1KX4D

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4D00
2BYKB 1U35D 3LJAC 3AZKB 2HIOB 5B32C 3AZHB 4QLCC 3W99B 3WAAA 1P3IA 5B0ZC 1KX5B 5B33A 3AZFB 3AZJD 1P3PC 1P3BB 1HQ3B 2AROC 2PYOA 2IO5C 3AZMA 3KWQB 1M18D 5B0YA 5AV6B 2NZDB 3MGPD 2PYOC 4Z5TC 5GXQB 3LELD 3C1BA 3C1CA 1P3KD 5B1LA 1P3FD 4Z2MH 5AY8C 5B1LB 5AV9B 3UTAB 1P3LD 1M1AB 5B24D 5B1LC 3REKB 3W97C 4EO5C 5BO0A 4LD9A 5AVCD 5B24B 5AVBD 3X1SC 4R8PA 3UT9C 3A6NA 3AZLA 3X1VB 5AV9D 1P3OB 1ID3B 3AZNA 1P3LA 3REJA 1P3FB 5CPJA 5GT0A 1ZLAA 3AYWA 1P3FA 3C1BD 4CAYA 4NFTA 5GT0C 4CAYB 1ZLAC 3W96D 3WA9C 5B2JC 4YM6B 5BS7A 3LZ0C 1P3GB 3WTPC 2CV5D 1KU5A 1M1AC 4AWLC 4G91C 5B2IC 4YS3D 5B1LD 3AZHD 2LY8A 4WU9C 3WKJA 5FUGB 3MGRB 4J8WC 1EQZC 4KHAA 4H9OB 3LELB 5GXQD 3W97B 3WKJC 3MGPB 3C1BC 5GXQA 3NQJA 5B40C 1M18A 4JJNC 3KWQD 1TAFB 2IO5B 1JFIB 3AZMB 1P3LC 3RELB 1HQ3A 3TU4C 3AN2B 3AZFC 5E5AC 1M19A 1U35A 5AVCC 5B0ZD 2JSSA 3UTBB 3B6FD 4Z2MG 4WU8A 1A7WA 3NQJB 5AV9C 3WTPD 2CV5C 3AZHA 3UT9D 3WKJD 3O62A 4J8XB 3AYWD 5DNMA 5B2JD 3AZND 4KGCC 4Z5TD 3LZ1A 3AV1A 3B0CT 4XUJB 3X1SB 3AZEB 2FJ7A 2BYMB 3TU4D 3AFAC 5DNND 5C3IC 5GSUB 4R8PD 3MGQB 3WTPE 5GT0B 1ZLAB 3C1CD 5CP6D 5E5AB 5GXQC 5AVCA 1P3GC 1P34A 3B6GB 1N1JA 3LZ0B 4WV4B 5BNVA 3AV1D 5B24A 3WA9B 3REID 4H9PA 4WZSB 3O62D 4XZQA 3UT9A 3B0CW 4H9NB 3LZ1C 4QLCB 3AFAD 4KHAB 4CSRB 5CPIB 3REKC 1R4VA 3AV2D 4WU8C 3MGSD 3X1TA 2PYOD 4WU9D 5DNMC 4J8VA 3WA9A 4J8UC 3AZGB 1JFIA 3W98D 4YM6A 4H9PB 4KUDD 3KWQA 3RELA 5B0YB 4KGCD 2PYOB 3WAAD 5AVBC 5JRGD 4J8UA 1P3MB 5AV6A 2NZDC 4HGAC 3MVDB 1TZYD 3KWQC 5F99C 2CWEA 4QLCD 1AOIA 3W99A 5B32G 3AZKA 5JRGB 1P3MD 4XUJC 5B40A 3REIB 4KGCB 1KX3B 5B1MB 3VH5T 5CHLB 4E44A 3W98B 3AZGD 2NQBA 4XUJA 4KUDC 3MGPC 4EO5B 3AZEA 3NQUA 1BH8A 3MGSB 5CPKA 4X23C 2NQBC 3AV2B 5B32B 4WU8B 3AFAB 4X23B 5CPJD 1F66B 3REJD 5DNMB 1P3AA 5AV9A 3O62B 3RELC 5B31C 5AVBA 4YS3C 5AV6C 1S32D 2NZDA 5AV5D 3R45A 2YFVA 5B31A 3X1SD 3LZ0D 4Z5TB 2YFVB 2RVQD 5E5AD 3X1VA 3UTBC 5AV8B 5CP6B 4YM6C 3MGRC 4J8WB 5B2JB 3W98C 2YFWA 5CP6C 4J8XD 5GSUD 3MGQD 4J8WA 1P3AB 4H9OA 3LELA 5CPIA 3MGRA 3VH5W 3MGPA 5B0ZB 3W97A 3AZGC 2BYKA 5CPKD 5BNXB 1EQZD 4LD9C 3AZED 3AZKC 1WWSA 3AN2D 1P34C 1P3GA 4XUJD 2F8NH 5B2ID 2HUEB 3AZFA 4WNNB 1P3BA 1M19C 2F8NA 5F99D 3REJC 3AYWB 3B6GC 1BH8B 3REHC 1P3IC 1P3MC 1KX4C 4G92C 4DRBA 3B6FB 4DRAA 1Q9CA 1B67A 2AROA 4G92B 3A6NC 3AZLC 2HIOA 5B1MA 4Z66D 4KGCA 2CV5B 3RELD 4J8VC 5GT3D 4YM6D 1M1AA 1KX3A 2AROD 5B2IA 4ZUXB 2FJ7C 5B1MC 5BO0B 4WU9A 5G49A 1ID3C 3W96B 1HTAA 1EQZA 3UTBA 3C1BB 3W97D 3X1UD 5AV8A 3MNNC 3AZIC 3KXBA 3KUYD 3MGRD 5F99A 3UTAA 4H9RA 5AY8D 4YS3B 4XZQD 1P3OD 1P3BC 5AVBB 3AN2A 1P3GD 3B6GA 5AVCB 5E5AA 3AZNC 3LJAA 3REKD 5AV5A 4UUZA 4JJNA 3AN2C 1S32A 5B32A 1P34D 3KXBB 5KDMA 4X23A 4XZQB 5AY8B 3KUYC 1F1EA 4WNNA 3V9RA 2BYMA 3KUYB 1KX3C 1ID3D 3X1VD 3KXBD 3KUYA 5BS7C 3LZ0A 1KX5C 3AV1C 1P34B 2NZDD 5BNVB 3AV2C 2AROB 1N1JB 2L5AA 4Z66C 3C1CC 5GT3B 3O62C 3VH5A 1M1AD 5AY8A 4Z66B 1F66C 3UTAD 3AZMC 1P3LB 5B2JA 5B0YC 1TZYC 2HIOD 3MVDA 3AZKD 1P3KB 5JRGC 3X1UB 5AV8C 3AZIA 5BNXA 1TZYA 5F99B 3AZGA 5AV6D 2NQBD 1M18B 4ZUXD 4H9RB 2F8ND 1HQ3D 1P3BD 4KUDA 4G91B 5B2IB 3MGSC 3AZJB 3AZFD 1KX5D 4LD9B 3W99D 1EQZB 4H9NA 3KSYA 4H9SA 3MGSA 5G49B 1S32C 1U35B 5B24C 3REHA 1KX4A 1U35C 5JA4B 3AYWC 4YS3A 4J8WD 1P3FC 5B40B 2HIOC 2CV5A 5B33C 3B0DC 3X1UC 3R45B 4JJND 3AV2A 1H3OA 5CPKB 3W96A 3AFAA 1ID3A 1F66A 3LELC 3KXBC 3A6NB 3AZLB 1P3OA 1P3AD 1F66D 5CPJB 4M6BA 4X23D 5B32D 3V9RB 3LZ1B 5AV8D 4H9SC 3MNNB 1BH9B 1AOIC 5GT3C 3W99C 5AV5B 2F8NG 1S32B 3LJAB 1KX3D 5AV5C 1HQ3C 3TU4A 3B0DB 5B31G 1P3PB 5DNMD 1P3MA 3REHD 3REJB 1KX4D 3X1UA 1M19B 2FJ7D 4WU8D 1TZYB 3X1TB 3WAAC 4QLCA 5B0ZA 5B31B 4J8VB 1P3IB 1KX5A 3WAAB 1TAFA 1ULYA 5B0YD 4J8UD 4KUDB 2YFWB 5B1MD 3VH6A 4ZUXA 4Z66A 3AZJA 4WU9B 5B33D 3W98A 4H9QB 1B6WA 3WTPA 1P3ID 4J8VD 5FUGA 1AOID 3NQUB 4NE3A 5CPIC 3X1TD 3AZID 4ZUXC 2FJ7B 1M19D 1BFMA 3MVDD 3AZIB 5JRGA 1AOIB 1P3OC 5B33B 5GSUA 3MGQA 3VH6W 3WA9D 5BT1C 4J8UB 1H3OB 4HGAB 3MNND 3X1SA 5B31D 1P3AC 4NE6A 3X1TC 5CPID 3VH6T 4R8PB 5CPJC 4AWLB 3REHB 1KX4B 4J8XA 2F8NK 2RVQC 3REIA 5JA4A 1P3PD 3AZJC 3LJAD 3REKA 4J8XC 3REIC 2HUEC 3AV1B 4JJNB 1WWIA 5CP6A 3B6GD 5KDMB 4Z5TA 3LZ1D 3C1CB 4UUZB 3W96C 5DNNA 5GT0D 1P3KC 1ZLAD 3MVDC 1P3PA 5DNNB 5C3IB 5GSUC 3X1VC 3MGQC 3UT9B 3A6ND 3TU4B 3AZLD 3B6FC 5DNNC 1P3KA 4E45A 3UTBD 1M18C 5BT1D 3B6FA 1BH9A 4CSRA 5CPKC 4LD9D 3MNNA 5GT3A 3UTAC 3AZMD 2F8NB 4R8PC 4ZBJC 5B40D 3AZNB 4NE5A 2NQBB 4ZBJB 3AZEC 3WKJB 4H9QA 3WTPB 4XZQC 3B0BA 3AZHC
chains in the Genus database with same CATH superfamily
2BYKB 1U35D 3LJAC 3AZKB 2HIOB 5B32C 3AZHB 4QLCC 3W99B 3WAAA 1P3IA 5B0ZC 1KX5B 5B33A 3AZFB 3AZJD 1P3PC 1P3BB 1HQ3B 2AROC 2PYOA 2IO5C 3AZMA 3KWQB 1M18D 5B0YA 5AV6B 2NZDB 3MGPD 2PYOC 4Z5TC 5GXQB 3LELD 3C1BA 3C1CA 1P3KD 5B1LA 1P3FD 4Z2MH 5AY8C 5B1LB 5AV9B 3UTAB 1P3LD 1M1AB 5B24D 5B1LC 3REKB 3W97C 4EO5C 5BO0A 4LD9A 5AVCD 5B24B 5AVBD 3X1SC 4R8PA 3UT9C 3A6NA 3AZLA 3X1VB 5AV9D 1P3OB 1ID3B 3AZNA 1P3LA 3REJA 1P3FB 5CPJA 5GT0A 1ZLAA 3AYWA 1P3FA 3C1BD 4CAYA 3P5JB 4NFTA 5GT0C 4CAYB 1ZLAC 3W96D 3WA9C 2RIQA 5B2JC 4YM6B 5BS7A 3LZ0C 1P3GB 3WTPC 2CV5D 1KU5A 1M1AC 4AWLC 4G91C 5B2IC 4YS3D 5B1LD 3AZHD 2LY8A 4WU9C 3WKJA 5FUGB 3MGRB 4J8WC 1EQZC 4KHAA 4H9OB 3LELB 5GXQD 3W97B 3WKJC 3MGPB 3C1BC 5GXQA 3NQJA 5B40C 1M18A 4JJNC 3KWQD 1TAFB 2IO5B 1JFIB 3AZMB 1P3LC 3RELB 1HQ3A 3TU4C 3AN2B 3AZFC 5E5AC 1M19A 1U35A 5AVCC 5B0ZD 2JSSA 3UTBB 3B6FD 4Z2MG 4WU8A 1A7WA 3NQJB 5AV9C 3WTPD 2CV5C 3AZHA 3UT9D 3WKJD 3O62A 4J8XB 3AYWD 1Z2CB 5DNMA 5B2JD 3AZND 4KGCC 4Z5TD 3LZ1A 3AV1A 3B0CT 2Y2JA 4XUJB 3X1SB 2Y2HA 3AZEB 2FJ7A 3H0LC 2BYMB 3TU4D 3AFAC 5DNND 5C3IC 5GSUB 4R8PD 3MGQB 3WTPE 5GT0B 1ZLAB 3C1CD 5CP6D 5E5AB 5GXQC 5AVCA 1P3GC 1P34A 3B6GB 1N1JA 3LZ0B 4WV4B 5BNVA 3AV1D 2Y2LA 5B24A 3WA9B 3REID 4H9PA 4WZSB 3O62D 4XZQA 3UT9A 2FFFB 3B0CW 4H9NB 4QLCB 3LZ1C 3AFAD 4KHAB 4CSRB 5CPIB 3REKC 1R4VA 2Y2GA 3AV2D 4WU8C 3MGSD 3X1TA 4UPKA 2PYOD 4WU9D 5DNMC 4J8VA 3WA9A 4J8UC 3AZGB 1JFIA 3W98D 4YM6A 4H9PB 4KUDD 3KWQA 3RELA 5B0YB 4KGCD 2PYOB 3WAAD 5AVBC 5JRGD 4J8UA 1P3MB 5AV6A 2NZDC 4HGAC 3MVDB 1TZYD 3KWQC 5F99C 2CWEA 4QLCD 1AOIA 3W99A 5B32G 3AZKA 5JRGB 1P3MD 4XUJC 5B40A 3REIB 4KGCB 2BG1A 1KX3B 5B1MB 3VH5T 5CHLB 4E44A 3W98B 3AZGD 3A1IA 2NQBA 4XUJA 4KUDC 3MGPC 4EO5B 3EPHA 3AZEA 3NQUA 1BH8A 3MGSB 5CPKA 4X23C 2NQBC 3AV2B 5B32B 4WU8B 3KFUG 3AFAB 4X23B 5CPJD 1F66B 2JE5A 3REJD 3F6TA 3IP4C 5DNMB 1P3AA 5AV9A 3O62B 3RELC 5B31C 5AVBA 4YS3C 5AV6C 1S32D 2NZDA 5AV5D 3R45A 2YFVA 2Y2OA 5B31A 3X1SD 3LZ0D 4Z5TB 2YFVB 2RVQD 5E5AD 3X1VA 3UTBC 5AV8B 5CP6B 4YM6C 3MGRC 4J8WB 5B2JB 3W98C 2YFWA 5CP6C 4J8XD 5GSUD 3MGQD 4J8WA 1P3AB 4H9OA 3LELA 5CPIA 3MGRA 3EG5B 3VH5W 3MGPA 5B0ZB 3W97A 3H0MC 3AZGC 2BYKA 5CPKD 5BNXB 1EQZD 4LD9C 3AZED 3AZKC 1WWSA 2JCHA 3AN2D 1P34C 1P3GA 4XUJD 2F8NH 5B2ID 2HUEB 3AZFA 4WNNB 1P3BA 1M19C 2F8NA 5F99D 3REJC 3AYWB 3B6GC 2DQNC 2Y2MA 1BH8B 3REHC 1P3IC 1P3MC 1KX4C 4G92C 4DRBA 2G5HC 3B6FB 4DRAA 2Y2KA 1Q9CA 1B67A 2AROA 4G92B 3A6NC 3AZLC 2HIOA 5B1MA 4Z66D 4KGCA 2CV5B 3RELD 4J8VC 5GT3D 4YM6D 1M1AA 2XD1A 1KX3A 2AROD 5B2IA 4ZUXB 2FJ7C 5B1MC 5BO0B 4WU9A 5G49A 1ID3C 3W96B 4WJ3C 1HTAA 1EQZA 3UTBA 2DF4C 3C1BB 3W97D 3X1UD 5AV8A 3MNNC 3AZIC 3KXBA 3KUYD 3MGRD 5F99A 3UTAA 4H9RA 5AY8D 4YS3B 4XZQD 3EPLA 1P3OD 1P3BC 5AVBB 3AN2A 1P3GD 3B6GA 5AVCB 5E5AA 3AZNC 3LJAA 3REKD 5AV5A 4UUZA 4JJNA 3AN2C 1S32A 5B32A 1P34D 3KXBB 5KDMA 4X23A 4XZQB 5AY8B 3KUYC 1F1EA 4WNNA 2Y2NA 3V9RA 2BYMA 3KUYB 1KX3C 1W2EA 1ID3D 3X1VD 3KXBD 3KUYA 5BS7C 3LZ0A 1KX5C 3AV1C 1P34B 2NZDD 3H0RC 5BNVB 3AV2C 2AROB 1N1JB 2L5AA 4Z66C 3C1CC 5GT3B 3O62C 3VH5A 3AL0C 1M1AD 5AY8A 4Z66B 1F66C 3UTAD 3AZMC 1P3LB 5B2JA 5B0YC 1TZYC 2HIOD 3MVDA 3AZKD 1P3KB 3EPKA 5JRGC 3X1UB 5AV8C 3AZIA 5BNXA 1TZYA 5F99B 3AZGA 5AV6D 2NQBD 1M18B 4ZUXD 2ZY3A 4H9RB 2F8ND 1HQ3D 1P3BD 4KUDA 4G91B 5B2IB 3MGSC 3AZJB 3AZFD 1KX5D 4LD9B 3W99D 1EQZB 4H9NA 3KSYA 4H9SA 3MGSA 5G49B 1S32C 1U35B 2J8PA 2ZY2A 5B24C 3REHA 1KX4A 1U35C 5JA4B 2UWXA 3AYWC 4YS3A 4J8WD 1P3FC 5B40B 2HIOC 3FDDA 2CV5A 5B33C 3B0DC 3X1UC 3R45B 4JJND 3AV2A 1H3OA 5CPKB 3W96A 3AFAA 1ID3A 2VQRA 2Y2PA 1F66A 3LELC 3KXBC 3A6NB 3AZLB 1P3OA 1P3AD 1F66D 5CPJB 4M6BA 4X23D 5B32D 3V9RB 3LZ1B 5AV8D 4H9SC 3MNNB 4DQYB 1BH9B 1AOIC 5GT3C 3W99C 5AV5B 2F8NG 1S32B 2G5IC 3LJAB 1KX3D 5AV5C 2Y2IA 2ZM5A 1HQ3C 3TU4A 3B0DB 5B31G 1P3PB 5DNMD 1P3MA 3REHD 3REJB 1KX4D 3X1UA 1M19B 2FJ7D 4WU8D 1TZYB 3X1TB 2F2AC 3WAAC 4QLCA 5B0ZA 5B31B 4J8VB 1P3IB 1KX5A 3WAAB 1TAFA 1ULYA 5B0YD 4J8UD 4KUDB 2YFWB 5B1MD 3VH6A 4ZUXA 4Z66A 1T3UA 3AZJA 5B33D 4WU9B 3W98A 4H9QB 1B6WA 3WTPA 1P3ID 4J8VD 5FUGA 1AOID 3NQUB 4NE3A 5CPIC 3X1TD 3AZID 4ZUXC 2FJ7B 1M19D 2ZY5A 1BFMA 3MVDD 3AZIB 5JRGA 1AOIB 3EPJA 2W8SA 1P3OC 5B33B 5GSUA 3MGQA 3VH6W 2Y2QA 3WA9D 5BT1C 4J8UB 2XD5A 1H3OB 4HGAB 3MNND 3X1SA 5B31D 1P3AC 4NE6A 3X1TC 5CPID 3VH6T 4R8PB 5CPJC 4AWLB 3REHB 1KX4B 4J8XA 2F8NK 2RVQC 3REIA 5JA4A 2ZY4A 1P3PD 3AZJC 3LJAD 3REKA 4J8XC 3REIC 2HUEC 3AV1B 4JJNB 1WWIA 5CP6A 3B6GD 5KDMB 4Z5TA 3LZ1D 3C1CB 4UUZB 3W96C 5DNNA 5GT0D 1P3KC 1ZLAD 3MVDC 1P3PA 5DNNB 5C3IB 5GSUC 3X1VC 3MGQC 3UT9B 3A6ND 3TU4B 3AZLD 3B6FC 3A1KA 5DNNC 1P3KA 4E45A 3UTBD 1M18C 5BT1D 3B6FA 1BH9A 4CSRA 5CPKC 4LD9D 3MNNA 5GT3A 3UTAC 3AZMD 2F8NB 4R8PC 4ZBJC 5B40D 3AZNB 1PZRA 4NE5A 2NQBB 4ZBJB 3AZEC 3WKJB 4H9QA 3WTPB 4XZQC 3B0BA 3AZHC
chains in the Genus database with same CATH topology
2BYKB 1U35D 3LJAC 3AZKB 2HIOB 5B32C 3AZHB 4QLCC 3W99B 3WAAA 1P3IA 5B0ZC 1KX5B 5B33A 3AZFB 3AZJD 1P3PC 1P3BB 1HQ3B 2AROC 2PYOA 2IO5C 3AZMA 3KWQB 1M18D 5B0YA 5AV6B 2NZDB 3MGPD 2PYOC 4Z5TC 5GXQB 3LELD 3C1BA 3C1CA 1P3KD 5B1LA 1P3FD 4Z2MH 5AY8C 5B1LB 5AV9B 3UTAB 1P3LD 1M1AB 5B24D 5B1LC 3REKB 3W97C 4EO5C 5BO0A 4LD9A 5AVCD 5B24B 5AVBD 3X1SC 4R8PA 3UT9C 3A6NA 3AZLA 3X1VB 5AV9D 1P3OB 1ID3B 3AZNA 1P3LA 3REJA 1P3FB 5CPJA 5GT0A 1ZLAA 3AYWA 1P3FA 3C1BD 4CAYA 3P5JB 4NFTA 5GT0C 4CAYB 1ZLAC 3W96D 3WA9C 2RIQA 5B2JC 4YM6B 5BS7A 3LZ0C 1P3GB 3WTPC 2CV5D 1KU5A 1M1AC 4AWLC 4G91C 5B2IC 4YS3D 5B1LD 3AZHD 2LY8A 4WU9C 3WKJA 5FUGB 3MGRB 4J8WC 1EQZC 4KHAA 4H9OB 3LELB 5GXQD 3W97B 3WKJC 3MGPB 3C1BC 5GXQA 3NQJA 5B40C 1M18A 4JJNC 3KWQD 1TAFB 2IO5B 1JFIB 3AZMB 1P3LC 3RELB 1HQ3A 3TU4C 3AN2B 3AZFC 5E5AC 1M19A 1U35A 5AVCC 5B0ZD 2JSSA 3UTBB 3B6FD 4Z2MG 4WU8A 1A7WA 3NQJB 5AV9C 3WTPD 2CV5C 3AZHA 3UT9D 3WKJD 3O62A 4J8XB 3AYWD 1Z2CB 5DNMA 5B2JD 3AZND 4KGCC 4Z5TD 3LZ1A 3AV1A 3B0CT 2Y2JA 4XUJB 3X1SB 2Y2HA 3AZEB 2FJ7A 3H0LC 2BYMB 3TU4D 3AFAC 5DNND 5C3IC 5GSUB 4R8PD 3MGQB 3WTPE 5GT0B 1ZLAB 3C1CD 5CP6D 5E5AB 5GXQC 5AVCA 1P3GC 1P34A 3B6GB 1N1JA 3LZ0B 4WV4B 5BNVA 3AV1D 2Y2LA 5B24A 3WA9B 3REID 4H9PA 4WZSB 3O62D 4XZQA 3UT9A 2FFFB 3B0CW 4H9NB 4QLCB 3LZ1C 3AFAD 4KHAB 4CSRB 5CPIB 3REKC 1R4VA 2Y2GA 3AV2D 4WU8C 3MGSD 3X1TA 4UPKA 2PYOD 4WU9D 5DNMC 4J8VA 3WA9A 4J8UC 3AZGB 1JFIA 3W98D 4YM6A 4H9PB 4KUDD 3KWQA 3RELA 5B0YB 4KGCD 2PYOB 3WAAD 5AVBC 5JRGD 4J8UA 1P3MB 5AV6A 2NZDC 4HGAC 3MVDB 1TZYD 3KWQC 5F99C 2CWEA 4QLCD 1AOIA 3W99A 5B32G 3AZKA 5JRGB 1P3MD 4XUJC 5B40A 3REIB 4KGCB 2BG1A 1KX3B 5B1MB 3VH5T 5CHLB 4E44A 3W98B 3AZGD 3A1IA 2NQBA 4XUJA 4KUDC 3MGPC 4EO5B 3EPHA 3AZEA 3NQUA 1BH8A 3MGSB 5CPKA 4X23C 2NQBC 3AV2B 5B32B 4WU8B 3KFUG 3AFAB 4X23B 5CPJD 1F66B 2JE5A 3REJD 3F6TA 3IP4C 5DNMB 1P3AA 5AV9A 3O62B 3RELC 5B31C 5AVBA 4YS3C 5AV6C 1S32D 2NZDA 5AV5D 3R45A 2YFVA 2Y2OA 5B31A 3X1SD 3LZ0D 4Z5TB 2YFVB 2RVQD 5E5AD 3X1VA 3UTBC 5AV8B 5CP6B 4YM6C 3MGRC 4J8WB 5B2JB 3W98C 2YFWA 5CP6C 4J8XD 5GSUD 3MGQD 4J8WA 1P3AB 4H9OA 3LELA 5CPIA 3MGRA 3EG5B 3VH5W 3MGPA 5B0ZB 3W97A 3H0MC 3AZGC 2BYKA 5CPKD 5BNXB 1EQZD 4LD9C 3AZED 3AZKC 1WWSA 2JCHA 3AN2D 1P34C 1P3GA 4XUJD 2F8NH 5B2ID 2HUEB 3AZFA 4WNNB 1P3BA 1M19C 2F8NA 5F99D 3REJC 3AYWB 3B6GC 2DQNC 2Y2MA 1BH8B 3REHC 1P3IC 1P3MC 1KX4C 4G92C 4DRBA 2G5HC 3B6FB 4DRAA 2Y2KA 1Q9CA 1B67A 2AROA 4G92B 3A6NC 3AZLC 2HIOA 5B1MA 4Z66D 4KGCA 2CV5B 3RELD 4J8VC 5GT3D 4YM6D 1M1AA 2XD1A 1KX3A 2AROD 5B2IA 4ZUXB 2FJ7C 5B1MC 5BO0B 4WU9A 5G49A 1ID3C 3W96B 4WJ3C 1HTAA 1EQZA 3UTBA 2DF4C 3C1BB 3W97D 3X1UD 5AV8A 3MNNC 3AZIC 3KXBA 3KUYD 3MGRD 5F99A 3UTAA 4H9RA 5AY8D 4YS3B 4XZQD 3EPLA 1P3OD 1P3BC 5AVBB 3AN2A 1P3GD 3B6GA 5AVCB 5E5AA 3AZNC 3LJAA 3REKD 5AV5A 4UUZA 4JJNA 3AN2C 1S32A 5B32A 1P34D 3KXBB 5KDMA 4X23A 4XZQB 5AY8B 3KUYC 1F1EA 4WNNA 2Y2NA 3V9RA 2BYMA 3KUYB 1KX3C 1W2EA 1ID3D 3X1VD 3KXBD 3KUYA 5BS7C 3LZ0A 1KX5C 3AV1C 1P34B 2NZDD 3H0RC 5BNVB 3AV2C 2AROB 1N1JB 2L5AA 4Z66C 3C1CC 5GT3B 3O62C 3VH5A 3AL0C 1M1AD 5AY8A 4Z66B 1F66C 3UTAD 3AZMC 1P3LB 5B2JA 5B0YC 1TZYC 2HIOD 3MVDA 3AZKD 1P3KB 3EPKA 5JRGC 3X1UB 5AV8C 3AZIA 5BNXA 1TZYA 5F99B 3AZGA 5AV6D 2NQBD 1M18B 4ZUXD 2ZY3A 4H9RB 2F8ND 1HQ3D 1P3BD 4KUDA 4G91B 5B2IB 3MGSC 3AZJB 3AZFD 1KX5D 4LD9B 3W99D 1EQZB 4H9NA 3KSYA 4H9SA 3MGSA 5G49B 1S32C 1U35B 2J8PA 2ZY2A 5B24C 3REHA 1KX4A 1U35C 5JA4B 2UWXA 3AYWC 4YS3A 4J8WD 1P3FC 5B40B 2HIOC 3FDDA 2CV5A 5B33C 3B0DC 3X1UC 3R45B 4JJND 3AV2A 1H3OA 5CPKB 3W96A 3AFAA 1ID3A 2VQRA 2Y2PA 1F66A 3LELC 3KXBC 3A6NB 3AZLB 1P3OA 1P3AD 1F66D 5CPJB 4M6BA 4X23D 5B32D 3V9RB 3LZ1B 5AV8D 4H9SC 3MNNB 4DQYB 1BH9B 1AOIC 5GT3C 3W99C 5AV5B 2F8NG 1S32B 2G5IC 3LJAB 1KX3D 5AV5C 2Y2IA 2ZM5A 1HQ3C 3TU4A 3B0DB 5B31G 1P3PB 5DNMD 1P3MA 3REHD 3REJB 1KX4D 3X1UA 1M19B 2FJ7D 4WU8D 1TZYB 3X1TB 2F2AC 3WAAC 4QLCA 5B0ZA 5B31B 4J8VB 1P3IB 1KX5A 3WAAB 1TAFA 1ULYA 5B0YD 4J8UD 4KUDB 2YFWB 5B1MD 3VH6A 4ZUXA 4Z66A 1T3UA 3AZJA 5B33D 4WU9B 3W98A 4H9QB 1B6WA 3WTPA 1P3ID 4J8VD 5FUGA 1AOID 3NQUB 4NE3A 5CPIC 3X1TD 3AZID 4ZUXC 2FJ7B 1M19D 2ZY5A 1BFMA 3MVDD 3AZIB 5JRGA 1AOIB 3EPJA 2W8SA 1P3OC 5B33B 5GSUA 3MGQA 3VH6W 2Y2QA 3WA9D 5BT1C 4J8UB 2XD5A 1H3OB 4HGAB 3MNND 3X1SA 5B31D 1P3AC 4NE6A 3X1TC 5CPID 3VH6T 4R8PB 5CPJC 4AWLB 3REHB 1KX4B 4J8XA 2F8NK 2RVQC 3REIA 5JA4A 2ZY4A 1P3PD 3AZJC 3LJAD 3REKA 4J8XC 3REIC 2HUEC 3AV1B 4JJNB 1WWIA 5CP6A 3B6GD 5KDMB 4Z5TA 3LZ1D 3C1CB 4UUZB 3W96C 5DNNA 5GT0D 1P3KC 1ZLAD 3MVDC 1P3PA 5DNNB 5C3IB 5GSUC 3X1VC 3MGQC 3UT9B 3A6ND 3TU4B 3AZLD 3B6FC 3A1KA 5DNNC 1P3KA 4E45A 3UTBD 1M18C 5BT1D 3B6FA 1BH9A 4CSRA 5CPKC 4LD9D 3MNNA 5GT3A 3UTAC 3AZMD 2F8NB 4R8PC 4ZBJC 5B40D 3AZNB 1PZRA 4NE5A 2NQBB 4ZBJB 3AZEC 3WKJB 4H9QA 3WTPB 4XZQC 3B0BA 3AZHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK B;  1U35 D;  3LJA C;  3AZK B;  2HIO B;  5B32 C;  3AZH B;  4QLC C;  3W99 B;  3WAA A;  1P3I A;  5B0Z C;  1KX5 B;  5B33 A;  3AZF B;  3AZJ D;  1P3P C;  1P3B B;  1HQ3 B;  2ARO C;  2PYO A;  2IO5 C;  3AZM A;  3KWQ B;  1M18 D;  5B0Y A;  5AV6 B;  2NZD B;  3MGP D;  2PYO C;  4Z5T C;  5GXQ B;  3LEL D;  3C1B A;  3C1C A;  1P3K D;  5B1L A;  1P3F D;  4Z2M H;  5AY8 C;  5B1L B;  5AV9 B;  3UTA B;  1P3L D;  1M1A B;  5B24 D;  5B1L C;  3REK B;  3W97 C;  4EO5 C;  5BO0 A;  4LD9 A;  5AVC D;  5B24 B;  5AVB D;  3X1S C;  4R8P A;  3UT9 C;  3A6N A;  3AZL A;  3X1V B;  5AV9 D;  1P3O B;  1ID3 B;  3AZN A;  1P3L A;  3REJ A;  1P3F B;  5CPJ A;  5GT0 A;  1ZLA A;  3AYW A;  1P3F A;  3C1B D;  4CAY A;  4NFT A;  5GT0 C;  4CAY B;  1ZLA C;  3W96 D;  3WA9 C;  5B2J C;  4YM6 B;  5BS7 A;  3LZ0 C;  1P3G B;  3WTP C;  2CV5 D;  1KU5 A;  1M1A C;  4AWL C;  4G91 C;  5B2I C;  4YS3 D;  5B1L D;  3AZH D;  2LY8 A;  4WU9 C;  3WKJ A;  5FUG B;  3MGR B;  4J8W C;  1EQZ C;  4KHA A;  4H9O B;  3LEL B;  5GXQ D;  3W97 B;  3WKJ C;  3MGP B;  3C1B C;  5GXQ A;  3NQJ A;  5B40 C;  1M18 A;  4JJN C;  3KWQ D;  1TAF B;  2IO5 B;  1JFI B;  3AZM B;  1P3L C;  3REL B;  1HQ3 A;  3TU4 C;  3AN2 B;  3AZF C;  5E5A C;  1M19 A;  1U35 A;  5AVC C;  5B0Z D;  2JSS A;  3UTB B;  3B6F D;  4Z2M G;  4WU8 A;  1A7W A;  3NQJ B;  5AV9 C;  3WTP D;  2CV5 C;  3AZH A;  3UT9 D;  3WKJ D;  3O62 A;  4J8X B;  3AYW D;  5DNM A;  5B2J D;  3AZN D;  4KGC C;  4Z5T D;  3LZ1 A;  3AV1 A;  3B0C T;  4XUJ B;  3X1S B;  3AZE B;  2FJ7 A;  2BYM B;  3TU4 D;  3AFA C;  5DNN D;  5C3I C;  5GSU B;  4R8P D;  3MGQ B;  3WTP E;  5GT0 B;  1ZLA B;  3C1C D;  5CP6 D;  5E5A B;  5GXQ C;  5AVC A;  1P3G C;  1P34 A;  3B6G B;  1N1J A;  3LZ0 B;  4WV4 B;  5BNV A;  3AV1 D;  5B24 A;  3WA9 B;  3REI D;  4H9P A;  4WZS B;  3O62 D;  4XZQ A;  3UT9 A;  3B0C W;  4H9N B;  3LZ1 C;  4QLC B;  3AFA D;  4KHA B;  4CSR B;  5CPI B;  3REK C;  1R4V A;  3AV2 D;  4WU8 C;  3MGS D;  3X1T A;  2PYO D;  4WU9 D;  5DNM C;  4J8V A;  3WA9 A;  4J8U C;  3AZG B;  1JFI A;  3W98 D;  4YM6 A;  4H9P B;  4KUD D;  3KWQ A;  3REL A;  5B0Y B;  4KGC D;  2PYO B;  3WAA D;  5AVB C;  5JRG D;  4J8U A;  1P3M B;  5AV6 A;  2NZD C;  4HGA C;  3MVD B;  1TZY D;  3KWQ C;  5F99 C;  2CWE A;  4QLC D;  1AOI A;  3W99 A;  5B32 G;  3AZK A;  5JRG B;  1P3M D;  4XUJ C;  5B40 A;  3REI B;  4KGC B;  1KX3 B;  5B1M B;  3VH5 T;  5CHL B;  4E44 A;  3W98 B;  3AZG D;  2NQB A;  4XUJ A;  4KUD C;  3MGP C;  4EO5 B;  3AZE A;  3NQU A;  1BH8 A;  3MGS B;  5CPK A;  4X23 C;  2NQB C;  3AV2 B;  5B32 B;  4WU8 B;  3AFA B;  4X23 B;  5CPJ D;  1F66 B;  3REJ D;  5DNM B;  1P3A A;  5AV9 A;  3O62 B;  3REL C;  5B31 C;  5AVB A;  4YS3 C;  5AV6 C;  1S32 D;  2NZD A;  5AV5 D;  3R45 A;  2YFV A;  5B31 A;  3X1S D;  3LZ0 D;  4Z5T B;  2YFV B;  2RVQ D;  5E5A D;  3X1V A;  3UTB C;  5AV8 B;  5CP6 B;  4YM6 C;  3MGR C;  4J8W B;  5B2J B;  3W98 C;  2YFW A;  5CP6 C;  4J8X D;  5GSU D;  3MGQ D;  4J8W A;  1P3A B;  4H9O A;  3LEL A;  5CPI A;  3MGR A;  3VH5 W;  3MGP A;  5B0Z B;  3W97 A;  3AZG C;  2BYK A;  5CPK D;  5BNX B;  1EQZ D;  4LD9 C;  3AZE D;  3AZK C;  1WWS A;  3AN2 D;  1P34 C;  1P3G A;  4XUJ D;  2F8N H;  5B2I D;  2HUE B;  3AZF A;  4WNN B;  1P3B A;  1M19 C;  2F8N A;  5F99 D;  3REJ C;  3AYW B;  3B6G C;  1BH8 B;  3REH C;  1P3I C;  1P3M C;  1KX4 C;  4G92 C;  4DRB A;  3B6F B;  4DRA A;  1Q9C A;  1B67 A;  2ARO A;  4G92 B;  3A6N C;  3AZL C;  2HIO A;  5B1M A;  4Z66 D;  4KGC A;  2CV5 B;  3REL D;  4J8V C;  5GT3 D;  4YM6 D;  1M1A A;  1KX3 A;  2ARO D;  5B2I A;  4ZUX B;  2FJ7 C;  5B1M C;  5BO0 B;  4WU9 A;  5G49 A;  1ID3 C;  3W96 B;  1HTA A;  1EQZ A;  3UTB A;  3C1B B;  3W97 D;  3X1U D;  5AV8 A;  3MNN C;  3AZI C;  3KXB A;  3KUY D;  3MGR D;  5F99 A;  3UTA A;  4H9R A;  5AY8 D;  4YS3 B;  4XZQ D;  1P3O D;  1P3B C;  5AVB B;  3AN2 A;  1P3G D;  3B6G A;  5AVC B;  5E5A A;  3AZN C;  3LJA A;  3REK D;  5AV5 A;  4UUZ A;  4JJN A;  3AN2 C;  1S32 A;  5B32 A;  1P34 D;  3KXB B;  5KDM A;  4X23 A;  4XZQ B;  5AY8 B;  3KUY C;  1F1E A;  4WNN A;  3V9R A;  2BYM A;  3KUY B;  1KX3 C;  1ID3 D;  3X1V D;  3KXB D;  3KUY A;  5BS7 C;  3LZ0 A;  1KX5 C;  3AV1 C;  1P34 B;  2NZD D;  5BNV B;  3AV2 C;  2ARO B;  1N1J B;  2L5A A;  4Z66 C;  3C1C C;  5GT3 B;  3O62 C;  3VH5 A;  1M1A D;  5AY8 A;  4Z66 B;  1F66 C;  3UTA D;  3AZM C;  1P3L B;  5B2J A;  5B0Y C;  1TZY C;  2HIO D;  3MVD A;  3AZK D;  1P3K B;  5JRG C;  3X1U B;  5AV8 C;  3AZI A;  5BNX A;  1TZY A;  5F99 B;  3AZG A;  5AV6 D;  2NQB D;  1M18 B;  4ZUX D;  4H9R B;  2F8N D;  1HQ3 D;  1P3B D;  4KUD A;  4G91 B;  5B2I B;  3MGS C;  3AZJ B;  3AZF D;  1KX5 D;  4LD9 B;  3W99 D;  1EQZ B;  4H9N A;  3KSY A;  4H9S A;  3MGS A;  5G49 B;  1S32 C;  1U35 B;  5B24 C;  3REH A;  1KX4 A;  1U35 C;  5JA4 B;  3AYW C;  4YS3 A;  4J8W D;  1P3F C;  5B40 B;  2HIO C;  2CV5 A;  5B33 C;  3B0D C;  3X1U C;  3R45 B;  4JJN D;  3AV2 A;  1H3O A;  5CPK B;  3W96 A;  3AFA A;  1ID3 A;  1F66 A;  3LEL C;  3KXB C;  3A6N B;  3AZL B;  1P3O A;  1P3A D;  1F66 D;  5CPJ B;  4M6B A;  4X23 D;  5B32 D;  3V9R B;  3LZ1 B;  5AV8 D;  4H9S C;  3MNN B;  1BH9 B;  1AOI C;  5GT3 C;  3W99 C;  5AV5 B;  2F8N G;  1S32 B;  3LJA B;  1KX3 D;  5AV5 C;  1HQ3 C;  3TU4 A;  3B0D B;  5B31 G;  1P3P B;  5DNM D;  1P3M A;  3REH D;  3REJ B;  1KX4 D;  3X1U A;  1M19 B;  2FJ7 D;  4WU8 D;  1TZY B;  3X1T B;  3WAA C;  4QLC A;  5B0Z A;  5B31 B;  4J8V B;  1P3I B;  1KX5 A;  3WAA B;  1TAF A;  1ULY A;  5B0Y D;  4J8U D;  4KUD B;  2YFW B;  5B1M D;  3VH6 A;  4ZUX A;  4Z66 A;  3AZJ A;  4WU9 B;  5B33 D;  3W98 A;  4H9Q B;  1B6W A;  3WTP A;  1P3I D;  4J8V D;  5FUG A;  1AOI D;  3NQU B;  4NE3 A;  5CPI C;  3X1T D;  3AZI D;  4ZUX C;  2FJ7 B;  1M19 D;  1BFM A;  3MVD D;  3AZI B;  5JRG A;  1AOI B;  1P3O C;  5B33 B;  5GSU A;  3MGQ A;  3VH6 W;  3WA9 D;  5BT1 C;  4J8U B;  1H3O B;  4HGA B;  3MNN D;  3X1S A;  5B31 D;  1P3A C;  4NE6 A;  3X1T C;  5CPI D;  3VH6 T;  4R8P B;  5CPJ C;  4AWL B;  3REH B;  1KX4 B;  4J8X A;  2F8N K;  2RVQ C;  3REI A;  5JA4 A;  1P3P D;  3AZJ C;  3LJA D;  3REK A;  4J8X C;  3REI C;  2HUE C;  3AV1 B;  4JJN B;  1WWI A;  5CP6 A;  3B6G D;  5KDM B;  4Z5T A;  3LZ1 D;  3C1C B;  4UUZ B;  3W96 C;  5DNN A;  5GT0 D;  1P3K C;  1ZLA D;  3MVD C;  1P3P A;  5DNN B;  5C3I B;  5GSU C;  3X1V C;  3MGQ C;  3UT9 B;  3A6N D;  3TU4 B;  3AZL D;  3B6F C;  5DNN C;  1P3K A;  4E45 A;  3UTB D;  1M18 C;  5BT1 D;  3B6F A;  1BH9 A;  4CSR A;  5CPK C;  4LD9 D;  3MNN A;  5GT3 A;  3UTA C;  3AZM D;  2F8N B;  4R8P C;  4ZBJ C;  5B40 D;  3AZN B;  4NE5 A;  2NQB B;  4ZBJ B;  3AZE C;  3WKJ B;  4H9Q A;  3WTP B;  4XZQ C;  3B0B A;  3AZH C; 
#chains in the Genus database with same CATH topology
 2BYK B;  1U35 D;  3LJA C;  3AZK B;  2HIO B;  5B32 C;  3AZH B;  4QLC C;  3W99 B;  3WAA A;  1P3I A;  5B0Z C;  1KX5 B;  5B33 A;  3AZF B;  3AZJ D;  1P3P C;  1P3B B;  1HQ3 B;  2ARO C;  2PYO A;  2IO5 C;  3AZM A;  3KWQ B;  1M18 D;  5B0Y A;  5AV6 B;  2NZD B;  3MGP D;  2PYO C;  4Z5T C;  5GXQ B;  3LEL D;  3C1B A;  3C1C A;  1P3K D;  5B1L A;  1P3F D;  4Z2M H;  5AY8 C;  5B1L B;  5AV9 B;  3UTA B;  1P3L D;  1M1A B;  5B24 D;  5B1L C;  3REK B;  3W97 C;  4EO5 C;  5BO0 A;  4LD9 A;  5AVC D;  5B24 B;  5AVB D;  3X1S C;  4R8P A;  3UT9 C;  3A6N A;  3AZL A;  3X1V B;  5AV9 D;  1P3O B;  1ID3 B;  3AZN A;  1P3L A;  3REJ A;  1P3F B;  5CPJ A;  5GT0 A;  1ZLA A;  3AYW A;  1P3F A;  3C1B D;  4CAY A;  3P5J B;  4NFT A;  5GT0 C;  4CAY B;  1ZLA C;  3W96 D;  3WA9 C;  2RIQ A;  5B2J C;  4YM6 B;  5BS7 A;  3LZ0 C;  1P3G B;  3WTP C;  2CV5 D;  1KU5 A;  1M1A C;  4AWL C;  4G91 C;  5B2I C;  4YS3 D;  5B1L D;  3AZH D;  2LY8 A;  4WU9 C;  3WKJ A;  5FUG B;  3MGR B;  4J8W C;  1EQZ C;  4KHA A;  4H9O B;  3LEL B;  5GXQ D;  3W97 B;  3WKJ C;  3MGP B;  3C1B C;  5GXQ A;  3NQJ A;  5B40 C;  1M18 A;  4JJN C;  3KWQ D;  1TAF B;  2IO5 B;  1JFI B;  3AZM B;  1P3L C;  3REL B;  1HQ3 A;  3TU4 C;  3AN2 B;  3AZF C;  5E5A C;  1M19 A;  1U35 A;  5AVC C;  5B0Z D;  2JSS A;  3UTB B;  3B6F D;  4Z2M G;  4WU8 A;  1A7W A;  3NQJ B;  5AV9 C;  3WTP D;  2CV5 C;  3AZH A;  3UT9 D;  3WKJ D;  3O62 A;  4J8X B;  3AYW D;  1Z2C B;  5DNM A;  5B2J D;  3AZN D;  4KGC C;  4Z5T D;  3LZ1 A;  3AV1 A;  3B0C T;  2Y2J A;  4XUJ B;  3X1S B;  2Y2H A;  3AZE B;  2FJ7 A;  3H0L C;  2BYM B;  3TU4 D;  3AFA C;  5DNN D;  5C3I C;  5GSU B;  4R8P D;  3MGQ B;  3WTP E;  5GT0 B;  1ZLA B;  3C1C D;  5CP6 D;  5E5A B;  5GXQ C;  5AVC A;  1P3G C;  1P34 A;  3B6G B;  1N1J A;  3LZ0 B;  4WV4 B;  5BNV A;  3AV1 D;  2Y2L A;  5B24 A;  3WA9 B;  3REI D;  4H9P A;  4WZS B;  3O62 D;  4XZQ A;  3UT9 A;  2FFF B;  3B0C W;  4H9N B;  4QLC B;  3LZ1 C;  3AFA D;  4KHA B;  4CSR B;  5CPI B;  3REK C;  1R4V A;  2Y2G A;  3AV2 D;  4WU8 C;  3MGS D;  3X1T A;  4UPK A;  2PYO D;  4WU9 D;  5DNM C;  4J8V A;  3WA9 A;  4J8U C;  3AZG B;  1JFI A;  3W98 D;  4YM6 A;  4H9P B;  4KUD D;  3KWQ A;  3REL A;  5B0Y B;  4KGC D;  2PYO B;  3WAA D;  5AVB C;  5JRG D;  4J8U A;  1P3M B;  5AV6 A;  2NZD C;  4HGA C;  3MVD B;  1TZY D;  3KWQ C;  5F99 C;  2CWE A;  4QLC D;  1AOI A;  3W99 A;  5B32 G;  3AZK A;  5JRG B;  1P3M D;  4XUJ C;  5B40 A;  3REI B;  4KGC B;  2BG1 A;  1KX3 B;  5B1M B;  3VH5 T;  5CHL B;  4E44 A;  3W98 B;  3AZG D;  3A1I A;  2NQB A;  4XUJ A;  4KUD C;  3MGP C;  4EO5 B;  3EPH A;  3AZE A;  3NQU A;  1BH8 A;  3MGS B;  5CPK A;  4X23 C;  2NQB C;  3AV2 B;  5B32 B;  4WU8 B;  3KFU G;  3AFA B;  4X23 B;  5CPJ D;  1F66 B;  2JE5 A;  3REJ D;  3F6T A;  3IP4 C;  5DNM B;  1P3A A;  5AV9 A;  3O62 B;  3REL C;  5B31 C;  5AVB A;  4YS3 C;  5AV6 C;  1S32 D;  2NZD A;  5AV5 D;  3R45 A;  2YFV A;  2Y2O A;  5B31 A;  3X1S D;  3LZ0 D;  4Z5T B;  2YFV B;  2RVQ D;  5E5A D;  3X1V A;  3UTB C;  5AV8 B;  5CP6 B;  4YM6 C;  3MGR C;  4J8W B;  5B2J B;  3W98 C;  2YFW A;  5CP6 C;  4J8X D;  5GSU D;  3MGQ D;  4J8W A;  1P3A B;  4H9O A;  3LEL A;  5CPI A;  3MGR A;  3EG5 B;  3VH5 W;  3MGP A;  5B0Z B;  3W97 A;  3H0M C;  3AZG C;  2BYK A;  5CPK D;  5BNX B;  1EQZ D;  4LD9 C;  3AZE D;  3AZK C;  1WWS A;  2JCH A;  3AN2 D;  1P34 C;  1P3G A;  4XUJ D;  2F8N H;  5B2I D;  2HUE B;  3AZF A;  4WNN B;  1P3B A;  1M19 C;  2F8N A;  5F99 D;  3REJ C;  3AYW B;  3B6G C;  2DQN C;  2Y2M A;  1BH8 B;  3REH C;  1P3I C;  1P3M C;  1KX4 C;  4G92 C;  4DRB A;  2G5H C;  3B6F B;  4DRA A;  2Y2K A;  1Q9C A;  1B67 A;  2ARO A;  4G92 B;  3A6N C;  3AZL C;  2HIO A;  5B1M A;  4Z66 D;  4KGC A;  2CV5 B;  3REL D;  4J8V C;  5GT3 D;  4YM6 D;  1M1A A;  2XD1 A;  1KX3 A;  2ARO D;  5B2I A;  4ZUX B;  2FJ7 C;  5B1M C;  5BO0 B;  4WU9 A;  5G49 A;  1ID3 C;  3W96 B;  4WJ3 C;  1HTA A;  1EQZ A;  3UTB A;  2DF4 C;  3C1B B;  3W97 D;  3X1U D;  5AV8 A;  3MNN C;  3AZI C;  3KXB A;  3KUY D;  3MGR D;  5F99 A;  3UTA A;  4H9R A;  5AY8 D;  4YS3 B;  4XZQ D;  3EPL A;  1P3O D;  1P3B C;  5AVB B;  3AN2 A;  1P3G D;  3B6G A;  5AVC B;  5E5A A;  3AZN C;  3LJA A;  3REK D;  5AV5 A;  4UUZ A;  4JJN A;  3AN2 C;  1S32 A;  5B32 A;  1P34 D;  3KXB B;  5KDM A;  4X23 A;  4XZQ B;  5AY8 B;  3KUY C;  1F1E A;  4WNN A;  2Y2N A;  3V9R A;  2BYM A;  3KUY B;  1KX3 C;  1W2E A;  1ID3 D;  3X1V D;  3KXB D;  3KUY A;  5BS7 C;  3LZ0 A;  1KX5 C;  3AV1 C;  1P34 B;  2NZD D;  3H0R C;  5BNV B;  3AV2 C;  2ARO B;  1N1J B;  2L5A A;  4Z66 C;  3C1C C;  5GT3 B;  3O62 C;  3VH5 A;  3AL0 C;  1M1A D;  5AY8 A;  4Z66 B;  1F66 C;  3UTA D;  3AZM C;  1P3L B;  5B2J A;  5B0Y C;  1TZY C;  2HIO D;  3MVD A;  3AZK D;  1P3K B;  3EPK A;  5JRG C;  3X1U B;  5AV8 C;  3AZI A;  5BNX A;  1TZY A;  5F99 B;  3AZG A;  5AV6 D;  2NQB D;  1M18 B;  4ZUX D;  2ZY3 A;  4H9R B;  2F8N D;  1HQ3 D;  1P3B D;  4KUD A;  4G91 B;  5B2I B;  3MGS C;  3AZJ B;  3AZF D;  1KX5 D;  4LD9 B;  3W99 D;  1EQZ B;  4H9N A;  3KSY A;  4H9S A;  3MGS A;  5G49 B;  1S32 C;  1U35 B;  2J8P A;  2ZY2 A;  5B24 C;  3REH A;  1KX4 A;  1U35 C;  5JA4 B;  2UWX A;  3AYW C;  4YS3 A;  4J8W D;  1P3F C;  5B40 B;  2HIO C;  3FDD A;  2CV5 A;  5B33 C;  3B0D C;  3X1U C;  3R45 B;  4JJN D;  3AV2 A;  1H3O A;  5CPK B;  3W96 A;  3AFA A;  1ID3 A;  2VQR A;  2Y2P A;  1F66 A;  3LEL C;  3KXB C;  3A6N B;  3AZL B;  1P3O A;  1P3A D;  1F66 D;  5CPJ B;  4M6B A;  4X23 D;  5B32 D;  3V9R B;  3LZ1 B;  5AV8 D;  4H9S C;  3MNN B;  4DQY B;  1BH9 B;  1AOI C;  5GT3 C;  3W99 C;  5AV5 B;  2F8N G;  1S32 B;  2G5I C;  3LJA B;  1KX3 D;  5AV5 C;  2Y2I A;  2ZM5 A;  1HQ3 C;  3TU4 A;  3B0D B;  5B31 G;  1P3P B;  5DNM D;  1P3M A;  3REH D;  3REJ B;  1KX4 D;  3X1U A;  1M19 B;  2FJ7 D;  4WU8 D;  1TZY B;  3X1T B;  2F2A C;  3WAA C;  4QLC A;  5B0Z A;  5B31 B;  4J8V B;  1P3I B;  1KX5 A;  3WAA B;  1TAF A;  1ULY A;  5B0Y D;  4J8U D;  4KUD B;  2YFW B;  5B1M D;  3VH6 A;  4ZUX A;  4Z66 A;  1T3U A;  3AZJ A;  5B33 D;  4WU9 B;  3W98 A;  4H9Q B;  1B6W A;  3WTP A;  1P3I D;  4J8V D;  5FUG A;  1AOI D;  3NQU B;  4NE3 A;  5CPI C;  3X1T D;  3AZI D;  4ZUX C;  2FJ7 B;  1M19 D;  2ZY5 A;  1BFM A;  3MVD D;  3AZI B;  5JRG A;  1AOI B;  3EPJ A;  2W8S A;  1P3O C;  5B33 B;  5GSU A;  3MGQ A;  3VH6 W;  2Y2Q A;  3WA9 D;  5BT1 C;  4J8U B;  2XD5 A;  1H3O B;  4HGA B;  3MNN D;  3X1S A;  5B31 D;  1P3A C;  4NE6 A;  3X1T C;  5CPI D;  3VH6 T;  4R8P B;  5CPJ C;  4AWL B;  3REH B;  1KX4 B;  4J8X A;  2F8N K;  2RVQ C;  3REI A;  5JA4 A;  2ZY4 A;  1P3P D;  3AZJ C;  3LJA D;  3REK A;  4J8X C;  3REI C;  2HUE C;  3AV1 B;  4JJN B;  1WWI A;  5CP6 A;  3B6G D;  5KDM B;  4Z5T A;  3LZ1 D;  3C1C B;  4UUZ B;  3W96 C;  5DNN A;  5GT0 D;  1P3K C;  1ZLA D;  3MVD C;  1P3P A;  5DNN B;  5C3I B;  5GSU C;  3X1V C;  3MGQ C;  3UT9 B;  3A6N D;  3TU4 B;  3AZL D;  3B6F C;  3A1K A;  5DNN C;  1P3K A;  4E45 A;  3UTB D;  1M18 C;  5BT1 D;  3B6F A;  1BH9 A;  4CSR A;  5CPK C;  4LD9 D;  3MNN A;  5GT3 A;  3UTA C;  3AZM D;  2F8N B;  4R8P C;  4ZBJ C;  5B40 D;  3AZN B;  1PZR A;  4NE5 A;  2NQB B;  4ZBJ B;  3AZE C;  3WKJ B;  4H9Q A;  3WTP B;  4XZQ C;  3B0B A;  3AZH C; 
#chains in the Genus database with same CATH homology
 2BYK B;  1U35 D;  3LJA C;  3AZK B;  2HIO B;  5B32 C;  3AZH B;  4QLC C;  3W99 B;  3WAA A;  1P3I A;  5B0Z C;  1KX5 B;  5B33 A;  3AZF B;  3AZJ D;  1P3P C;  1P3B B;  1HQ3 B;  2ARO C;  2PYO A;  2IO5 C;  3AZM A;  3KWQ B;  1M18 D;  5B0Y A;  5AV6 B;  2NZD B;  3MGP D;  2PYO C;  4Z5T C;  5GXQ B;  3LEL D;  3C1B A;  3C1C A;  1P3K D;  5B1L A;  1P3F D;  4Z2M H;  5AY8 C;  5B1L B;  5AV9 B;  3UTA B;  1P3L D;  1M1A B;  5B24 D;  5B1L C;  3REK B;  3W97 C;  4EO5 C;  5BO0 A;  4LD9 A;  5AVC D;  5B24 B;  5AVB D;  3X1S C;  4R8P A;  3UT9 C;  3A6N A;  3AZL A;  3X1V B;  5AV9 D;  1P3O B;  1ID3 B;  3AZN A;  1P3L A;  3REJ A;  1P3F B;  5CPJ A;  5GT0 A;  1ZLA A;  3AYW A;  1P3F A;  3C1B D;  4CAY A;  3P5J B;  4NFT A;  5GT0 C;  4CAY B;  1ZLA C;  3W96 D;  3WA9 C;  2RIQ A;  5B2J C;  4YM6 B;  5BS7 A;  3LZ0 C;  1P3G B;  3WTP C;  2CV5 D;  1KU5 A;  1M1A C;  4AWL C;  4G91 C;  5B2I C;  4YS3 D;  5B1L D;  3AZH D;  2LY8 A;  4WU9 C;  3WKJ A;  5FUG B;  3MGR B;  4J8W C;  1EQZ C;  4KHA A;  4H9O B;  3LEL B;  5GXQ D;  3W97 B;  3WKJ C;  3MGP B;  3C1B C;  5GXQ A;  3NQJ A;  5B40 C;  1M18 A;  4JJN C;  3KWQ D;  1TAF B;  2IO5 B;  1JFI B;  3AZM B;  1P3L C;  3REL B;  1HQ3 A;  3TU4 C;  3AN2 B;  3AZF C;  5E5A C;  1M19 A;  1U35 A;  5AVC C;  5B0Z D;  2JSS A;  3UTB B;  3B6F D;  4Z2M G;  4WU8 A;  1A7W A;  3NQJ B;  5AV9 C;  3WTP D;  2CV5 C;  3AZH A;  3UT9 D;  3WKJ D;  3O62 A;  4J8X B;  3AYW D;  1Z2C B;  5DNM A;  5B2J D;  3AZN D;  4KGC C;  4Z5T D;  3LZ1 A;  3AV1 A;  3B0C T;  2Y2J A;  4XUJ B;  3X1S B;  2Y2H A;  3AZE B;  2FJ7 A;  3H0L C;  2BYM B;  3TU4 D;  3AFA C;  5DNN D;  5C3I C;  5GSU B;  4R8P D;  3MGQ B;  3WTP E;  5GT0 B;  1ZLA B;  3C1C D;  5CP6 D;  5E5A B;  5GXQ C;  5AVC A;  1P3G C;  1P34 A;  3B6G B;  1N1J A;  3LZ0 B;  4WV4 B;  5BNV A;  3AV1 D;  2Y2L A;  5B24 A;  3WA9 B;  3REI D;  4H9P A;  4WZS B;  3O62 D;  4XZQ A;  3UT9 A;  2FFF B;  3B0C W;  4H9N B;  4QLC B;  3LZ1 C;  3AFA D;  4KHA B;  4CSR B;  5CPI B;  3REK C;  1R4V A;  2Y2G A;  3AV2 D;  4WU8 C;  3MGS D;  3X1T A;  4UPK A;  2PYO D;  4WU9 D;  5DNM C;  4J8V A;  3WA9 A;  4J8U C;  3AZG B;  1JFI A;  3W98 D;  4YM6 A;  4H9P B;  4KUD D;  3KWQ A;  3REL A;  5B0Y B;  4KGC D;  2PYO B;  3WAA D;  5AVB C;  5JRG D;  4J8U A;  1P3M B;  5AV6 A;  2NZD C;  4HGA C;  3MVD B;  1TZY D;  3KWQ C;  5F99 C;  2CWE A;  4QLC D;  1AOI A;  3W99 A;  5B32 G;  3AZK A;  5JRG B;  1P3M D;  4XUJ C;  5B40 A;  3REI B;  4KGC B;  2BG1 A;  1KX3 B;  5B1M B;  3VH5 T;  5CHL B;  4E44 A;  3W98 B;  3AZG D;  3A1I A;  2NQB A;  4XUJ A;  4KUD C;  3MGP C;  4EO5 B;  3EPH A;  3AZE A;  3NQU A;  1BH8 A;  3MGS B;  5CPK A;  4X23 C;  2NQB C;  3AV2 B;  5B32 B;  4WU8 B;  3KFU G;  3AFA B;  4X23 B;  5CPJ D;  1F66 B;  2JE5 A;  3REJ D;  3F6T A;  3IP4 C;  5DNM B;  1P3A A;  5AV9 A;  3O62 B;  3REL C;  5B31 C;  5AVB A;  4YS3 C;  5AV6 C;  1S32 D;  2NZD A;  5AV5 D;  3R45 A;  2YFV A;  2Y2O A;  5B31 A;  3X1S D;  3LZ0 D;  4Z5T B;  2YFV B;  2RVQ D;  5E5A D;  3X1V A;  3UTB C;  5AV8 B;  5CP6 B;  4YM6 C;  3MGR C;  4J8W B;  5B2J B;  3W98 C;  2YFW A;  5CP6 C;  4J8X D;  5GSU D;  3MGQ D;  4J8W A;  1P3A B;  4H9O A;  3LEL A;  5CPI A;  3MGR A;  3EG5 B;  3VH5 W;  3MGP A;  5B0Z B;  3W97 A;  3H0M C;  3AZG C;  2BYK A;  5CPK D;  5BNX B;  1EQZ D;  4LD9 C;  3AZE D;  3AZK C;  1WWS A;  2JCH A;  3AN2 D;  1P34 C;  1P3G A;  4XUJ D;  2F8N H;  5B2I D;  2HUE B;  3AZF A;  4WNN B;  1P3B A;  1M19 C;  2F8N A;  5F99 D;  3REJ C;  3AYW B;  3B6G C;  2DQN C;  2Y2M A;  1BH8 B;  3REH C;  1P3I C;  1P3M C;  1KX4 C;  4G92 C;  4DRB A;  2G5H C;  3B6F B;  4DRA A;  2Y2K A;  1Q9C A;  1B67 A;  2ARO A;  4G92 B;  3A6N C;  3AZL C;  2HIO A;  5B1M A;  4Z66 D;  4KGC A;  2CV5 B;  3REL D;  4J8V C;  5GT3 D;  4YM6 D;  1M1A A;  2XD1 A;  1KX3 A;  2ARO D;  5B2I A;  4ZUX B;  2FJ7 C;  5B1M C;  5BO0 B;  4WU9 A;  5G49 A;  1ID3 C;  3W96 B;  4WJ3 C;  1HTA A;  1EQZ A;  3UTB A;  2DF4 C;  3C1B B;  3W97 D;  3X1U D;  5AV8 A;  3MNN C;  3AZI C;  3KXB A;  3KUY D;  3MGR D;  5F99 A;  3UTA A;  4H9R A;  5AY8 D;  4YS3 B;  4XZQ D;  3EPL A;  1P3O D;  1P3B C;  5AVB B;  3AN2 A;  1P3G D;  3B6G A;  5AVC B;  5E5A A;  3AZN C;  3LJA A;  3REK D;  5AV5 A;  4UUZ A;  4JJN A;  3AN2 C;  1S32 A;  5B32 A;  1P34 D;  3KXB B;  5KDM A;  4X23 A;  4XZQ B;  5AY8 B;  3KUY C;  1F1E A;  4WNN A;  2Y2N A;  3V9R A;  2BYM A;  3KUY B;  1KX3 C;  1W2E A;  1ID3 D;  3X1V D;  3KXB D;  3KUY A;  5BS7 C;  3LZ0 A;  1KX5 C;  3AV1 C;  1P34 B;  2NZD D;  3H0R C;  5BNV B;  3AV2 C;  2ARO B;  1N1J B;  2L5A A;  4Z66 C;  3C1C C;  5GT3 B;  3O62 C;  3VH5 A;  3AL0 C;  1M1A D;  5AY8 A;  4Z66 B;  1F66 C;  3UTA D;  3AZM C;  1P3L B;  5B2J A;  5B0Y C;  1TZY C;  2HIO D;  3MVD A;  3AZK D;  1P3K B;  3EPK A;  5JRG C;  3X1U B;  5AV8 C;  3AZI A;  5BNX A;  1TZY A;  5F99 B;  3AZG A;  5AV6 D;  2NQB D;  1M18 B;  4ZUX D;  2ZY3 A;  4H9R B;  2F8N D;  1HQ3 D;  1P3B D;  4KUD A;  4G91 B;  5B2I B;  3MGS C;  3AZJ B;  3AZF D;  1KX5 D;  4LD9 B;  3W99 D;  1EQZ B;  4H9N A;  3KSY A;  4H9S A;  3MGS A;  5G49 B;  1S32 C;  1U35 B;  2J8P A;  2ZY2 A;  5B24 C;  3REH A;  1KX4 A;  1U35 C;  5JA4 B;  2UWX A;  3AYW C;  4YS3 A;  4J8W D;  1P3F C;  5B40 B;  2HIO C;  3FDD A;  2CV5 A;  5B33 C;  3B0D C;  3X1U C;  3R45 B;  4JJN D;  3AV2 A;  1H3O A;  5CPK B;  3W96 A;  3AFA A;  1ID3 A;  2VQR A;  2Y2P A;  1F66 A;  3LEL C;  3KXB C;  3A6N B;  3AZL B;  1P3O A;  1P3A D;  1F66 D;  5CPJ B;  4M6B A;  4X23 D;  5B32 D;  3V9R B;  3LZ1 B;  5AV8 D;  4H9S C;  3MNN B;  4DQY B;  1BH9 B;  1AOI C;  5GT3 C;  3W99 C;  5AV5 B;  2F8N G;  1S32 B;  2G5I C;  3LJA B;  1KX3 D;  5AV5 C;  2Y2I A;  2ZM5 A;  1HQ3 C;  3TU4 A;  3B0D B;  5B31 G;  1P3P B;  5DNM D;  1P3M A;  3REH D;  3REJ B;  1KX4 D;  3X1U A;  1M19 B;  2FJ7 D;  4WU8 D;  1TZY B;  3X1T B;  2F2A C;  3WAA C;  4QLC A;  5B0Z A;  5B31 B;  4J8V B;  1P3I B;  1KX5 A;  3WAA B;  1TAF A;  1ULY A;  5B0Y D;  4J8U D;  4KUD B;  2YFW B;  5B1M D;  3VH6 A;  4ZUX A;  4Z66 A;  1T3U A;  3AZJ A;  5B33 D;  4WU9 B;  3W98 A;  4H9Q B;  1B6W A;  3WTP A;  1P3I D;  4J8V D;  5FUG A;  1AOI D;  3NQU B;  4NE3 A;  5CPI C;  3X1T D;  3AZI D;  4ZUX C;  2FJ7 B;  1M19 D;  2ZY5 A;  1BFM A;  3MVD D;  3AZI B;  5JRG A;  1AOI B;  3EPJ A;  2W8S A;  1P3O C;  5B33 B;  5GSU A;  3MGQ A;  3VH6 W;  2Y2Q A;  3WA9 D;  5BT1 C;  4J8U B;  2XD5 A;  1H3O B;  4HGA B;  3MNN D;  3X1S A;  5B31 D;  1P3A C;  4NE6 A;  3X1T C;  5CPI D;  3VH6 T;  4R8P B;  5CPJ C;  4AWL B;  3REH B;  1KX4 B;  4J8X A;  2F8N K;  2RVQ C;  3REI A;  5JA4 A;  2ZY4 A;  1P3P D;  3AZJ C;  3LJA D;  3REK A;  4J8X C;  3REI C;  2HUE C;  3AV1 B;  4JJN B;  1WWI A;  5CP6 A;  3B6G D;  5KDM B;  4Z5T A;  3LZ1 D;  3C1C B;  4UUZ B;  3W96 C;  5DNN A;  5GT0 D;  1P3K C;  1ZLA D;  3MVD C;  1P3P A;  5DNN B;  5C3I B;  5GSU C;  3X1V C;  3MGQ C;  3UT9 B;  3A6N D;  3TU4 B;  3AZL D;  3B6F C;  3A1K A;  5DNN C;  1P3K A;  4E45 A;  3UTB D;  1M18 C;  5BT1 D;  3B6F A;  1BH9 A;  4CSR A;  5CPK C;  4LD9 D;  3MNN A;  5GT3 A;  3UTA C;  3AZM D;  2F8N B;  4R8P C;  4ZBJ C;  5B40 D;  3AZN B;  1PZR A;  4NE5 A;  2NQB B;  4ZBJ B;  3AZE C;  3WKJ B;  4H9Q A;  3WTP B;  4XZQ C;  3B0B A;  3AZH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...