1KX4D

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4D00
3LJAA 4X23A 5B31G 1M19B 4H9RA 4H9NB 3AZGA 4EO5C 3REJA 1KX5C 5G49A 3UTBD 3AFAC 2CV5C 5AV8D 1N1JA 3X1VA 3AZNC 1TZYA 2FJ7A 3REIC 1KX5D 5BNXA 3AFAD 3MVDB 5B33C 3UT9A 5B2IC 2CV5D 5B1MB 4Z5TA 2YFVB 3A6ND 3AZND 5CPIB 4JJNB 3AV1B 3REID 5C3IC 1HTAA 5CP6B 4QLCC 5B33D 1U35B 5B2ID 4H9OB 5BO0A 3B6GC 4Z2MG 4H9PB 2YFWB 5GSUB 1M1AB 4KGCC 4QLCD 5BS7C 1H3OA 3VH6W 1P3LC 5B24A 5AVCA 4H9SC 3AYWB 1F66B 1ID3A 5AV9B 1BH9A 3VH5T 4ZUXB 3AN2C 3WA9D 5AV5C 5GT3C 1P3LD 3AZHA 3AZJC 2F8NB 2PYOC 3B6FB 4WNNB 5DNMA 3LZ1B 4CAYA 3WKJB 5B2JB 4YS3B 1P3BA 1F1EA 4XZQA 5CPKC 4J8UC 5AV5D 5GT3D 2PYOD 3AZEA 4KUDA 2HIOC 1HQ3D 4X23B 2FJ7D 1P3IB 3MGSC 3REJB 4J8XC 1P3AC 1P3FA 5KDMA 3AZIA 4J8VA 1KU5A 5CPKD 4G92C 4ZBJC 3AV2C 3LELC 2HIOD 4R8PC 5B40B 4J8WC 3UTAD 2LY8A 3MGSD 4J8XD 3LZ0B 5E5AC 3W96C 3X1UC 3MGPB 5CPJC 3UTBA 5GT0A 1P3MD 3AV2D 3KUYC 1KX4D 3X1SD 4R8PD 3LELD 1ULYA 4J8WD 4WU9C 5BNVB 1KX5A 5E5AD 3W96D 5CPJD 1P3GB 3AFAA 3KUYD 3AZKC 3WAAC 5BO0B 2CV5A 1BFMA 1R4VA 4YM6C 1S32B 4WU9D 3A6NA 3AZNA 4WU8C 3REIA 1M18C 5B32C 1AOIC 4XUJB 4H9QB 5AY8B 4WZSB 4HGAB 5B33A 3AZKD 5B2IA 3WAAD 3O62C 5B1LC 3KXBC 1P3OB 5AVCB 1M18D 5B32D 1P3BD 1AOID 5B32G 3RELC 3MGQC 1BH8B 3W97B 4QLCA 4LD9C 3VH6A 1KX3C 1EQZB 3O62D 5AVBC 3KXBD 3MGRC 3WTPC 5F99D 5B0YC 3MGQD 3TU4B 2NQBB 1P3PC 5GXQC 2F8NH 4LD9D 1KX3D 3B0DB 3WA9A 1P3LA 1M19C 3C1BB 2NZDB 5AVBD 3AZFB 3WTPD 1P3KD 5AV6D 5B0YD 1WWIA 5GT0D 1P3PD 5GXQD 3AZMB 3AN2A 4NE5A 5AV5A 5GT3A 2PYOA 3W99B 1M19D 5B31B 1HQ3A 4NE3A 3R45B 5FUGA 3X1TB 3MVDC 1JFIA 5B1MC 5CPKA 5B0ZB 5CPIC 3MNNB 4JJNC 5AV8B 2HIOA 3AV1C 1P3KC 3REHB 2AROB 2BYMA 3UTAA 3MGSA 5CP6C 1P3AA 4J8XA 1P34B 3MVDD 1U35C 5B1MD 1ZLAB 3V9RA 1P3MA 3AV2A 3NQJB 5CPID 4JJND 1KX4A 3X1SA 5DNNB 4R8PA 3LELA 3AV1D 5GSUC 3A6NB 4J8WA 1M1AC 5CP6D 3B0CW 1U35D 5E5AA 3W96A 3AZLB 5CPJA 4AWLB 3B6GD 3KUYA 5GSUD 1M1AD 3AYWC 3C1CC 4WU9A 1F66C 4Z66B 5AV9C 2IO5B 4ZUXC 4KGCD 3B6FC 3AZKA 3WAAA 3WTPE 3WKJC 5B2JC 4YS3C 3C1CD 5AV9D 5JRGB 3REKB 1M18A 5B32A 3KWQB 4CSRA 1AOIA 3W98B 3AN2D 3B6FD 2BYKA 3AZJD 1A7WA 4X23C 3LJAB 3WA9B 5BT1C 3O62A 1P3IC 3VH6T 5B1LA 3WKJD 5B2JD 4YS3D 4H9RB 3AZGB 3KXBA 5F99A 5G49B 3RELA 3MGQA 4J8UD 4LD9A 1KX3A 4E45A 4KHAA 5BT1D 5GT3B 5B40C 1N1JB 1P3ID 5JA4A 3X1VB 1TZYB 1HQ3B 2FJ7B 5AVBA 3LZ0C 1P3AD 3WTPA 1TAFA 5BNXB 3MGPC 5AV6A 1P3KA 5B0YA 1P3PA 5GXQA 3UT9B 5B40D 4NE6A 4Z5TB 1M19A 4H9NA 4UUZA 3LZ0D 3MGPD 3UTAB 3X1UD 4DRAA 1P3GC 4DRBA 1P3MB 1S32C 4E44A 1KX4B 3X1SB 4XUJC 1P3GD 5AY8C 4HGAC 3MVDA 5B1MA 1H3OB 1S32D 4YM6D 4JJNA 5CPIA 5B24B 3AV1A 1P3OC 4WU8D 5AVCC 1P3FD 1B67A 4XUJD 5CP6A 5AY8D 3W97C 1ID3B 1BH9B 1U35A 1EQZC 4Z2MH 3B6GA 3AZHB 2JSSA 5B1LD 4H9PA 2YFWA 5DNMB 1P3OD 5GSUA 4CAYB 1M1AA 3TU4C 2NQBC 3W97D 3RELD 2HUEB 5B32B 1P3BB 4KGCA 3B0DC 1EQZD 3NQUA 4XZQB 1WWSA 5BS7A 3C1BC 3AZEB 4KUDB 2NZDC 3AZFC 3MGRD 3C1CA 3AYWA 4H9SA 3TU4D 2NQBD 5AV9A 1P3FB 5KDMB 5F99B 3AZMC 3AZIB 4J8VB 3W99C 2F8NA 3C1BD 3B6FA 4WNNA 5B31C 3AZJA 4G91B 2NZDD 3X1TC 3AZFD 3WKJA 5B2JA 4YS3A 1P3KB 5AV6B 3UTBB 5GT0B 5B0ZC 3W99D 4J8UA 3MNNC 2F8NK 5B31D 5AV8C 3X1TD 3REHC 2AROC 1P3IA 4UUZB 3KSYA 4EO5B 1P34C 1KX5B 1ZLAC 5B0ZD 3AFAB 3MNND 2CV5B 5DNNC 5B40A 3REHD 2AROD 2RVQC 3A6NC 3AZNB 1P34D 3LZ0A 3REIB 3AZLC 3MGPA 4AWLC 1ZLAD 3X1UA 5B33B 5DNND 5B2IB 2RVQD 4Z66C 2IO5C 5BNVA 3AZLD 3VH5W 5C3IB 1P3GA 4QLCB 3B6GB 3LZ1C 1S32A 4YM6A 4Z66D 3AYWD 1F66D 5JRGC 4WU8A 3REKC 3KWQC 3W98C 4XUJA 4ZUXD 4H9QA 3B0CT 5AY8A 4KGCB 2F8ND 3NQUB 3LJAC 3WA9C 2F8NG 3LZ1D 1P3LB 3AZGC 1P3OA 5JRGD 3REJC 3REKD 3C1CB 3KWQD 3W98D 1BH8A 2CWEA 3W97A 4M6BA 3LJAD 1EQZA 3AN2B 1B6WA 4X23D 5AV5B 2PYOB 3X1VC 3AZJB 1TZYC 1HQ3C 2FJ7C 3AZGD 3REJD 5FUGB 3MGRA 4WV4B 3TU4A 2NQBA 3UT9C 1JFIB 5CPKB 4J8UB 4Z5TC 3C1BA 3X1VD 1TZYD 2NZDA 2L5AA 2HIOB 3AZFA 3UTAC 2BYMB 3MGSB 1P3AB 4J8XB 3AZMA 3UT9D 1P3MC 3V9RB 3W99A 4G92B 4ZBJB 4Z5TD 1KX4C 3AV2B 3X1SC 5B31A 3LELB 3R45A 4R8PB 3X1TA 4J8WB 4NFTA 5E5AB 3X1UB 3W96B 5CPJB 5B0ZA 3MNNA 3KUYB 2YFVA 5AV8A 5B24C 3REHA 2AROA 3B0BA 5CHLB 4WU9B 1P34A 1ID3C 1ZLAA 4H9OA 3AZHC 3NQJA 3AZKB 3WAAB 5DNNA 5B24D 5DNMC 1Q9CA 5AVCD 4YM6B 3VH5A 4WU8B 1ID3D 2HUEC 3AZLA 1P3BC 1M18B 1AOIB 4CSRB 4XZQC 3AZEC 3AZHD 2BYKB 4KUDC 5DNMD 3O62B 5B1LB 4Z66A 1F66A 1P3FC 5F99C 3KXBB 3AZIC 4J8VC 4ZUXA 4XZQD 3RELB 3MGQB 3AZED 4KUDD 4LD9B 4G91C 1KX3B 4KHAB 3LZ1A 5JA4B 5JRGA 5AVBB 3REKA 5AV6C 3MGRB 3AZID 3WTPB 1TAFB 3KWQA 4J8VD 3UTBC 5GT0C 5B0YB 3AZMD 3W98A 1P3PB 5GXQB
chains in the Genus database with same CATH superfamily
3LJAA 4X23A 5B31G 1M19B 4H9RA 4H9NB 3AZGA 4EO5C 3REJA 1KX5C 5G49A 3UTBD 3AFAC 2CV5C 5AV8D 1N1JA 3X1VA 3AZNC 1TZYA 2FJ7A 3REIC 1KX5D 5BNXA 3AFAD 3MVDB 5B33C 3UT9A 5B2IC 2CV5D 5B1MB 4Z5TA 2YFVB 3A6ND 3AZND 5CPIB 4JJNB 3AV1B 3REID 2W8SA 5C3IC 1HTAA 5CP6B 4QLCC 5B33D 1U35B 5B2ID 4H9OB 5BO0A 3B6GC 3A1IA 4Z2MG 4H9PB 2YFWB 5GSUB 1M1AB 2XD1A 4KGCC 4QLCD 2Y2KA 5BS7C 1H3OA 3VH6W 1P3LC 2Y2QA 5B24A 5AVCA 4H9SC 3AYWB 1F66B 1ID3A 5AV9B 1BH9A 3VH5T 4ZUXB 3AN2C 3WA9D 5AV5C 5GT3C 1P3LD 3AZHA 3AZJC 2F8NB 2PYOC 3B6FB 4WNNB 5DNMA 3LZ1B 4CAYA 3WKJB 5B2JB 4YS3B 3EPJA 1P3BA 1F1EA 4XZQA 5CPKC 4J8UC 5AV5D 5GT3D 2PYOD 3AZEA 4KUDA 2HIOC 1HQ3D 4X23B 2FJ7D 1P3IB 3MGSC 3REJB 4J8XC 1P3AC 1P3FA 5KDMA 3AZIA 4J8VA 1KU5A 5CPKD 4G92C 4ZBJC 3AV2C 3LELC 2HIOD 4R8PC 5B40B 4J8WC 3UTAD 2LY8A 3MGSD 4J8XD 3LZ0B 5E5AC 3W96C 3X1UC 3MGPB 5CPJC 3UTBA 5GT0A 1P3MD 3AV2D 3KUYC 1KX4D 3H0MC 3X1SD 4R8PD 3LELD 1ULYA 4J8WD 4WU9C 3A1KA 5BNVB 1KX5A 5E5AD 3W96D 5CPJD 2Y2PA 3H0LC 1P3GB 3AFAA 3KUYD 3AZKC 3WAAC 5BO0B 2CV5A 1BFMA 1R4VA 4YM6C 1S32B 4WU9D 3A6NA 3AZNA 4WU8C 3REIA 1M18C 5B32C 1AOIC 4XUJB 4H9QB 5AY8B 2VQRA 4WZSB 4HGAB 5B33A 3AZKD 5B2IA 3WAAD 3O62C 5B1LC 3KXBC 1P3OB 5AVCB 4WJ3C 1M18D 5B32D 1P3BD 1AOID 5B32G 3RELC 3MGQC 1BH8B 3W97B 4QLCA 4LD9C 3VH6A 1KX3C 1EQZB 3O62D 2Y2LA 5AVBC 3KXBD 3MGRC 3WTPC 5F99D 5B0YC 2ZY4A 3EPLA 3MGQD 3TU4B 2NQBB 1P3PC 5GXQC 2F8NH 3IP4C 1KX3D 4LD9D 3B0DB 3F6TA 3WA9A 1P3LA 1M19C 3C1BB 2NZDB 5AVBD 3AZFB 3WTPD 1P3KD 5AV6D 5B0YD 1WWIA 5GT0D 1P3PD 5GXQD 3AZMB 3AN2A 4NE5A 5AV5A 5GT3A 2PYOA 3W99B 2Y2MA 1M19D 5B31B 2FFFB 1HQ3A 4NE3A 3R45B 5FUGA 3X1TB 3MVDC 1JFIA 5B1MC 2Y2IA 5CPKA 5B0ZB 5CPIC 3MNNB 4JJNC 5AV8B 2HIOA 3AV1C 1P3KC 3REHB 2AROB 2BYMA 3UTAA 3MGSA 5CP6C 1P3AA 4J8XA 1P34B 3MVDD 1U35C 5B1MD 2Y2JA 1ZLAB 3V9RA 1P3MA 3AV2A 3NQJB 5CPID 4JJND 1KX4A 3X1SA 5DNNB 4R8PA 2Y2HA 3LELA 3AV1D 5GSUC 3KFUG 2XD5A 3A6NB 4J8WA 1M1AC 2ZY2A 5CP6D 3B0CW 2ZY3A 5E5AA 3W96A 3AZLB 1U35D 5CPJA 4AWLB 3B6GD 3KUYA 5GSUD 1M1AD 3AYWC 3C1CC 4WU9A 1F66C 4Z66B 5AV9C 2IO5B 2DQNC 4ZUXC 4KGCD 3P5JB 2DF4C 3B6FC 3AZKA 3WAAA 3WTPE 2F2AC 2JE5A 3WKJC 5B2JC 4YS3C 3C1CD 3FDDA 5AV9D 5JRGB 3REKB 1M18A 5B32A 3KWQB 4CSRA 1AOIA 3W98B 3AN2D 3B6FD 2BYKA 3AZJD 1A7WA 4X23C 3LJAB 3WA9B 5BT1C 3O62A 1P3IC 3VH6T 5B1LA 3WKJD 5B2JD 4YS3D 4H9RB 3AZGB 3KXBA 5F99A 5G49B 3RELA 3MGQA 4J8UD 4LD9A 1KX3A 4E45A 4KHAA 5BT1D 5GT3B 5B40C 1N1JB 1P3ID 5JA4A 3EPKA 1TZYB 1HQ3B 2ZM5A 3X1VB 2FJ7B 3EG5B 5AVBA 3LZ0C 1P3AD 3WTPA 1TAFA 5BNXB 3MGPC 5AV6A 1P3KA 2ZY5A 5B0YA 1P3PA 5GXQA 3UT9B 5B40D 4NE6A 4Z5TB 1M19A 4H9NA 4UUZA 3LZ0D 3MGPD 3UTAB 3X1UD 4DRAA 1P3GC 4DRBA 2G5IC 1P3MB 1S32C 4E44A 1KX4B 3X1SB 4XUJC 1P3GD 5AY8C 4HGAC 3MVDA 5B1MA 1H3OB 1S32D 4YM6D 4JJNA 5CPIA 1W2EA 5B24B 3AV1A 1P3OC 4WU8D 5AVCC 1P3FD 1B67A 4XUJD 5CP6A 5AY8D 3W97C 1ID3B 1BH9B 1U35A 1EQZC 4Z2MH 3B6GA 3AL0C 2RIQA 3AZHB 2JSSA 5B1LD 4H9PA 2YFWA 5DNMB 1P3OD 5GSUA 4CAYB 1M1AA 3TU4C 2NQBC 3W97D 3RELD 2HUEB 5B32B 1P3BB 4KGCA 3B0DC 1EQZD 3NQUA 4XZQB 1WWSA 5BS7A 3C1BC 3AZEB 4KUDB 2NZDC 3AZFC 3MGRD 3C1CA 3AYWA 4H9SA 3TU4D 2NQBD 5AV9A 1P3FB 5KDMB 5F99B 3AZMC 3AZIB 4J8VB 2G5HC 4UPKA 3W99C 2F8NA 3C1BD 3B6FA 4WNNA 5B31C 3AZJA 4G91B 2NZDD 3X1TC 3AZFD 3WKJA 5B2JA 4YS3A 1P3KB 5AV6B 3UTBB 5GT0B 2J8PA 5B0ZC 3W99D 4J8UA 3MNNC 2F8NK 5B31D 5AV8C 3X1TD 3REHC 2AROC 3H0RC 1P3IA 4UUZB 3KSYA 4EO5B 1P34C 1KX5B 1ZLAC 5B0ZD 3AFAB 3MNND 2CV5B 5DNNC 5B40A 3REHD 2AROD 2RVQC 3A6NC 3AZNB 1P34D 3LZ0A 3REIB 3AZLC 3MGPA 4AWLC 1ZLAD 3X1UA 5B33B 5DNND 5B2IB 2RVQD 4Z66C 2IO5C 5BNVA 3AZLD 3VH5W 5C3IB 1P3GA 4QLCB 3B6GB 3LZ1C 1S32A 4YM6A 4Z66D 3AYWD 1F66D 2BG1A 5JRGC 4WU8A 3REKC 3KWQC 3W98C 4XUJA 4ZUXD 4H9QA 3B0CT 5AY8A 4KGCB 2F8ND 3NQUB 3LJAC 3WA9C 2F8NG 3LZ1D 1P3LB 3AZGC 1P3OA 5JRGD 3REJC 3REKD 3C1CB 3KWQD 3W98D 3EPHA 1BH8A 2CWEA 3W97A 4M6BA 3LJAD 1EQZA 3AN2B 1B6WA 4X23D 5AV5B 2PYOB 3X1VC 3AZJB 1TZYC 1HQ3C 2FJ7C 3AZGD 3REJD 5FUGB 3MGRA 4WV4B 3TU4A 2NQBA 3UT9C 1JFIB 5CPKB 4J8UB 4Z5TC 3C1BA 3X1VD 1TZYD 2NZDA 2L5AA 2HIOB 3AZFA 3UTAC 2BYMB 3MGSB 1P3AB 4J8XB 3AZMA 3UT9D 1P3MC 3V9RB 3W99A 4G92B 4ZBJB 4Z5TD 1KX4C 3AV2B 3X1SC 5B31A 1Z2CB 3LELB 3R45A 4R8PB 3X1TA 4J8WB 4NFTA 5E5AB 3X1UB 3W96B 1PZRA 5CPJB 5B0ZA 1T3UA 2Y2NA 3MNNA 3KUYB 2YFVA 5AV8A 5B24C 3REHA 2AROA 3B0BA 5CHLB 4WU9B 2Y2OA 1P34A 1ID3C 1ZLAA 4H9OA 3AZHC 3NQJA 3AZKB 3WAAB 5DNNA 5B24D 5DNMC 1Q9CA 5AVCD 4YM6B 3VH5A 4WU8B 1ID3D 2HUEC 3AZLA 1P3BC 1M18B 1AOIB 4CSRB 4XZQC 3AZEC 2JCHA 3AZHD 2BYKB 4KUDC 5DNMD 3O62B 5B1LB 4Z66A 1F66A 1P3FC 5F99C 3KXBB 3AZIC 4J8VC 4ZUXA 4DQYB 2Y2GA 4XZQD 3RELB 3MGQB 3AZED 4KUDD 4LD9B 4G91C 1KX3B 4KHAB 3LZ1A 2UWXA 5JA4B 5JRGA 5AVBB 3REKA 5AV6C 3MGRB 3AZID 3WTPB 1TAFB 3KWQA 4J8VD 3UTBC 5GT0C 5B0YB 3AZMD 3W98A 1P3PB 5GXQB
chains in the Genus database with same CATH topology
3LJAA 4X23A 5B31G 1M19B 4H9RA 4H9NB 3AZGA 4EO5C 3REJA 1KX5C 5G49A 3UTBD 3AFAC 2CV5C 5AV8D 1N1JA 3X1VA 3AZNC 1TZYA 2FJ7A 3REIC 1KX5D 5BNXA 3AFAD 3MVDB 5B33C 3UT9A 5B2IC 2CV5D 5B1MB 4Z5TA 2YFVB 3A6ND 3AZND 5CPIB 4JJNB 3AV1B 3REID 2W8SA 5C3IC 1HTAA 5CP6B 4QLCC 5B33D 1U35B 5B2ID 4H9OB 5BO0A 3B6GC 3A1IA 4Z2MG 4H9PB 2YFWB 5GSUB 1M1AB 2XD1A 4KGCC 4QLCD 2Y2KA 5BS7C 1H3OA 3VH6W 1P3LC 2Y2QA 5B24A 5AVCA 4H9SC 3AYWB 1F66B 1ID3A 5AV9B 1BH9A 3VH5T 4ZUXB 3AN2C 3WA9D 5AV5C 5GT3C 1P3LD 3AZHA 3AZJC 2F8NB 2PYOC 3B6FB 4WNNB 5DNMA 3LZ1B 4CAYA 3WKJB 5B2JB 4YS3B 3EPJA 1P3BA 1F1EA 4XZQA 5CPKC 4J8UC 5AV5D 5GT3D 2PYOD 3AZEA 4KUDA 2HIOC 1HQ3D 4X23B 2FJ7D 1P3IB 3MGSC 3REJB 4J8XC 1P3AC 1P3FA 5KDMA 3AZIA 4J8VA 1KU5A 5CPKD 4G92C 4ZBJC 3AV2C 3LELC 2HIOD 4R8PC 5B40B 4J8WC 3UTAD 2LY8A 3MGSD 4J8XD 3LZ0B 5E5AC 3W96C 3X1UC 3MGPB 5CPJC 3UTBA 5GT0A 1P3MD 3AV2D 3KUYC 1KX4D 3H0MC 3X1SD 4R8PD 3LELD 1ULYA 4J8WD 4WU9C 3A1KA 5BNVB 1KX5A 5E5AD 3W96D 5CPJD 2Y2PA 3H0LC 1P3GB 3AFAA 3KUYD 3AZKC 3WAAC 5BO0B 2CV5A 1BFMA 1R4VA 4YM6C 1S32B 4WU9D 3A6NA 3AZNA 4WU8C 3REIA 1M18C 5B32C 1AOIC 4XUJB 4H9QB 5AY8B 2VQRA 4WZSB 4HGAB 5B33A 3AZKD 5B2IA 3WAAD 3O62C 5B1LC 3KXBC 1P3OB 5AVCB 4WJ3C 1M18D 5B32D 1P3BD 1AOID 5B32G 3RELC 3MGQC 1BH8B 3W97B 4QLCA 4LD9C 3VH6A 1KX3C 1EQZB 3O62D 2Y2LA 5AVBC 3KXBD 3MGRC 3WTPC 5F99D 5B0YC 2ZY4A 3EPLA 3MGQD 3TU4B 2NQBB 1P3PC 5GXQC 2F8NH 3IP4C 1KX3D 4LD9D 3B0DB 3F6TA 3WA9A 1P3LA 1M19C 3C1BB 2NZDB 5AVBD 3AZFB 3WTPD 1P3KD 5AV6D 5B0YD 1WWIA 5GT0D 1P3PD 5GXQD 3AZMB 3AN2A 4NE5A 5AV5A 5GT3A 2PYOA 3W99B 2Y2MA 1M19D 5B31B 2FFFB 1HQ3A 4NE3A 3R45B 5FUGA 3X1TB 3MVDC 1JFIA 5B1MC 2Y2IA 5CPKA 5B0ZB 5CPIC 3MNNB 4JJNC 5AV8B 2HIOA 3AV1C 1P3KC 3REHB 2AROB 2BYMA 3UTAA 3MGSA 5CP6C 1P3AA 4J8XA 1P34B 3MVDD 1U35C 5B1MD 2Y2JA 1ZLAB 3V9RA 1P3MA 3AV2A 3NQJB 5CPID 4JJND 1KX4A 3X1SA 5DNNB 4R8PA 2Y2HA 3LELA 3AV1D 5GSUC 3KFUG 2XD5A 3A6NB 4J8WA 1M1AC 2ZY2A 5CP6D 3B0CW 2ZY3A 5E5AA 3W96A 3AZLB 1U35D 5CPJA 4AWLB 3B6GD 3KUYA 5GSUD 1M1AD 3AYWC 3C1CC 4WU9A 1F66C 4Z66B 5AV9C 2IO5B 2DQNC 4ZUXC 4KGCD 3P5JB 2DF4C 3B6FC 3AZKA 3WAAA 3WTPE 2F2AC 2JE5A 3WKJC 5B2JC 4YS3C 3C1CD 3FDDA 5AV9D 5JRGB 3REKB 1M18A 5B32A 3KWQB 4CSRA 1AOIA 3W98B 3AN2D 3B6FD 2BYKA 3AZJD 1A7WA 4X23C 3LJAB 3WA9B 5BT1C 3O62A 1P3IC 3VH6T 5B1LA 3WKJD 5B2JD 4YS3D 4H9RB 3AZGB 3KXBA 5F99A 5G49B 3RELA 3MGQA 4J8UD 4LD9A 1KX3A 4E45A 4KHAA 5BT1D 5GT3B 5B40C 1N1JB 1P3ID 5JA4A 3EPKA 1TZYB 1HQ3B 2ZM5A 3X1VB 2FJ7B 3EG5B 5AVBA 3LZ0C 1P3AD 3WTPA 1TAFA 5BNXB 3MGPC 5AV6A 1P3KA 2ZY5A 5B0YA 1P3PA 5GXQA 3UT9B 5B40D 4NE6A 4Z5TB 1M19A 4H9NA 4UUZA 3LZ0D 3MGPD 3UTAB 3X1UD 4DRAA 1P3GC 4DRBA 2G5IC 1P3MB 1S32C 4E44A 1KX4B 3X1SB 4XUJC 1P3GD 5AY8C 4HGAC 3MVDA 5B1MA 1H3OB 1S32D 4YM6D 4JJNA 5CPIA 1W2EA 5B24B 3AV1A 1P3OC 4WU8D 5AVCC 1P3FD 1B67A 4XUJD 5CP6A 5AY8D 3W97C 1ID3B 1BH9B 1U35A 1EQZC 4Z2MH 3B6GA 3AL0C 2RIQA 3AZHB 2JSSA 5B1LD 4H9PA 2YFWA 5DNMB 1P3OD 5GSUA 4CAYB 1M1AA 3TU4C 2NQBC 3W97D 3RELD 2HUEB 5B32B 1P3BB 4KGCA 3B0DC 1EQZD 3NQUA 4XZQB 1WWSA 5BS7A 3C1BC 3AZEB 4KUDB 2NZDC 3AZFC 3MGRD 3C1CA 3AYWA 4H9SA 3TU4D 2NQBD 5AV9A 1P3FB 5KDMB 5F99B 3AZMC 3AZIB 4J8VB 2G5HC 4UPKA 3W99C 2F8NA 3C1BD 3B6FA 4WNNA 5B31C 3AZJA 4G91B 2NZDD 3X1TC 3AZFD 3WKJA 5B2JA 4YS3A 1P3KB 5AV6B 3UTBB 5GT0B 2J8PA 5B0ZC 3W99D 4J8UA 3MNNC 2F8NK 5B31D 5AV8C 3X1TD 3REHC 2AROC 3H0RC 1P3IA 4UUZB 3KSYA 4EO5B 1P34C 1KX5B 1ZLAC 5B0ZD 3AFAB 3MNND 2CV5B 5DNNC 5B40A 3REHD 2AROD 2RVQC 3A6NC 3AZNB 1P34D 3LZ0A 3REIB 3AZLC 3MGPA 4AWLC 1ZLAD 3X1UA 5B33B 5DNND 5B2IB 2RVQD 4Z66C 2IO5C 5BNVA 3AZLD 3VH5W 5C3IB 1P3GA 4QLCB 3B6GB 3LZ1C 1S32A 4YM6A 4Z66D 3AYWD 1F66D 2BG1A 5JRGC 4WU8A 3REKC 3KWQC 3W98C 4XUJA 4ZUXD 4H9QA 3B0CT 5AY8A 4KGCB 2F8ND 3NQUB 3LJAC 3WA9C 2F8NG 3LZ1D 1P3LB 3AZGC 1P3OA 5JRGD 3REJC 3REKD 3C1CB 3KWQD 3W98D 3EPHA 1BH8A 2CWEA 3W97A 4M6BA 3LJAD 1EQZA 3AN2B 1B6WA 4X23D 5AV5B 2PYOB 3X1VC 3AZJB 1TZYC 1HQ3C 2FJ7C 3AZGD 3REJD 5FUGB 3MGRA 4WV4B 3TU4A 2NQBA 3UT9C 1JFIB 5CPKB 4J8UB 4Z5TC 3C1BA 3X1VD 1TZYD 2NZDA 2L5AA 2HIOB 3AZFA 3UTAC 2BYMB 3MGSB 1P3AB 4J8XB 3AZMA 3UT9D 1P3MC 3V9RB 3W99A 4G92B 4ZBJB 4Z5TD 1KX4C 3AV2B 3X1SC 5B31A 1Z2CB 3LELB 3R45A 4R8PB 3X1TA 4J8WB 4NFTA 5E5AB 3X1UB 3W96B 1PZRA 5CPJB 5B0ZA 1T3UA 2Y2NA 3MNNA 3KUYB 2YFVA 5AV8A 5B24C 3REHA 2AROA 3B0BA 5CHLB 4WU9B 2Y2OA 1P34A 1ID3C 1ZLAA 4H9OA 3AZHC 3NQJA 3AZKB 3WAAB 5DNNA 5B24D 5DNMC 1Q9CA 5AVCD 4YM6B 3VH5A 4WU8B 1ID3D 2HUEC 3AZLA 1P3BC 1M18B 1AOIB 4CSRB 4XZQC 3AZEC 2JCHA 3AZHD 2BYKB 4KUDC 5DNMD 3O62B 5B1LB 4Z66A 1F66A 1P3FC 5F99C 3KXBB 3AZIC 4J8VC 4ZUXA 4DQYB 2Y2GA 4XZQD 3RELB 3MGQB 3AZED 4KUDD 4LD9B 4G91C 1KX3B 4KHAB 3LZ1A 2UWXA 5JA4B 5JRGA 5AVBB 3REKA 5AV6C 3MGRB 3AZID 3WTPB 1TAFB 3KWQA 4J8VD 3UTBC 5GT0C 5B0YB 3AZMD 3W98A 1P3PB 5GXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA A;  4X23 A;  5B31 G;  1M19 B;  4H9R A;  4H9N B;  3AZG A;  4EO5 C;  3REJ A;  1KX5 C;  5G49 A;  3UTB D;  3AFA C;  2CV5 C;  5AV8 D;  1N1J A;  3X1V A;  3AZN C;  1TZY A;  2FJ7 A;  3REI C;  1KX5 D;  5BNX A;  3AFA D;  3MVD B;  5B33 C;  3UT9 A;  5B2I C;  2CV5 D;  5B1M B;  4Z5T A;  2YFV B;  3A6N D;  3AZN D;  5CPI B;  4JJN B;  3AV1 B;  3REI D;  5C3I C;  1HTA A;  5CP6 B;  4QLC C;  5B33 D;  1U35 B;  5B2I D;  4H9O B;  5BO0 A;  3B6G C;  4Z2M G;  4H9P B;  2YFW B;  5GSU B;  1M1A B;  4KGC C;  4QLC D;  5BS7 C;  1H3O A;  3VH6 W;  1P3L C;  5B24 A;  5AVC A;  4H9S C;  3AYW B;  1F66 B;  1ID3 A;  5AV9 B;  1BH9 A;  3VH5 T;  4ZUX B;  3AN2 C;  3WA9 D;  5AV5 C;  5GT3 C;  1P3L D;  3AZH A;  3AZJ C;  2F8N B;  2PYO C;  3B6F B;  4WNN B;  5DNM A;  3LZ1 B;  4CAY A;  3WKJ B;  5B2J B;  4YS3 B;  1P3B A;  1F1E A;  4XZQ A;  5CPK C;  4J8U C;  5AV5 D;  5GT3 D;  2PYO D;  3AZE A;  4KUD A;  2HIO C;  1HQ3 D;  4X23 B;  2FJ7 D;  1P3I B;  3MGS C;  3REJ B;  4J8X C;  1P3A C;  1P3F A;  5KDM A;  3AZI A;  4J8V A;  1KU5 A;  5CPK D;  4G92 C;  4ZBJ C;  3AV2 C;  3LEL C;  2HIO D;  4R8P C;  5B40 B;  4J8W C;  3UTA D;  2LY8 A;  3MGS D;  4J8X D;  3LZ0 B;  5E5A C;  3W96 C;  3X1U C;  3MGP B;  5CPJ C;  3UTB A;  5GT0 A;  1P3M D;  3AV2 D;  3KUY C;  1KX4 D;  3X1S D;  4R8P D;  3LEL D;  1ULY A;  4J8W D;  4WU9 C;  5BNV B;  1KX5 A;  5E5A D;  3W96 D;  5CPJ D;  1P3G B;  3AFA A;  3KUY D;  3AZK C;  3WAA C;  5BO0 B;  2CV5 A;  1BFM A;  1R4V A;  4YM6 C;  1S32 B;  4WU9 D;  3A6N A;  3AZN A;  4WU8 C;  3REI A;  1M18 C;  5B32 C;  1AOI C;  4XUJ B;  4H9Q B;  5AY8 B;  4WZS B;  4HGA B;  5B33 A;  3AZK D;  5B2I A;  3WAA D;  3O62 C;  5B1L C;  3KXB C;  1P3O B;  5AVC B;  1M18 D;  5B32 D;  1P3B D;  1AOI D;  5B32 G;  3REL C;  3MGQ C;  1BH8 B;  3W97 B;  4QLC A;  4LD9 C;  3VH6 A;  1KX3 C;  1EQZ B;  3O62 D;  5AVB C;  3KXB D;  3MGR C;  3WTP C;  5F99 D;  5B0Y C;  3MGQ D;  3TU4 B;  2NQB B;  1P3P C;  5GXQ C;  2F8N H;  4LD9 D;  1KX3 D;  3B0D B;  3WA9 A;  1P3L A;  1M19 C;  3C1B B;  2NZD B;  5AVB D;  3AZF B;  3WTP D;  1P3K D;  5AV6 D;  5B0Y D;  1WWI A;  5GT0 D;  1P3P D;  5GXQ D;  3AZM B;  3AN2 A;  4NE5 A;  5AV5 A;  5GT3 A;  2PYO A;  3W99 B;  1M19 D;  5B31 B;  1HQ3 A;  4NE3 A;  3R45 B;  5FUG A;  3X1T B;  3MVD C;  1JFI A;  5B1M C;  5CPK A;  5B0Z B;  5CPI C;  3MNN B;  4JJN C;  5AV8 B;  2HIO A;  3AV1 C;  1P3K C;  3REH B;  2ARO B;  2BYM A;  3UTA A;  3MGS A;  5CP6 C;  1P3A A;  4J8X A;  1P34 B;  3MVD D;  1U35 C;  5B1M D;  1ZLA B;  3V9R A;  1P3M A;  3AV2 A;  3NQJ B;  5CPI D;  4JJN D;  1KX4 A;  3X1S A;  5DNN B;  4R8P A;  3LEL A;  3AV1 D;  5GSU C;  3A6N B;  4J8W A;  1M1A C;  5CP6 D;  3B0C W;  1U35 D;  5E5A A;  3W96 A;  3AZL B;  5CPJ A;  4AWL B;  3B6G D;  3KUY A;  5GSU D;  1M1A D;  3AYW C;  3C1C C;  4WU9 A;  1F66 C;  4Z66 B;  5AV9 C;  2IO5 B;  4ZUX C;  4KGC D;  3B6F C;  3AZK A;  3WAA A;  3WTP E;  3WKJ C;  5B2J C;  4YS3 C;  3C1C D;  5AV9 D;  5JRG B;  3REK B;  1M18 A;  5B32 A;  3KWQ B;  4CSR A;  1AOI A;  3W98 B;  3AN2 D;  3B6F D;  2BYK A;  3AZJ D;  1A7W A;  4X23 C;  3LJA B;  3WA9 B;  5BT1 C;  3O62 A;  1P3I C;  3VH6 T;  5B1L A;  3WKJ D;  5B2J D;  4YS3 D;  4H9R B;  3AZG B;  3KXB A;  5F99 A;  5G49 B;  3REL A;  3MGQ A;  4J8U D;  4LD9 A;  1KX3 A;  4E45 A;  4KHA A;  5BT1 D;  5GT3 B;  5B40 C;  1N1J B;  1P3I D;  5JA4 A;  3X1V B;  1TZY B;  1HQ3 B;  2FJ7 B;  5AVB A;  3LZ0 C;  1P3A D;  3WTP A;  1TAF A;  5BNX B;  3MGP C;  5AV6 A;  1P3K A;  5B0Y A;  1P3P A;  5GXQ A;  3UT9 B;  5B40 D;  4NE6 A;  4Z5T B;  1M19 A;  4H9N A;  4UUZ A;  3LZ0 D;  3MGP D;  3UTA B;  3X1U D;  4DRA A;  1P3G C;  4DRB A;  1P3M B;  1S32 C;  4E44 A;  1KX4 B;  3X1S B;  4XUJ C;  1P3G D;  5AY8 C;  4HGA C;  3MVD A;  5B1M A;  1H3O B;  1S32 D;  4YM6 D;  4JJN A;  5CPI A;  5B24 B;  3AV1 A;  1P3O C;  4WU8 D;  5AVC C;  1P3F D;  1B67 A;  4XUJ D;  5CP6 A;  5AY8 D;  3W97 C;  1ID3 B;  1BH9 B;  1U35 A;  1EQZ C;  4Z2M H;  3B6G A;  3AZH B;  2JSS A;  5B1L D;  4H9P A;  2YFW A;  5DNM B;  1P3O D;  5GSU A;  4CAY B;  1M1A A;  3TU4 C;  2NQB C;  3W97 D;  3REL D;  2HUE B;  5B32 B;  1P3B B;  4KGC A;  3B0D C;  1EQZ D;  3NQU A;  4XZQ B;  1WWS A;  5BS7 A;  3C1B C;  3AZE B;  4KUD B;  2NZD C;  3AZF C;  3MGR D;  3C1C A;  3AYW A;  4H9S A;  3TU4 D;  2NQB D;  5AV9 A;  1P3F B;  5KDM B;  5F99 B;  3AZM C;  3AZI B;  4J8V B;  3W99 C;  2F8N A;  3C1B D;  3B6F A;  4WNN A;  5B31 C;  3AZJ A;  4G91 B;  2NZD D;  3X1T C;  3AZF D;  3WKJ A;  5B2J A;  4YS3 A;  1P3K B;  5AV6 B;  3UTB B;  5GT0 B;  5B0Z C;  3W99 D;  4J8U A;  3MNN C;  2F8N K;  5B31 D;  5AV8 C;  3X1T D;  3REH C;  2ARO C;  1P3I A;  4UUZ B;  3KSY A;  4EO5 B;  1P34 C;  1KX5 B;  1ZLA C;  5B0Z D;  3AFA B;  3MNN D;  2CV5 B;  5DNN C;  5B40 A;  3REH D;  2ARO D;  2RVQ C;  3A6N C;  3AZN B;  1P34 D;  3LZ0 A;  3REI B;  3AZL C;  3MGP A;  4AWL C;  1ZLA D;  3X1U A;  5B33 B;  5DNN D;  5B2I B;  2RVQ D;  4Z66 C;  2IO5 C;  5BNV A;  3AZL D;  3VH5 W;  5C3I B;  1P3G A;  4QLC B;  3B6G B;  3LZ1 C;  1S32 A;  4YM6 A;  4Z66 D;  3AYW D;  1F66 D;  5JRG C;  4WU8 A;  3REK C;  3KWQ C;  3W98 C;  4XUJ A;  4ZUX D;  4H9Q A;  3B0C T;  5AY8 A;  4KGC B;  2F8N D;  3NQU B;  3LJA C;  3WA9 C;  2F8N G;  3LZ1 D;  1P3L B;  3AZG C;  1P3O A;  5JRG D;  3REJ C;  3REK D;  3C1C B;  3KWQ D;  3W98 D;  1BH8 A;  2CWE A;  3W97 A;  4M6B A;  3LJA D;  1EQZ A;  3AN2 B;  1B6W A;  4X23 D;  5AV5 B;  2PYO B;  3X1V C;  3AZJ B;  1TZY C;  1HQ3 C;  2FJ7 C;  3AZG D;  3REJ D;  5FUG B;  3MGR A;  4WV4 B;  3TU4 A;  2NQB A;  3UT9 C;  1JFI B;  5CPK B;  4J8U B;  4Z5T C;  3C1B A;  3X1V D;  1TZY D;  2NZD A;  2L5A A;  2HIO B;  3AZF A;  3UTA C;  2BYM B;  3MGS B;  1P3A B;  4J8X B;  3AZM A;  3UT9 D;  1P3M C;  3V9R B;  3W99 A;  4G92 B;  4ZBJ B;  4Z5T D;  1KX4 C;  3AV2 B;  3X1S C;  5B31 A;  3LEL B;  3R45 A;  4R8P B;  3X1T A;  4J8W B;  4NFT A;  5E5A B;  3X1U B;  3W96 B;  5CPJ B;  5B0Z A;  3MNN A;  3KUY B;  2YFV A;  5AV8 A;  5B24 C;  3REH A;  2ARO A;  3B0B A;  5CHL B;  4WU9 B;  1P34 A;  1ID3 C;  1ZLA A;  4H9O A;  3AZH C;  3NQJ A;  3AZK B;  3WAA B;  5DNN A;  5B24 D;  5DNM C;  1Q9C A;  5AVC D;  4YM6 B;  3VH5 A;  4WU8 B;  1ID3 D;  2HUE C;  3AZL A;  1P3B C;  1M18 B;  1AOI B;  4CSR B;  4XZQ C;  3AZE C;  3AZH D;  2BYK B;  4KUD C;  5DNM D;  3O62 B;  5B1L B;  4Z66 A;  1F66 A;  1P3F C;  5F99 C;  3KXB B;  3AZI C;  4J8V C;  4ZUX A;  4XZQ D;  3REL B;  3MGQ B;  3AZE D;  4KUD D;  4LD9 B;  4G91 C;  1KX3 B;  4KHA B;  3LZ1 A;  5JA4 B;  5JRG A;  5AVB B;  3REK A;  5AV6 C;  3MGR B;  3AZI D;  3WTP B;  1TAF B;  3KWQ A;  4J8V D;  3UTB C;  5GT0 C;  5B0Y B;  3AZM D;  3W98 A;  1P3P B;  5GXQ B; 
#chains in the Genus database with same CATH topology
 3LJA A;  4X23 A;  5B31 G;  1M19 B;  4H9R A;  4H9N B;  3AZG A;  4EO5 C;  3REJ A;  1KX5 C;  5G49 A;  3UTB D;  3AFA C;  2CV5 C;  5AV8 D;  1N1J A;  3X1V A;  3AZN C;  1TZY A;  2FJ7 A;  3REI C;  1KX5 D;  5BNX A;  3AFA D;  3MVD B;  5B33 C;  3UT9 A;  5B2I C;  2CV5 D;  5B1M B;  4Z5T A;  2YFV B;  3A6N D;  3AZN D;  5CPI B;  4JJN B;  3AV1 B;  3REI D;  2W8S A;  5C3I C;  1HTA A;  5CP6 B;  4QLC C;  5B33 D;  1U35 B;  5B2I D;  4H9O B;  5BO0 A;  3B6G C;  3A1I A;  4Z2M G;  4H9P B;  2YFW B;  5GSU B;  1M1A B;  2XD1 A;  4KGC C;  4QLC D;  2Y2K A;  5BS7 C;  1H3O A;  3VH6 W;  1P3L C;  2Y2Q A;  5B24 A;  5AVC A;  4H9S C;  3AYW B;  1F66 B;  1ID3 A;  5AV9 B;  1BH9 A;  3VH5 T;  4ZUX B;  3AN2 C;  3WA9 D;  5AV5 C;  5GT3 C;  1P3L D;  3AZH A;  3AZJ C;  2F8N B;  2PYO C;  3B6F B;  4WNN B;  5DNM A;  3LZ1 B;  4CAY A;  3WKJ B;  5B2J B;  4YS3 B;  3EPJ A;  1P3B A;  1F1E A;  4XZQ A;  5CPK C;  4J8U C;  5AV5 D;  5GT3 D;  2PYO D;  3AZE A;  4KUD A;  2HIO C;  1HQ3 D;  4X23 B;  2FJ7 D;  1P3I B;  3MGS C;  3REJ B;  4J8X C;  1P3A C;  1P3F A;  5KDM A;  3AZI A;  4J8V A;  1KU5 A;  5CPK D;  4G92 C;  4ZBJ C;  3AV2 C;  3LEL C;  2HIO D;  4R8P C;  5B40 B;  4J8W C;  3UTA D;  2LY8 A;  3MGS D;  4J8X D;  3LZ0 B;  5E5A C;  3W96 C;  3X1U C;  3MGP B;  5CPJ C;  3UTB A;  5GT0 A;  1P3M D;  3AV2 D;  3KUY C;  1KX4 D;  3H0M C;  3X1S D;  4R8P D;  3LEL D;  1ULY A;  4J8W D;  4WU9 C;  3A1K A;  5BNV B;  1KX5 A;  5E5A D;  3W96 D;  5CPJ D;  2Y2P A;  3H0L C;  1P3G B;  3AFA A;  3KUY D;  3AZK C;  3WAA C;  5BO0 B;  2CV5 A;  1BFM A;  1R4V A;  4YM6 C;  1S32 B;  4WU9 D;  3A6N A;  3AZN A;  4WU8 C;  3REI A;  1M18 C;  5B32 C;  1AOI C;  4XUJ B;  4H9Q B;  5AY8 B;  2VQR A;  4WZS B;  4HGA B;  5B33 A;  3AZK D;  5B2I A;  3WAA D;  3O62 C;  5B1L C;  3KXB C;  1P3O B;  5AVC B;  4WJ3 C;  1M18 D;  5B32 D;  1P3B D;  1AOI D;  5B32 G;  3REL C;  3MGQ C;  1BH8 B;  3W97 B;  4QLC A;  4LD9 C;  3VH6 A;  1KX3 C;  1EQZ B;  3O62 D;  2Y2L A;  5AVB C;  3KXB D;  3MGR C;  3WTP C;  5F99 D;  5B0Y C;  2ZY4 A;  3EPL A;  3MGQ D;  3TU4 B;  2NQB B;  1P3P C;  5GXQ C;  2F8N H;  3IP4 C;  1KX3 D;  4LD9 D;  3B0D B;  3F6T A;  3WA9 A;  1P3L A;  1M19 C;  3C1B B;  2NZD B;  5AVB D;  3AZF B;  3WTP D;  1P3K D;  5AV6 D;  5B0Y D;  1WWI A;  5GT0 D;  1P3P D;  5GXQ D;  3AZM B;  3AN2 A;  4NE5 A;  5AV5 A;  5GT3 A;  2PYO A;  3W99 B;  2Y2M A;  1M19 D;  5B31 B;  2FFF B;  1HQ3 A;  4NE3 A;  3R45 B;  5FUG A;  3X1T B;  3MVD C;  1JFI A;  5B1M C;  2Y2I A;  5CPK A;  5B0Z B;  5CPI C;  3MNN B;  4JJN C;  5AV8 B;  2HIO A;  3AV1 C;  1P3K C;  3REH B;  2ARO B;  2BYM A;  3UTA A;  3MGS A;  5CP6 C;  1P3A A;  4J8X A;  1P34 B;  3MVD D;  1U35 C;  5B1M D;  2Y2J A;  1ZLA B;  3V9R A;  1P3M A;  3AV2 A;  3NQJ B;  5CPI D;  4JJN D;  1KX4 A;  3X1S A;  5DNN B;  4R8P A;  2Y2H A;  3LEL A;  3AV1 D;  5GSU C;  3KFU G;  2XD5 A;  3A6N B;  4J8W A;  1M1A C;  2ZY2 A;  5CP6 D;  3B0C W;  2ZY3 A;  5E5A A;  3W96 A;  3AZL B;  1U35 D;  5CPJ A;  4AWL B;  3B6G D;  3KUY A;  5GSU D;  1M1A D;  3AYW C;  3C1C C;  4WU9 A;  1F66 C;  4Z66 B;  5AV9 C;  2IO5 B;  2DQN C;  4ZUX C;  4KGC D;  3P5J B;  2DF4 C;  3B6F C;  3AZK A;  3WAA A;  3WTP E;  2F2A C;  2JE5 A;  3WKJ C;  5B2J C;  4YS3 C;  3C1C D;  3FDD A;  5AV9 D;  5JRG B;  3REK B;  1M18 A;  5B32 A;  3KWQ B;  4CSR A;  1AOI A;  3W98 B;  3AN2 D;  3B6F D;  2BYK A;  3AZJ D;  1A7W A;  4X23 C;  3LJA B;  3WA9 B;  5BT1 C;  3O62 A;  1P3I C;  3VH6 T;  5B1L A;  3WKJ D;  5B2J D;  4YS3 D;  4H9R B;  3AZG B;  3KXB A;  5F99 A;  5G49 B;  3REL A;  3MGQ A;  4J8U D;  4LD9 A;  1KX3 A;  4E45 A;  4KHA A;  5BT1 D;  5GT3 B;  5B40 C;  1N1J B;  1P3I D;  5JA4 A;  3EPK A;  1TZY B;  1HQ3 B;  2ZM5 A;  3X1V B;  2FJ7 B;  3EG5 B;  5AVB A;  3LZ0 C;  1P3A D;  3WTP A;  1TAF A;  5BNX B;  3MGP C;  5AV6 A;  1P3K A;  2ZY5 A;  5B0Y A;  1P3P A;  5GXQ A;  3UT9 B;  5B40 D;  4NE6 A;  4Z5T B;  1M19 A;  4H9N A;  4UUZ A;  3LZ0 D;  3MGP D;  3UTA B;  3X1U D;  4DRA A;  1P3G C;  4DRB A;  2G5I C;  1P3M B;  1S32 C;  4E44 A;  1KX4 B;  3X1S B;  4XUJ C;  1P3G D;  5AY8 C;  4HGA C;  3MVD A;  5B1M A;  1H3O B;  1S32 D;  4YM6 D;  4JJN A;  5CPI A;  1W2E A;  5B24 B;  3AV1 A;  1P3O C;  4WU8 D;  5AVC C;  1P3F D;  1B67 A;  4XUJ D;  5CP6 A;  5AY8 D;  3W97 C;  1ID3 B;  1BH9 B;  1U35 A;  1EQZ C;  4Z2M H;  3B6G A;  3AL0 C;  2RIQ A;  3AZH B;  2JSS A;  5B1L D;  4H9P A;  2YFW A;  5DNM B;  1P3O D;  5GSU A;  4CAY B;  1M1A A;  3TU4 C;  2NQB C;  3W97 D;  3REL D;  2HUE B;  5B32 B;  1P3B B;  4KGC A;  3B0D C;  1EQZ D;  3NQU A;  4XZQ B;  1WWS A;  5BS7 A;  3C1B C;  3AZE B;  4KUD B;  2NZD C;  3AZF C;  3MGR D;  3C1C A;  3AYW A;  4H9S A;  3TU4 D;  2NQB D;  5AV9 A;  1P3F B;  5KDM B;  5F99 B;  3AZM C;  3AZI B;  4J8V B;  2G5H C;  4UPK A;  3W99 C;  2F8N A;  3C1B D;  3B6F A;  4WNN A;  5B31 C;  3AZJ A;  4G91 B;  2NZD D;  3X1T C;  3AZF D;  3WKJ A;  5B2J A;  4YS3 A;  1P3K B;  5AV6 B;  3UTB B;  5GT0 B;  2J8P A;  5B0Z C;  3W99 D;  4J8U A;  3MNN C;  2F8N K;  5B31 D;  5AV8 C;  3X1T D;  3REH C;  2ARO C;  3H0R C;  1P3I A;  4UUZ B;  3KSY A;  4EO5 B;  1P34 C;  1KX5 B;  1ZLA C;  5B0Z D;  3AFA B;  3MNN D;  2CV5 B;  5DNN C;  5B40 A;  3REH D;  2ARO D;  2RVQ C;  3A6N C;  3AZN B;  1P34 D;  3LZ0 A;  3REI B;  3AZL C;  3MGP A;  4AWL C;  1ZLA D;  3X1U A;  5B33 B;  5DNN D;  5B2I B;  2RVQ D;  4Z66 C;  2IO5 C;  5BNV A;  3AZL D;  3VH5 W;  5C3I B;  1P3G A;  4QLC B;  3B6G B;  3LZ1 C;  1S32 A;  4YM6 A;  4Z66 D;  3AYW D;  1F66 D;  2BG1 A;  5JRG C;  4WU8 A;  3REK C;  3KWQ C;  3W98 C;  4XUJ A;  4ZUX D;  4H9Q A;  3B0C T;  5AY8 A;  4KGC B;  2F8N D;  3NQU B;  3LJA C;  3WA9 C;  2F8N G;  3LZ1 D;  1P3L B;  3AZG C;  1P3O A;  5JRG D;  3REJ C;  3REK D;  3C1C B;  3KWQ D;  3W98 D;  3EPH A;  1BH8 A;  2CWE A;  3W97 A;  4M6B A;  3LJA D;  1EQZ A;  3AN2 B;  1B6W A;  4X23 D;  5AV5 B;  2PYO B;  3X1V C;  3AZJ B;  1TZY C;  1HQ3 C;  2FJ7 C;  3AZG D;  3REJ D;  5FUG B;  3MGR A;  4WV4 B;  3TU4 A;  2NQB A;  3UT9 C;  1JFI B;  5CPK B;  4J8U B;  4Z5T C;  3C1B A;  3X1V D;  1TZY D;  2NZD A;  2L5A A;  2HIO B;  3AZF A;  3UTA C;  2BYM B;  3MGS B;  1P3A B;  4J8X B;  3AZM A;  3UT9 D;  1P3M C;  3V9R B;  3W99 A;  4G92 B;  4ZBJ B;  4Z5T D;  1KX4 C;  3AV2 B;  3X1S C;  5B31 A;  1Z2C B;  3LEL B;  3R45 A;  4R8P B;  3X1T A;  4J8W B;  4NFT A;  5E5A B;  3X1U B;  3W96 B;  1PZR A;  5CPJ B;  5B0Z A;  1T3U A;  2Y2N A;  3MNN A;  3KUY B;  2YFV A;  5AV8 A;  5B24 C;  3REH A;  2ARO A;  3B0B A;  5CHL B;  4WU9 B;  2Y2O A;  1P34 A;  1ID3 C;  1ZLA A;  4H9O A;  3AZH C;  3NQJ A;  3AZK B;  3WAA B;  5DNN A;  5B24 D;  5DNM C;  1Q9C A;  5AVC D;  4YM6 B;  3VH5 A;  4WU8 B;  1ID3 D;  2HUE C;  3AZL A;  1P3B C;  1M18 B;  1AOI B;  4CSR B;  4XZQ C;  3AZE C;  2JCH A;  3AZH D;  2BYK B;  4KUD C;  5DNM D;  3O62 B;  5B1L B;  4Z66 A;  1F66 A;  1P3F C;  5F99 C;  3KXB B;  3AZI C;  4J8V C;  4ZUX A;  4DQY B;  2Y2G A;  4XZQ D;  3REL B;  3MGQ B;  3AZE D;  4KUD D;  4LD9 B;  4G91 C;  1KX3 B;  4KHA B;  3LZ1 A;  2UWX A;  5JA4 B;  5JRG A;  5AVB B;  3REK A;  5AV6 C;  3MGR B;  3AZI D;  3WTP B;  1TAF B;  3KWQ A;  4J8V D;  3UTB C;  5GT0 C;  5B0Y B;  3AZM D;  3W98 A;  1P3P B;  5GXQ B; 
#chains in the Genus database with same CATH homology
 3LJA A;  4X23 A;  5B31 G;  1M19 B;  4H9R A;  4H9N B;  3AZG A;  4EO5 C;  3REJ A;  1KX5 C;  5G49 A;  3UTB D;  3AFA C;  2CV5 C;  5AV8 D;  1N1J A;  3X1V A;  3AZN C;  1TZY A;  2FJ7 A;  3REI C;  1KX5 D;  5BNX A;  3AFA D;  3MVD B;  5B33 C;  3UT9 A;  5B2I C;  2CV5 D;  5B1M B;  4Z5T A;  2YFV B;  3A6N D;  3AZN D;  5CPI B;  4JJN B;  3AV1 B;  3REI D;  2W8S A;  5C3I C;  1HTA A;  5CP6 B;  4QLC C;  5B33 D;  1U35 B;  5B2I D;  4H9O B;  5BO0 A;  3B6G C;  3A1I A;  4Z2M G;  4H9P B;  2YFW B;  5GSU B;  1M1A B;  2XD1 A;  4KGC C;  4QLC D;  2Y2K A;  5BS7 C;  1H3O A;  3VH6 W;  1P3L C;  2Y2Q A;  5B24 A;  5AVC A;  4H9S C;  3AYW B;  1F66 B;  1ID3 A;  5AV9 B;  1BH9 A;  3VH5 T;  4ZUX B;  3AN2 C;  3WA9 D;  5AV5 C;  5GT3 C;  1P3L D;  3AZH A;  3AZJ C;  2F8N B;  2PYO C;  3B6F B;  4WNN B;  5DNM A;  3LZ1 B;  4CAY A;  3WKJ B;  5B2J B;  4YS3 B;  3EPJ A;  1P3B A;  1F1E A;  4XZQ A;  5CPK C;  4J8U C;  5AV5 D;  5GT3 D;  2PYO D;  3AZE A;  4KUD A;  2HIO C;  1HQ3 D;  4X23 B;  2FJ7 D;  1P3I B;  3MGS C;  3REJ B;  4J8X C;  1P3A C;  1P3F A;  5KDM A;  3AZI A;  4J8V A;  1KU5 A;  5CPK D;  4G92 C;  4ZBJ C;  3AV2 C;  3LEL C;  2HIO D;  4R8P C;  5B40 B;  4J8W C;  3UTA D;  2LY8 A;  3MGS D;  4J8X D;  3LZ0 B;  5E5A C;  3W96 C;  3X1U C;  3MGP B;  5CPJ C;  3UTB A;  5GT0 A;  1P3M D;  3AV2 D;  3KUY C;  1KX4 D;  3H0M C;  3X1S D;  4R8P D;  3LEL D;  1ULY A;  4J8W D;  4WU9 C;  3A1K A;  5BNV B;  1KX5 A;  5E5A D;  3W96 D;  5CPJ D;  2Y2P A;  3H0L C;  1P3G B;  3AFA A;  3KUY D;  3AZK C;  3WAA C;  5BO0 B;  2CV5 A;  1BFM A;  1R4V A;  4YM6 C;  1S32 B;  4WU9 D;  3A6N A;  3AZN A;  4WU8 C;  3REI A;  1M18 C;  5B32 C;  1AOI C;  4XUJ B;  4H9Q B;  5AY8 B;  2VQR A;  4WZS B;  4HGA B;  5B33 A;  3AZK D;  5B2I A;  3WAA D;  3O62 C;  5B1L C;  3KXB C;  1P3O B;  5AVC B;  4WJ3 C;  1M18 D;  5B32 D;  1P3B D;  1AOI D;  5B32 G;  3REL C;  3MGQ C;  1BH8 B;  3W97 B;  4QLC A;  4LD9 C;  3VH6 A;  1KX3 C;  1EQZ B;  3O62 D;  2Y2L A;  5AVB C;  3KXB D;  3MGR C;  3WTP C;  5F99 D;  5B0Y C;  2ZY4 A;  3EPL A;  3MGQ D;  3TU4 B;  2NQB B;  1P3P C;  5GXQ C;  2F8N H;  3IP4 C;  1KX3 D;  4LD9 D;  3B0D B;  3F6T A;  3WA9 A;  1P3L A;  1M19 C;  3C1B B;  2NZD B;  5AVB D;  3AZF B;  3WTP D;  1P3K D;  5AV6 D;  5B0Y D;  1WWI A;  5GT0 D;  1P3P D;  5GXQ D;  3AZM B;  3AN2 A;  4NE5 A;  5AV5 A;  5GT3 A;  2PYO A;  3W99 B;  2Y2M A;  1M19 D;  5B31 B;  2FFF B;  1HQ3 A;  4NE3 A;  3R45 B;  5FUG A;  3X1T B;  3MVD C;  1JFI A;  5B1M C;  2Y2I A;  5CPK A;  5B0Z B;  5CPI C;  3MNN B;  4JJN C;  5AV8 B;  2HIO A;  3AV1 C;  1P3K C;  3REH B;  2ARO B;  2BYM A;  3UTA A;  3MGS A;  5CP6 C;  1P3A A;  4J8X A;  1P34 B;  3MVD D;  1U35 C;  5B1M D;  2Y2J A;  1ZLA B;  3V9R A;  1P3M A;  3AV2 A;  3NQJ B;  5CPI D;  4JJN D;  1KX4 A;  3X1S A;  5DNN B;  4R8P A;  2Y2H A;  3LEL A;  3AV1 D;  5GSU C;  3KFU G;  2XD5 A;  3A6N B;  4J8W A;  1M1A C;  2ZY2 A;  5CP6 D;  3B0C W;  2ZY3 A;  5E5A A;  3W96 A;  3AZL B;  1U35 D;  5CPJ A;  4AWL B;  3B6G D;  3KUY A;  5GSU D;  1M1A D;  3AYW C;  3C1C C;  4WU9 A;  1F66 C;  4Z66 B;  5AV9 C;  2IO5 B;  2DQN C;  4ZUX C;  4KGC D;  3P5J B;  2DF4 C;  3B6F C;  3AZK A;  3WAA A;  3WTP E;  2F2A C;  2JE5 A;  3WKJ C;  5B2J C;  4YS3 C;  3C1C D;  3FDD A;  5AV9 D;  5JRG B;  3REK B;  1M18 A;  5B32 A;  3KWQ B;  4CSR A;  1AOI A;  3W98 B;  3AN2 D;  3B6F D;  2BYK A;  3AZJ D;  1A7W A;  4X23 C;  3LJA B;  3WA9 B;  5BT1 C;  3O62 A;  1P3I C;  3VH6 T;  5B1L A;  3WKJ D;  5B2J D;  4YS3 D;  4H9R B;  3AZG B;  3KXB A;  5F99 A;  5G49 B;  3REL A;  3MGQ A;  4J8U D;  4LD9 A;  1KX3 A;  4E45 A;  4KHA A;  5BT1 D;  5GT3 B;  5B40 C;  1N1J B;  1P3I D;  5JA4 A;  3EPK A;  1TZY B;  1HQ3 B;  2ZM5 A;  3X1V B;  2FJ7 B;  3EG5 B;  5AVB A;  3LZ0 C;  1P3A D;  3WTP A;  1TAF A;  5BNX B;  3MGP C;  5AV6 A;  1P3K A;  2ZY5 A;  5B0Y A;  1P3P A;  5GXQ A;  3UT9 B;  5B40 D;  4NE6 A;  4Z5T B;  1M19 A;  4H9N A;  4UUZ A;  3LZ0 D;  3MGP D;  3UTA B;  3X1U D;  4DRA A;  1P3G C;  4DRB A;  2G5I C;  1P3M B;  1S32 C;  4E44 A;  1KX4 B;  3X1S B;  4XUJ C;  1P3G D;  5AY8 C;  4HGA C;  3MVD A;  5B1M A;  1H3O B;  1S32 D;  4YM6 D;  4JJN A;  5CPI A;  1W2E A;  5B24 B;  3AV1 A;  1P3O C;  4WU8 D;  5AVC C;  1P3F D;  1B67 A;  4XUJ D;  5CP6 A;  5AY8 D;  3W97 C;  1ID3 B;  1BH9 B;  1U35 A;  1EQZ C;  4Z2M H;  3B6G A;  3AL0 C;  2RIQ A;  3AZH B;  2JSS A;  5B1L D;  4H9P A;  2YFW A;  5DNM B;  1P3O D;  5GSU A;  4CAY B;  1M1A A;  3TU4 C;  2NQB C;  3W97 D;  3REL D;  2HUE B;  5B32 B;  1P3B B;  4KGC A;  3B0D C;  1EQZ D;  3NQU A;  4XZQ B;  1WWS A;  5BS7 A;  3C1B C;  3AZE B;  4KUD B;  2NZD C;  3AZF C;  3MGR D;  3C1C A;  3AYW A;  4H9S A;  3TU4 D;  2NQB D;  5AV9 A;  1P3F B;  5KDM B;  5F99 B;  3AZM C;  3AZI B;  4J8V B;  2G5H C;  4UPK A;  3W99 C;  2F8N A;  3C1B D;  3B6F A;  4WNN A;  5B31 C;  3AZJ A;  4G91 B;  2NZD D;  3X1T C;  3AZF D;  3WKJ A;  5B2J A;  4YS3 A;  1P3K B;  5AV6 B;  3UTB B;  5GT0 B;  2J8P A;  5B0Z C;  3W99 D;  4J8U A;  3MNN C;  2F8N K;  5B31 D;  5AV8 C;  3X1T D;  3REH C;  2ARO C;  3H0R C;  1P3I A;  4UUZ B;  3KSY A;  4EO5 B;  1P34 C;  1KX5 B;  1ZLA C;  5B0Z D;  3AFA B;  3MNN D;  2CV5 B;  5DNN C;  5B40 A;  3REH D;  2ARO D;  2RVQ C;  3A6N C;  3AZN B;  1P34 D;  3LZ0 A;  3REI B;  3AZL C;  3MGP A;  4AWL C;  1ZLA D;  3X1U A;  5B33 B;  5DNN D;  5B2I B;  2RVQ D;  4Z66 C;  2IO5 C;  5BNV A;  3AZL D;  3VH5 W;  5C3I B;  1P3G A;  4QLC B;  3B6G B;  3LZ1 C;  1S32 A;  4YM6 A;  4Z66 D;  3AYW D;  1F66 D;  2BG1 A;  5JRG C;  4WU8 A;  3REK C;  3KWQ C;  3W98 C;  4XUJ A;  4ZUX D;  4H9Q A;  3B0C T;  5AY8 A;  4KGC B;  2F8N D;  3NQU B;  3LJA C;  3WA9 C;  2F8N G;  3LZ1 D;  1P3L B;  3AZG C;  1P3O A;  5JRG D;  3REJ C;  3REK D;  3C1C B;  3KWQ D;  3W98 D;  3EPH A;  1BH8 A;  2CWE A;  3W97 A;  4M6B A;  3LJA D;  1EQZ A;  3AN2 B;  1B6W A;  4X23 D;  5AV5 B;  2PYO B;  3X1V C;  3AZJ B;  1TZY C;  1HQ3 C;  2FJ7 C;  3AZG D;  3REJ D;  5FUG B;  3MGR A;  4WV4 B;  3TU4 A;  2NQB A;  3UT9 C;  1JFI B;  5CPK B;  4J8U B;  4Z5T C;  3C1B A;  3X1V D;  1TZY D;  2NZD A;  2L5A A;  2HIO B;  3AZF A;  3UTA C;  2BYM B;  3MGS B;  1P3A B;  4J8X B;  3AZM A;  3UT9 D;  1P3M C;  3V9R B;  3W99 A;  4G92 B;  4ZBJ B;  4Z5T D;  1KX4 C;  3AV2 B;  3X1S C;  5B31 A;  1Z2C B;  3LEL B;  3R45 A;  4R8P B;  3X1T A;  4J8W B;  4NFT A;  5E5A B;  3X1U B;  3W96 B;  1PZR A;  5CPJ B;  5B0Z A;  1T3U A;  2Y2N A;  3MNN A;  3KUY B;  2YFV A;  5AV8 A;  5B24 C;  3REH A;  2ARO A;  3B0B A;  5CHL B;  4WU9 B;  2Y2O A;  1P34 A;  1ID3 C;  1ZLA A;  4H9O A;  3AZH C;  3NQJ A;  3AZK B;  3WAA B;  5DNN A;  5B24 D;  5DNM C;  1Q9C A;  5AVC D;  4YM6 B;  3VH5 A;  4WU8 B;  1ID3 D;  2HUE C;  3AZL A;  1P3B C;  1M18 B;  1AOI B;  4CSR B;  4XZQ C;  3AZE C;  2JCH A;  3AZH D;  2BYK B;  4KUD C;  5DNM D;  3O62 B;  5B1L B;  4Z66 A;  1F66 A;  1P3F C;  5F99 C;  3KXB B;  3AZI C;  4J8V C;  4ZUX A;  4DQY B;  2Y2G A;  4XZQ D;  3REL B;  3MGQ B;  3AZE D;  4KUD D;  4LD9 B;  4G91 C;  1KX3 B;  4KHA B;  3LZ1 A;  2UWX A;  5JA4 B;  5JRG A;  5AVB B;  3REK A;  5AV6 C;  3MGR B;  3AZI D;  3WTP B;  1TAF B;  3KWQ A;  4J8V D;  3UTB C;  5GT0 C;  5B0Y B;  3AZM D;  3W98 A;  1P3P B;  5GXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...