WV4B 3AZND 5AY8A 5B1MD 3AZIC 2F8ND 1ZLAB 1ID3A 3REHC 3A6NC 3AYWA 5GSUA 1H3OB 5B33D 5CP6D 1BFMA 4YM6B 3LZ1A 1P3KB 5AVCB 3O62A 3RELA 1KX4D 4WU9A 5B32A 3MGRD 2NZDB 4J8UC 3KUYD 5CPKA 3X1TB 1KX5A 3AZNB 1P3IB 2F8NB 3AV1A 3W98C 5AV8C 4G92C 5CP6B 5B33B 4R8PA 5AV6A 5AVBA 3NQUA 4XZQA 4ZUXA 3LJAC 3TU4A 5AV5C 3UTBD 1KX4B 3UT9A 5B1LD 3MGRB 4JJNA 4XUJD 5JA4A 3AZMC 3KUYB 1JFIB 5F99A 4LD9A 4NE3A 5GT0D 1M1AC 5B0YA 3VH6W 3MGPC 3VH5W 5BO0A 3WKJD 5B24A 2AROC 5GT3B 3WAAD 3UTBB 4CSRA 5B1LB 4XUJB 3MVDA 4Z5TC 1P3FA 2RVQC 3WA9A 4J8WD 1U35C 4CAYA 3C1BD 5B40C 3AZGA 4WU8C 4J8UD 4AWLB 3AFAC 3WAAB 3AN2A 5DNNB 3VH6A 5AV8D 1P3LA 5AVCD 2YFWA 3AV2C 4J8XC 2CWEA 4QLCD 3B6FC 3LJAD 5FUGB 5AV5D 5E5AA 3AZFD 4J8WB 5CPJA 3C1BB 5AV9C 1HQ3D 4G91B 2HIOD 3WTPE 3LELA 5B2JA 4X23D 5G49B 2FJ7A 5B0YB 4KHAB 3B0CW 3UTAB 5DNMA 2CV5C 4YS3D 5BO0B 3LZ0A 3X1VD 1M19A 3W97A 1F66A 3C1CD 2NQBD 4QLCB 3MGQD 2PYOC 1ZLAA 3AZFB 3KXBC 1H3OA 5GXQB 1HQ3B 4NFTA 4YM6A 4Z5TD 1P3MC 1P3FB 5AVCA 2HIOB 3KWQC 4X23B 3WA9B 1P3KC 2NZDA 1P3BD 3AZHD 2F8NK 4YS3B 3REJD 4WU8D 3AZKC 3X1VB 3X1TA 2NQBB 3C1CB 3AZNA 3MGQB 5B1MA 5CPID 2F8NA 3X1SD 5B0ZD 5CP6A 5B33A 1P3IC 1KX3C 1P3LB 1P3OC 3AV2D 3MNNC 5B2ID 1KX4A 3MGRA 1HTAA 2L5AA 3AZEC 5CPJB 4KUDD 1P3BB 3AZHB 3REIC 3REJB 3KUYA 5B32G 1JFIA 5CPIB 3X1SB 1P3PC 5B0ZB 1M18C 2CV5D 3REKC 1S32C 1N1JB 5BNXA 3B6GD 4J8VC 4HGAC 5B2IB 3UTBA 1F66B 5B1LA 3W99D 5B31D 4WNNB 3W96C 1P34C 4XUJA 4KUDB 4Z66C 5C3IB 5AY8C 4NE6A 1ID3C 3AYWC 3KWQD 5GSUC 3LZ1C 3WKJA 3O62C 3RELC 4WU9C 5B32C 3B6GB 3WAAA 5DNNA 1TAFB 5B1MB 5B31B 3W99B 5CPKC 3B0BA 1KX5C 3AV1C 5FUGA 3MNND 3AZLD 4WZSB 4J8WA 4R8PC 5AV6C 5AVBC 1AOID 2IO5C 3C1BA 4XZQC 4ZUXC 1R4VA 4DRAA 3X1UD 3TU4C 1EQZD 4EO5B 4J8UA 3UT9C 3WTPD 4JJNC 3AZJD 3MGSD 5JRGC 3B0DC 5G49A 4KHAA 3UTAA 5AV8A 1TZYD 5F99C 4LD9C 4ZBJB 4H9SA 5B0YC 1P3AD 4QLCA 5KDMB 3LJAA 5BNXB 3AZLB 4H9OB 5AV5A 4J8VD 3AZFA 3AZID 5B24C 1AOIB 3REHD 5GXQA 1HQ3A 3A6ND 3X1UB 1EQZB 4E45A 2HUEC 2HIOA 3WTPB 4KGCC 3AZJB 3MGSB 4X23A 5GT0B 3MVDC 1TZYB 4YS3A 3X1VA 1P3AB 2NQBA 3WKJB 3C1CA 4H9RB 3MGQA 3AZGC 3AZIB 3REHB 3A6NB 3W98D 3AN2C 4Z5TA 2F8NH 1P3BA 3KSYA 3AZHA 3REJA 4WU8A 5E5AC 4J8UB 3AZMD 5CPIA 3V9RA 5JRGD 3X1SA 1M1AD 5B0ZA 2F8NG 3W98B 5AV8B 3LELC 5B2JC 1N1JA 3MGPD 4G92B 2FJ7C 1P3GC 1WWIA 5B2IA 2AROD 5DNMC 3LJAB 4WNNA 5AV5B 1A7WA 3LZ0C 4KUDA 1M19C 1WWSA 3W97C 5BT1C 1ZLAC 3AZMB 2BYMB 4KGCD 2RVQD 1M1AB 5BS7A 3MVDD 4YM6C 2CV5A 1U35D 5AVCC 5B40D 3B6GA 2AROB 3AFAD 2JSSA 2NZDC 1TAFA 5B31A 3W99A 3X1TC 3AZNC 4Z5TB 4J8XD 5CP6C 5B33C 3B6FD 1U35B 1KX4C 5B40B 5BNVA 5AV9D 4WU8B 3MGRC 3AFAB 3V9RB 3KUYC 4Z2MH 1BH8B 4H9PB 5KDMA 3AV2B 1P3GD 3AZLA 4H9OA 4J8XB 3B6FB 2PYOD 1AOIA 5GT3C 3KXBD 3X1UA 3UTBC 1EQZA 5B1LC 3WTPA 5AV9B 4Z2MG 3AZJA 3MGSA 4XUJC 1P3MD 4UUZB 5GT0A 1BH9B 1TZYA 1P3KD 4H9NB 2CV5B 1P3AA 5CHLB 4H9RA 2YFVB 3AZKD 4J8VA 1F1EA 3AZIA 2PYOB 2LY8A 4AWLC 3REHA 3WAAC 3KXBB 3A6NA 5DNNC 1P3ID 1ULYA 1KX3D 1P3OD 1P3MB 3KWQB 3AZED 4J8WC 3REID 3AZKB 5BNVB 3VH6T 3C1BC 3VH5T 4G91C 1P3PD 3W98A 1M18D 1KX3B 3REKD 1P3OB 1S32D 3UTAC 3MNNB 4H9QB 4H9SC 4QLCC 5GT3D 3AZEB 1P34D 3W96D 4Z66D 3AZFC 3REIB 3AZMA 2BYMA 5AY8D 5JRGA 1ID3D 5GXQC 1HQ3C 3AYWD 1M1AA 3NQJB 5GSUD 1P3FC 2HIOC 1P3PB 1M18B 4X23C 3LZ1D 3MGPA 3WA9C 3REKB 3O62D 3RELD 1S32B 2AROA 4WU9D 5B32D 4YS3C 4HGAB 4J8VB 3R45B 3X1VC 2NQBC 3C1CC 1P34B 3W96B 3MGQC 5CPKD 4Z66B 2BYKA 1KX5D 5DNND 5AY8B 4KGCA 1ID3B 3AV1D 3AYWB 1P3LC 5GSUB 4R8PD 1U35A 5AV6D 5AVBD 4XZQD 4ZUXD 5B40A 3LZ1B 3TU4D 3O62B 3RELB 5CPJC 4WU9B 3AFAA 3UT9D 5B32B 3B0CT 3AZHC 1P3BC 4NE5A 4JJND 3REJC 4DRBA 1BH8A 5CPIC 5CPKB 4H9PA 5B31G 5F99D 4LD9D 1KX5B 3AV2A 3X1SC 5B0ZC 5B0YD 4J8XA 3UTAD 3VH5A 3B6FA 3AV1B 4R8PB 5AV6B 5AVBB 5B2IC 5B24D 2IO5B 3NQUB 4XZQB 4ZUXB 4M6BA 1F66C 5AV9A 3TU4B 3UT9B 4UUZA 4KUDC 1BH9A 5C3IC 4JJNB 5GXQD 3B0DB 5JRGB 5JA4B 4H9NA 1P3FD 1B67A 5F99B 4LD9B 3MGPB 3WA9D 2YFVA 1P3GA 5BS7C 2PYOA 3AZGD 3KXBA 3B6GC 5B24B 5B1MC 3W99C 5B31C 2BYKB 4CSRB 3AN2D 1P3MA 2HUEB 4E44A 3KWQA 4KGCB 1P3LD 3MVDB 1KU5A 1P3KA 1Q9CA 3AZKA 5E5AD 5CPJD 4CAYB 4EO5C 3AZGB 1P3IA 1KX3A 1P3OA 3LELD 5B2JD 3AN2B 2FJ7D 3MNNA 4ZBJC 4H9QA 5DNMD 3AZEA 2YFWB 3LZ0D 3AZLC 1M19D 1F66D 3W97D 3REIA 5BT1D 1AOIC 1ZLAD 5E5AB 1B6WA 3NQJA 3X1UC 1EQZC 3WTPC 1P3PA 3AZJC 1M18A 3MGSC 4YM6D 5GT0C
chains in the Genus database with same CATH superfamily
3REKA 3LELB 5B2JB 1S32A 2FJ7B 1P3GB 1TZYC 2NZDD 3R45A 5DNMB 1P3AC 3WKJC 3W96A 5GT3A 1P34A 3LZ0B 3X1TD 4Z66A 1M19B 3W97B 4WV4B 3AZND 5AY8A 5B1MD 3AZIC 2F8ND 1ZLAB 1ID3A 3REHC 3A6NC 3AYWA 4UPKA 5GSUA 1H3OB 5B33D 5CP6D 2Y2NA 2XD1A 1BFMA 4YM6B 3LZ1A 1P3KB 5AVCB 3O62A 3RELA 1KX4D 4WU9A 5B32A 1Z2CB 3MGRD 2NZDB 4J8UC 3KUYD 5CPKA 2Y2KA 3X1TB 1KX5A 3AZNB 1P3IB 2F8NB 2ZY5A 3AV1A 3W98C 5AV8C 4G92C 5CP6B 5B33B 4R8PA 5AV6A 5AVBA 3NQUA 4XZQA 4ZUXA 3LJAC 3TU4A 5AV5C 3UTBD 1KX4B 3UT9A 5B1LD 3MGRB 4JJNA 4XUJD 5JA4A 3AZMC 3KUYB 1JFIB 5F99A 4LD9A 4NE3A 5GT0D 1M1AC 5B0YA 3VH6W 3EG5B 3MGPC 3VH5W 5BO0A 3WKJD 5B24A 2AROC 5GT3B 2JCHA 3WAAD 3UTBB 4CSRA 5B1LB 4XUJB 3MVDA 3FDDA 4Z5TC 1P3FA 2RVQC 3WA9A 2ZY2A 4J8WD 1U35C 4CAYA 3C1BD 5B40C 3AZGA 4WU8C 4J8UD 4AWLB 3AFAC 3WAAB 3AN2A 5DNNB 3P5JB 3VH6A 3EPJA 2DQNC 5AV8D 1P3LA 5AVCD 2YFWA 3AV2C 4J8XC 2CWEA 4QLCD 3B6FC 3LJAD 1T3UA 5FUGB 5AV5D 5E5AA 3AZFD 4J8WB 5CPJA 3C1BB 5AV9C 1HQ3D 4G91B 2HIOD 3WTPE 3LELA 5B2JA 4X23D 5G49B 2FJ7A 2Y2LA 5B0YB 4KHAB 3B0CW 3UTAB 5DNMA 2CV5C 4YS3D 5BO0B 3LZ0A 3X1VD 1M19A 3W97A 1F66A 3C1CD 2NQBD 4QLCB 3MGQD 2PYOC 1ZLAA 3AZFB 3KXBC 1H3OA 5GXQB 1HQ3B 4NFTA 4YM6A 4Z5TD 1P3MC 1P3FB 5AVCA 2HIOB 3KWQC 4X23B 3WA9B 1P3KC 2NZDA 1P3BD 3AZHD 2F8NK 4YS3B 3REJD 4WU8D 3AZKC 3X1VB 3X1TA 2NQBB 3C1CB 3AZNA 3MGQB 5B1MA 5CPID 2F8NA 3X1SD 5B0ZD 2ZY4A 5B33A 5CP6A 1P3IC 1KX3C 1P3LB 1P3OC 3AV2D 3MNNC 5B2ID 1KX4A 3EPHA 3MGRA 1HTAA 2L5AA 3AZEC 3IP4C 5CPJB 4KUDD 1P3BB 3AZHB 3REIC 3REJB 3KUYA 3AL0C 5B32G 1JFIA 4WJ3C 5CPIB 3X1SB 1P3PC 5B0ZB 1M18C 2CV5D 3REKC 1S32C 1N1JB 5BNXA 2Y2MA 3B6GD 4J8VC 4HGAC 5B2IB 3UTBA 1F66B 2Y2PA 5B1LA 3W99D 5B31D 4WNNB 3W96C 1P34C 4XUJA 4KUDB 4Z66C 5C3IB 5AY8C 4NE6A 1ID3C 3KFUG 3AYWC 3KWQD 5GSUC 3EPLA 3LZ1C 2ZM5A 3WKJA 3O62C 3RELC 4WU9C 5B32C 3B6GB 3WAAA 5DNNA 1TAFB 5B1MB 5B31B 3W99B 5CPKC 3B0BA 1KX5C 3AV1C 5FUGA 3MNND 2FFFB 3AZLD 4WZSB 4J8WA 4R8PC 5AV6C 5AVBC 1AOID 2IO5C 2XD5A 4XZQC 4ZUXC 3C1BA 1R4VA 4DRAA 3X1UD 3TU4C 1EQZD 4EO5B 4J8UA 3UT9C 3WTPD 4JJNC 3AZJD 3MGSD 5JRGC 3B0DC 5G49A 4KHAA 3UTAA 5AV8A 1TZYD 2Y2OA 2Y2GA 2ZY3A 4ZBJB 5F99C 4LD9C 4H9SA 5B0YC 1P3AD 4QLCA 5KDMB 3LJAA 5BNXB 3AZLB 4H9OB 5AV5A 4J8VD 3AZFA 2Y2IA 3AZID 5B24C 1AOIB 3REHD 5GXQA 1HQ3A 3A6ND 3X1UB 1EQZB 4E45A 2HUEC 2HIOA 3WTPB 4KGCC 3AZJB 3MGSB 4X23A 5GT0B 3MVDC 1TZYB 4YS3A 3H0MC 3X1VA 1P3AB 2NQBA 3WKJB 3C1CA 4H9RB 3MGQA 3AZGC 3F6TA 3AZIB 3REHB 3A6NB 3W98D 3AN2C 4Z5TA 2F8NH 3H0RC 1P3BA 3KSYA 3AZHA 3REJA 4WU8A 5E5AC 4J8UB 3AZMD 5CPIA 3V9RA 5JRGD 2J8PA 3X1SA 1M1AD 5B0ZA 2F8NG 3W98B 5AV8B 3LELC 5B2JC 1N1JA 3MGPD 4G92B 2FJ7C 4DQYB 1P3GC 1WWIA 5B2IA 2AROD 5DNMC 3LJAB 4WNNA 5AV5B 1A7WA 3LZ0C 4KUDA 1M19C 1WWSA 3W97C 5BT1C 1ZLAC 3AZMB 2BYMB 4KGCD 2RVQD 3A1IA 1M1AB 5BS7A 3MVDD 4YM6C 2CV5A 1U35D 5AVCC 5B40D 3B6GA 2AROB 3AFAD 2JSSA 2NZDC 1TAFA 5B31A 3W99A 3X1TC 2G5HC 3AZNC 4Z5TB 4J8XD 5CP6C 5B33C 3B6FD 1U35B 1KX4C 5B40B 5BNVA 5AV9D 4WU8B 3MGRC 3AFAB 3V9RB 3KUYC 4Z2MH 1BH8B 4H9PB 5KDMA 3AV2B 1P3GD 3AZLA 4H9OA 4J8XB 3B6FB 2PYOD 1AOIA 5GT3C 3KXBD 3X1UA 3UTBC 1EQZA 5B1LC 5AV9B 3WTPA 4Z2MG 3AZJA 3MGSA 4XUJC 1P3MD 4UUZB 5GT0A 1BH9B 1TZYA 1P3KD 4H9NB 2CV5B 1P3AA 5CHLB 4H9RA 2YFVB 3AZKD 3A1KA 4J8VA 1F1EA 3AZIA 2PYOB 2LY8A 4AWLC 3REHA 3WAAC 3KXBB 3A6NA 5DNNC 1P3ID 1ULYA 1KX3D 2DF4C 1P3OD 1P3MB 3KWQB 2BG1A 3AZED 4J8WC 3REID 2JE5A 3AZKB 5BNVB 3VH6T 3C1BC 3VH5T 2G5IC 4G91C 1P3PD 3W98A 1M18D 1KX3B 3REKD 1P3OB 1S32D 3H0LC 3UTAC 3MNNB 4H9QB 4H9SC 4QLCC 5GT3D 3AZEB 1P34D 3W96D 4Z66D 3AZFC 3REIB 3AZMA 2BYMA 5AY8D 5JRGA 1ID3D 5GXQC 1HQ3C 3AYWD 1M1AA 3NQJB 5GSUD 1P3FC 2HIOC 1P3PB 3EPKA 2F2AC 1M18B 4X23C 3LZ1D 3MGPA 3WA9C 3REKB 3O62D 3RELD 1S32B 2AROA 4WU9D 5B32D 4YS3C 4HGAB 4J8VB 3R45B 3X1VC 2NQBC 3C1CC 1P34B 3W96B 3MGQC 5CPKD 4Z66B 2BYKA 1KX5D 5DNND 5AY8B 4KGCA 1ID3B 3AV1D 3AYWB 1P3LC 5GSUB 4R8PD 1U35A 1PZRA 5AV6D 5AVBD 4XZQD 4ZUXD 5B40A 3LZ1B 2Y2HA 3TU4D 3O62B 3RELB 5CPJC 4WU9B 3AFAA 3UT9D 5B32B 3B0CT 2UWXA 3AZHC 4NE5A 4JJND 1P3BC 3REJC 4DRBA 1BH8A 5CPIC 5CPKB 4H9PA 5B31G 5F99D 4LD9D 1KX5B 3AV2A 3X1SC 5B0ZC 5B0YD 4J8XA 3UTAD 2W8SA 3VH5A 3AV1B 3B6FA 4R8PB 5AV6B 5AVBB 5B2IC 5B24D 2IO5B 3NQUB 4XZQB 4ZUXB 4M6BA 1F66C 5AV9A 3TU4B 3UT9B 2Y2JA 4UUZA 4KUDC 1BH9A 5C3IC 4JJNB 5GXQD 3B0DB 5JRGB 5JA4B 4H9NA 1P3FD 2VQRA 1B67A 5F99B 4LD9B 3MGPB 3WA9D 2YFVA 1P3GA 5BS7C 2Y2QA 2PYOA 3AZGD 3KXBA 3B6GC 5B24B 5B1MC 3W99C 5B31C 2BYKB 4CSRB 3AN2D 1P3MA 2HUEB 4E44A 3KWQA 4KGCB 1P3LD 3MVDB 1KU5A 1P3KA 1Q9CA 3AZKA 5E5AD 5CPJD 2RIQA 1W2EA 4CAYB 4EO5C 3AZGB 1P3IA 1KX3A 1P3OA 3LELD 5B2JD 3AN2B 2FJ7D 3MNNA 4ZBJC 4H9QA 5DNMD 3AZEA 2YFWB 3LZ0D 3AZLC 1M19D 1F66D 3W97D 3REIA 5BT1D 1AOIC 1ZLAD 5E5AB 1B6WA 3NQJA 3X1UC 1EQZC 3WTPC 1P3PA 3AZJC 1M18A 3MGSC 4YM6D 5GT0C
chains in the Genus database with same CATH topology
3REKA 3LELB 5B2JB 1S32A 2FJ7B 1P3GB 1TZYC 2NZDD 3R45A 5DNMB 1P3AC 3WKJC 3W96A 5GT3A 1P34A 3LZ0B 3X1TD 4Z66A 1M19B 3W97B 4WV4B 3AZND 5AY8A 5B1MD 3AZIC 2F8ND 1ZLAB 1ID3A 3REHC 3A6NC 3AYWA 4UPKA 5GSUA 1H3OB 5B33D 5CP6D 2Y2NA 2XD1A 1BFMA 4YM6B 3LZ1A 1P3KB 5AVCB 3O62A 3RELA 1KX4D 4WU9A 5B32A 1Z2CB 3MGRD 2NZDB 4J8UC 3KUYD 5CPKA 2Y2KA 3X1TB 1KX5A 3AZNB 1P3IB 2F8NB 2ZY5A 3AV1A 3W98C 5AV8C 4G92C 5CP6B 5B33B 4R8PA 5AV6A 5AVBA 3NQUA 4XZQA 4ZUXA 3LJAC 3TU4A 5AV5C 3UTBD 1KX4B 3UT9A 5B1LD 3MGRB 4JJNA 4XUJD 5JA4A 3AZMC 3KUYB 1JFIB 5F99A 4LD9A 4NE3A 5GT0D 1M1AC 5B0YA 3VH6W 3EG5B 3MGPC 3VH5W 5BO0A 3WKJD 5B24A 2AROC 5GT3B 2JCHA 3WAAD 3UTBB 4CSRA 5B1LB 4XUJB 3MVDA 3FDDA 4Z5TC 1P3FA 2RVQC 3WA9A 2ZY2A 4J8WD 1U35C 4CAYA 3C1BD 5B40C 3AZGA 4WU8C 4J8UD 4AWLB 3AFAC 3WAAB 3AN2A 5DNNB 3P5JB 3VH6A 3EPJA 2DQNC 5AV8D 1P3LA 5AVCD 2YFWA 3AV2C 4J8XC 2CWEA 4QLCD 3B6FC 3LJAD 1T3UA 5FUGB 5AV5D 5E5AA 3AZFD 4J8WB 5CPJA 3C1BB 5AV9C 1HQ3D 4G91B 2HIOD 3WTPE 3LELA 5B2JA 4X23D 5G49B 2FJ7A 2Y2LA 5B0YB 4KHAB 3B0CW 3UTAB 5DNMA 2CV5C 4YS3D 5BO0B 3LZ0A 3X1VD 1M19A 3W97A 1F66A 3C1CD 2NQBD 4QLCB 3MGQD 2PYOC 1ZLAA 3AZFB 3KXBC 1H3OA 5GXQB 1HQ3B 4NFTA 4YM6A 4Z5TD 1P3MC 1P3FB 5AVCA 2HIOB 3KWQC 4X23B 3WA9B 1P3KC 2NZDA 1P3BD 3AZHD 2F8NK 4YS3B 3REJD 4WU8D 3AZKC 3X1VB 3X1TA 2NQBB 3C1CB 3AZNA 3MGQB 5B1MA 5CPID 2F8NA 3X1SD 5B0ZD 2ZY4A 5B33A 5CP6A 1P3IC 1KX3C 1P3LB 1P3OC 3AV2D 3MNNC 5B2ID 1KX4A 3EPHA 3MGRA 1HTAA 2L5AA 3AZEC 3IP4C 5CPJB 4KUDD 1P3BB 3AZHB 3REIC 3REJB 3KUYA 3AL0C 5B32G 1JFIA 4WJ3C 5CPIB 3X1SB 1P3PC 5B0ZB 1M18C 2CV5D 3REKC 1S32C 1N1JB 5BNXA 2Y2MA 3B6GD 4J8VC 4HGAC 5B2IB 3UTBA 1F66B 2Y2PA 5B1LA 3W99D 5B31D 4WNNB 3W96C 1P34C 4XUJA 4KUDB 4Z66C 5C3IB 5AY8C 4NE6A 1ID3C 3KFUG 3AYWC 3KWQD 5GSUC 3EPLA 3LZ1C 2ZM5A 3WKJA 3O62C 3RELC 4WU9C 5B32C 3B6GB 3WAAA 5DNNA 1TAFB 5B1MB 5B31B 3W99B 5CPKC 3B0BA 1KX5C 3AV1C 5FUGA 3MNND 2FFFB 3AZLD 4WZSB 4J8WA 4R8PC 5AV6C 5AVBC 1AOID 2IO5C 2XD5A 4XZQC 4ZUXC 3C1BA 1R4VA 4DRAA 3X1UD 3TU4C 1EQZD 4EO5B 4J8UA 3UT9C 3WTPD 4JJNC 3AZJD 3MGSD 5JRGC 3B0DC 5G49A 4KHAA 3UTAA 5AV8A 1TZYD 2Y2OA 2Y2GA 2ZY3A 4ZBJB 5F99C 4LD9C 4H9SA 5B0YC 1P3AD 4QLCA 5KDMB 3LJAA 5BNXB 3AZLB 4H9OB 5AV5A 4J8VD 3AZFA 2Y2IA 3AZID 5B24C 1AOIB 3REHD 5GXQA 1HQ3A 3A6ND 3X1UB 1EQZB 4E45A 2HUEC 2HIOA 3WTPB 4KGCC 3AZJB 3MGSB 4X23A 5GT0B 3MVDC 1TZYB 4YS3A 3H0MC 3X1VA 1P3AB 2NQBA 3WKJB 3C1CA 4H9RB 3MGQA 3AZGC 3F6TA 3AZIB 3REHB 3A6NB 3W98D 3AN2C 4Z5TA 2F8NH 3H0RC 1P3BA 3KSYA 3AZHA 3REJA 4WU8A 5E5AC 4J8UB 3AZMD 5CPIA 3V9RA 5JRGD 2J8PA 3X1SA 1M1AD 5B0ZA 2F8NG 3W98B 5AV8B 3LELC 5B2JC 1N1JA 3MGPD 4G92B 2FJ7C 4DQYB 1P3GC 1WWIA 5B2IA 2AROD 5DNMC 3LJAB 4WNNA 5AV5B 1A7WA 3LZ0C 4KUDA 1M19C 1WWSA 3W97C 5BT1C 1ZLAC 3AZMB 2BYMB 4KGCD 2RVQD 3A1IA 1M1AB 5BS7A 3MVDD 4YM6C 2CV5A 1U35D 5AVCC 5B40D 3B6GA 2AROB 3AFAD 2JSSA 2NZDC 1TAFA 5B31A 3W99A 3X1TC 2G5HC 3AZNC 4Z5TB 4J8XD 5CP6C 5B33C 3B6FD 1U35B 1KX4C 5B40B 5BNVA 5AV9D 4WU8B 3MGRC 3AFAB 3V9RB 3KUYC 4Z2MH 1BH8B 4H9PB 5KDMA 3AV2B 1P3GD 3AZLA 4H9OA 4J8XB 3B6FB 2PYOD 1AOIA 5GT3C 3KXBD 3X1UA 3UTBC 1EQZA 5B1LC 5AV9B 3WTPA 4Z2MG 3AZJA 3MGSA 4XUJC 1P3MD 4UUZB 5GT0A 1BH9B 1TZYA 1P3KD 4H9NB 2CV5B 1P3AA 5CHLB 4H9RA 2YFVB 3AZKD 3A1KA 4J8VA 1F1EA 3AZIA 2PYOB 2LY8A 4AWLC 3REHA 3WAAC 3KXBB 3A6NA 5DNNC 1P3ID 1ULYA 1KX3D 2DF4C 1P3OD 1P3MB 3KWQB 2BG1A 3AZED 4J8WC 3REID 2JE5A 3AZKB 5BNVB 3VH6T 3C1BC 3VH5T 2G5IC 4G91C 1P3PD 3W98A 1M18D 1KX3B 3REKD 1P3OB 1S32D 3H0LC 3UTAC 3MNNB 4H9QB 4H9SC 4QLCC 5GT3D 3AZEB 1P34D 3W96D 4Z66D 3AZFC 3REIB 3AZMA 2BYMA 5AY8D 5JRGA 1ID3D 5GXQC 1HQ3C 3AYWD 1M1AA 3NQJB 5GSUD 1P3FC 2HIOC 1P3PB 3EPKA 2F2AC 1M18B 4X23C 3LZ1D 3MGPA 3WA9C 3REKB 3O62D 3RELD 1S32B 2AROA 4WU9D 5B32D 4YS3C 4HGAB 4J8VB 3R45B 3X1VC 2NQBC 3C1CC 1P34B 3W96B 3MGQC 5CPKD 4Z66B 2BYKA 1KX5D 5DNND 5AY8B 4KGCA 1ID3B 3AV1D 3AYWB 1P3LC 5GSUB 4R8PD 1U35A 1PZRA 5AV6D 5AVBD 4XZQD 4ZUXD 5B40A 3LZ1B 2Y2HA 3TU4D 3O62B 3RELB 5CPJC 4WU9B 3AFAA 3UT9D 5B32B 3B0CT 2UWXA 3AZHC 4NE5A 4JJND 1P3BC 3REJC 4DRBA 1BH8A 5CPIC 5CPKB 4H9PA 5B31G 5F99D 4LD9D 1KX5B 3AV2A 3X1SC 5B0ZC 5B0YD 4J8XA 3UTAD 2W8SA 3VH5A 3AV1B 3B6FA 4R8PB 5AV6B 5AVBB 5B2IC 5B24D 2IO5B 3NQUB 4XZQB 4ZUXB 4M6BA 1F66C 5AV9A 3TU4B 3UT9B 2Y2JA 4UUZA 4KUDC 1BH9A 5C3IC 4JJNB 5GXQD 3B0DB 5JRGB 5JA4B 4H9NA 1P3FD 2VQRA 1B67A 5F99B 4LD9B 3MGPB 3WA9D 2YFVA 1P3GA 5BS7C 2Y2QA 2PYOA 3AZGD 3KXBA 3B6GC 5B24B 5B1MC 3W99C 5B31C 2BYKB 4CSRB 3AN2D 1P3MA 2HUEB 4E44A 3KWQA 4KGCB 1P3LD 3MVDB 1KU5A 1P3KA 1Q9CA 3AZKA 5E5AD 5CPJD 2RIQA 1W2EA 4CAYB 4EO5C 3AZGB 1P3IA 1KX3A 1P3OA 3LELD 5B2JD 3AN2B 2FJ7D 3MNNA 4ZBJC 4H9QA 5DNMD 3AZEA 2YFWB 3LZ0D 3AZLC 1M19D 1F66D 3W97D 3REIA 5BT1D 1AOIC 1ZLAD 5E5AB 1B6WA 3NQJA 3X1UC 1EQZC 3WTPC 1P3PA 3AZJC 1M18A 3MGSC 4YM6D 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK A;  3LEL B;  5B2J B;  1S32 A;  2FJ7 B;  1P3G B;  1TZY C;  2NZD D;  3R45 A;  5DNM B;  1P3A C;  3WKJ C;  3W96 A;  5GT3 A;  1P34 A;  3LZ0 B;  3X1T D;  4Z66 A;  1M19 B;  3W97 B;  4WV4 B;  3AZN D;  5AY8 A;  5B1M D;  3AZI C;  2F8N D;  1ZLA B;  1ID3 A;  3REH C;  3A6N C;  3AYW A;  5GSU A;  1H3O B;  5B33 D;  5CP6 D;  1BFM A;  4YM6 B;  3LZ1 A;  1P3K B;  5AVC B;  3O62 A;  3REL A;  1KX4 D;  4WU9 A;  5B32 A;  3MGR D;  2NZD B;  4J8U C;  3KUY D;  5CPK A;  3X1T B;  1KX5 A;  3AZN B;  1P3I B;  2F8N B;  3AV1 A;  3W98 C;  5AV8 C;  4G92 C;  5CP6 B;  5B33 B;  4R8P A;  5AV6 A;  5AVB A;  3NQU A;  4XZQ A;  4ZUX A;  3LJA C;  3TU4 A;  5AV5 C;  3UTB D;  1KX4 B;  3UT9 A;  5B1L D;  3MGR B;  4JJN A;  4XUJ D;  5JA4 A;  3AZM C;  3KUY B;  1JFI B;  5F99 A;  4LD9 A;  4NE3 A;  5GT0 D;  1M1A C;  5B0Y A;  3VH6 W;  3MGP C;  3VH5 W;  5BO0 A;  3WKJ D;  5B24 A;  2ARO C;  5GT3 B;  3WAA D;  3UTB B;  4CSR A;  5B1L B;  4XUJ B;  3MVD A;  4Z5T C;  1P3F A;  2RVQ C;  3WA9 A;  4J8W D;  1U35 C;  4CAY A;  3C1B D;  5B40 C;  3AZG A;  4WU8 C;  4J8U D;  4AWL B;  3AFA C;  3WAA B;  3AN2 A;  5DNN B;  3VH6 A;  5AV8 D;  1P3L A;  5AVC D;  2YFW A;  3AV2 C;  4J8X C;  2CWE A;  4QLC D;  3B6F C;  3LJA D;  5FUG B;  5AV5 D;  5E5A A;  3AZF D;  4J8W B;  5CPJ A;  3C1B B;  5AV9 C;  1HQ3 D;  4G91 B;  2HIO D;  3WTP E;  3LEL A;  5B2J A;  4X23 D;  5G49 B;  2FJ7 A;  5B0Y B;  4KHA B;  3B0C W;  3UTA B;  5DNM A;  2CV5 C;  4YS3 D;  5BO0 B;  3LZ0 A;  3X1V D;  1M19 A;  3W97 A;  1F66 A;  3C1C D;  2NQB D;  4QLC B;  3MGQ D;  2PYO C;  1ZLA A;  3AZF B;  3KXB C;  1H3O A;  5GXQ B;  1HQ3 B;  4NFT A;  4YM6 A;  4Z5T D;  1P3M C;  1P3F B;  5AVC A;  2HIO B;  3KWQ C;  4X23 B;  3WA9 B;  1P3K C;  2NZD A;  1P3B D;  3AZH D;  2F8N K;  4YS3 B;  3REJ D;  4WU8 D;  3AZK C;  3X1V B;  3X1T A;  2NQB B;  3C1C B;  3AZN A;  3MGQ B;  5B1M A;  5CPI D;  2F8N A;  3X1S D;  5B0Z D;  5CP6 A;  5B33 A;  1P3I C;  1KX3 C;  1P3L B;  1P3O C;  3AV2 D;  3MNN C;  5B2I D;  1KX4 A;  3MGR A;  1HTA A;  2L5A A;  3AZE C;  5CPJ B;  4KUD D;  1P3B B;  3AZH B;  3REI C;  3REJ B;  3KUY A;  5B32 G;  1JFI A;  5CPI B;  3X1S B;  1P3P C;  5B0Z B;  1M18 C;  2CV5 D;  3REK C;  1S32 C;  1N1J B;  5BNX A;  3B6G D;  4J8V C;  4HGA C;  5B2I B;  3UTB A;  1F66 B;  5B1L A;  3W99 D;  5B31 D;  4WNN B;  3W96 C;  1P34 C;  4XUJ A;  4KUD B;  4Z66 C;  5C3I B;  5AY8 C;  4NE6 A;  1ID3 C;  3AYW C;  3KWQ D;  5GSU C;  3LZ1 C;  3WKJ A;  3O62 C;  3REL C;  4WU9 C;  5B32 C;  3B6G B;  3WAA A;  5DNN A;  1TAF B;  5B1M B;  5B31 B;  3W99 B;  5CPK C;  3B0B A;  1KX5 C;  3AV1 C;  5FUG A;  3MNN D;  3AZL D;  4WZS B;  4J8W A;  4R8P C;  5AV6 C;  5AVB C;  1AOI D;  2IO5 C;  3C1B A;  4XZQ C;  4ZUX C;  1R4V A;  4DRA A;  3X1U D;  3TU4 C;  1EQZ D;  4EO5 B;  4J8U A;  3UT9 C;  3WTP D;  4JJN C;  3AZJ D;  3MGS D;  5JRG C;  3B0D C;  5G49 A;  4KHA A;  3UTA A;  5AV8 A;  1TZY D;  5F99 C;  4LD9 C;  4ZBJ B;  4H9S A;  5B0Y C;  1P3A D;  4QLC A;  5KDM B;  3LJA A;  5BNX B;  3AZL B;  4H9O B;  5AV5 A;  4J8V D;  3AZF A;  3AZI D;  5B24 C;  1AOI B;  3REH D;  5GXQ A;  1HQ3 A;  3A6N D;  3X1U B;  1EQZ B;  4E45 A;  2HUE C;  2HIO A;  3WTP B;  4KGC C;  3AZJ B;  3MGS B;  4X23 A;  5GT0 B;  3MVD C;  1TZY B;  4YS3 A;  3X1V A;  1P3A B;  2NQB A;  3WKJ B;  3C1C A;  4H9R B;  3MGQ A;  3AZG C;  3AZI B;  3REH B;  3A6N B;  3W98 D;  3AN2 C;  4Z5T A;  2F8N H;  1P3B A;  3KSY A;  3AZH A;  3REJ A;  4WU8 A;  5E5A C;  4J8U B;  3AZM D;  5CPI A;  3V9R A;  5JRG D;  3X1S A;  1M1A D;  5B0Z A;  2F8N G;  3W98 B;  5AV8 B;  3LEL C;  5B2J C;  1N1J A;  3MGP D;  4G92 B;  2FJ7 C;  1P3G C;  1WWI A;  5B2I A;  2ARO D;  5DNM C;  3LJA B;  4WNN A;  5AV5 B;  1A7W A;  3LZ0 C;  4KUD A;  1M19 C;  1WWS A;  3W97 C;  5BT1 C;  1ZLA C;  3AZM B;  2BYM B;  4KGC D;  2RVQ D;  1M1A B;  5BS7 A;  3MVD D;  4YM6 C;  2CV5 A;  1U35 D;  5AVC C;  5B40 D;  3B6G A;  2ARO B;  3AFA D;  2JSS A;  2NZD C;  1TAF A;  5B31 A;  3W99 A;  3X1T C;  3AZN C;  4Z5T B;  4J8X D;  5CP6 C;  5B33 C;  3B6F D;  1U35 B;  1KX4 C;  5B40 B;  5BNV A;  5AV9 D;  4WU8 B;  3MGR C;  3AFA B;  3V9R B;  3KUY C;  4Z2M H;  1BH8 B;  4H9P B;  5KDM A;  3AV2 B;  1P3G D;  3AZL A;  4H9O A;  4J8X B;  3B6F B;  2PYO D;  1AOI A;  5GT3 C;  3KXB D;  3X1U A;  3UTB C;  1EQZ A;  5B1L C;  3WTP A;  5AV9 B;  4Z2M G;  3AZJ A;  3MGS A;  4XUJ C;  1P3M D;  4UUZ B;  5GT0 A;  1BH9 B;  1TZY A;  1P3K D;  4H9N B;  2CV5 B;  1P3A A;  5CHL B;  4H9R A;  2YFV B;  3AZK D;  4J8V A;  1F1E A;  3AZI A;  2PYO B;  2LY8 A;  4AWL C;  3REH A;  3WAA C;  3KXB B;  3A6N A;  5DNN C;  1P3I D;  1ULY A;  1KX3 D;  1P3O D;  1P3M B;  3KWQ B;  3AZE D;  4J8W C;  3REI D;  3AZK B;  5BNV B;  3VH6 T;  3C1B C;  3VH5 T;  4G91 C;  1P3P D;  3W98 A;  1M18 D;  1KX3 B;  3REK D;  1P3O B;  1S32 D;  3UTA C;  3MNN B;  4H9Q B;  4H9S C;  4QLC C;  5GT3 D;  3AZE B;  1P34 D;  3W96 D;  4Z66 D;  3AZF C;  3REI B;  3AZM A;  2BYM A;  5AY8 D;  5JRG A;  1ID3 D;  5GXQ C;  1HQ3 C;  3AYW D;  1M1A A;  3NQJ B;  5GSU D;  1P3F C;  2HIO C;  1P3P B;  1M18 B;  4X23 C;  3LZ1 D;  3MGP A;  3WA9 C;  3REK B;  3O62 D;  3REL D;  1S32 B;  2ARO A;  4WU9 D;  5B32 D;  4YS3 C;  4HGA B;  4J8V B;  3R45 B;  3X1V C;  2NQB C;  3C1C C;  1P34 B;  3W96 B;  3MGQ C;  5CPK D;  4Z66 B;  2BYK A;  1KX5 D;  5DNN D;  5AY8 B;  4KGC A;  1ID3 B;  3AV1 D;  3AYW B;  1P3L C;  5GSU B;  4R8P D;  1U35 A;  5AV6 D;  5AVB D;  4XZQ D;  4ZUX D;  5B40 A;  3LZ1 B;  3TU4 D;  3O62 B;  3REL B;  5CPJ C;  4WU9 B;  3AFA A;  3UT9 D;  5B32 B;  3B0C T;  3AZH C;  1P3B C;  4NE5 A;  4JJN D;  3REJ C;  4DRB A;  1BH8 A;  5CPI C;  5CPK B;  4H9P A;  5B31 G;  5F99 D;  4LD9 D;  1KX5 B;  3AV2 A;  3X1S C;  5B0Z C;  5B0Y D;  4J8X A;  3UTA D;  3VH5 A;  3B6F A;  3AV1 B;  4R8P B;  5AV6 B;  5AVB B;  5B2I C;  5B24 D;  2IO5 B;  3NQU B;  4XZQ B;  4ZUX B;  4M6B A;  1F66 C;  5AV9 A;  3TU4 B;  3UT9 B;  4UUZ A;  4KUD C;  1BH9 A;  5C3I C;  4JJN B;  5GXQ D;  3B0D B;  5JRG B;  5JA4 B;  4H9N A;  1P3F D;  1B67 A;  5F99 B;  4LD9 B;  3MGP B;  3WA9 D;  2YFV A;  1P3G A;  5BS7 C;  2PYO A;  3AZG D;  3KXB A;  3B6G C;  5B24 B;  5B1M C;  3W99 C;  5B31 C;  2BYK B;  4CSR B;  3AN2 D;  1P3M A;  2HUE B;  4E44 A;  3KWQ A;  4KGC B;  1P3L D;  3MVD B;  1KU5 A;  1P3K A;  1Q9C A;  3AZK A;  5E5A D;  5CPJ D;  4CAY B;  4EO5 C;  3AZG B;  1P3I A;  1KX3 A;  1P3O A;  3LEL D;  5B2J D;  3AN2 B;  2FJ7 D;  3MNN A;  4ZBJ C;  4H9Q A;  5DNM D;  3AZE A;  2YFW B;  3LZ0 D;  3AZL C;  1M19 D;  1F66 D;  3W97 D;  3REI A;  5BT1 D;  1AOI C;  1ZLA D;  5E5A B;  1B6W A;  3NQJ A;  3X1U C;  1EQZ C;  3WTP C;  1P3P A;  3AZJ C;  1M18 A;  3MGS C;  4YM6 D;  5GT0 C; 
#chains in the Genus database with same CATH topology
 3REK A;  3LEL B;  5B2J B;  1S32 A;  2FJ7 B;  1P3G B;  1TZY C;  2NZD D;  3R45 A;  5DNM B;  1P3A C;  3WKJ C;  3W96 A;  5GT3 A;  1P34 A;  3LZ0 B;  3X1T D;  4Z66 A;  1M19 B;  3W97 B;  4WV4 B;  3AZN D;  5AY8 A;  5B1M D;  3AZI C;  2F8N D;  1ZLA B;  1ID3 A;  3REH C;  3A6N C;  3AYW A;  4UPK A;  5GSU A;  1H3O B;  5B33 D;  5CP6 D;  2Y2N A;  2XD1 A;  1BFM A;  4YM6 B;  3LZ1 A;  1P3K B;  5AVC B;  3O62 A;  3REL A;  1KX4 D;  4WU9 A;  5B32 A;  1Z2C B;  3MGR D;  2NZD B;  4J8U C;  3KUY D;  5CPK A;  2Y2K A;  3X1T B;  1KX5 A;  3AZN B;  1P3I B;  2F8N B;  2ZY5 A;  3AV1 A;  3W98 C;  5AV8 C;  4G92 C;  5CP6 B;  5B33 B;  4R8P A;  5AV6 A;  5AVB A;  3NQU A;  4XZQ A;  4ZUX A;  3LJA C;  3TU4 A;  5AV5 C;  3UTB D;  1KX4 B;  3UT9 A;  5B1L D;  3MGR B;  4JJN A;  4XUJ D;  5JA4 A;  3AZM C;  3KUY B;  1JFI B;  5F99 A;  4LD9 A;  4NE3 A;  5GT0 D;  1M1A C;  5B0Y A;  3VH6 W;  3EG5 B;  3MGP C;  3VH5 W;  5BO0 A;  3WKJ D;  5B24 A;  2ARO C;  5GT3 B;  2JCH A;  3WAA D;  3UTB B;  4CSR A;  5B1L B;  4XUJ B;  3MVD A;  3FDD A;  4Z5T C;  1P3F A;  2RVQ C;  3WA9 A;  2ZY2 A;  4J8W D;  1U35 C;  4CAY A;  3C1B D;  5B40 C;  3AZG A;  4WU8 C;  4J8U D;  4AWL B;  3AFA C;  3WAA B;  3AN2 A;  5DNN B;  3P5J B;  3VH6 A;  3EPJ A;  2DQN C;  5AV8 D;  1P3L A;  5AVC D;  2YFW A;  3AV2 C;  4J8X C;  2CWE A;  4QLC D;  3B6F C;  3LJA D;  1T3U A;  5FUG B;  5AV5 D;  5E5A A;  3AZF D;  4J8W B;  5CPJ A;  3C1B B;  5AV9 C;  1HQ3 D;  4G91 B;  2HIO D;  3WTP E;  3LEL A;  5B2J A;  4X23 D;  5G49 B;  2FJ7 A;  2Y2L A;  5B0Y B;  4KHA B;  3B0C W;  3UTA B;  5DNM A;  2CV5 C;  4YS3 D;  5BO0 B;  3LZ0 A;  3X1V D;  1M19 A;  3W97 A;  1F66 A;  3C1C D;  2NQB D;  4QLC B;  3MGQ D;  2PYO C;  1ZLA A;  3AZF B;  3KXB C;  1H3O A;  5GXQ B;  1HQ3 B;  4NFT A;  4YM6 A;  4Z5T D;  1P3M C;  1P3F B;  5AVC A;  2HIO B;  3KWQ C;  4X23 B;  3WA9 B;  1P3K C;  2NZD A;  1P3B D;  3AZH D;  2F8N K;  4YS3 B;  3REJ D;  4WU8 D;  3AZK C;  3X1V B;  3X1T A;  2NQB B;  3C1C B;  3AZN A;  3MGQ B;  5B1M A;  5CPI D;  2F8N A;  3X1S D;  5B0Z D;  2ZY4 A;  5B33 A;  5CP6 A;  1P3I C;  1KX3 C;  1P3L B;  1P3O C;  3AV2 D;  3MNN C;  5B2I D;  1KX4 A;  3EPH A;  3MGR A;  1HTA A;  2L5A A;  3AZE C;  3IP4 C;  5CPJ B;  4KUD D;  1P3B B;  3AZH B;  3REI C;  3REJ B;  3KUY A;  3AL0 C;  5B32 G;  1JFI A;  4WJ3 C;  5CPI B;  3X1S B;  1P3P C;  5B0Z B;  1M18 C;  2CV5 D;  3REK C;  1S32 C;  1N1J B;  5BNX A;  2Y2M A;  3B6G D;  4J8V C;  4HGA C;  5B2I B;  3UTB A;  1F66 B;  2Y2P A;  5B1L A;  3W99 D;  5B31 D;  4WNN B;  3W96 C;  1P34 C;  4XUJ A;  4KUD B;  4Z66 C;  5C3I B;  5AY8 C;  4NE6 A;  1ID3 C;  3KFU G;  3AYW C;  3KWQ D;  5GSU C;  3EPL A;  3LZ1 C;  2ZM5 A;  3WKJ A;  3O62 C;  3REL C;  4WU9 C;  5B32 C;  3B6G B;  3WAA A;  5DNN A;  1TAF B;  5B1M B;  5B31 B;  3W99 B;  5CPK C;  3B0B A;  1KX5 C;  3AV1 C;  5FUG A;  3MNN D;  2FFF B;  3AZL D;  4WZS B;  4J8W A;  4R8P C;  5AV6 C;  5AVB C;  1AOI D;  2IO5 C;  2XD5 A;  4XZQ C;  4ZUX C;  3C1B A;  1R4V A;  4DRA A;  3X1U D;  3TU4 C;  1EQZ D;  4EO5 B;  4J8U A;  3UT9 C;  3WTP D;  4JJN C;  3AZJ D;  3MGS D;  5JRG C;  3B0D C;  5G49 A;  4KHA A;  3UTA A;  5AV8 A;  1TZY D;  2Y2O A;  2Y2G A;  2ZY3 A;  4ZBJ B;  5F99 C;  4LD9 C;  4H9S A;  5B0Y C;  1P3A D;  4QLC A;  5KDM B;  3LJA A;  5BNX B;  3AZL B;  4H9O B;  5AV5 A;  4J8V D;  3AZF A;  2Y2I A;  3AZI D;  5B24 C;  1AOI B;  3REH D;  5GXQ A;  1HQ3 A;  3A6N D;  3X1U B;  1EQZ B;  4E45 A;  2HUE C;  2HIO A;  3WTP B;  4KGC C;  3AZJ B;  3MGS B;  4X23 A;  5GT0 B;  3MVD C;  1TZY B;  4YS3 A;  3H0M C;  3X1V A;  1P3A B;  2NQB A;  3WKJ B;  3C1C A;  4H9R B;  3MGQ A;  3AZG C;  3F6T A;  3AZI B;  3REH B;  3A6N B;  3W98 D;  3AN2 C;  4Z5T A;  2F8N H;  3H0R C;  1P3B A;  3KSY A;  3AZH A;  3REJ A;  4WU8 A;  5E5A C;  4J8U B;  3AZM D;  5CPI A;  3V9R A;  5JRG D;  2J8P A;  3X1S A;  1M1A D;  5B0Z A;  2F8N G;  3W98 B;  5AV8 B;  3LEL C;  5B2J C;  1N1J A;  3MGP D;  4G92 B;  2FJ7 C;  4DQY B;  1P3G C;  1WWI A;  5B2I A;  2ARO D;  5DNM C;  3LJA B;  4WNN A;  5AV5 B;  1A7W A;  3LZ0 C;  4KUD A;  1M19 C;  1WWS A;  3W97 C;  5BT1 C;  1ZLA C;  3AZM B;  2BYM B;  4KGC D;  2RVQ D;  3A1I A;  1M1A B;  5BS7 A;  3MVD D;  4YM6 C;  2CV5 A;  1U35 D;  5AVC C;  5B40 D;  3B6G A;  2ARO B;  3AFA D;  2JSS A;  2NZD C;  1TAF A;  5B31 A;  3W99 A;  3X1T C;  2G5H C;  3AZN C;  4Z5T B;  4J8X D;  5CP6 C;  5B33 C;  3B6F D;  1U35 B;  1KX4 C;  5B40 B;  5BNV A;  5AV9 D;  4WU8 B;  3MGR C;  3AFA B;  3V9R B;  3KUY C;  4Z2M H;  1BH8 B;  4H9P B;  5KDM A;  3AV2 B;  1P3G D;  3AZL A;  4H9O A;  4J8X B;  3B6F B;  2PYO D;  1AOI A;  5GT3 C;  3KXB D;  3X1U A;  3UTB C;  1EQZ A;  5B1L C;  5AV9 B;  3WTP A;  4Z2M G;  3AZJ A;  3MGS A;  4XUJ C;  1P3M D;  4UUZ B;  5GT0 A;  1BH9 B;  1TZY A;  1P3K D;  4H9N B;  2CV5 B;  1P3A A;  5CHL B;  4H9R A;  2YFV B;  3AZK D;  3A1K A;  4J8V A;  1F1E A;  3AZI A;  2PYO B;  2LY8 A;  4AWL C;  3REH A;  3WAA C;  3KXB B;  3A6N A;  5DNN C;  1P3I D;  1ULY A;  1KX3 D;  2DF4 C;  1P3O D;  1P3M B;  3KWQ B;  2BG1 A;  3AZE D;  4J8W C;  3REI D;  2JE5 A;  3AZK B;  5BNV B;  3VH6 T;  3C1B C;  3VH5 T;  2G5I C;  4G91 C;  1P3P D;  3W98 A;  1M18 D;  1KX3 B;  3REK D;  1P3O B;  1S32 D;  3H0L C;  3UTA C;  3MNN B;  4H9Q B;  4H9S C;  4QLC C;  5GT3 D;  3AZE B;  1P34 D;  3W96 D;  4Z66 D;  3AZF C;  3REI B;  3AZM A;  2BYM A;  5AY8 D;  5JRG A;  1ID3 D;  5GXQ C;  1HQ3 C;  3AYW D;  1M1A A;  3NQJ B;  5GSU D;  1P3F C;  2HIO C;  1P3P B;  3EPK A;  2F2A C;  1M18 B;  4X23 C;  3LZ1 D;  3MGP A;  3WA9 C;  3REK B;  3O62 D;  3REL D;  1S32 B;  2ARO A;  4WU9 D;  5B32 D;  4YS3 C;  4HGA B;  4J8V B;  3R45 B;  3X1V C;  2NQB C;  3C1C C;  1P34 B;  3W96 B;  3MGQ C;  5CPK D;  4Z66 B;  2BYK A;  1KX5 D;  5DNN D;  5AY8 B;  4KGC A;  1ID3 B;  3AV1 D;  3AYW B;  1P3L C;  5GSU B;  4R8P D;  1U35 A;  1PZR A;  5AV6 D;  5AVB D;  4XZQ D;  4ZUX D;  5B40 A;  3LZ1 B;  2Y2H A;  3TU4 D;  3O62 B;  3REL B;  5CPJ C;  4WU9 B;  3AFA A;  3UT9 D;  5B32 B;  3B0C T;  2UWX A;  3AZH C;  4NE5 A;  4JJN D;  1P3B C;  3REJ C;  4DRB A;  1BH8 A;  5CPI C;  5CPK B;  4H9P A;  5B31 G;  5F99 D;  4LD9 D;  1KX5 B;  3AV2 A;  3X1S C;  5B0Z C;  5B0Y D;  4J8X A;  3UTA D;  2W8S A;  3VH5 A;  3AV1 B;  3B6F A;  4R8P B;  5AV6 B;  5AVB B;  5B2I C;  5B24 D;  2IO5 B;  3NQU B;  4XZQ B;  4ZUX B;  4M6B A;  1F66 C;  5AV9 A;  3TU4 B;  3UT9 B;  2Y2J A;  4UUZ A;  4KUD C;  1BH9 A;  5C3I C;  4JJN B;  5GXQ D;  3B0D B;  5JRG B;  5JA4 B;  4H9N A;  1P3F D;  2VQR A;  1B67 A;  5F99 B;  4LD9 B;  3MGP B;  3WA9 D;  2YFV A;  1P3G A;  5BS7 C;  2Y2Q A;  2PYO A;  3AZG D;  3KXB A;  3B6G C;  5B24 B;  5B1M C;  3W99 C;  5B31 C;  2BYK B;  4CSR B;  3AN2 D;  1P3M A;  2HUE B;  4E44 A;  3KWQ A;  4KGC B;  1P3L D;  3MVD B;  1KU5 A;  1P3K A;  1Q9C A;  3AZK A;  5E5A D;  5CPJ D;  2RIQ A;  1W2E A;  4CAY B;  4EO5 C;  3AZG B;  1P3I A;  1KX3 A;  1P3O A;  3LEL D;  5B2J D;  3AN2 B;  2FJ7 D;  3MNN A;  4ZBJ C;  4H9Q A;  5DNM D;  3AZE A;  2YFW B;  3LZ0 D;  3AZL C;  1M19 D;  1F66 D;  3W97 D;  3REI A;  5BT1 D;  1AOI C;  1ZLA D;  5E5A B;  1B6W A;  3NQJ A;  3X1U C;  1EQZ C;  3WTP C;  1P3P A;  3AZJ C;  1M18 A;  3MGS C;  4YM6 D;  5GT0 C; 
#chains in the Genus database with same CATH homology
 3REK A;  3LEL B;  5B2J B;  1S32 A;  2FJ7 B;  1P3G B;  1TZY C;  2NZD D;  3R45 A;  5DNM B;  1P3A C;  3WKJ C;  3W96 A;  5GT3 A;  1P34 A;  3LZ0 B;  3X1T D;  4Z66 A;  1M19 B;  3W97 B;  4WV4 B;  3AZN D;  5AY8 A;  5B1M D;  3AZI C;  2F8N D;  1ZLA B;  1ID3 A;  3REH C;  3A6N C;  3AYW A;  4UPK A;  5GSU A;  1H3O B;  5B33 D;  5CP6 D;  2Y2N A;  2XD1 A;  1BFM A;  4YM6 B;  3LZ1 A;  1P3K B;  5AVC B;  3O62 A;  3REL A;  1KX4 D;  4WU9 A;  5B32 A;  1Z2C B;  3MGR D;  2NZD B;  4J8U C;  3KUY D;  5CPK A;  2Y2K A;  3X1T B;  1KX5 A;  3AZN B;  1P3I B;  2F8N B;  2ZY5 A;  3AV1 A;  3W98 C;  5AV8 C;  4G92 C;  5CP6 B;  5B33 B;  4R8P A;  5AV6 A;  5AVB A;  3NQU A;  4XZQ A;  4ZUX A;  3LJA C;  3TU4 A;  5AV5 C;  3UTB D;  1KX4 B;  3UT9 A;  5B1L D;  3MGR B;  4JJN A;  4XUJ D;  5JA4 A;  3AZM C;  3KUY B;  1JFI B;  5F99 A;  4LD9 A;  4NE3 A;  5GT0 D;  1M1A C;  5B0Y A;  3VH6 W;  3EG5 B;  3MGP C;  3VH5 W;  5BO0 A;  3WKJ D;  5B24 A;  2ARO C;  5GT3 B;  2JCH A;  3WAA D;  3UTB B;  4CSR A;  5B1L B;  4XUJ B;  3MVD A;  3FDD A;  4Z5T C;  1P3F A;  2RVQ C;  3WA9 A;  2ZY2 A;  4J8W D;  1U35 C;  4CAY A;  3C1B D;  5B40 C;  3AZG A;  4WU8 C;  4J8U D;  4AWL B;  3AFA C;  3WAA B;  3AN2 A;  5DNN B;  3P5J B;  3VH6 A;  3EPJ A;  2DQN C;  5AV8 D;  1P3L A;  5AVC D;  2YFW A;  3AV2 C;  4J8X C;  2CWE A;  4QLC D;  3B6F C;  3LJA D;  1T3U A;  5FUG B;  5AV5 D;  5E5A A;  3AZF D;  4J8W B;  5CPJ A;  3C1B B;  5AV9 C;  1HQ3 D;  4G91 B;  2HIO D;  3WTP E;  3LEL A;  5B2J A;  4X23 D;  5G49 B;  2FJ7 A;  2Y2L A;  5B0Y B;  4KHA B;  3B0C W;  3UTA B;  5DNM A;  2CV5 C;  4YS3 D;  5BO0 B;  3LZ0 A;  3X1V D;  1M19 A;  3W97 A;  1F66 A;  3C1C D;  2NQB D;  4QLC B;  3MGQ D;  2PYO C;  1ZLA A;  3AZF B;  3KXB C;  1H3O A;  5GXQ B;  1HQ3 B;  4NFT A;  4YM6 A;  4Z5T D;  1P3M C;  1P3F B;  5AVC A;  2HIO B;  3KWQ C;  4X23 B;  3WA9 B;  1P3K C;  2NZD A;  1P3B D;  3AZH D;  2F8N K;  4YS3 B;  3REJ D;  4WU8 D;  3AZK C;  3X1V B;  3X1T A;  2NQB B;  3C1C B;  3AZN A;  3MGQ B;  5B1M A;  5CPI D;  2F8N A;  3X1S D;  5B0Z D;  2ZY4 A;  5B33 A;  5CP6 A;  1P3I C;  1KX3 C;  1P3L B;  1P3O C;  3AV2 D;  3MNN C;  5B2I D;  1KX4 A;  3EPH A;  3MGR A;  1HTA A;  2L5A A;  3AZE C;  3IP4 C;  5CPJ B;  4KUD D;  1P3B B;  3AZH B;  3REI C;  3REJ B;  3KUY A;  3AL0 C;  5B32 G;  1JFI A;  4WJ3 C;  5CPI B;  3X1S B;  1P3P C;  5B0Z B;  1M18 C;  2CV5 D;  3REK C;  1S32 C;  1N1J B;  5BNX A;  2Y2M A;  3B6G D;  4J8V C;  4HGA C;  5B2I B;  3UTB A;  1F66 B;  2Y2P A;  5B1L A;  3W99 D;  5B31 D;  4WNN B;  3W96 C;  1P34 C;  4XUJ A;  4KUD B;  4Z66 C;  5C3I B;  5AY8 C;  4NE6 A;  1ID3 C;  3KFU G;  3AYW C;  3KWQ D;  5GSU C;  3EPL A;  3LZ1 C;  2ZM5 A;  3WKJ A;  3O62 C;  3REL C;  4WU9 C;  5B32 C;  3B6G B;  3WAA A;  5DNN A;  1TAF B;  5B1M B;  5B31 B;  3W99 B;  5CPK C;  3B0B A;  1KX5 C;  3AV1 C;  5FUG A;  3MNN D;  2FFF B;  3AZL D;  4WZS B;  4J8W A;  4R8P C;  5AV6 C;  5AVB C;  1AOI D;  2IO5 C;  2XD5 A;  4XZQ C;  4ZUX C;  3C1B A;  1R4V A;  4DRA A;  3X1U D;  3TU4 C;  1EQZ D;  4EO5 B;  4J8U A;  3UT9 C;  3WTP D;  4JJN C;  3AZJ D;  3MGS D;  5JRG C;  3B0D C;  5G49 A;  4KHA A;  3UTA A;  5AV8 A;  1TZY D;  2Y2O A;  2Y2G A;  2ZY3 A;  4ZBJ B;  5F99 C;  4LD9 C;  4H9S A;  5B0Y C;  1P3A D;  4QLC A;  5KDM B;  3LJA A;  5BNX B;  3AZL B;  4H9O B;  5AV5 A;  4J8V D;  3AZF A;  2Y2I A;  3AZI D;  5B24 C;  1AOI B;  3REH D;  5GXQ A;  1HQ3 A;  3A6N D;  3X1U B;  1EQZ B;  4E45 A;  2HUE C;  2HIO A;  3WTP B;  4KGC C;  3AZJ B;  3MGS B;  4X23 A;  5GT0 B;  3MVD C;  1TZY B;  4YS3 A;  3H0M C;  3X1V A;  1P3A B;  2NQB A;  3WKJ B;  3C1C A;  4H9R B;  3MGQ A;  3AZG C;  3F6T A;  3AZI B;  3REH B;  3A6N B;  3W98 D;  3AN2 C;  4Z5T A;  2F8N H;  3H0R C;  1P3B A;  3KSY A;  3AZH A;  3REJ A;  4WU8 A;  5E5A C;  4J8U B;  3AZM D;  5CPI A;  3V9R A;  5JRG D;  2J8P A;  3X1S A;  1M1A D;  5B0Z A;  2F8N G;  3W98 B;  5AV8 B;  3LEL C;  5B2J C;  1N1J A;  3MGP D;  4G92 B;  2FJ7 C;  4DQY B;  1P3G C;  1WWI A;  5B2I A;  2ARO D;  5DNM C;  3LJA B;  4WNN A;  5AV5 B;  1A7W A;  3LZ0 C;  4KUD A;  1M19 C;  1WWS A;  3W97 C;  5BT1 C;  1ZLA C;  3AZM B;  2BYM B;  4KGC D;  2RVQ D;  3A1I A;  1M1A B;  5BS7 A;  3MVD D;  4YM6 C;  2CV5 A;  1U35 D;  5AVC C;  5B40 D;  3B6G A;  2ARO B;  3AFA D;  2JSS A;  2NZD C;  1TAF A;  5B31 A;  3W99 A;  3X1T C;  2G5H C;  3AZN C;  4Z5T B;  4J8X D;  5CP6 C;  5B33 C;  3B6F D;  1U35 B;  1KX4 C;  5B40 B;  5BNV A;  5AV9 D;  4WU8 B;  3MGR C;  3AFA B;  3V9R B;  3KUY C;  4Z2M H;  1BH8 B;  4H9P B;  5KDM A;  3AV2 B;  1P3G D;  3AZL A;  4H9O A;  4J8X B;  3B6F B;  2PYO D;  1AOI A;  5GT3 C;  3KXB D;  3X1U A;  3UTB C;  1EQZ A;  5B1L C;  5AV9 B;  3WTP A;  4Z2M G;  3AZJ A;  3MGS A;  4XUJ C;  1P3M D;  4UUZ B;  5GT0 A;  1BH9 B;  1TZY A;  1P3K D;  4H9N B;  2CV5 B;  1P3A A;  5CHL B;  4H9R A;  2YFV B;  3AZK D;  3A1K A;  4J8V A;  1F1E A;  3AZI A;  2PYO B;  2LY8 A;  4AWL C;  3REH A;  3WAA C;  3KXB B;  3A6N A;  5DNN C;  1P3I D;  1ULY A;  1KX3 D;  2DF4 C;  1P3O D;  1P3M B;  3KWQ B;  2BG1 A;  3AZE D;  4J8W C;  3REI D;  2JE5 A;  3AZK B;  5BNV B;  3VH6 T;  3C1B C;  3VH5 T;  2G5I C;  4G91 C;  1P3P D;  3W98 A;  1M18 D;  1KX3 B;  3REK D;  1P3O B;  1S32 D;  3H0L C;  3UTA C;  3MNN B;  4H9Q B;  4H9S C;  4QLC C;  5GT3 D;  3AZE B;  1P34 D;  3W96 D;  4Z66 D;  3AZF C;  3REI B;  3AZM A;  2BYM A;  5AY8 D;  5JRG A;  1ID3 D;  5GXQ C;  1HQ3 C;  3AYW D;  1M1A A;  3NQJ B;  5GSU D;  1P3F C;  2HIO C;  1P3P B;  3EPK A;  2F2A C;  1M18 B;  4X23 C;  3LZ1 D;  3MGP A;  3WA9 C;  3REK B;  3O62 D;  3REL D;  1S32 B;  2ARO A;  4WU9 D;  5B32 D;  4YS3 C;  4HGA B;  4J8V B;  3R45 B;  3X1V C;  2NQB C;  3C1C C;  1P34 B;  3W96 B;  3MGQ C;  5CPK D;  4Z66 B;  2BYK A;  1KX5 D;  5DNN D;  5AY8 B;  4KGC A;  1ID3 B;  3AV1 D;  3AYW B;  1P3L C;  5GSU B;  4R8P D;  1U35 A;  1PZR A;  5AV6 D;  5AVB D;  4XZQ D;  4ZUX D;  5B40 A;  3LZ1 B;  2Y2H A;  3TU4 D;  3O62 B;  3REL B;  5CPJ C;  4WU9 B;  3AFA A;  3UT9 D;  5B32 B;  3B0C T;  2UWX A;  3AZH C;  4NE5 A;  4JJN D;  1P3B C;  3REJ C;  4DRB A;  1BH8 A;  5CPI C;  5CPK B;  4H9P A;  5B31 G;  5F99 D;  4LD9 D;  1KX5 B;  3AV2 A;  3X1S C;  5B0Z C;  5B0Y D;  4J8X A;  3UTA D;  2W8S A;  3VH5 A;  3AV1 B;  3B6F A;  4R8P B;  5AV6 B;  5AVB B;  5B2I C;  5B24 D;  2IO5 B;  3NQU B;  4XZQ B;  4ZUX B;  4M6B A;  1F66 C;  5AV9 A;  3TU4 B;  3UT9 B;  2Y2J A;  4UUZ A;  4KUD C;  1BH9 A;  5C3I C;  4JJN B;  5GXQ D;  3B0D B;  5JRG B;  5JA4 B;  4H9N A;  1P3F D;  2VQR A;  1B67 A;  5F99 B;  4LD9 B;  3MGP B;  3WA9 D;  2YFV A;  1P3G A;  5BS7 C;  2Y2Q A;  2PYO A;  3AZG D;  3KXB A;  3B6G C;  5B24 B;  5B1M C;  3W99 C;  5B31 C;  2BYK B;  4CSR B;  3AN2 D;  1P3M A;  2HUE B;  4E44 A;  3KWQ A;  4KGC B;  1P3L D;  3MVD B;  1KU5 A;  1P3K A;  1Q9C A;  3AZK A;  5E5A D;  5CPJ D;  2RIQ A;  1W2E A;  4CAY B;  4EO5 C;  3AZG B;  1P3I A;  1KX3 A;  1P3O A;  3LEL D;  5B2J D;  3AN2 B;  2FJ7 D;  3MNN A;  4ZBJ C;  4H9Q A;  5DNM D;  3AZE A;  2YFW B;  3LZ0 D;  3AZL C;  1M19 D;  1F66 D;  3W97 D;  3REI A;  5BT1 D;  1AOI C;  1ZLA D;  5E5A B;  1B6W A;  3NQJ A;  3X1U C;  1EQZ C;  3WTP C;  1P3P A;  3AZJ C;  1M18 A;  3MGS C;  4YM6 D;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...