1KX4D

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4D00
3MNND 4J8UD 3X1SC 3UTAB 4J8XA 5JA4B 3W98B 2PYOC 4H9NA 4YM6D 5F99B 3LJAD 3AV2B 1U35D 5BT1C 3V9RA 3UT9D 3AZIA 1P3IC 2CV5A 1P3BA 5GT3B 3MGPC 3VH5T 4Z66D 3AZMA 4KHAB 2JSSA 4KUDD 4XZQD 3LZ0B 3REKC 3WKJD 1S32D 5B2IC 4LD9D 3O62B 1M1AA 1ULYA 4H9PA 5GT0B 3MVDC 2YFVA 3WTPB 3A6NC 5B40A 2NQBB 4Z5TC 5BNVB 3VH6W 1KX4C 4HGAB 5B0YB 3MGRA 5B24B 1EQZB 4E45A 3KWQB 1M18B 1P3LB 1ZLAB 3WA9C 5GXQC 1P3OA 3B0DB 3C1BA 5AVBA 5B32B 3AZMD 1P3KB 3X1VB 4DRBA 4H9RB 5C3IC 3W96C 2AROB 3AFAA 1BH8A 3AZHA 1P34D 4XUJB 1M1AD 4H9SC 5AVCA 1R4VA 3AZGC 3W99C 4X23A 1P3AB 3AZLA 3MGRD 3AZJD 5B0ZB 1KU5A 1BFMA 1TAFB 3REIC 2PYOA 1N1JB 3B6FB 5CP6B 3REHA 1P3IA 5FUGB 4JJNB 1KX3A 5B31B 5E5AC 3AZKD 3AFAD 5CPKD 3TU4A 5BNXA 4ZUXA 1F66D 2NZDB 1P3MB 5AVCD 3B6GA 5AV8D 3AN2B 5G49A 3UTBB 4X23D 1KX5C 1AOIA 4KGCD 3NQUB 3B0CT 3MVDA 3A6NA 5B1LC 3LZ1C 5AV6C 5CPJB 4Z5TA 3AZNB 1KX4A 1HQ3D 4WU9D 3REHD 4CAYA 4G92B 3MGSA 4M6BA 1KX3D 4WV4B 1ID3D 5B1MA 5GXQA 5AV9C 4ZUXD 3TU4D 4R8PA 1TZYB 2F8NG 5AV5D 3B6GD 5DNMC 3KUYA 3AZEC 3MGQC 3MNNB 4J8UB 3W96A 3X1UA 1AOID 4YS3D 3LELA 4NE6A 4YM6B 3AZGA 3A6ND 3UTAC 3LJAB 1U35B 3W99A 4WZSB 3UT9B 3W98C 5B2JA 1P3GA 2YFWB 5F99C 3AV2C 4WNNA 3MGSD 5B1MD 4Z66B 4R8PD 5GT3C 3AZFD 5CPID 3KUYD 3REJA 4XZQB 4KUDB 4WU8D 3WKJB 1H3OA 4LD9B 2FJ7A 3KXBD 3X1UD 3X1TD 3LZ0C 3O62C 3LELD 3VH6T 4J8VA 3AZGD 5B33D 2RVQC 5GT0C 3WTPC 2BYMB 5B2JD 1P3GD 1M19D 2NQBC 4G91B 4HGAC 5B0YC 5B24C 1EQZC 3WAAA 3AV1A 3NQJA 1WWSA 5B1LA 5AV6A 3LZ1A 4QLCD 3KWQC 1M18C 1P3LC 1ZLAC 3AZMB 3R45A 5GSUA 5DNNA 3REJD 3B0DC 1P34B 5B32C 1P3KC 1M1AB 3X1VC 1B6WA 2F8ND 2FJ7D 4UUZB 3RELD 5AV9A 5KDMB 2AROC 4XUJC 3C1CD 4J8VD 5DNMA 3MGQA 3MGRB 2HIOA 3AZJB 4J8XD 1P3AC 1P3FA 1JFIB 3WAAD 3AV1D 3UTAA 5B0ZC 3AZID 5GSUD 5DNND 3W97A 2CV5D 1P3BD 3AZKB 3B6FC 3AFAB 5CPKB 1BH8B 5CP6C 1BH9A 1F66B 3AYWC 5AVCB 4JJNC 5AV8B 5B31C 5AY8A 2NZDC 4X23B 1P3MC 4KGCB 5JRGA 3AN2C 4KHAA 5BS7C 2HIOD 3UTBC 1P3FD 3LZ0A 1P3PA 5B40D 4J8WA 1WWIA 3B0BA 5GT0A 3WTPA 1HQ3B 4WU9B 3REHB 3X1SA 5CPJC 3W97D 1ID3B 3AZNC 1KX3B 5B0YA 5B24A 3TU4B 1P3OD 4ZUXB 1EQZA 5AV5B 4G92C 3C1BD 3B6GB 3KWQA 5AVBD 1M18A 1ZLAA 5AY8D 5G49B 3VH5A 1TZYC 3AZHD 2IO5B 5JRGD 1AOIB 4YS3B 5B32A 4H9QA 3VH5W 3MGPA 3MNNC 4J8UC 1P3PD 4J8WD 5BO0B 3REKA 3AZLD 5B2IA 4YM6C 3X1SD 3LJAC 1U35C 4CAYB 3MGSB 3UT9C 4NFTA 2PYOD 2BYKA 5B1MB 1EQZD 4R8PB 3AZFB 5CPIB 5BT1D 3KUYB 1P3ID 1TAFA 4WU8B 1N1JA 4Z66C 3WA9A 3KXBB 3X1UB 3X1TB 4NE3A 4KUDC 5CP6A 4XZQC 3MGPD 4Z2MG 3WKJC 4LD9C 5FUGA 3AYWA 4JJNA 3LELB 5B31A 5B33B 3REKD 5B2JB 5B2ID 1P3GB 1P3MA 1M19B 4H9SA 4H9OA 3AN2A 5BS7A 4WNNB 3MVDD 2LY8A 4QLCB 4Z5TD 1KX4D 4G91C 3REJB 1H3OB 3WA9D 3AZMC 2FJ7B 2F8NB 3REIA 4CSRA 5GXQD 3RELB 4AWLB 1P34C 3AYWD 4J8VB 3C1CB 1M1AC 1S32B 5E5AA 3W96D 4J8XB 2HUEB 3MGRC 4H9NB 4EO5B 3WAAB 4J8UA 3AV1B 3W99D 3AZJC 3AZIB 3V9RB 1KX5A 2CWEA 3R45B 5GSUB 5DNNB 3B0CW 2CV5B 1P3BB 3LJAA 1U35A 3REID 4ZBJB 3AZKC 3AFAC 1Q9CA 5CPKC 1F66C 5AVCC 5AV8C 5E5AD 4H9PB 2HIOB 2YFVB 4X23C 1P3FB 4XZQA 5B40B 3WKJA 4KGCC 4LD9A 3AZEA 1HTAA 1KX5D 4NE5A 3WTPE 3W97B 1P3OB 1HQ3C 1BH9B 3REHC 2BYMA 5B1LD 5AV6D 3LZ1D 4WU9C 3C1BB 5JA4A 1ID3C 1KX3C 5AVBB 3W98A 5AY8B 3TU4C 4ZUXC 5F99A 3AV2A 5AV5C 1B67A 3AZHB 3B6GC 5JRGB 5AV9D 5B32G 5GT3A 1P3PB 4J8WB 2IO5C 1AOIC 1P34A 4YS3C 5DNMD 3AZED 3AZLB 3MGQD 4UUZA 5KDMA 3VH6A 3X1SB 1A7WA 3O62A 2PYOB 3UTAD 3AZJA 3MGSC 1JFIA 2F8NK 3W98D 1P3IB 2NQBA 5B1MC 5BNVA 5CHLB 4R8PC 5F99D 3AZFC 3AV2D 5CPIC 5BNXB 3KUYC 4H9QB 3MGPB 4WU8C 1P3LA 5GT3D 3KXBC 3AZKA 3X1UC 3X1TC 5CPKA 5B31G 1F66A 3REKB 5B2IB 3LELC 5AV8A 1P3KA 3X1VA 5B33C 4H9RA 3MVDB 3LZ0D 3A6NB 2AROA 5B2JC 3O62D 1P3GC 1M19C 2BYKB 4XUJA 4KGCA 4Z5TB 1KX4B 2RVQD 5GT0D 3WTPD 1P3AA 4QLCC 4E44A 2NQBD 3WA9B 5B0YD 5B24D 5GXQB 1HQ3A 3REJC 4WU9A 5B0ZA 3KWQD 1M18D 3AYWB 1P3LD 1ID3A 1ZLAD 2FJ7C 3RELC 4AWLC 4DRAA 5C3IB 3B6FA 5AV5A 3W96B 4J8VC 3C1CC 5B32D 1P3KD 3X1VD 3KSYA 4H9OB 1S32C 3AZGB 1S32A 2AROD 3W99B 2NZDA 4XUJD 4J8XC 4YS3A 2HUEC 3WAAC 4EO5C 3AV1C 3UTBA 1P3AD 5BO0A 3AZIC 5GSUC 4CSRB 5DNNC 3REIB 2CV5C 1P3BC 3NQUA 5B0ZD 5CPJA 4ZBJC 3AZNA 5E5AB 3AZFA 3B6FD 5CPIA 5CP6D 4WU8A 4JJND 5B31D 3KXBA 2HIOC 3X1TA 2NZDD 1TZYA 1P3FC 5B40C 1KX5B 1P3MD 3AN2D 2F8NH 4Z2MH 5B33A 3UTBD 3MNNA 3NQJB 5B1LB 3LZ1B 5AV6B 1M19A 3W97C 4YM6A 1P3OC 5CPJD 3C1BC 4QLCA 5AVBC 3UT9A 3AZND 5AY8C 2YFWA 5AV9B 3AZHC 5JRGC 5DNMB 3AZEB 2F8NA 1F1EA 3MGQB 3RELA 2L5AA 4Z66A 1TZYD 1P3PC 4J8WC 4KUDA 3C1CA 3AZLC
chains in the Genus database with same CATH superfamily
3MNND 4J8UD 3X1SC 3UTAB 4J8XA 5JA4B 3W98B 2PYOC 4H9NA 4YM6D 5F99B 3LJAD 3AV2B 1U35D 5BT1C 3V9RA 3UT9D 3AZIA 1P3IC 3KFUG 2CV5A 1P3BA 5GT3B 3MGPC 3VH5T 4Z66D 3AZMA 4KHAB 2JSSA 3EPHA 3H0RC 4KUDD 4XZQD 3LZ0B 3REKC 3WKJD 1S32D 5B2IC 4LD9D 3O62B 1M1AA 1ULYA 4H9PA 5GT0B 3MVDC 2YFVA 1Z2CB 3WTPB 3A6NC 5B40A 2NQBB 4Z5TC 5BNVB 3VH6W 1KX4C 4WJ3C 4HGAB 3EG5B 5B0YB 3MGRA 5B24B 1EQZB 4E45A 3KWQB 1M18B 1P3LB 1ZLAB 3WA9C 3EPKA 5GXQC 1P3OA 3EPJA 3B0DB 3C1BA 5AVBA 5B32B 3AZMD 1P3KB 3X1VB 4DRBA 4H9RB 2UWXA 5C3IC 3W96C 2AROB 3AFAA 1BH8A 3AZHA 1P34D 4XUJB 1M1AD 4H9SC 5AVCA 1R4VA 3AZGC 3W99C 4X23A 1P3AB 3AZLA 3MGRD 3AZJD 5B0ZB 1KU5A 1BFMA 1TAFB 3REIC 2PYOA 1N1JB 2Y2MA 3B6FB 5CP6B 3REHA 1P3IA 5FUGB 4JJNB 1KX3A 5B31B 5E5AC 3AZKD 2BG1A 3AFAD 5CPKD 3TU4A 5BNXA 4ZUXA 1F66D 2NZDB 1P3MB 5AVCD 3B6GA 5AV8D 3AN2B 5G49A 3UTBB 4X23D 1KX5C 1AOIA 4KGCD 3NQUB 3B0CT 3MVDA 3A6NA 5B1LC 3LZ1C 5AV6C 4DQYB 5CPJB 4Z5TA 3AZNB 1KX4A 1HQ3D 4WU9D 3REHD 4CAYA 4G92B 3MGSA 4M6BA 1KX3D 4WV4B 1ID3D 5B1MA 5GXQA 5AV9C 4ZUXD 3TU4D 4R8PA 1TZYB 2F8NG 5AV5D 3B6GD 5DNMC 3KUYA 3AZEC 3MGQC 3MNNB 4J8UB 3W96A 3X1UA 1AOID 4YS3D 3A1KA 3LELA 4NE6A 4YM6B 3AZGA 3A6ND 2VQRA 3UTAC 3LJAB 1U35B 3W99A 4WZSB 3UT9B 3W98C 5B2JA 1P3GA 2YFWB 5F99C 3AV2C 4WNNA 3MGSD 2XD5A 5B1MD 4Z66B 4R8PD 5GT3C 3AZFD 2Y2QA 5CPID 2RIQA 3KUYD 4XZQB 3REJA 4KUDB 4WU8D 3WKJB 1H3OA 4LD9B 2Y2GA 2FJ7A 3KXBD 3X1UD 2JCHA 3X1TD 3LZ0C 3O62C 3LELD 3VH6T 4J8VA 3AZGD 5B33D 2RVQC 5GT0C 3WTPC 2BYMB 5B2JD 1P3GD 2ZY4A 1M19D 2NQBC 4G91B 4HGAC 5B0YC 5B24C 1EQZC 2Y2LA 3WAAA 3AV1A 3NQJA 1WWSA 5B1LA 5AV6A 3LZ1A 4QLCD 3KWQC 1M18C 1P3LC 1ZLAC 3AZMB 3R45A 5GSUA 5DNNA 3REJD 3B0DC 1P34B 5B32C 1P3KC 1M1AB 3X1VC 1B6WA 2F8ND 2Y2PA 2FJ7D 4UUZB 3RELD 5AV9A 5KDMB 2AROC 4XUJC 3C1CD 4J8VD 5DNMA 2Y2KA 3MGQA 3MGRB 2HIOA 3AZJB 4J8XD 1P3AC 1P3FA 1JFIB 3WAAD 3H0LC 3AV1D 3UTAA 5B0ZC 3AZID 5GSUD 5DNND 3W97A 2CV5D 1P3BD 2F2AC 3AZKB 3B6FC 3AFAB 5CPKB 1BH8B 5CP6C 1BH9A 1F66B 3AYWC 5AVCB 4JJNC 2ZY2A 5AV8B 5B31C 5AY8A 2NZDC 4X23B 1P3MC 4KGCB 5JRGA 3AN2C 4KHAA 2DF4C 2Y2IA 2HIOD 5BS7C 3UTBC 1P3FD 3LZ0A 1P3PA 5B40D 4J8WA 3F6TA 1WWIA 3B0BA 5GT0A 3WTPA 1HQ3B 4WU9B 3REHB 3X1SA 2ZY5A 5CPJC 3W97D 1ID3B 3AZNC 1KX3B 2Y2HA 5B0YA 5B24A 3TU4B 1P3OD 4ZUXB 1EQZA 5AV5B 4G92C 3C1BD 3B6GB 3KWQA 5AVBD 1M18A 1ZLAA 5AY8D 5G49B 3VH5A 1TZYC 3AZHD 2ZM5A 2IO5B 5JRGD 1AOIB 4YS3B 5B32A 4H9QA 3VH5W 3MGPA 3MNNC 2Y2NA 4J8UC 1P3PD 4J8WD 5BO0B 3REKA 3AZLD 5B2IA 4YM6C 3X1SD 3LJAC 1U35C 4CAYB 3MGSB 3UT9C 4NFTA 2PYOD 2BYKA 5B1MB 1EQZD 4R8PB 3AZFB 5CPIB 5BT1D 3KUYB 1P3ID 1TAFA 4WU8B 1N1JA 4Z66C 3WA9A 3KXBB 3X1UB 3X1TB 4NE3A 4KUDC 5CP6A 4XZQC 3MGPD 4Z2MG 3WKJC 4LD9C 5FUGA 3AYWA 4JJNA 3LELB 5B31A 5B33B 3REKD 5B2JB 5B2ID 1P3GB 1P3MA 1M19B 4H9SA 4H9OA 3AN2A 5BS7A 4UPKA 4WNNB 3MVDD 2LY8A 4QLCB 4Z5TD 1KX4D 4G91C 3REJB 2DQNC 1H3OB 3WA9D 3AZMC 2FJ7B 2F8NB 3REIA 4CSRA 5GXQD 3RELB 4AWLB 1P34C 3AYWD 4J8VB 3C1CB 1M1AC 1S32B 5E5AA 3W96D 4J8XB 2HUEB 3MGRC 4H9NB 4EO5B 3WAAB 4J8UA 3AV1B 3W99D 3AZJC 3AZIB 3V9RB 1KX5A 2CWEA 3R45B 5GSUB 5DNNB 3B0CW 2CV5B 1P3BB 2Y2OA 3LJAA 1U35A 3REID 4ZBJB 3AZKC 3AFAC 1Q9CA 5CPKC 1F66C 3C1CA 5AVCC 5AV8C 5E5AD 4H9PB 2HIOB 2YFVB 4X23C 2J8PA 1P3FB 4XZQA 5B40B 3WKJA 4KGCC 4LD9A 3AZEA 1HTAA 1KX5D 4NE5A 3WTPE 3W97B 2ZY3A 1P3OB 1HQ3C 1BH9B 3REHC 2BYMA 5B1LD 5AV6D 3LZ1D 4WU9C 3C1BB 5JA4A 1ID3C 1KX3C 5AVBB 3W98A 5AY8B 3TU4C 4ZUXC 5F99A 3AV2A 5AV5C 1B67A 3AZHB 3B6GC 5JRGB 5AV9D 5B32G 5GT3A 1P3PB 4J8WB 2IO5C 1AOIC 1P34A 4YS3C 5DNMD 3AZED 3AZLB 3MGQD 4UUZA 5KDMA 3VH6A 3X1SB 1A7WA 3O62A 2PYOB 3UTAD 3AZJA 3MGSC 1JFIA 2F8NK 3W98D 1P3IB 2NQBA 5B1MC 5BNVA 5CHLB 4R8PC 5F99D 3AZFC 3EPLA 3AV2D 5CPIC 5BNXB 3KUYC 4H9QB 3MGPB 4WU8C 1P3LA 5GT3D 2FFFB 3KXBC 3AZKA 3X1UC 3X1TC 5CPKA 5B31G 1F66A 3REKB 3AL0C 2G5IC 5B2IB 3LELC 5AV8A 3IP4C 1P3KA 3X1VA 5B33C 4H9RA 3MVDB 3LZ0D 3A6NB 2AROA 5B2JC 3O62D 1P3GC 1M19C 2BYKB 4XUJA 4KGCA 4Z5TB 1KX4B 2RVQD 5GT0D 3WTPD 2Y2JA 1P3AA 4QLCC 4E44A 2NQBD 3WA9B 5B0YD 5B24D 5GXQB 1HQ3A 3REJC 4WU9A 5B0ZA 3KWQD 1M18D 3AYWB 1P3LD 1ID3A 1ZLAD 2FJ7C 3RELC 4AWLC 4DRAA 5C3IB 3B6FA 5AV5A 3W96B 4J8VC 3C1CC 5B32D 1P3KD 3X1VD 3KSYA 3P5JB 4H9OB 1S32C 3AZGB 1S32A 2AROD 3W99B 2W8SA 2NZDA 4XUJD 4J8XC 4YS3A 2HUEC 2XD1A 3WAAC 4EO5C 3AV1C 3A1IA 3UTBA 1T3UA 2JE5A 2G5HC 1P3AD 5BO0A 3AZIC 5GSUC 4CSRB 1W2EA 5DNNC 3REIB 2CV5C 1P3BC 3NQUA 5B0ZD 3H0MC 5CPJA 4ZBJC 3AZNA 5E5AB 3AZFA 3B6FD 5CPIA 5CP6D 4WU8A 4JJND 5B31D 3KXBA 2HIOC 3X1TA 2NZDD 1TZYA 1P3FC 5B40C 1KX5B 1P3MD 3AN2D 2F8NH 4Z2MH 5B33A 3UTBD 3MNNA 3NQJB 5B1LB 3LZ1B 5AV6B 1M19A 3W97C 4YM6A 1P3OC 5CPJD 3C1BC 4QLCA 3FDDA 5AVBC 3UT9A 3AZND 5AY8C 2YFWA 5AV9B 3AZHC 5JRGC 5DNMB 3AZEB 2F8NA 1F1EA 3MGQB 3RELA 2L5AA 4Z66A 1TZYD 1P3PC 4J8WC 4KUDA 1PZRA 3AZLC
chains in the Genus database with same CATH topology
3MNND 4J8UD 3X1SC 3UTAB 4J8XA 5JA4B 3W98B 2PYOC 4H9NA 4YM6D 5F99B 3LJAD 3AV2B 1U35D 5BT1C 3V9RA 3UT9D 3AZIA 1P3IC 3KFUG 2CV5A 1P3BA 5GT3B 3MGPC 3VH5T 4Z66D 3AZMA 4KHAB 2JSSA 3EPHA 3H0RC 4KUDD 4XZQD 3LZ0B 3REKC 3WKJD 1S32D 5B2IC 4LD9D 3O62B 1M1AA 1ULYA 4H9PA 5GT0B 3MVDC 2YFVA 1Z2CB 3WTPB 3A6NC 5B40A 2NQBB 4Z5TC 5BNVB 3VH6W 1KX4C 4WJ3C 4HGAB 3EG5B 5B0YB 3MGRA 5B24B 1EQZB 4E45A 3KWQB 1M18B 1P3LB 1ZLAB 3WA9C 3EPKA 5GXQC 1P3OA 3EPJA 3B0DB 3C1BA 5AVBA 5B32B 3AZMD 1P3KB 3X1VB 4DRBA 4H9RB 2UWXA 5C3IC 3W96C 2AROB 3AFAA 1BH8A 3AZHA 1P34D 4XUJB 1M1AD 4H9SC 5AVCA 1R4VA 3AZGC 3W99C 4X23A 1P3AB 3AZLA 3MGRD 3AZJD 5B0ZB 1KU5A 1BFMA 1TAFB 3REIC 2PYOA 1N1JB 2Y2MA 3B6FB 5CP6B 3REHA 1P3IA 5FUGB 4JJNB 1KX3A 5B31B 5E5AC 3AZKD 2BG1A 3AFAD 5CPKD 3TU4A 5BNXA 4ZUXA 1F66D 2NZDB 1P3MB 5AVCD 3B6GA 5AV8D 3AN2B 5G49A 3UTBB 4X23D 1KX5C 1AOIA 4KGCD 3NQUB 3B0CT 3MVDA 3A6NA 5B1LC 3LZ1C 5AV6C 4DQYB 5CPJB 4Z5TA 3AZNB 1KX4A 1HQ3D 4WU9D 3REHD 4CAYA 4G92B 3MGSA 4M6BA 1KX3D 4WV4B 1ID3D 5B1MA 5GXQA 5AV9C 4ZUXD 3TU4D 4R8PA 1TZYB 2F8NG 5AV5D 3B6GD 5DNMC 3KUYA 3AZEC 3MGQC 3MNNB 4J8UB 3W96A 3X1UA 1AOID 4YS3D 3A1KA 3LELA 4NE6A 4YM6B 3AZGA 3A6ND 2VQRA 3UTAC 3LJAB 1U35B 3W99A 4WZSB 3UT9B 3W98C 5B2JA 1P3GA 2YFWB 5F99C 3AV2C 4WNNA 3MGSD 2XD5A 5B1MD 4Z66B 4R8PD 5GT3C 3AZFD 2Y2QA 5CPID 2RIQA 3KUYD 4XZQB 3REJA 4KUDB 4WU8D 3WKJB 1H3OA 4LD9B 2Y2GA 2FJ7A 3KXBD 3X1UD 2JCHA 3X1TD 3LZ0C 3O62C 3LELD 3VH6T 4J8VA 3AZGD 5B33D 2RVQC 5GT0C 3WTPC 2BYMB 5B2JD 1P3GD 2ZY4A 1M19D 2NQBC 4G91B 4HGAC 5B0YC 5B24C 1EQZC 2Y2LA 3WAAA 3AV1A 3NQJA 1WWSA 5B1LA 5AV6A 3LZ1A 4QLCD 3KWQC 1M18C 1P3LC 1ZLAC 3AZMB 3R45A 5GSUA 5DNNA 3REJD 3B0DC 1P34B 5B32C 1P3KC 1M1AB 3X1VC 1B6WA 2F8ND 2Y2PA 2FJ7D 4UUZB 3RELD 5AV9A 5KDMB 2AROC 4XUJC 3C1CD 4J8VD 5DNMA 2Y2KA 3MGQA 3MGRB 2HIOA 3AZJB 4J8XD 1P3AC 1P3FA 1JFIB 3WAAD 3H0LC 3AV1D 3UTAA 5B0ZC 3AZID 5GSUD 5DNND 3W97A 2CV5D 1P3BD 2F2AC 3AZKB 3B6FC 3AFAB 5CPKB 1BH8B 5CP6C 1BH9A 1F66B 3AYWC 5AVCB 4JJNC 2ZY2A 5AV8B 5B31C 5AY8A 2NZDC 4X23B 1P3MC 4KGCB 5JRGA 3AN2C 4KHAA 2DF4C 2Y2IA 2HIOD 5BS7C 3UTBC 1P3FD 3LZ0A 1P3PA 5B40D 4J8WA 3F6TA 1WWIA 3B0BA 5GT0A 3WTPA 1HQ3B 4WU9B 3REHB 3X1SA 2ZY5A 5CPJC 3W97D 1ID3B 3AZNC 1KX3B 2Y2HA 5B0YA 5B24A 3TU4B 1P3OD 4ZUXB 1EQZA 5AV5B 4G92C 3C1BD 3B6GB 3KWQA 5AVBD 1M18A 1ZLAA 5AY8D 5G49B 3VH5A 1TZYC 3AZHD 2ZM5A 2IO5B 5JRGD 1AOIB 4YS3B 5B32A 4H9QA 3VH5W 3MGPA 3MNNC 2Y2NA 4J8UC 1P3PD 4J8WD 5BO0B 3REKA 3AZLD 5B2IA 4YM6C 3X1SD 3LJAC 1U35C 4CAYB 3MGSB 3UT9C 4NFTA 2PYOD 2BYKA 5B1MB 1EQZD 4R8PB 3AZFB 5CPIB 5BT1D 3KUYB 1P3ID 1TAFA 4WU8B 1N1JA 4Z66C 3WA9A 3KXBB 3X1UB 3X1TB 4NE3A 4KUDC 5CP6A 4XZQC 3MGPD 4Z2MG 3WKJC 4LD9C 5FUGA 3AYWA 4JJNA 3LELB 5B31A 5B33B 3REKD 5B2JB 5B2ID 1P3GB 1P3MA 1M19B 4H9SA 4H9OA 3AN2A 5BS7A 4UPKA 4WNNB 3MVDD 2LY8A 4QLCB 4Z5TD 1KX4D 4G91C 3REJB 2DQNC 1H3OB 3WA9D 3AZMC 2FJ7B 2F8NB 3REIA 4CSRA 5GXQD 3RELB 4AWLB 1P34C 3AYWD 4J8VB 3C1CB 1M1AC 1S32B 5E5AA 3W96D 4J8XB 2HUEB 3MGRC 4H9NB 4EO5B 3WAAB 4J8UA 3AV1B 3W99D 3AZJC 3AZIB 3V9RB 1KX5A 2CWEA 3R45B 5GSUB 5DNNB 3B0CW 2CV5B 1P3BB 2Y2OA 3LJAA 1U35A 3REID 4ZBJB 3AZKC 3AFAC 1Q9CA 5CPKC 1F66C 3C1CA 5AVCC 5AV8C 5E5AD 4H9PB 2HIOB 2YFVB 4X23C 2J8PA 1P3FB 4XZQA 5B40B 3WKJA 4KGCC 4LD9A 3AZEA 1HTAA 1KX5D 4NE5A 3WTPE 3W97B 2ZY3A 1P3OB 1HQ3C 1BH9B 3REHC 2BYMA 5B1LD 5AV6D 3LZ1D 4WU9C 3C1BB 5JA4A 1ID3C 1KX3C 5AVBB 3W98A 5AY8B 3TU4C 4ZUXC 5F99A 3AV2A 5AV5C 1B67A 3AZHB 3B6GC 5JRGB 5AV9D 5B32G 5GT3A 1P3PB 4J8WB 2IO5C 1AOIC 1P34A 4YS3C 5DNMD 3AZED 3AZLB 3MGQD 4UUZA 5KDMA 3VH6A 3X1SB 1A7WA 3O62A 2PYOB 3UTAD 3AZJA 3MGSC 1JFIA 2F8NK 3W98D 1P3IB 2NQBA 5B1MC 5BNVA 5CHLB 4R8PC 5F99D 3AZFC 3EPLA 3AV2D 5CPIC 5BNXB 3KUYC 4H9QB 3MGPB 4WU8C 1P3LA 5GT3D 2FFFB 3KXBC 3AZKA 3X1UC 3X1TC 5CPKA 5B31G 1F66A 3REKB 3AL0C 2G5IC 5B2IB 3LELC 5AV8A 3IP4C 1P3KA 3X1VA 5B33C 4H9RA 3MVDB 3LZ0D 3A6NB 2AROA 5B2JC 3O62D 1P3GC 1M19C 2BYKB 4XUJA 4KGCA 4Z5TB 1KX4B 2RVQD 5GT0D 3WTPD 2Y2JA 1P3AA 4QLCC 4E44A 2NQBD 3WA9B 5B0YD 5B24D 5GXQB 1HQ3A 3REJC 4WU9A 5B0ZA 3KWQD 1M18D 3AYWB 1P3LD 1ID3A 1ZLAD 2FJ7C 3RELC 4AWLC 4DRAA 5C3IB 3B6FA 5AV5A 3W96B 4J8VC 3C1CC 5B32D 1P3KD 3X1VD 3KSYA 3P5JB 4H9OB 1S32C 3AZGB 1S32A 2AROD 3W99B 2W8SA 2NZDA 4XUJD 4J8XC 4YS3A 2HUEC 2XD1A 3WAAC 4EO5C 3AV1C 3A1IA 3UTBA 1T3UA 2JE5A 2G5HC 1P3AD 5BO0A 3AZIC 5GSUC 4CSRB 1W2EA 5DNNC 3REIB 2CV5C 1P3BC 3NQUA 5B0ZD 3H0MC 5CPJA 4ZBJC 3AZNA 5E5AB 3AZFA 3B6FD 5CPIA 5CP6D 4WU8A 4JJND 5B31D 3KXBA 2HIOC 3X1TA 2NZDD 1TZYA 1P3FC 5B40C 1KX5B 1P3MD 3AN2D 2F8NH 4Z2MH 5B33A 3UTBD 3MNNA 3NQJB 5B1LB 3LZ1B 5AV6B 1M19A 3W97C 4YM6A 1P3OC 5CPJD 3C1BC 4QLCA 3FDDA 5AVBC 3UT9A 3AZND 5AY8C 2YFWA 5AV9B 3AZHC 5JRGC 5DNMB 3AZEB 2F8NA 1F1EA 3MGQB 3RELA 2L5AA 4Z66A 1TZYD 1P3PC 4J8WC 4KUDA 1PZRA 3AZLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN D;  4J8U D;  3X1S C;  3UTA B;  4J8X A;  5JA4 B;  3W98 B;  2PYO C;  4H9N A;  4YM6 D;  5F99 B;  3LJA D;  3AV2 B;  1U35 D;  5BT1 C;  3V9R A;  3UT9 D;  3AZI A;  1P3I C;  2CV5 A;  1P3B A;  5GT3 B;  3MGP C;  3VH5 T;  4Z66 D;  3AZM A;  4KHA B;  2JSS A;  4KUD D;  4XZQ D;  3LZ0 B;  3REK C;  3WKJ D;  1S32 D;  5B2I C;  4LD9 D;  3O62 B;  1M1A A;  1ULY A;  4H9P A;  5GT0 B;  3MVD C;  2YFV A;  3WTP B;  3A6N C;  5B40 A;  2NQB B;  4Z5T C;  5BNV B;  3VH6 W;  1KX4 C;  4HGA B;  5B0Y B;  3MGR A;  5B24 B;  1EQZ B;  4E45 A;  3KWQ B;  1M18 B;  1P3L B;  1ZLA B;  3WA9 C;  5GXQ C;  1P3O A;  3B0D B;  3C1B A;  5AVB A;  5B32 B;  3AZM D;  1P3K B;  3X1V B;  4DRB A;  4H9R B;  5C3I C;  3W96 C;  2ARO B;  3AFA A;  1BH8 A;  3AZH A;  1P34 D;  4XUJ B;  1M1A D;  4H9S C;  5AVC A;  1R4V A;  3AZG C;  3W99 C;  4X23 A;  1P3A B;  3AZL A;  3MGR D;  3AZJ D;  5B0Z B;  1KU5 A;  1BFM A;  1TAF B;  3REI C;  2PYO A;  1N1J B;  3B6F B;  5CP6 B;  3REH A;  1P3I A;  5FUG B;  4JJN B;  1KX3 A;  5B31 B;  5E5A C;  3AZK D;  3AFA D;  5CPK D;  3TU4 A;  5BNX A;  4ZUX A;  1F66 D;  2NZD B;  1P3M B;  5AVC D;  3B6G A;  5AV8 D;  3AN2 B;  5G49 A;  3UTB B;  4X23 D;  1KX5 C;  1AOI A;  4KGC D;  3NQU B;  3B0C T;  3MVD A;  3A6N A;  5B1L C;  3LZ1 C;  5AV6 C;  5CPJ B;  4Z5T A;  3AZN B;  1KX4 A;  1HQ3 D;  4WU9 D;  3REH D;  4CAY A;  4G92 B;  3MGS A;  4M6B A;  1KX3 D;  4WV4 B;  1ID3 D;  5B1M A;  5GXQ A;  5AV9 C;  4ZUX D;  3TU4 D;  4R8P A;  1TZY B;  2F8N G;  5AV5 D;  3B6G D;  5DNM C;  3KUY A;  3AZE C;  3MGQ C;  3MNN B;  4J8U B;  3W96 A;  3X1U A;  1AOI D;  4YS3 D;  3LEL A;  4NE6 A;  4YM6 B;  3AZG A;  3A6N D;  3UTA C;  3LJA B;  1U35 B;  3W99 A;  4WZS B;  3UT9 B;  3W98 C;  5B2J A;  1P3G A;  2YFW B;  5F99 C;  3AV2 C;  4WNN A;  3MGS D;  5B1M D;  4Z66 B;  4R8P D;  5GT3 C;  3AZF D;  5CPI D;  3KUY D;  3REJ A;  4XZQ B;  4KUD B;  4WU8 D;  3WKJ B;  1H3O A;  4LD9 B;  2FJ7 A;  3KXB D;  3X1U D;  3X1T D;  3LZ0 C;  3O62 C;  3LEL D;  3VH6 T;  4J8V A;  3AZG D;  5B33 D;  2RVQ C;  5GT0 C;  3WTP C;  2BYM B;  5B2J D;  1P3G D;  1M19 D;  2NQB C;  4G91 B;  4HGA C;  5B0Y C;  5B24 C;  1EQZ C;  3WAA A;  3AV1 A;  3NQJ A;  1WWS A;  5B1L A;  5AV6 A;  3LZ1 A;  4QLC D;  3KWQ C;  1M18 C;  1P3L C;  1ZLA C;  3AZM B;  3R45 A;  5GSU A;  5DNN A;  3REJ D;  3B0D C;  1P34 B;  5B32 C;  1P3K C;  1M1A B;  3X1V C;  1B6W A;  2F8N D;  2FJ7 D;  4UUZ B;  3REL D;  5AV9 A;  5KDM B;  2ARO C;  4XUJ C;  3C1C D;  4J8V D;  5DNM A;  3MGQ A;  3MGR B;  2HIO A;  3AZJ B;  4J8X D;  1P3A C;  1P3F A;  1JFI B;  3WAA D;  3AV1 D;  3UTA A;  5B0Z C;  3AZI D;  5GSU D;  5DNN D;  3W97 A;  2CV5 D;  1P3B D;  3AZK B;  3B6F C;  3AFA B;  5CPK B;  1BH8 B;  5CP6 C;  1BH9 A;  1F66 B;  3AYW C;  5AVC B;  4JJN C;  5AV8 B;  5B31 C;  5AY8 A;  2NZD C;  4X23 B;  1P3M C;  4KGC B;  5JRG A;  3AN2 C;  4KHA A;  5BS7 C;  2HIO D;  3UTB C;  1P3F D;  3LZ0 A;  1P3P A;  5B40 D;  4J8W A;  1WWI A;  3B0B A;  5GT0 A;  3WTP A;  1HQ3 B;  4WU9 B;  3REH B;  3X1S A;  5CPJ C;  3W97 D;  1ID3 B;  3AZN C;  1KX3 B;  5B0Y A;  5B24 A;  3TU4 B;  1P3O D;  4ZUX B;  1EQZ A;  5AV5 B;  4G92 C;  3C1B D;  3B6G B;  3KWQ A;  5AVB D;  1M18 A;  1ZLA A;  5AY8 D;  5G49 B;  3VH5 A;  1TZY C;  3AZH D;  2IO5 B;  5JRG D;  1AOI B;  4YS3 B;  5B32 A;  4H9Q A;  3VH5 W;  3MGP A;  3MNN C;  4J8U C;  1P3P D;  4J8W D;  5BO0 B;  3REK A;  3AZL D;  5B2I A;  4YM6 C;  3X1S D;  3LJA C;  1U35 C;  4CAY B;  3MGS B;  3UT9 C;  4NFT A;  2PYO D;  2BYK A;  5B1M B;  1EQZ D;  4R8P B;  3AZF B;  5CPI B;  5BT1 D;  3KUY B;  1P3I D;  1TAF A;  4WU8 B;  1N1J A;  4Z66 C;  3WA9 A;  3KXB B;  3X1U B;  3X1T B;  4NE3 A;  4KUD C;  5CP6 A;  4XZQ C;  3MGP D;  4Z2M G;  3WKJ C;  4LD9 C;  5FUG A;  3AYW A;  4JJN A;  3LEL B;  5B31 A;  5B33 B;  3REK D;  5B2J B;  5B2I D;  1P3G B;  1P3M A;  1M19 B;  4H9S A;  4H9O A;  3AN2 A;  5BS7 A;  4WNN B;  3MVD D;  2LY8 A;  4QLC B;  4Z5T D;  1KX4 D;  4G91 C;  3REJ B;  1H3O B;  3WA9 D;  3AZM C;  2FJ7 B;  2F8N B;  3REI A;  4CSR A;  5GXQ D;  3REL B;  4AWL B;  1P34 C;  3AYW D;  4J8V B;  3C1C B;  1M1A C;  1S32 B;  5E5A A;  3W96 D;  4J8X B;  2HUE B;  3MGR C;  4H9N B;  4EO5 B;  3WAA B;  4J8U A;  3AV1 B;  3W99 D;  3AZJ C;  3AZI B;  3V9R B;  1KX5 A;  2CWE A;  3R45 B;  5GSU B;  5DNN B;  3B0C W;  2CV5 B;  1P3B B;  3LJA A;  1U35 A;  3REI D;  4ZBJ B;  3AZK C;  3AFA C;  1Q9C A;  5CPK C;  1F66 C;  5AVC C;  5AV8 C;  5E5A D;  4H9P B;  2HIO B;  2YFV B;  4X23 C;  1P3F B;  4XZQ A;  5B40 B;  3WKJ A;  4KGC C;  4LD9 A;  3AZE A;  1HTA A;  1KX5 D;  4NE5 A;  3WTP E;  3W97 B;  1P3O B;  1HQ3 C;  1BH9 B;  3REH C;  2BYM A;  5B1L D;  5AV6 D;  3LZ1 D;  4WU9 C;  3C1B B;  5JA4 A;  1ID3 C;  1KX3 C;  5AVB B;  3W98 A;  5AY8 B;  3TU4 C;  4ZUX C;  5F99 A;  3AV2 A;  5AV5 C;  1B67 A;  3AZH B;  3B6G C;  5JRG B;  5AV9 D;  5B32 G;  5GT3 A;  1P3P B;  4J8W B;  2IO5 C;  1AOI C;  1P34 A;  4YS3 C;  5DNM D;  3AZE D;  3AZL B;  3MGQ D;  4UUZ A;  5KDM A;  3VH6 A;  3X1S B;  1A7W A;  3O62 A;  2PYO B;  3UTA D;  3AZJ A;  3MGS C;  1JFI A;  2F8N K;  3W98 D;  1P3I B;  2NQB A;  5B1M C;  5BNV A;  5CHL B;  4R8P C;  5F99 D;  3AZF C;  3AV2 D;  5CPI C;  5BNX B;  3KUY C;  4H9Q B;  3MGP B;  4WU8 C;  1P3L A;  5GT3 D;  3KXB C;  3AZK A;  3X1U C;  3X1T C;  5CPK A;  5B31 G;  1F66 A;  3REK B;  5B2I B;  3LEL C;  5AV8 A;  1P3K A;  3X1V A;  5B33 C;  4H9R A;  3MVD B;  3LZ0 D;  3A6N B;  2ARO A;  5B2J C;  3O62 D;  1P3G C;  1M19 C;  2BYK B;  4XUJ A;  4KGC A;  4Z5T B;  1KX4 B;  2RVQ D;  5GT0 D;  3WTP D;  1P3A A;  4QLC C;  4E44 A;  2NQB D;  3WA9 B;  5B0Y D;  5B24 D;  5GXQ B;  1HQ3 A;  3REJ C;  4WU9 A;  5B0Z A;  3KWQ D;  1M18 D;  3AYW B;  1P3L D;  1ID3 A;  1ZLA D;  2FJ7 C;  3REL C;  4AWL C;  4DRA A;  5C3I B;  3B6F A;  5AV5 A;  3W96 B;  4J8V C;  3C1C C;  5B32 D;  1P3K D;  3X1V D;  3KSY A;  4H9O B;  1S32 C;  3AZG B;  1S32 A;  2ARO D;  3W99 B;  2NZD A;  4XUJ D;  4J8X C;  4YS3 A;  2HUE C;  3WAA C;  4EO5 C;  3AV1 C;  3UTB A;  1P3A D;  5BO0 A;  3AZI C;  5GSU C;  4CSR B;  5DNN C;  3REI B;  2CV5 C;  1P3B C;  3NQU A;  5B0Z D;  5CPJ A;  4ZBJ C;  3AZN A;  5E5A B;  3AZF A;  3B6F D;  5CPI A;  5CP6 D;  4WU8 A;  4JJN D;  5B31 D;  3KXB A;  2HIO C;  3X1T A;  2NZD D;  1TZY A;  1P3F C;  5B40 C;  1KX5 B;  1P3M D;  3AN2 D;  2F8N H;  4Z2M H;  5B33 A;  3UTB D;  3MNN A;  3NQJ B;  5B1L B;  3LZ1 B;  5AV6 B;  1M19 A;  3W97 C;  4YM6 A;  1P3O C;  5CPJ D;  3C1B C;  4QLC A;  5AVB C;  3UT9 A;  3AZN D;  5AY8 C;  2YFW A;  5AV9 B;  3AZH C;  5JRG C;  5DNM B;  3AZE B;  2F8N A;  1F1E A;  3MGQ B;  3REL A;  2L5A A;  4Z66 A;  1TZY D;  1P3P C;  4J8W C;  4KUD A;  3C1C A;  3AZL C; 
#chains in the Genus database with same CATH topology
 3MNN D;  4J8U D;  3X1S C;  3UTA B;  4J8X A;  5JA4 B;  3W98 B;  2PYO C;  4H9N A;  4YM6 D;  5F99 B;  3LJA D;  3AV2 B;  1U35 D;  5BT1 C;  3V9R A;  3UT9 D;  3AZI A;  1P3I C;  3KFU G;  2CV5 A;  1P3B A;  5GT3 B;  3MGP C;  3VH5 T;  4Z66 D;  3AZM A;  4KHA B;  2JSS A;  3EPH A;  3H0R C;  4KUD D;  4XZQ D;  3LZ0 B;  3REK C;  3WKJ D;  1S32 D;  5B2I C;  4LD9 D;  3O62 B;  1M1A A;  1ULY A;  4H9P A;  5GT0 B;  3MVD C;  2YFV A;  1Z2C B;  3WTP B;  3A6N C;  5B40 A;  2NQB B;  4Z5T C;  5BNV B;  3VH6 W;  1KX4 C;  4WJ3 C;  4HGA B;  3EG5 B;  5B0Y B;  3MGR A;  5B24 B;  1EQZ B;  4E45 A;  3KWQ B;  1M18 B;  1P3L B;  1ZLA B;  3WA9 C;  3EPK A;  5GXQ C;  1P3O A;  3EPJ A;  3B0D B;  3C1B A;  5AVB A;  5B32 B;  3AZM D;  1P3K B;  3X1V B;  4DRB A;  4H9R B;  2UWX A;  5C3I C;  3W96 C;  2ARO B;  3AFA A;  1BH8 A;  3AZH A;  1P34 D;  4XUJ B;  1M1A D;  4H9S C;  5AVC A;  1R4V A;  3AZG C;  3W99 C;  4X23 A;  1P3A B;  3AZL A;  3MGR D;  3AZJ D;  5B0Z B;  1KU5 A;  1BFM A;  1TAF B;  3REI C;  2PYO A;  1N1J B;  2Y2M A;  3B6F B;  5CP6 B;  3REH A;  1P3I A;  5FUG B;  4JJN B;  1KX3 A;  5B31 B;  5E5A C;  3AZK D;  2BG1 A;  3AFA D;  5CPK D;  3TU4 A;  5BNX A;  4ZUX A;  1F66 D;  2NZD B;  1P3M B;  5AVC D;  3B6G A;  5AV8 D;  3AN2 B;  5G49 A;  3UTB B;  4X23 D;  1KX5 C;  1AOI A;  4KGC D;  3NQU B;  3B0C T;  3MVD A;  3A6N A;  5B1L C;  3LZ1 C;  5AV6 C;  4DQY B;  5CPJ B;  4Z5T A;  3AZN B;  1KX4 A;  1HQ3 D;  4WU9 D;  3REH D;  4CAY A;  4G92 B;  3MGS A;  4M6B A;  1KX3 D;  4WV4 B;  1ID3 D;  5B1M A;  5GXQ A;  5AV9 C;  4ZUX D;  3TU4 D;  4R8P A;  1TZY B;  2F8N G;  5AV5 D;  3B6G D;  5DNM C;  3KUY A;  3AZE C;  3MGQ C;  3MNN B;  4J8U B;  3W96 A;  3X1U A;  1AOI D;  4YS3 D;  3A1K A;  3LEL A;  4NE6 A;  4YM6 B;  3AZG A;  3A6N D;  2VQR A;  3UTA C;  3LJA B;  1U35 B;  3W99 A;  4WZS B;  3UT9 B;  3W98 C;  5B2J A;  1P3G A;  2YFW B;  5F99 C;  3AV2 C;  4WNN A;  3MGS D;  2XD5 A;  5B1M D;  4Z66 B;  4R8P D;  5GT3 C;  3AZF D;  2Y2Q A;  5CPI D;  2RIQ A;  3KUY D;  4XZQ B;  3REJ A;  4KUD B;  4WU8 D;  3WKJ B;  1H3O A;  4LD9 B;  2Y2G A;  2FJ7 A;  3KXB D;  3X1U D;  2JCH A;  3X1T D;  3LZ0 C;  3O62 C;  3LEL D;  3VH6 T;  4J8V A;  3AZG D;  5B33 D;  2RVQ C;  5GT0 C;  3WTP C;  2BYM B;  5B2J D;  1P3G D;  2ZY4 A;  1M19 D;  2NQB C;  4G91 B;  4HGA C;  5B0Y C;  5B24 C;  1EQZ C;  2Y2L A;  3WAA A;  3AV1 A;  3NQJ A;  1WWS A;  5B1L A;  5AV6 A;  3LZ1 A;  4QLC D;  3KWQ C;  1M18 C;  1P3L C;  1ZLA C;  3AZM B;  3R45 A;  5GSU A;  5DNN A;  3REJ D;  3B0D C;  1P34 B;  5B32 C;  1P3K C;  1M1A B;  3X1V C;  1B6W A;  2F8N D;  2Y2P A;  2FJ7 D;  4UUZ B;  3REL D;  5AV9 A;  5KDM B;  2ARO C;  4XUJ C;  3C1C D;  4J8V D;  5DNM A;  2Y2K A;  3MGQ A;  3MGR B;  2HIO A;  3AZJ B;  4J8X D;  1P3A C;  1P3F A;  1JFI B;  3WAA D;  3H0L C;  3AV1 D;  3UTA A;  5B0Z C;  3AZI D;  5GSU D;  5DNN D;  3W97 A;  2CV5 D;  1P3B D;  2F2A C;  3AZK B;  3B6F C;  3AFA B;  5CPK B;  1BH8 B;  5CP6 C;  1BH9 A;  1F66 B;  3AYW C;  5AVC B;  4JJN C;  2ZY2 A;  5AV8 B;  5B31 C;  5AY8 A;  2NZD C;  4X23 B;  1P3M C;  4KGC B;  5JRG A;  3AN2 C;  4KHA A;  2DF4 C;  2Y2I A;  2HIO D;  5BS7 C;  3UTB C;  1P3F D;  3LZ0 A;  1P3P A;  5B40 D;  4J8W A;  3F6T A;  1WWI A;  3B0B A;  5GT0 A;  3WTP A;  1HQ3 B;  4WU9 B;  3REH B;  3X1S A;  2ZY5 A;  5CPJ C;  3W97 D;  1ID3 B;  3AZN C;  1KX3 B;  2Y2H A;  5B0Y A;  5B24 A;  3TU4 B;  1P3O D;  4ZUX B;  1EQZ A;  5AV5 B;  4G92 C;  3C1B D;  3B6G B;  3KWQ A;  5AVB D;  1M18 A;  1ZLA A;  5AY8 D;  5G49 B;  3VH5 A;  1TZY C;  3AZH D;  2ZM5 A;  2IO5 B;  5JRG D;  1AOI B;  4YS3 B;  5B32 A;  4H9Q A;  3VH5 W;  3MGP A;  3MNN C;  2Y2N A;  4J8U C;  1P3P D;  4J8W D;  5BO0 B;  3REK A;  3AZL D;  5B2I A;  4YM6 C;  3X1S D;  3LJA C;  1U35 C;  4CAY B;  3MGS B;  3UT9 C;  4NFT A;  2PYO D;  2BYK A;  5B1M B;  1EQZ D;  4R8P B;  3AZF B;  5CPI B;  5BT1 D;  3KUY B;  1P3I D;  1TAF A;  4WU8 B;  1N1J A;  4Z66 C;  3WA9 A;  3KXB B;  3X1U B;  3X1T B;  4NE3 A;  4KUD C;  5CP6 A;  4XZQ C;  3MGP D;  4Z2M G;  3WKJ C;  4LD9 C;  5FUG A;  3AYW A;  4JJN A;  3LEL B;  5B31 A;  5B33 B;  3REK D;  5B2J B;  5B2I D;  1P3G B;  1P3M A;  1M19 B;  4H9S A;  4H9O A;  3AN2 A;  5BS7 A;  4UPK A;  4WNN B;  3MVD D;  2LY8 A;  4QLC B;  4Z5T D;  1KX4 D;  4G91 C;  3REJ B;  2DQN C;  1H3O B;  3WA9 D;  3AZM C;  2FJ7 B;  2F8N B;  3REI A;  4CSR A;  5GXQ D;  3REL B;  4AWL B;  1P34 C;  3AYW D;  4J8V B;  3C1C B;  1M1A C;  1S32 B;  5E5A A;  3W96 D;  4J8X B;  2HUE B;  3MGR C;  4H9N B;  4EO5 B;  3WAA B;  4J8U A;  3AV1 B;  3W99 D;  3AZJ C;  3AZI B;  3V9R B;  1KX5 A;  2CWE A;  3R45 B;  5GSU B;  5DNN B;  3B0C W;  2CV5 B;  1P3B B;  2Y2O A;  3LJA A;  1U35 A;  3REI D;  4ZBJ B;  3AZK C;  3AFA C;  1Q9C A;  5CPK C;  1F66 C;  3C1C A;  5AVC C;  5AV8 C;  5E5A D;  4H9P B;  2HIO B;  2YFV B;  4X23 C;  2J8P A;  1P3F B;  4XZQ A;  5B40 B;  3WKJ A;  4KGC C;  4LD9 A;  3AZE A;  1HTA A;  1KX5 D;  4NE5 A;  3WTP E;  3W97 B;  2ZY3 A;  1P3O B;  1HQ3 C;  1BH9 B;  3REH C;  2BYM A;  5B1L D;  5AV6 D;  3LZ1 D;  4WU9 C;  3C1B B;  5JA4 A;  1ID3 C;  1KX3 C;  5AVB B;  3W98 A;  5AY8 B;  3TU4 C;  4ZUX C;  5F99 A;  3AV2 A;  5AV5 C;  1B67 A;  3AZH B;  3B6G C;  5JRG B;  5AV9 D;  5B32 G;  5GT3 A;  1P3P B;  4J8W B;  2IO5 C;  1AOI C;  1P34 A;  4YS3 C;  5DNM D;  3AZE D;  3AZL B;  3MGQ D;  4UUZ A;  5KDM A;  3VH6 A;  3X1S B;  1A7W A;  3O62 A;  2PYO B;  3UTA D;  3AZJ A;  3MGS C;  1JFI A;  2F8N K;  3W98 D;  1P3I B;  2NQB A;  5B1M C;  5BNV A;  5CHL B;  4R8P C;  5F99 D;  3AZF C;  3EPL A;  3AV2 D;  5CPI C;  5BNX B;  3KUY C;  4H9Q B;  3MGP B;  4WU8 C;  1P3L A;  5GT3 D;  2FFF B;  3KXB C;  3AZK A;  3X1U C;  3X1T C;  5CPK A;  5B31 G;  1F66 A;  3REK B;  3AL0 C;  2G5I C;  5B2I B;  3LEL C;  5AV8 A;  3IP4 C;  1P3K A;  3X1V A;  5B33 C;  4H9R A;  3MVD B;  3LZ0 D;  3A6N B;  2ARO A;  5B2J C;  3O62 D;  1P3G C;  1M19 C;  2BYK B;  4XUJ A;  4KGC A;  4Z5T B;  1KX4 B;  2RVQ D;  5GT0 D;  3WTP D;  2Y2J A;  1P3A A;  4QLC C;  4E44 A;  2NQB D;  3WA9 B;  5B0Y D;  5B24 D;  5GXQ B;  1HQ3 A;  3REJ C;  4WU9 A;  5B0Z A;  3KWQ D;  1M18 D;  3AYW B;  1P3L D;  1ID3 A;  1ZLA D;  2FJ7 C;  3REL C;  4AWL C;  4DRA A;  5C3I B;  3B6F A;  5AV5 A;  3W96 B;  4J8V C;  3C1C C;  5B32 D;  1P3K D;  3X1V D;  3KSY A;  3P5J B;  4H9O B;  1S32 C;  3AZG B;  1S32 A;  2ARO D;  3W99 B;  2W8S A;  2NZD A;  4XUJ D;  4J8X C;  4YS3 A;  2HUE C;  2XD1 A;  3WAA C;  4EO5 C;  3AV1 C;  3A1I A;  3UTB A;  1T3U A;  2JE5 A;  2G5H C;  1P3A D;  5BO0 A;  3AZI C;  5GSU C;  4CSR B;  1W2E A;  5DNN C;  3REI B;  2CV5 C;  1P3B C;  3NQU A;  5B0Z D;  3H0M C;  5CPJ A;  4ZBJ C;  3AZN A;  5E5A B;  3AZF A;  3B6F D;  5CPI A;  5CP6 D;  4WU8 A;  4JJN D;  5B31 D;  3KXB A;  2HIO C;  3X1T A;  2NZD D;  1TZY A;  1P3F C;  5B40 C;  1KX5 B;  1P3M D;  3AN2 D;  2F8N H;  4Z2M H;  5B33 A;  3UTB D;  3MNN A;  3NQJ B;  5B1L B;  3LZ1 B;  5AV6 B;  1M19 A;  3W97 C;  4YM6 A;  1P3O C;  5CPJ D;  3C1B C;  4QLC A;  3FDD A;  5AVB C;  3UT9 A;  3AZN D;  5AY8 C;  2YFW A;  5AV9 B;  3AZH C;  5JRG C;  5DNM B;  3AZE B;  2F8N A;  1F1E A;  3MGQ B;  3REL A;  2L5A A;  4Z66 A;  1TZY D;  1P3P C;  4J8W C;  4KUD A;  1PZR A;  3AZL C; 
#chains in the Genus database with same CATH homology
 3MNN D;  4J8U D;  3X1S C;  3UTA B;  4J8X A;  5JA4 B;  3W98 B;  2PYO C;  4H9N A;  4YM6 D;  5F99 B;  3LJA D;  3AV2 B;  1U35 D;  5BT1 C;  3V9R A;  3UT9 D;  3AZI A;  1P3I C;  3KFU G;  2CV5 A;  1P3B A;  5GT3 B;  3MGP C;  3VH5 T;  4Z66 D;  3AZM A;  4KHA B;  2JSS A;  3EPH A;  3H0R C;  4KUD D;  4XZQ D;  3LZ0 B;  3REK C;  3WKJ D;  1S32 D;  5B2I C;  4LD9 D;  3O62 B;  1M1A A;  1ULY A;  4H9P A;  5GT0 B;  3MVD C;  2YFV A;  1Z2C B;  3WTP B;  3A6N C;  5B40 A;  2NQB B;  4Z5T C;  5BNV B;  3VH6 W;  1KX4 C;  4WJ3 C;  4HGA B;  3EG5 B;  5B0Y B;  3MGR A;  5B24 B;  1EQZ B;  4E45 A;  3KWQ B;  1M18 B;  1P3L B;  1ZLA B;  3WA9 C;  3EPK A;  5GXQ C;  1P3O A;  3EPJ A;  3B0D B;  3C1B A;  5AVB A;  5B32 B;  3AZM D;  1P3K B;  3X1V B;  4DRB A;  4H9R B;  2UWX A;  5C3I C;  3W96 C;  2ARO B;  3AFA A;  1BH8 A;  3AZH A;  1P34 D;  4XUJ B;  1M1A D;  4H9S C;  5AVC A;  1R4V A;  3AZG C;  3W99 C;  4X23 A;  1P3A B;  3AZL A;  3MGR D;  3AZJ D;  5B0Z B;  1KU5 A;  1BFM A;  1TAF B;  3REI C;  2PYO A;  1N1J B;  2Y2M A;  3B6F B;  5CP6 B;  3REH A;  1P3I A;  5FUG B;  4JJN B;  1KX3 A;  5B31 B;  5E5A C;  3AZK D;  2BG1 A;  3AFA D;  5CPK D;  3TU4 A;  5BNX A;  4ZUX A;  1F66 D;  2NZD B;  1P3M B;  5AVC D;  3B6G A;  5AV8 D;  3AN2 B;  5G49 A;  3UTB B;  4X23 D;  1KX5 C;  1AOI A;  4KGC D;  3NQU B;  3B0C T;  3MVD A;  3A6N A;  5B1L C;  3LZ1 C;  5AV6 C;  4DQY B;  5CPJ B;  4Z5T A;  3AZN B;  1KX4 A;  1HQ3 D;  4WU9 D;  3REH D;  4CAY A;  4G92 B;  3MGS A;  4M6B A;  1KX3 D;  4WV4 B;  1ID3 D;  5B1M A;  5GXQ A;  5AV9 C;  4ZUX D;  3TU4 D;  4R8P A;  1TZY B;  2F8N G;  5AV5 D;  3B6G D;  5DNM C;  3KUY A;  3AZE C;  3MGQ C;  3MNN B;  4J8U B;  3W96 A;  3X1U A;  1AOI D;  4YS3 D;  3A1K A;  3LEL A;  4NE6 A;  4YM6 B;  3AZG A;  3A6N D;  2VQR A;  3UTA C;  3LJA B;  1U35 B;  3W99 A;  4WZS B;  3UT9 B;  3W98 C;  5B2J A;  1P3G A;  2YFW B;  5F99 C;  3AV2 C;  4WNN A;  3MGS D;  2XD5 A;  5B1M D;  4Z66 B;  4R8P D;  5GT3 C;  3AZF D;  2Y2Q A;  5CPI D;  2RIQ A;  3KUY D;  4XZQ B;  3REJ A;  4KUD B;  4WU8 D;  3WKJ B;  1H3O A;  4LD9 B;  2Y2G A;  2FJ7 A;  3KXB D;  3X1U D;  2JCH A;  3X1T D;  3LZ0 C;  3O62 C;  3LEL D;  3VH6 T;  4J8V A;  3AZG D;  5B33 D;  2RVQ C;  5GT0 C;  3WTP C;  2BYM B;  5B2J D;  1P3G D;  2ZY4 A;  1M19 D;  2NQB C;  4G91 B;  4HGA C;  5B0Y C;  5B24 C;  1EQZ C;  2Y2L A;  3WAA A;  3AV1 A;  3NQJ A;  1WWS A;  5B1L A;  5AV6 A;  3LZ1 A;  4QLC D;  3KWQ C;  1M18 C;  1P3L C;  1ZLA C;  3AZM B;  3R45 A;  5GSU A;  5DNN A;  3REJ D;  3B0D C;  1P34 B;  5B32 C;  1P3K C;  1M1A B;  3X1V C;  1B6W A;  2F8N D;  2Y2P A;  2FJ7 D;  4UUZ B;  3REL D;  5AV9 A;  5KDM B;  2ARO C;  4XUJ C;  3C1C D;  4J8V D;  5DNM A;  2Y2K A;  3MGQ A;  3MGR B;  2HIO A;  3AZJ B;  4J8X D;  1P3A C;  1P3F A;  1JFI B;  3WAA D;  3H0L C;  3AV1 D;  3UTA A;  5B0Z C;  3AZI D;  5GSU D;  5DNN D;  3W97 A;  2CV5 D;  1P3B D;  2F2A C;  3AZK B;  3B6F C;  3AFA B;  5CPK B;  1BH8 B;  5CP6 C;  1BH9 A;  1F66 B;  3AYW C;  5AVC B;  4JJN C;  2ZY2 A;  5AV8 B;  5B31 C;  5AY8 A;  2NZD C;  4X23 B;  1P3M C;  4KGC B;  5JRG A;  3AN2 C;  4KHA A;  2DF4 C;  2Y2I A;  2HIO D;  5BS7 C;  3UTB C;  1P3F D;  3LZ0 A;  1P3P A;  5B40 D;  4J8W A;  3F6T A;  1WWI A;  3B0B A;  5GT0 A;  3WTP A;  1HQ3 B;  4WU9 B;  3REH B;  3X1S A;  2ZY5 A;  5CPJ C;  3W97 D;  1ID3 B;  3AZN C;  1KX3 B;  2Y2H A;  5B0Y A;  5B24 A;  3TU4 B;  1P3O D;  4ZUX B;  1EQZ A;  5AV5 B;  4G92 C;  3C1B D;  3B6G B;  3KWQ A;  5AVB D;  1M18 A;  1ZLA A;  5AY8 D;  5G49 B;  3VH5 A;  1TZY C;  3AZH D;  2ZM5 A;  2IO5 B;  5JRG D;  1AOI B;  4YS3 B;  5B32 A;  4H9Q A;  3VH5 W;  3MGP A;  3MNN C;  2Y2N A;  4J8U C;  1P3P D;  4J8W D;  5BO0 B;  3REK A;  3AZL D;  5B2I A;  4YM6 C;  3X1S D;  3LJA C;  1U35 C;  4CAY B;  3MGS B;  3UT9 C;  4NFT A;  2PYO D;  2BYK A;  5B1M B;  1EQZ D;  4R8P B;  3AZF B;  5CPI B;  5BT1 D;  3KUY B;  1P3I D;  1TAF A;  4WU8 B;  1N1J A;  4Z66 C;  3WA9 A;  3KXB B;  3X1U B;  3X1T B;  4NE3 A;  4KUD C;  5CP6 A;  4XZQ C;  3MGP D;  4Z2M G;  3WKJ C;  4LD9 C;  5FUG A;  3AYW A;  4JJN A;  3LEL B;  5B31 A;  5B33 B;  3REK D;  5B2J B;  5B2I D;  1P3G B;  1P3M A;  1M19 B;  4H9S A;  4H9O A;  3AN2 A;  5BS7 A;  4UPK A;  4WNN B;  3MVD D;  2LY8 A;  4QLC B;  4Z5T D;  1KX4 D;  4G91 C;  3REJ B;  2DQN C;  1H3O B;  3WA9 D;  3AZM C;  2FJ7 B;  2F8N B;  3REI A;  4CSR A;  5GXQ D;  3REL B;  4AWL B;  1P34 C;  3AYW D;  4J8V B;  3C1C B;  1M1A C;  1S32 B;  5E5A A;  3W96 D;  4J8X B;  2HUE B;  3MGR C;  4H9N B;  4EO5 B;  3WAA B;  4J8U A;  3AV1 B;  3W99 D;  3AZJ C;  3AZI B;  3V9R B;  1KX5 A;  2CWE A;  3R45 B;  5GSU B;  5DNN B;  3B0C W;  2CV5 B;  1P3B B;  2Y2O A;  3LJA A;  1U35 A;  3REI D;  4ZBJ B;  3AZK C;  3AFA C;  1Q9C A;  5CPK C;  1F66 C;  3C1C A;  5AVC C;  5AV8 C;  5E5A D;  4H9P B;  2HIO B;  2YFV B;  4X23 C;  2J8P A;  1P3F B;  4XZQ A;  5B40 B;  3WKJ A;  4KGC C;  4LD9 A;  3AZE A;  1HTA A;  1KX5 D;  4NE5 A;  3WTP E;  3W97 B;  2ZY3 A;  1P3O B;  1HQ3 C;  1BH9 B;  3REH C;  2BYM A;  5B1L D;  5AV6 D;  3LZ1 D;  4WU9 C;  3C1B B;  5JA4 A;  1ID3 C;  1KX3 C;  5AVB B;  3W98 A;  5AY8 B;  3TU4 C;  4ZUX C;  5F99 A;  3AV2 A;  5AV5 C;  1B67 A;  3AZH B;  3B6G C;  5JRG B;  5AV9 D;  5B32 G;  5GT3 A;  1P3P B;  4J8W B;  2IO5 C;  1AOI C;  1P34 A;  4YS3 C;  5DNM D;  3AZE D;  3AZL B;  3MGQ D;  4UUZ A;  5KDM A;  3VH6 A;  3X1S B;  1A7W A;  3O62 A;  2PYO B;  3UTA D;  3AZJ A;  3MGS C;  1JFI A;  2F8N K;  3W98 D;  1P3I B;  2NQB A;  5B1M C;  5BNV A;  5CHL B;  4R8P C;  5F99 D;  3AZF C;  3EPL A;  3AV2 D;  5CPI C;  5BNX B;  3KUY C;  4H9Q B;  3MGP B;  4WU8 C;  1P3L A;  5GT3 D;  2FFF B;  3KXB C;  3AZK A;  3X1U C;  3X1T C;  5CPK A;  5B31 G;  1F66 A;  3REK B;  3AL0 C;  2G5I C;  5B2I B;  3LEL C;  5AV8 A;  3IP4 C;  1P3K A;  3X1V A;  5B33 C;  4H9R A;  3MVD B;  3LZ0 D;  3A6N B;  2ARO A;  5B2J C;  3O62 D;  1P3G C;  1M19 C;  2BYK B;  4XUJ A;  4KGC A;  4Z5T B;  1KX4 B;  2RVQ D;  5GT0 D;  3WTP D;  2Y2J A;  1P3A A;  4QLC C;  4E44 A;  2NQB D;  3WA9 B;  5B0Y D;  5B24 D;  5GXQ B;  1HQ3 A;  3REJ C;  4WU9 A;  5B0Z A;  3KWQ D;  1M18 D;  3AYW B;  1P3L D;  1ID3 A;  1ZLA D;  2FJ7 C;  3REL C;  4AWL C;  4DRA A;  5C3I B;  3B6F A;  5AV5 A;  3W96 B;  4J8V C;  3C1C C;  5B32 D;  1P3K D;  3X1V D;  3KSY A;  3P5J B;  4H9O B;  1S32 C;  3AZG B;  1S32 A;  2ARO D;  3W99 B;  2W8S A;  2NZD A;  4XUJ D;  4J8X C;  4YS3 A;  2HUE C;  2XD1 A;  3WAA C;  4EO5 C;  3AV1 C;  3A1I A;  3UTB A;  1T3U A;  2JE5 A;  2G5H C;  1P3A D;  5BO0 A;  3AZI C;  5GSU C;  4CSR B;  1W2E A;  5DNN C;  3REI B;  2CV5 C;  1P3B C;  3NQU A;  5B0Z D;  3H0M C;  5CPJ A;  4ZBJ C;  3AZN A;  5E5A B;  3AZF A;  3B6F D;  5CPI A;  5CP6 D;  4WU8 A;  4JJN D;  5B31 D;  3KXB A;  2HIO C;  3X1T A;  2NZD D;  1TZY A;  1P3F C;  5B40 C;  1KX5 B;  1P3M D;  3AN2 D;  2F8N H;  4Z2M H;  5B33 A;  3UTB D;  3MNN A;  3NQJ B;  5B1L B;  3LZ1 B;  5AV6 B;  1M19 A;  3W97 C;  4YM6 A;  1P3O C;  5CPJ D;  3C1B C;  4QLC A;  3FDD A;  5AVB C;  3UT9 A;  3AZN D;  5AY8 C;  2YFW A;  5AV9 B;  3AZH C;  5JRG C;  5DNM B;  3AZE B;  2F8N A;  1F1E A;  3MGQ B;  3REL A;  2L5A A;  4Z66 A;  1TZY D;  1P3P C;  4J8W C;  4KUD A;  1PZR A;  3AZL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...