1KXLA

Solution structure of the cdc13 dna-binding domain in a complex with single-stranded telomeric dna (dna structure not modeled)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
187
structure length
187
Chain Sequence
KMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structure for single-stranded telomeric DNA recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords CELL DIVISION CONTROL PROTEIN 13
total genus 25
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1kxlA00
1Q1BA 2ID0A 2UU9L 3OTOQ 3CXCA 2CWPA 4DR2L 4OONA 4IFDG 2CQOA 4A3MH 1HR0Q 4R1JA 4A3BH 2JA7H 2AKWB 4JOIC 3G48A 3E9HA 4DKAC 3RN2A 3FKIH 4DV0Q 3I55A 4A3GG 1L1OC 2JA6G 4K0KL 4WJ4A 1Z47A 4DK3C 1Y1WG 3J7A5 3PIPA 1HZBA 2D0PA 3RLOA 2NVYH 4X62Q 5LMNL 4A75A 4A76A 1VQ7A 1VQ4A 3BZKA 4K0KQ 4UPAA 3U50C 4LNQA 3GTKH 2B3GA 4C3HH 4YY3L 4X6AH 4DV2Q 1XNRQ 1K3RA 1CUKA 1NBWA 3TS2A 1KQSA 3GTGH 1KL9A 2PQAA 2I5HA 3I4MG 1D7QA 3K7AH 3CCMA 3J7ZC 4DV6L 4GNXC 1YJ9A 1OXXK 4IPCA 2K5NA 4BBRG 4POFA 4JG2A 3RNUA 4LF4Q 3W1GA 1N32Q 1VQ9A 4JBMA 1JJGA 2MQHA 4PZ6A 4RG1A 4B3TL 2A8VA 1X65A 2LXKA 1Y1VG 4DV7Q 1IYJB 2ZTEA 3TREA 4QGUA 1YHQA 1CKMA 2Z6KA 4LUOA 3CCRA 4DV5Q 5FLMH 3CCLA 3SGIA 3H0GH 4A3JH 3S1MH 3S15H 1NJIC 4DPGA 2CWAA 4ALPA 4EQ5A 1YJNA 1JMCA 2BH2A 4LF7L 3K81C 2VS1A 2ATWA 4KLKA 3T1YQ 2PQAB 4GKJL 2OTJA 1YIJA 4LF5L 4DV3Q 1ASYA 4JI4Q 3S17H 3FHWA 3NENA 4KHPQ 4LF6L 3PUVA 4OWXB 1UEBA 3S24A 1Q86C 3H3VH 1BBUA 2IHFA 3UDFA 2QA4A 4XTCS 4AYBE 3TRZA 1YHBA 2ZJRA 4IJLA 1XPOA 4HJ7A 4A3GH 2VQEL 2NN6I 2OQKA 2ALYB 4JI7L 3T1HL 1XMOQ 4A3LH 2ASBA 4JI4L 2R93H 1SLJA 3GO5A 4O2DA 5IP9G 5FLMG 1VQEA 1Y1VH 1EQRA 4GKJQ 4JI5Q 2E5LL 1UWVA 5LMUQ 4JI0L 2MO0A 1OXUA 4HJ5A 3I4MH 1QZHA 4MZ9A 1PH8A 1O7IA 5JEAG 3DLLA 4MTNA 5JEAJ 3WWVA 1PH4A 1R9TH 3ZJYC 3RZOH 5IE8A 4DR6L 4GN3B 1PH9A 2E5LQ 3GTLH 1K83H 1FL0A 1LYLA 4A3FG 1OXSC 5M5XH 2JE6I 1X3GA 2JK8A 4BBSG 5BR8L 2UUCL 1Q8KA 2BA0A 1I6HH 3EBEA 2VQEQ 5E7NA 1XMQL 2YTXA 2Q2TA 4LF4L 4A3DG 1VQMA 3PF5A 2QGQA 3FP9A 1IXRA 1IBKL 3M4QA 4A3LG 2HT1A 4DV1Q 4A3JG 4A3IG 4DK6C 4LF6Q 4QQBX 4XIGS 1X55A 1HNWL 4P72A 4Y52H 4DR1L 4DV2L 2UUAQ 1XNRL 1L2FA 4LUZA 4DV3L 3S16H 1PYBA 1P8LA 1EUJA 3S2DH 4DR4L 1M1KC 3HOYG 5C44G 1CKNA 2E2HH 3KFUA 4PG3A 1K73C 1WJJA 2AMCB 2VW9A 2D0OA 3UDGA 1MJEA 4A3EH 4LF8L 2R7ZH 3PUYA 4JOIA 1VQNA 4HIOA 1VQ6A 2HIVA 2K14A 1CKNB 4JBWA 4P75A 4DR3Q 4B3RL 2WB1G 1VQAA 3CMEA 4OWWB 4L5QA 3CPFA 4TVAB 1VQIA 2E2IH 4YHHQ 3K8AA 5GAGC 4IFDJ 3I2ZA 5GROA 4PMWA 3KDFB 2VUMH 1HZ9A 1I5FA 1GD7A 2NVQH 3E0EA 5C0XI 1GKHA 1VQGA 1HNXL 3UE1A 1HZAA 3AQQA 1QUQB 1E1OA 2CFMA 1X6OA 4FDBA 1CSQA 1VQ8A 1LUZA 3M7NA 2R7DA 3CCEA 2KHJA 4DUZQ 4BY1H 3RR5A 5C4XG 1NMGA 2N49A 2IX0A 1YZ6A 1V9PA 4A3MG 2JQOA 1WFQA 3JC66 2GVBA 4B3RQ 4IPGA 4LF9L 4YCUA 3PO3G 5LMNQ 4DV5L 4WJ3M 1AE2A 1FGUA 1SFOH 3KLWA 1Q12A 1VQLA 1VQKA 3CCVA 3CP0A 2Z6KC 4DV0L 1PH3A 3E9IA 4DV7L 5JJKA 2OTLA 1UE1A 1IZ6A 1AE3A 3ULJA 4NXMQ 1TWCH 1VQBA 3M9BA 2ZJPA 3RN5A 2UU9Q 4JI1L 1BBWA 4EX5A 4JI6Q 5DLQE 4BXXG 4BBSH 3A74A 4UP8A 3CCUA 2DGYA 5IP7H 2JA8G 3AYHB 3OYYA 1B7YB 3NBHB 4JBJA 4ME3A 4DV1L 4A3FH 1YJWA 2NVTH 2R7ZG 2N8NA 5M5WH 1PH2A 3TEHB 2WAQE 4R4QA 2OQ0A 4X66L 5H1SE 1A62A 2GVAA 4B3SL 4IOAA 4JV5Q 5JJIA 1VQFA 2K52A 2EQSA 4LUVA 1JT8A 3I4NH 4X65Q 4A93G 1VQPA 3F1ZA 2K50A 1E7ZA 4IPDA 5BR8Q 5LMNW 2UUCQ 2OWOA 3GD7A 4OX9Q 3F2BA 3K0XA 1XJVA 4QJFA 2RCNA 4BA2I 2H5XA 4QL5A 2Z0SA 4LF9Q 3GTOH 3S1QH 3S1NH 1Q7YC 2N78A 2PI2E 1WCMG 2V1CC 5HY6A 3STBD 4NB3A 3ULPA 5IYCG 1FJGL 2RF4A 4JI2Q 1HR0L 3RLFA 2MFIA 3HOWG 4A3CH 2UXBL 4TQUS 2XGTA 4JI5L 1RL2A 3ULLA 1CSPA 1WCMH 5M3FG 1EYGA 1K8GA 4DR7L 3M4OH 2R7FA 4DR5Q 3CD6A 2EXDA 3NELA 3DM3A 4JI3Q 3HOUH 5J3BA 2UXDQ 2HHHQ 5C4XH 2R92G 5IT9c 2LXJA 2E2JH 2YU9H 1TWFH 4Y7NH 1KHIA 1PHJA 2MO1A 1YVCA 3CMAA 5M3MG 5IWAL 5IYDG 1GM5A 3PO2G 3CPWA 4DR7Q 1OTCA 3IRBA 2R93G 2CCZA 3I4OA 3HOZH 2IHEA 4BXXH 1NTGA 4GS3A 4GN4B 3KF6B 2WB1E 4X64Q 4A3DH 2UXCQ 4JYAQ 4X64L 3G6EA 4LF7Q 4A3KH 2K5VA 3OW2A 1L1OA 5AJ3Q 4R4IA 1LTLA 4YWLA 4DR1Q 1HNWQ 4OXPA 3PIOA 4C2MH 4NXNQ 3Q8DA 1TWGH 1S72A 5IWAQ 1I50H 2A1AA 2WP8J 3PGZA 1X56A 2E8GA 4JI8Q 5IYBG 3RZDH 1Q1EA 1QUQA 3HOXG 5EAYA 4R4TA 1EWIA 3K80C 4LW1A 3PF4A 1J5EL 4LFCL 5M3FH 4UP9A 1FVIA 1YI2A 2VZAA 1N36Q 2QEXA 1SRUA 4L5TA 3STBC 4P71A 1N36L 2UXDL 3PSIA 3F2CA 3KJOA 4A3BG 3KDFA 2YTVA 5IYCH 3FKIG 1YEZA 1L0WA 3J81j 1MJCA 4AYBG 5M5YH 3GTPH 4DAMA 1Y1WH 2BH8A 2K4KA 4LFBQ 4A3IH 4NXML 4O0AA 1P16A 4RMFA 3JAMc 1U0LA 4JBKA 1N9WA 1XTDA 2RHSB 4A93H 3GTMH 2JA9A 5C0XJ 2UXCL 3HOVG 3HKZE 1HH2P 5FLXc 4HIKA 5IYBH 1S40A 1X54A 1XMOL 1X9NA 2Q2UA 2JJQA 2I0QA 3S14H 3AFPA 3EN2A 3I56A 4DUYL 2VL6A 1X3FA 2ZTCA 5GQOA 2JEBI 2K5HA 4HJAA 3HKZG 4A3EG 1PH5A 4B3SQ 1BKBA 4OO1G 4DV4Q 5GAHC 3OTOL 3CQZH 2IY5B 1XNQL 3PO2H 4NPSA 1I94Q 1IBLL 2LSSA 1C9OA 2CKZB 5FJ8G 4GNXB 1HNXQ 2JA5H 4KHPL 5IY0A 2B63G 4DR5L 2ES2A 1EIYB 3HOYH 2F52A 1BVSA 2HQLA 3A0JA 4P73A 3S2HH 4POGA 4B3ML 1LM0A 3KOJA 5FJ8H 5C44H 1IBMQ 4JI2L 4LFAL 1UE5A 2DUDA 1M90C 4BY1G 2I5MX 4DR3L 2PNHA 2B63H 2F4VQ 1I3QH 2RHQB 1HZCA 3HOXH 2XTIA 4DNIA 3KF8B 3JAMi 4OO1I 2UUBL 5C4JH 2NN6G 2GN5A 1HJPA 1SR3A 1QZGA 4L5SA 5JJLA 3GTJH 4QIWE 1OXVA 4OX9L 2AWOA 4AH6A 2ZJQA 3PV0A 4GNXA 4DR4Q 1EIFA 5GAEC 1JE5A 1TWAH 1B70B 1NE3A 2NZOA 4DV6Q 3D31A 1A8VA 3W1BA 1I94L 1PH1A 1XNQQ 3PUXA 1UE7A 3H15A 4APVA 1MKHA 1MIUA 5IP9H 1QVGA 2ZM6L 3PUWA 5C3EG 1YHAA 3BU2A 4YWKA 4JI1Q 4HJ8A 2FXQA 4YY3Q 4JI6L 1OXTA 3VDYA 1NY4A 3J80i 1KRTA 1K8AC 2WFWA 1YITA 3A5ZB 4L5RC 5K36G 1E24A 1A63A 3RLNA 4BY7H 4GLXA 4JC0A 2HIXA 2NVXH 2AWNA 1EQQA 4LF8Q 4HIMA 4GOPB 4GLVB 4GOPC 4JCVE 1C7YA 1SE8A 2D62A 5LMUL 4JI0Q 3J80c 1VQ5A 4UY8C 3U4VA 3W5OA 1IL2A 2VY3A 3UDXA 3HFZB 2ZM6Q 3M85A 3L2PA 4A3CG 1PVOA 1KXLA 3PO3H 3F8TA 1B8AA 1N33L 1KAWA 1VQHA 4PZ8A 4BA1I 3D0FA 1PYSB 3T1HQ 3HOZG 4PZ7A 2EIFA 1Z9FA 2AHOB 4R4CA 3A5UA 3K7UC 3H0GG 1YNXA 3LGJA 4QY7A 2YV5A 5ELOA 1XMQQ 1J5EQ 1JB7A 4J15A 1KD1C 2A19A 1VQCA 2BA1A 3BJUA 5C3EH 4JI8L 3I4NG 4YHHL 3HOVH 1XPRA 2B29A 1N8RC 2C35B 1RIPA 2KHIA 4IO9A 2UUBQ 4AIMA 2WAQG 3S1RH 1XPUA 1JJ2A 1VQJA 5IP7G 2JA8H 4DR6Q 2JA5G 1PFSA 1YBYA 4HIDA 1VQDA 2PI2A 4YCVA 5C0XG 3G71A 1N34Q 1H95A 2ZTDA 4P74A 4IFDI 1IBML 3U58A 4YWMA 4MNOA 4H02A 2JEAI 5HGQA 2NZHA 1N34L 3ERSX 1S3OA 3UE0A 4C3JH 1W2BA 3KF6A 2Q2IA 3HOUG 2UUAL 1ASZA 4IOCA 2L15A 3CF5A 1SN8A 1K0RA 2K75A 4GOPA 4AQYQ 1HNZL 3GTQH 1EOVA 1KRSA 4A4IA 1IBKQ 4DV4L 1WI5A 4R4OA 4JI3L 1VCIA 3MEFA 1E1TA 4YCWA 4DUYQ 3UDIA 4BY7G 1J6QA 2MNAA 2Y0SG 4C3IH 3EIVA 4KI0A 3CCJA 3CCQA 2UXBQ 1SROA 1TWHH 1D8LA 2JA6H 3PUZA 4UP7A 1N33Q 3CAMA 3ER0A 4LF5Q 1UE6A 4OWTB 4NXNL 2VQFL 1FJGQ 4IPHA 2R6GA 1X3EA 1KC8C 4GKKQ 1L1OB 4GKKL 2KBNA 2N3SA 2OCEA 1PH6A 4JYAL 2Y0SE 2VQFQ 3PCOB 3NEMA 4LFBL 1EFWA 1QVFA 3KYHC 4GLAC 1DGSA 1Q46A 4X65L 1K9MC 1VQOA 4GN5A 2Q2HA 4IJHA 3F2DA 3L7ZC 4DAYB 2YTYA 3TS0A 4JI7Q 1N32L 2I5LX 3HOWH 1SMXA 3CCSA 4DR2Q 1T9HA 1HNZQ 4AQYL 3HKSA 4LFCQ 3L0OA 2HHHL 2KCMA 3AFQA 3M3YH 1AH9A 1G291 2PMZE 1C0AA 1E3PA 1PH7A 3B6YA 1A0IA 3H3VI 2JA7G 1KIXA 3U4ZA 2R92H 3CC7A 3M4PA 5AJ3L 5ELNA 4BBRH 3KJPA 1G6PA 3MXNB 3J81i 3T1YL 1HR0W 1G51A 1Q82C 1NMFA 3J81c 1TXYA 3CW2C 3AEVA 4X62L 1WYDA 2VUMG 2IT1A 3CC2A 1PV4A 1WOCA 3ICEA 2F3IA 1W3SA 4LWCA 2F4VL 1Y14B 4DUZL 4LFAQ 2KENA 1QVCA 4A3KG 1V1QA 1GVPA 5GADC 1VS0A 3CC4A 4B3MQ 4B3TQ 2IX1A 4X66Q 1E22A 4JV5L 1GO3E 1V43A 3GDEA 3TQYA 1JJCB 2KCTA 1Q81C 2YYZA 4KHZA 5M3MH 1CKOA 1U5KA 3BZCA 4HJ9A 2VNUD 5IYDH 3I7FA 1IBLQ 1PA6A 3G4SA
chains in the Genus database with same CATH superfamily
4IFDG 2CQOA 1NAPA 4ABNA 4A3DB 1A15A 3M3YB 2PZWA 3I55A 1RJTA 1Z47A 1Y1WG 3PIPA 1HZBA 1MSHA 2NVYH 3RLOA 4B08A 1TIID 3P7JA 3BZKA 1II3A 3EFXD 3MWYW 1B4OA 4LNQA 3LWEA 2B3GA 3IAYA 4C3HH 5M5XB 1K3RA 4G57A 4NMZA 1KQSA 5F2DA 3CU7A 2G9DA 1TS3A 3GTGH 3K7AH 5D3IB 3CCMA 3HEJA 1OXXK 4IPCA 4DAPA 3RNUA 5E4WC 3W3AA 5M5WB 2A68D 4RG1A 1HCZA 2CQAA 1Y1VG 3JAML 1SXTA 1CKMA 2Z6KA 2IL8A 3CCLA 4A3JH 3S15H 2IX3A 5A2QL 1NJIC 3F2UA 4LF7L 3S14B 4RA8A 3ONAB 4GKJL 4MTKA 4LF5L 4XQNA 1ASYA 3NENA 3AMUA 3PUVA 5HGTA 4O42A 1G6ZA 1Q86C 4WFN3 2QA4A 2Q8RE 3MVVA 3SVMA 4KMUC 1O7ZA 4HJ7A 4HSPA 1XMOQ 4A3LH 1PRTC 4O2DA 1C4QA 5ELCA 2XWBB 5FLMG 1QJOA 1Y1VH 5FO7B 4GKJQ 4JI5Q 1JORA 2FMCA 1UEAB 2MO0A 1QG7A 2I07B 4MTNA 1FNUA 3KLSA 1PH9A 4EQPA 3H0GB 1FL0A 4HCEA 2F0WA 3K5OA 1HQRD 5M5XH 1I6HH 4C3HG 3EBEA 2A6EC 2YTXA 4A3DG 1QWYA 2QGQA 1PDQA 3M4QA 3J81L 2HT1A 4KD3A 2WV6D 4DGZA 4Y52H 4P72A 3C1FA 1GUTA 3NE5B 4XT3B 1M1KC 3KFUA 5C44G 1CKNA 3DWQA 4H0LC 5KYIA 2VW9A 3A8JE 3MXPA 1LT4D 4OHJA 1MJEA 3S15B 3A55A 2NYZD 3PUYA 5KRUA 4JOIA 1VQNA 2K01A 1I4XA 3FVQA 4DNRB 4BWGB 3IFDA 3E0JA 4JBWA 4B3RL 3CPFA 3J7YW 4IFDJ 3ND9A 2F0GA 4ZKCB 1HZ9A 1KABA 5C0XI 1GHKA 2HCCA 1HNXL 4A3GB 1EQTA 3AQQA 1QUQB 1CSQA 5J22A 2R7DA 3CCEA 1YZ6A 1ENCA 1DZ1A 3JC66 1WFQA 4B3RQ 3DEPA 4YCUA 3D4DA 2F03A 5C6AA 4XDXA 5LMNQ 3GTOB 1VQKA 4XYQA 2Z6KC 1YNND 5JJKA 2P5ZX 4C3HB 1ZKOA 2JP1A 3EROA 4BBSH 4UP8A 3CCUA 2DGYA 4DV1L 2NVTH 1B7YB 4ME3A 5EPLA 3Q24A 3R3OA 4X66L 5JJIA 4IOAA 4LMQD 2F0IA 2K52A 2ICIA 4ILWA 5M3MB 2K50A 5LMNW 4IPDA 3Q22A 2UUCQ 5CV8A 5L37A 4ZLTF 1ET6A 3IFTA 1PTOB 2EDGA 4QJFA 4BA2I 2H5XA 4QL5A 3OMCA 2V1CC 1WCMG 2XNAC 4DAYA 3RLFA 4A3CH 3VA5A 3ULLA 5EKKA 3HOWB 2EXDA 3KLRA 5I9OA 2HHHQ 1KDAA 5IT9c 2EVBA 1EYDA 1NNXA 1YVCA 1OTCA 1STHA 5JPNC 2CCZA 2ZT9C 2IHEA 4GS3A 2CH4A 4WJWA 4ZQ3A 4X64L 1VMPA 1BQQT 5AJ3Q 1TWGH 2RSOA 3OOCA 3JAME 4JI8Q 5I9PA 4V0BA 2F0QA 2NN6H 1YI2A 3OPOA 2VZAA 1QNUA 1N36Q 5CC4A 3GTQB 1SRUA 3STBC 1I4RA 3KJOA 1JR0D 3TDQA 1YEZA 3J81j 1MJCA 4AYBG 4XQQA 4LFBQ 1PTOC 3JAMc 1OO9B 2EY1A 2JA9A 2PW5A 2N55A 3HOVG 3HKZE 5FLXc 2A6HC 2K33A 3HP3A 5IYBH 2RBMA 1X54A 1A2TA 3C1EA 3RZDB 2JJQA 2DJFC 2Q8TA 3EN2A 1TQOA 1X3FA 2R3ZA 5GAHC 4C3IB 4LAAA 2O4XA 2JA5H 2KEEA 1K0SA 5IY0A 2B63G 2ES2A 1BVSA 1EIGA 3BG3A 4OIJA 1CFMA 4B3ML 2LS01 1M90C 4DR3L 3MZ5A 2F0FA 5EBCA 2XTIA 5DNFA 2BCOA 5JVH3 2F0UA 3TP5A 1HJPA 1SR3A 1B9MA 5JJLA 3KBGA 2O2LD 4QIWE 4OX9L 2AWOA 1AP0A 4ME5A 4DFAA 5FO8B 5GAEC 2ENBA 2L4NA 1B70B 4DV6Q 2D5DA 5KNCA 4IUUA 4UAIA 5IGGA 1UE7A 3K7AB 1BO0A 1MKHA 1MIUA 5C3EG 4JI6L 1JOOA 3VDYA 1NY4A 1SNMA 4RCOA 1TY0A 1PRTB 5K36G 1E24A 1A63A 3RLNA 3T51B 3QOJA 4GLXA 3BVZA 5EJWA 2NVXH 4LF8Q 1EZ8A 4CKEA 2E2IB 4GLVB 1AFPA 5ELBA 2XRSD 1TWCB 2D62A 3J80c 4UY8C 3W5OA 3UDXA 4A3CG 1PVOA 2AQ2B 1B8AA 1KAWA 1VQHA 1K3BC 2F3WA 3D0FA 3NTHA 2B2WA 3A8IE 3PO2B 4PZ7A 5KNBA 1B50A 2F1MA 5I2XA 1YNXA 2YV5A 2A19A 3BJUA 1Y8PB 5C3EH 4JI8L 2ZXRA 4IO9A 5FKAC 3T53B 1JJ2A 5IP7G 1SMYC 4A3MB 2JA8H 2JA5G 4K8IA 4KN7C 3RD4A 2ZTDA 4IQZA 4R8IA 3U58A 2MP1A 4MNOA 4H02A 2JEAI 1SFOB 2HUGA 2KEDA 2L1BA 2NZHA 1S3OA 3LWUA 1SE4A 4CKBA 1B44D 1ASZA 4IOCA 3MTSA 2L15A 3O13A 1PYWD 1K0RA 2JA5B 4GOPA 1LV9A 4A4IA 5HURA 1WTRA 1E1TA 3FPUB 4YCWA 4DUYQ 3UDIA 1F2MA 4FF2A 2EYOA 3X3NA 4HMIA 2Y0SG 2FJ2A 3EIVA 4C3IH 3S1MB 1TWHH 4KY5A 2JA6H 4IURA 1PZKD 2Z9HA 4OWTB 4IPHA 4F8MA 1X3EA 1KC8C 4OL7A 4JYAL 1DONA 1SE2A 3S1NB 1QVFA 4GLAC 4OEMB 1EU4A 4X65L 2Q2HA 4IJHA 5D3DA 2YTYA 3FMCA 1K8OA 1STAA 2X69A 5KYLA 1HNZQ 1E2WA 5CYUA 1SNDA 4F88A 3I70A 2VUMB 3HS0C 2KCMA 3AFQA 3M3YH 2PMZE 1E3PA 3B6YA 1O80A 1LO5D 2DN8A 1KIXA 2R92H 3VYTA 1SYFA 4BBRH 3KJPA 2PZTA 2PO4A 3T1YL 3HGBA 4FNFA 1NMFA 1K83B 1NR4A 4QB4A 1DD2A 1B1ZA 1KLGD 3CC2A 1M8AA 1RHPA 1A3VA 2L12A 2QF7A 1YNJC 1GVPA 2F0OA 1HUNA 3CC4A 5EBDA 4XYOA 1GO3E 2RDHA 3GDEA 1CK1A 1AZPA 3BYTB 3T13A 2VNUD 4K8JA 4A3IB 1IBLQ 1PA6A 1G91A 4OIKA 3WOEA 4OONA 4A3MH 2KQ3A 4R1JA 4RGNA 1ET9A 4DV0Q 4K0KL 2JA6G 3TBIB 2SNMA 1S5DD 2D0PA 1PTOH 5LMNL 5CV6A 5BN3A 4MN3A 5ELEA 2HDLA 4I7ZC 1O7LA 2DJGC 1ONLA 1EY0A 2PQAA 1WCMB 1ZYRC 2K5NA 4LF4Q 2E74C 1AZQA 3LNNA 1YNJD 5IIFA 3TREA 4QGUA 4ULLA 2FMMA 1B3AA 3MXGA 5EPKA 4DV5Q 2A6ED 1JE4A 3SGIA 3H0GH 3S1MH 4K2LA 4EQ5A 1YJNA 2SEBD 2BH2A 5TSSA 2PQAB 1F77A 4PMBA 5JOBA 4IUTA 4B9XA 4DXGA 4KHPQ 3S24A 3QG1A 3UDFA 2B2UC 4RKLA 2OQKA 2ALYB 4C1NI 4ID6A 2R93H 4ZUIA 3GO5A 1WVLA 4Z9CB 1UWVA 5LMUQ 1OXUA 1QZHA 1O7IA 3DLLA 1PH4A 3RZOH 5IE8A 4GN3B 3GTLH 4CJ2C 5BN4A 1K83H 3MA2B 1QCBD 4YIJA 1OXSC 4K14A 4BBSG 2KECA 2UUCL 4FXKC 1XMQL 2Q2TA 5EGTA 1EWCA 1SEBD 2FHTA 1BUVT 1H9KA 1IBKL 3MFGA 3R2TA 5DM63 4A3BB 1HNWL 4DR1L 1Y1VB 1L2FA 3S16H 3N6RA 4RWSC 5C4ZA 1EUJA 3C2PA 4DR4L 2MJ8A 3VYRA 4DAVA 4RAUC 4RHRA 4A3EH 2R7ZH 2WKDA 1L0YB 5AFWA 3HOZB 5IT9L 2Z4IA 2B8GA 4DR3Q 3NQTA 4BBSB 4OWWB 1VQAA 3CMEA 2F3VA 4TVAB 1HTPA 2XWJB 3I2ZA 5GAGC 4IUQA 4PMWA 4RGTA 1H9SA 2NVQH 2F0DA 5C4XB 4HCSA 2KOLA 3PO3B 1BBXC 1K28A 3K6OA 1ZEQX 3QR8A 3UE1A 1PXUA 1X6OA 4UDUC 3GV6A 3KUPA 2IX0A 2JQOA 2BDNA 4LF9L 1SNPA 5I6WA 4DA2A 3D6WA 4DV5L 4WJ3M 1SFOH 1Q12A 3PQIA 1VQLA 3CP0A 1G2TA 4WRDA 2L0CA 3ULJA 2UU9Q 1FNWA 3RN5A 4JI1L 5DLQE 5CV7A 4RFBA 1FYCA 3NBHB 4JBJA 3TEHB 4B3SL 1XYIA 1X3QA 1GHJA 2EQSA 4LUVA 4MHEA 5I2YA 2B2VC 1QILA 2JA7B 3I4NH 4X65Q 1JT8A 4A93G 1VQPA 3F1ZA 1E7ZA 3K59A 2OWOA 3GD7A 3F2BA 2ICEC 2PMZB 1I4QA 1EY5A 2Z0SA 3GTOH 3S1NH 1LTSD 4X3TA 2L9HA 2RF4A 2MFIA 1WTVA 5CV5A 1U4LA 3NPPA 2D2CC 4JI5L 4CJ1B 1CSPA 3DMUA 1EYGA 4DR7L 3H09A 3IKJA 2GA4B 1CZWA 2RA4A 1K8MA 3V96A 3HOUH 5C4XH 1FR3A 2R92G 4C56C 2LXJA 3OMGA 2E2JH 2YU9H 4Y7NH 3T56B 2EJFC 3EQLC 2L55A 1GM5A 5IWAL 5IYDG 4U673 4DR7Q 3IRBA 2AQ1B 3I4OA 1STNA 3HOZH 1S5ED 3KF6B 4A3DH 2UXCQ 3AU7A 4LF7Q 2H4OA 2K5VA 3OW2A 1L1OA 2QILA 4ODGA 4X3SA 4PNYA 1MBYA 2F4IA 1SYDA 1HNWQ 1RTNA 1ILQA 1S72A 5IWAQ 5ELFA 2A1AA 2O5JC 4XT1B 2DY7A 5EAYA 1J9OA 1GUSA 4LW1A 1CQVA 1U4MA 4LFCL 1FVIA 4HN7A 1MI2A 2UXDL 3PSIA 2F0HA 5DAUA 4FVMA 3ERQA 5K36H 4N9TA 2K4KA 2IW3A 2JA6B 1P16A 1TU2B 4RMFA 4JBKA 3I73A 2RHSB 4BBRB 4A93H 3N52A 4K2KA 2MHVA 3R2IA 2C9OA 3MC0B 1X3PA 2R7ZB 1S40A 4C3JG 2E75C 2I0QA 3S14H 3AFPA 2O5IC 2ZTCA 2JEBI 3C3LA 4HJAA 3HKZG 4B3SQ 1BKBA 1TY2A 4DV4Q 2EXZA 3OTOL 2JN4A 4FXDA 2B39A 4DR5L 2K5QA 5T1IA 3A0JA 3D4RA 4P73A 3S2HH 4U68A 3RMHA 5C44H 3KOJA 3D6CA 1IBMQ 3NTIA 4L6TB 2F4VQ 2I5MX 2RHQB 1V1PB 4PQXA 1HZCA 3HOXH 3JAMi 3KF8B 2UUBL 3HZXA 4L5SA 1BCPD 4AH6A 1W6JA 2ZJQA 2RVLA 1EIFA 1PRTF 1JE5A 1GUWA 1SMYD 1F2LA 1F9QA 3E3XA 4Y7NB 1I94L 1IW7C 1PH1A 1XNQQ 3H15A 1BR9A 2K5DA 2XIWA 4YWKA 4JI1Q 2FXQA 5CMDA 1OXTA 2PPBC 3OIQA 2Z1CA 1KRTA 3A5ZB 2K6AA 1EQVA 3S2DB 4ZRZA 2NVXB 3RZOB 1ICFB 2V4DA 2F0MA 4HIMA 3CRKC 4GOPB 1WD1A 2M00A 1SE8A 3GP7A 5LMUL 1SSOA 1D1KA 5LL6X 1IL2A 4G7OC 5COYA 5M9OA 1EY8A 3M85A 1GUNA 4ZCKA 4BA1I 1EY7A 3T1HQ 1DYQA 2E2DC 2EY6A 3LGJA 5ELOA 4N9PA 3VR6A 3ND8A 1JB7A 2BA1A 2NTSA 4YHHL 4TRDA 3P75A 1N8RC 2KHIA 3NBIA 4A3EB 1D6EC 1IW7D 2PI2A 4YCVA 5C0XG 3G71A 1SYBA 2EE1A 5HGQA 1KNEA 1TS5A 4C3JH 2AQ3B 3A7LA 3KF6A 1XWEA 2UUAL 3AB9A 1TS4A 3K0YA 1Y69U 2K1BA 2K75A 5IGDA 1HFGA 2E76C 1KRSA 2OXPA 4DV4L 1Q8IA 5C3WA 3MEFA 1HTLD 3EJIA 2J7ZA 1J6QA 2MNAA 2E2HB 4RGOS 4KV6A 4IN3A 4UP7A 3V2TA 2Y0SB 1UE6A 2VQFL 1SNOA 1FJGQ 4GKKQ 5FLXE 1L1OB 4IFDH 2OCEA 1PH6A 2Y0SE 2LKVA 2NVYB 1IKLA 1DGSA 1Q46A 1D5XC 1K9MC 1E2ZA 3NBHA 1QB5D 2MUYA 2RQXA 3L7ZC 4JI7Q 1N32L 1SMXA 3CCSA 4DR2Q 4AQYL 1RKNA 1JWUD 2BE5D 5DEHA 1IKMA 5CBEE 1PH7A 4HMJA 4IALA 5EKLA 2R92B 2JA7G 3U9OA 3U4ZA 4AYBB 3CC7A 3S1QB 3NWTA 1JCKB 1FNVA 1NR2A 4QF4A 5ELNA 3J81i 1HR0W 1WTPA 1G51A 5KNDA 1E0BA 4F7XA 1CM9A 4QMGA 1LTAD 3RUZA 1SYCA 3A56A 2F3IA 4IUNA 1W3SA 1VF5C 4H44C 3D8GA 1Y14B 4LFAQ 2KENA 1V1PA 1V1QA 4ZYSA 1BDOA 1B2TA 1VS0A 5C0XH 4B3TQ 1JICA 3SK5A 5FO9B 4JV5L 1WTOA 1V43A 1Q81C 3SK8A 1CZGA 1I4GA 4HJ9A 5IYDH 4KN4C 3G4SA 1Q1BA 2JSOA 5JEAH 3L9AX 3OTOQ 1PZID 2CWPA 2DY8A 5D65A 2UU9L 1HR0Q 2K03A 1C48A 2CHBD 1QNKA 1CQFA 2AKWB 2NUCA 3BDCA 3G48A 4JOIC 3RN2A 2JA7H 1F9PA 1L1OC 4WJ4A 4FP5D 4CDDC 4HEDA 1R4QB 2PW7A 4X62Q 4A76A 1VQ4A 4K0KQ 3U50C 1Y8NB 4X6AH 4DV2Q 3TS2A 5CV9A 3DHQA 1KL9A 3I4MG 2F0LA 4DV6L 1SYGA 4GNXC 4KD4A 3MHBA 1STYA 2OT2A 1DOLA 3A8KE 1VQ9A 4JBMA 2MQHA 4PZ6A 4B3TL 1JJGA 2A8VA 1X65A 2WIIB 4K5XA 4DV7Q 1JWSD 2F0EA 1D1IA 3OSOA 5M5YB 3MEHA 4E6IA 1Z7TA 4DPGA 2CWAA 4ALPA 1CA6A 1JMCA 2CH4W 3K81C 3DEOA 3G6JB 2ATWA 3T1YQ 1SNQA 2OTJA 4G7ZC 2XN9C 1YIJA 1MSGA 4DV3Q 5CGKA 4JI4Q 3FHWA 2IWHA 5FOBB 3HKZB 1BBUA 1RCVD 1LT5D 4XTCS 2ZJRA 4IJLA 1XPOA 3S16B 4A3GH 2NN6I 3T1HL 4F87A 1LTID 3Q0AA 2ASBA 4JI4L 2QCPX 3KK7A 5IP9G 3I8ZA 1PLFA 1TVXA 4DN4M 1I4HA 1HA6A 2RDGA 4JI0L 3I4MH 4HJ5A 4OGQC 4MZ9A 2OEOA 1NUCA 5JEAG 3GTJB 3ZJYC 3LX0A 4CGYB 3SXHA 2A68C 4MIUA 4A3FG 1DJRD 1Q8KA 2EYPA 3J81E 2BA0A 4IZ8A 4J8QA 2VQEQ 5E7NA 1LT3D 3I90A 3OIPA 2NVTB 1ICWA 4A3LG 4R9WA 3VYSA 4DV1Q 2ZXOA 4DK6C 1X55A 2TSSA 4DV2L 2UUAQ 4LUZA 1JOQA 1PYBA 3S2DH 4EQNA 4RKBA 4I7AA 3BS1A 1WJJA 1K73C 3IL8A 2D0OA 3UDGA 4LF8L 2PYKA 2L5TA 2JA8B 3VR2A 4BY7B 2HIVA 1CKNB 4P75A 4L5QA 4YHHQ 3K8AA 3GTGB 4CKCA 5GROA 2VUMH 4J1MA 2HD3A 1I5FA 3E0EA 1RDPD 4CHTB 1HRJA 1I6VC 1VQGA 2H1EA 5J39A 1E1OA 3M7NA 2RDFA 2KHJA 5C4XG 2BOSA 3FKIB 1V9PA 1XX8A 5C44B 1VDZA 4A3MG 3J7AF 2GVBA 1U4PA 2KCCA 4IPGA 1AE2A 1FD7D 2VB3X 3GQBA 3CCVA 1NCVA 1PH3A 3BVMA 2OTLA 1AE3A 1KLUD 1GOZA 1ENFA 1VQBA 3M9BA 2ZJPA 4EX5A 4BXXG 4K6LA 5IP7H 2JA8G 3AYHB 3OYYA 1WTQA 1IHZA 1PZJD 1H9JA 2R7ZG 2WAQE 4R4QA 2OQ0A 4JV5Q 3DWPA 1A62A 5DM73 4QQBX 1SNCA 1Y8OB 4WORA 1WTWA 5BR8Q 3EVQA 2LMCB 1S5FD 1XJVA 3OWEB 2MGSA 1GUGA 5JPMC 4M8AA 3T16A 1WD0A 2N78A 5CV4A 3STBD 3ULPA 4NB3A 2NB0A 1FJGL 4RHSA 3DUZA 3QJYA 4C3JB 3I91A 1WCMH 1K8GA 4DR5Q 3NELA 2WAQB 4I65A 4JI3Q 1H9MA 4CBVA 3R93A 3OWFA 2M9VA 4KY7A 2KUMA 1DOKA 1KHIA 1I4PA 4JK1C 4A93B 2EYFA 5M3MG 2CW0C 4JW0A 3CPWA 3A7AB 2A5HA 1BF4A 2R93G 4KJNA 2MPMA 4BXXH 1NTGA 4GN4B 3DXJC 1EEFD 2WB1E 4X64Q 2I46A 2NBFA 1PFBA 4A3KH 1KTKA 3TP6A 1LTLA 4YWLA 4DR1Q 2B2YA 2BDOA 4OXPA 4C2MH 3PIOA 1I50H 1F2ZA 2WP8J 5IYBG 4FF4A 1Q1EA 3G7LA 3M7GA 1EWIA 3URYA 3K80C 3VR3A 3PF4A 1J5EL 3FDTA 1IYVA 5LHY1 2KA7A 1HFNA 2EZVA 1N36L 1DXMA 4QUFA 1J8IA 3KDFA 2YTVA 1JOKA 2FINB 3TP8A 2Z4HA 4DAMA 1Y1WB 1GUOA 4K5VA 3K57A 4O0AA 1EYAA 1XTDA 2AUKA 3TZDA 5J1ZA 4N8FA 2A69D 4FF1A 4UHVA 4HIKA 1RODA 5D14A 1XMOL 1X9NA 2CW0D 3I56A 3HOVH 2VL6A 2K5HA 2DNEA 2EJMA 4OO1G 4NKLA 4G7HC 4L8JA 3PO2H 1I94Q 4NDXA 5A35A 2LSSA 2CKZB 1QOHA 4GNXB 3HOYH 5KEEA 1EIYB 2F52A 4RCNA 4POGA 3KLSX 1F2YA 4X3UA 1U4RA 1LM0A 5FJ8H 1A2UA 2R93B 4LFAL 3NK9A 1I3QH 1PFMA 1G8ZD 4OO1I 3NXWA 3A54A 3D4WA 5C4JH 1LT6D 1QZGA 5IGCA 1DM0B 4QUCA 4GNXA 4DR4Q 3T4AC 1TWAH 1VF7A 2NZOA 3PIO3 2EPBA 3W1BA 2A69C 3PUXA 1QVGA 4APVA 1TKWB 5IP9H 3PUWA 1K8AC 2CVRA 3I4MB 1KDCA 3MXUA 3NQIA 4JC0A 5IT9E 3HOXB 2HIXA 4KY6A 2AWNA 4C3IG 4GOPC 2RKSA 2WKCA 4JCVE 4JI0Q 2NVQB 3SHLA 2K5WA 1ESRA 2WB1B 5LL6S 1V8QA 1N33L 3PO3H 1TR5A 5IODA 1RTOA 5I6YA 4DNTB 3HOZG 2AHOB 4R4CA 5C3XA 1XMQQ 4PMCA 1BCPC 1KD1C 3HOYB 1VQCA 3I4NG 1MHWC 2B29A 4KKSA 2F0JA 3S1RH 3HRZC 4DR6Q 1JC7A 1PFSA 1YBYA 2EYJA 2F0KA 3BZDB 3QO2A 4IFDI 1RF2D 1S5BD 1IBML 1HPCA 4L63B 1BCPF 1N34L 5IGBA 2JXMB 1W2BA 3TZUA 5CBAE 1T5XD 3GTKB 3SK6A 4HTHA 5A2QE 1HNZL 4C1NK 1EOVA 2YU9B 1KAAA 1BNZA 3CRLC 1VCIA 4BY7G 1EU3A 3K58A 4M1UB 3SR1A 4KI0A 2X6LA 2VB2X 1SROA 1D8LA 3PUZA 1N33Q 3ER0A 5JJZA 4LF5Q 1I3QB 4NXNL 3M4YA 5ISRA 4HAEA 3ZYYX 4DF7A 3P20A 2KBNA 5K5PA 2VQFQ 3PCOB 3NEMA 3KYHC 4LK1C 3HOUB 4GN5A 1JB3A 5C4JB 3F2DA 1AEXA 1VMCA 3VA7A 3TS0A 3MAQA 2E2JB 2I5LX 5IGEA 3HOVB 4LFCQ 2HHHL 2WACA 3VR5A 1G291 3FEWX 5C3EB 2XRQD 1A0IA 4FF3A 3BVGA 2OF1A 3M4PA 2EJGC 1HXYD 2K32A 1S5CD 3MXNB 4J6HA 1Q82C 4TSSA 1TXYA 4QIWB 3AEVA 1WYDA 1EY9A 4FYDA 4OELB 1PV4A 4KKUA 3ICEA 1F9RA 4LWCA 5C5LA 2F4VL 1FGBD 3S17B 1QVCA 4A3KG 4NP5A 2K7VA 3QWNA 1X32A 1SJED 2K28A 3SDZA 2K04A 3H91A 3PIP3 2IX1A 1E22A 2EY5A 4KK7A 1A3TA 2YYZA 4KHZA 5M3MH 1CKOA 1U5KA 2F0TA 3J80E 4LJZC 4H7BA 3I7FA 1LTRD 1EEID 4DU9A 2ID0A 3CXCA 4DR2L 1TWHB 2F0NA 4Q0FA 2B2TC 2LY7A 4A3BH 3FPPA 1CT1D 4DKAC 3E9HA 2A74C 3FKIH 4A3GG 1JQYD 2PCFB 2PQEA 4DK3C 3J7A5 2B2YC 3DWAA 4CDCC 3K5NA 4A75A 3S1RB 1VQ7A 1NSNS 2SDFA 4UPAA 5FLXL 3GTKH 3H3VC 4CJ0B 1UAPA 4YY3L 3TMEA 1XNRQ 1BXTA 1CUKA 1NBWA 4KHVA 3I4LA 3I72A 1ESFA 2EOTA 1D7QA 2I5HA 1QE6A 3J7ZC 1YJ9A 1O78A 3QOLA 4BBRG 4POFA 4JG2A 3W1GA 4DK0A 1N32Q 1ENAA 5JAVA 2LXKA 1IYJB 1S4ZA 1XTCD 2ZTEA 1Q90A 3OW7A 1YHQA 1LTGD 4LUOA 3CCRA 5FLMH 1DCZA 1UNSA 1STEA 4XQJA 2NZ1D 1SAPA 4KTAA 2VS1A 1EL0A 4KLKA 5CORA 1GXDC 3S17H 4LF6L 4S3SA 4ZAIA 1WTHA 2C5CA 2PZUA 4OWXB 1C8CA 1EOTA 1UEBA 3H3VH 2QW7A 2IHFA 3R8BA 4AYBE 3TRZA 1YHBA 3Q6SA 1PTOF 3SE0A 2ZXPA 2VQEL 1GJXA 4JI7L 3FRPB 1SLJA 1H9SB 1VQEA 1EQRA 2K05A 2E5LL 1LACA 3GV3A 1D2BA 5JEAJ 3WWVA 1R9TH 2G5DA 4DR6L 2E5LQ 5E3FA 1HQMC 5C4HA 1LYLA 2JYOA 3W2DA 2JE6I 1X3GA 2JK8A 4EGVA 5BR8L 4H13C 2KJXA 1AN8A 3K5LA 4LF4L 2EYHA 1VQMA 3PF5A 3FP9A 1IXRA 1LLRD 4Q5VA 2M2LA 4A3JG 4A3IG 2KCNA 4LF6Q 4XIGS 5KIXA 1HA5A 1XNRL 3H6MA 4DV3L 4JPBW 1P8LA 3OHXC 3HOYG 2E2HH 4PG3A 5EQ0A 2AMCB 5C5MA 3CKIB 4NW2A 4HIOA 1VQ6A 4X3KA 2K14A 2FFKB 1PRTD 5M3FB 5NUCA 2WB1G 2IJ0A 1JWMD 2E2IH 1VQIA 2XSCA 3KDFB 2HQEA 4GZYC 1GD7A 1U9RA 3TN2A 1IL8A 1MGSA 3GTPB 1GKHA 1DOMA 2J0TD 1HZAA 2CFMA 1VQ8A 4FDBA 1LUZA 1O7YA 4DUZQ 1F9SA 4BY1H 3DM1A 2TMPA 1NMGA 2N49A 3PMFA 3RR5A 5E1FA 3PO3G 1D5MC 1FGUA 3KLWA 2G9HD 1R9TB 4DV0L 3GTMB 1CHQD 3E9IA 4DV7L 1ML0D 1UE1A 1IZ6A 1T5EA 4NXMQ 1TWCH 1LTTD 1PMRA 1BBWA 4JI6Q 2B2VA 3NSWA 2SNSA 3A74A 1SE3A 4N8X1 4A3FH 1YJWA 2PNRC 2N8NA 5M5WH 1PH2A 2KVMA 5H1SE 2GVAA 4O1NA 1VQFA 2F0PA 5ELDA 2RCFA 2Z8LA 2QEJC 4OX9Q 1G2SA 5BN5A 3K0XA 2RCNA 1CTMA 3NWSA 4LF9Q 3S1QH 3SEBA 1Q7YC 2PI2E 5HY6A 5IYCG 4JI2Q 3U9SA 2LFNA 1HR0L 3HOWG 2UXBL 4TQUS 2XGTA 1RL2A 5M3FG 3M4OH 2R7FA 2EYLA 3CD6A 1PTOD 3UI2A 3DM3A 3NHHA 3CQZB 5J3BA 5JVG3 2UXDQ 1RD9D 1YNNC 1TWFH 2NTTA 1PHJA 5IOCA 1V1OA 2MO1A 3CMAA 3S2HB 3PO2G 4BY1B 3P1HA 3V05A 3H94A 3J80L 4JYAQ 3G6EA 4R4IA 4NXNQ 3Q8DA 4HSVA 1CI3M 3PGZA 1X56A 2E8GA 5IGFA 3RZDH 1QUQA 3HOXG 4R4TA 5M3FH 2QDLA 4UP9A 2QEXA 4L5TA 2B8FA 1KNAA 4P71A 1M4VA 4A3FB 3F2CA 4A3BG 5IYCH 4QCLA 3FKIG 1L0WA 2Q8IB 5M5YH 3GTPH 1Y1WH 3E5SA 4BS9A 2BH8A 4A3IH 4NXML 1U0LA 1STBA 1N9WA 3TSSA 3GTMH 5C0XJ 2UXCL 1HH2P 1MD2D 1CA5A 1PFNA 3L3OC 5FK9C 4OO1H 2EY2A 1TWAB 4RH6A 2L11A 3D3RA 2Q2UA 4B9WA 3BDLA 4CDFC 2SOBA 4DUYL 1PH8A 2QKIC 5GQOA 4A3EG 1PH5A 2AUJD 3CQZH 2IY5B 1XNQL 4NPSA 1IBLL 1HNXQ 1C9OA 5FJ8G 2D9UA 4KHPL 3VR4A 3NP8A 1EZ6A 2HQLA 1A6XA 1BOSA 3QB3A 4KKTA 1KDBA 4JI2L 4IUPA 1UE5A 2DUDA 2B63H 4BY1G 2PNHA 3ITPA 1E2VA 3TP7A 1B3QA 4DNIA 5CR3A 1Z6HA 2NN6G 2GN5A 2Z6BA 3GTJH 4V190 1OXVA 4PV1C 2VXWA 3Q23A 3SK4A 3PV0A 1XXGA 3MFYA 1TT2A 4JVZA 1NE3A 3D31A 1A8VA 1EWHA 1TWFB 1ZXTA 1HHVA 1UUPA 2ZM6L 2A6HD 4EQOA 1YHAA 3BU2A 4HJ8A 4K6DA 3MXNA 3S9WA 4YY3Q 2IPKD 3J80i 2WFWA 2N88A 1YITA 1AW7A 5T1GA 4ZK9B 4L5RC 4BY7H 3KF8A 2F0VA 1L0XB 1EQQA 2XVSA 3K5MA 4FO2A 2KHSA 3X3MA 5KGUA 1C7YA 1VQ5A 3U4VA 2DNCA 1EIHA 2VY3A 1TS2A 3HFZB 2ZM6Q 5EPJA 3L2PA 3NUCA 1KXLA 3KBXA 3F8TA 4PZ8A 3J7AV 1PYSB 2A73B 3WOFA 2EIFA 1Z9FA 1SBBB 3M4OB 3A5UA 3K7UC 3H0GG 1J5EQ 4QY7A 3WDNA 4J15A 4CDEC 1BCPB 2NWGA 1XPRA 5G3LF 2C35B 1RIPA 1SJHD 4AIMA 2WAQG 1B9NA 2UUBQ 1XPUA 1WTXA 1VQJA 3GTLB 1D5ZC 4HIDA 4ZKBB 1VQDA 1N34Q 1IYUA 1H95A 4G4KA 4P74A 4YWMA 1HUMA 4RGMA 2BE5C 3ERSX 3UE0A 3HOUG 2Q2IA 2J4XA 3EA6A 3CF5A 4FXGC 1SN8A 1EFID 4AQYQ 1LTBD 3GTQH 1IBKQ 1STGA 1WI5A 4IUVA 4R4OA 4JI3L 5EKIA 1SDFA 1EYCA 3HG9A 4DK1A 4DXFA 3CCJA 3CCQA 2UXBQ 2B2WC 2HCIA 4TKOB 3CAMA 3I3CA 5I4DA 3C46A 2EYMA 2R6GA 4GKKL 2N3SA 4KJOA 3BYYB 1I50B 2B2TA 4A3JB 4LFBL 1TWGB 1EFWA 1I6HB 2B2UA 4A3KB 1VQOA 4XXEA 4DAYB 4K5WA 4C2MB 1EY4A 3HOWH 1T9HA 3HKSA 1Q3LA 3L0OA 1R4PB 4ZUJA 4EVOA 1AH9A 1C0AA 3H3VI 2X6GA 5G3LD 3VYUA 5AJ3L 3NTKA 1SYEA 2RSNA 1EY6A 1G6PA 3BDOA 3J81c 1B53A 4HR7B 3CW2C 4X62L 2VUMG 2F0SA 2WINB 3QIAA 2IT1A 1ZYRD 2B63B 1ILPA 1WOCA 2HDMA 1H9RA 4DUZL 3CHBD 4R8NA 5GADC 1W6KA 4B3MQ 4X66Q 2R61A 1CHPD 3TQYA 1LABA 1JJCB 2KCTA 3E6ZX 3I4NB 3BZCA 5E4XA 4P2CB 1A3UA 2QDBA
chains in the Genus database with same CATH topology
1Q1BA 2ID0A 2UU9L 3OTOQ 3CXCA 2CWPA 4DR2L 4OONA 4IFDG 2CQOA 4A3MH 1HR0Q 4R1JA 4A3BH 2JA7H 2AKWB 4JOIC 3G48A 3E9HA 4DKAC 3RN2A 3FKIH 4DV0Q 3I55A 4A3GG 1L1OC 2JA6G 4K0KL 4WJ4A 1Z47A 4DK3C 1Y1WG 3J7A5 3PIPA 1HZBA 2D0PA 3RLOA 2NVYH 4X62Q 5LMNL 4A75A 4A76A 1VQ7A 1VQ4A 3BZKA 4K0KQ 4UPAA 3U50C 4LNQA 3GTKH 2B3GA 4C3HH 4YY3L 4X6AH 4DV2Q 1XNRQ 1K3RA 1CUKA 1NBWA 3TS2A 1KQSA 3GTGH 1KL9A 2PQAA 2I5HA 3I4MG 1D7QA 3K7AH 3CCMA 3J7ZC 4DV6L 4GNXC 1YJ9A 1OXXK 4IPCA 2K5NA 4BBRG 4POFA 4JG2A 3RNUA 4LF4Q 3W1GA 1N32Q 1VQ9A 4JBMA 1JJGA 2MQHA 4PZ6A 4RG1A 4B3TL 2A8VA 1X65A 2LXKA 1Y1VG 4DV7Q 1IYJB 2ZTEA 3TREA 4QGUA 1YHQA 1CKMA 2Z6KA 4LUOA 3CCRA 4DV5Q 5FLMH 3CCLA 3SGIA 3H0GH 4A3JH 3S1MH 3S15H 1NJIC 4DPGA 2CWAA 4ALPA 4EQ5A 1YJNA 1JMCA 2BH2A 4LF7L 3K81C 2VS1A 2ATWA 4KLKA 3T1YQ 2PQAB 4GKJL 2OTJA 1YIJA 4LF5L 4DV3Q 1ASYA 4JI4Q 3S17H 3FHWA 3NENA 4KHPQ 4LF6L 3PUVA 4OWXB 1UEBA 3S24A 1Q86C 3H3VH 1BBUA 2IHFA 3UDFA 2QA4A 4XTCS 4AYBE 3TRZA 1YHBA 2ZJRA 4IJLA 1XPOA 4HJ7A 4A3GH 2VQEL 2NN6I 2OQKA 2ALYB 4JI7L 3T1HL 1XMOQ 4A3LH 2ASBA 4JI4L 2R93H 1SLJA 3GO5A 4O2DA 5IP9G 5FLMG 1VQEA 1Y1VH 1EQRA 4GKJQ 4JI5Q 2E5LL 1UWVA 5LMUQ 4JI0L 2MO0A 1OXUA 4HJ5A 3I4MH 1QZHA 4MZ9A 1PH8A 1O7IA 5JEAG 3DLLA 4MTNA 5JEAJ 3WWVA 1PH4A 1R9TH 3ZJYC 3RZOH 5IE8A 4DR6L 4GN3B 1PH9A 2E5LQ 3GTLH 1K83H 1FL0A 1LYLA 4A3FG 1OXSC 5M5XH 2JE6I 1X3GA 2JK8A 4BBSG 5BR8L 2UUCL 1Q8KA 2BA0A 1I6HH 3EBEA 2VQEQ 5E7NA 1XMQL 2YTXA 2Q2TA 4LF4L 4A3DG 1VQMA 3PF5A 2QGQA 3FP9A 1IXRA 1IBKL 3M4QA 4A3LG 2HT1A 4DV1Q 4A3JG 4A3IG 4DK6C 4LF6Q 4QQBX 4XIGS 1X55A 1HNWL 4P72A 4Y52H 4DR1L 4DV2L 2UUAQ 1XNRL 1L2FA 4LUZA 4DV3L 3S16H 1PYBA 1P8LA 1EUJA 3S2DH 4DR4L 1M1KC 3HOYG 5C44G 1CKNA 2E2HH 3KFUA 4PG3A 1K73C 1WJJA 2AMCB 2VW9A 2D0OA 3UDGA 1MJEA 4A3EH 4LF8L 2R7ZH 3PUYA 4JOIA 1VQNA 4HIOA 1VQ6A 2HIVA 2K14A 1CKNB 4JBWA 4P75A 4DR3Q 4B3RL 2WB1G 1VQAA 3CMEA 4OWWB 4L5QA 3CPFA 4TVAB 1VQIA 2E2IH 4YHHQ 3K8AA 5GAGC 4IFDJ 3I2ZA 5GROA 4PMWA 3KDFB 2VUMH 1HZ9A 1I5FA 1GD7A 2NVQH 3E0EA 5C0XI 1GKHA 1VQGA 1HNXL 3UE1A 1HZAA 3AQQA 1QUQB 1E1OA 2CFMA 1X6OA 4FDBA 1CSQA 1VQ8A 1LUZA 3M7NA 2R7DA 3CCEA 2KHJA 4DUZQ 4BY1H 3RR5A 5C4XG 1NMGA 2N49A 2IX0A 1YZ6A 1V9PA 4A3MG 2JQOA 1WFQA 3JC66 2GVBA 4B3RQ 4IPGA 4LF9L 4YCUA 3PO3G 5LMNQ 4DV5L 4WJ3M 1AE2A 1FGUA 1SFOH 3KLWA 1Q12A 1VQLA 1VQKA 3CCVA 3CP0A 2Z6KC 4DV0L 1PH3A 3E9IA 4DV7L 5JJKA 2OTLA 1UE1A 1IZ6A 1AE3A 3ULJA 4NXMQ 1TWCH 1VQBA 3M9BA 2ZJPA 3RN5A 2UU9Q 4JI1L 1BBWA 4EX5A 4JI6Q 5DLQE 4BXXG 4BBSH 3A74A 4UP8A 3CCUA 2DGYA 5IP7H 2JA8G 3AYHB 3OYYA 1B7YB 3NBHB 4JBJA 4ME3A 4DV1L 4A3FH 1YJWA 2NVTH 2R7ZG 2N8NA 5M5WH 1PH2A 3TEHB 2WAQE 4R4QA 2OQ0A 4X66L 5H1SE 1A62A 2GVAA 4B3SL 4IOAA 4JV5Q 5JJIA 1VQFA 2K52A 2EQSA 4LUVA 1JT8A 3I4NH 4X65Q 4A93G 1VQPA 3F1ZA 2K50A 1E7ZA 4IPDA 5BR8Q 5LMNW 2UUCQ 2OWOA 3GD7A 4OX9Q 3F2BA 3K0XA 1XJVA 4QJFA 2RCNA 4BA2I 2H5XA 4QL5A 2Z0SA 4LF9Q 3GTOH 3S1QH 3S1NH 1Q7YC 2N78A 2PI2E 1WCMG 2V1CC 5HY6A 3STBD 4NB3A 3ULPA 5IYCG 1FJGL 2RF4A 4JI2Q 1HR0L 3RLFA 2MFIA 3HOWG 4A3CH 2UXBL 4TQUS 2XGTA 4JI5L 1RL2A 3ULLA 1CSPA 1WCMH 5M3FG 1EYGA 1K8GA 4DR7L 3M4OH 2R7FA 4DR5Q 3CD6A 2EXDA 3NELA 3DM3A 4JI3Q 3HOUH 5J3BA 2UXDQ 2HHHQ 5C4XH 2R92G 5IT9c 2LXJA 2E2JH 2YU9H 1TWFH 4Y7NH 1KHIA 1PHJA 2MO1A 1YVCA 3CMAA 5M3MG 5IWAL 5IYDG 1GM5A 3PO2G 3CPWA 4DR7Q 1OTCA 3IRBA 2R93G 2CCZA 3I4OA 3HOZH 2IHEA 4BXXH 1NTGA 4GS3A 4GN4B 3KF6B 2WB1E 4X64Q 4A3DH 2UXCQ 4JYAQ 4X64L 3G6EA 4LF7Q 4A3KH 2K5VA 3OW2A 1L1OA 5AJ3Q 4R4IA 1LTLA 4YWLA 4DR1Q 1HNWQ 4OXPA 3PIOA 4C2MH 4NXNQ 3Q8DA 1TWGH 1S72A 5IWAQ 1I50H 2A1AA 2WP8J 3PGZA 1X56A 2E8GA 4JI8Q 5IYBG 3RZDH 1Q1EA 1QUQA 3HOXG 5EAYA 4R4TA 1EWIA 3K80C 4LW1A 3PF4A 1J5EL 4LFCL 5M3FH 4UP9A 1FVIA 1YI2A 2VZAA 1N36Q 2QEXA 1SRUA 4L5TA 3STBC 4P71A 1N36L 2UXDL 3PSIA 3F2CA 3KJOA 4A3BG 3KDFA 2YTVA 5IYCH 3FKIG 1YEZA 1L0WA 3J81j 1MJCA 4AYBG 5M5YH 3GTPH 4DAMA 1Y1WH 2BH8A 2K4KA 4LFBQ 4A3IH 4NXML 4O0AA 1P16A 4RMFA 3JAMc 1U0LA 4JBKA 1N9WA 1XTDA 2RHSB 4A93H 3GTMH 2JA9A 5C0XJ 2UXCL 3HOVG 3HKZE 1HH2P 5FLXc 4HIKA 5IYBH 1S40A 1X54A 1XMOL 1X9NA 2Q2UA 2JJQA 2I0QA 3S14H 3AFPA 3EN2A 3I56A 4DUYL 2VL6A 1X3FA 2ZTCA 5GQOA 2JEBI 2K5HA 4HJAA 3HKZG 4A3EG 1PH5A 4B3SQ 1BKBA 4OO1G 4DV4Q 5GAHC 3OTOL 3CQZH 2IY5B 1XNQL 3PO2H 4NPSA 1I94Q 1IBLL 2LSSA 1C9OA 2CKZB 5FJ8G 4GNXB 1HNXQ 2JA5H 4KHPL 5IY0A 2B63G 4DR5L 2ES2A 1EIYB 3HOYH 2F52A 1BVSA 2HQLA 3A0JA 4P73A 3S2HH 4POGA 4B3ML 1LM0A 3KOJA 5FJ8H 5C44H 1IBMQ 4JI2L 4LFAL 1UE5A 2DUDA 1M90C 4BY1G 2I5MX 4DR3L 2PNHA 2B63H 2F4VQ 1I3QH 2RHQB 1HZCA 3HOXH 2XTIA 4DNIA 3KF8B 3JAMi 4OO1I 2UUBL 5C4JH 2NN6G 2GN5A 1HJPA 1SR3A 1QZGA 4L5SA 5JJLA 3GTJH 4QIWE 1OXVA 4OX9L 2AWOA 4AH6A 2ZJQA 3PV0A 4GNXA 4DR4Q 1EIFA 5GAEC 1JE5A 1TWAH 1B70B 1NE3A 2NZOA 4DV6Q 3D31A 1A8VA 3W1BA 1I94L 1PH1A 1XNQQ 3PUXA 1UE7A 3H15A 4APVA 1MKHA 1MIUA 5IP9H 1QVGA 2ZM6L 3PUWA 5C3EG 1YHAA 3BU2A 4YWKA 4JI1Q 4HJ8A 2FXQA 4YY3Q 4JI6L 1OXTA 3VDYA 1NY4A 3J80i 1KRTA 1K8AC 2WFWA 1YITA 3A5ZB 4L5RC 5K36G 1E24A 1A63A 3RLNA 4BY7H 4GLXA 4JC0A 2HIXA 2NVXH 2AWNA 1EQQA 4LF8Q 4HIMA 4GOPB 4GLVB 4GOPC 4JCVE 1C7YA 1SE8A 2D62A 5LMUL 4JI0Q 3J80c 1VQ5A 4UY8C 3U4VA 3W5OA 1IL2A 2VY3A 3UDXA 3HFZB 2ZM6Q 3M85A 3L2PA 4A3CG 1PVOA 1KXLA 3PO3H 3F8TA 1B8AA 1N33L 1KAWA 1VQHA 4PZ8A 4BA1I 3D0FA 1PYSB 3T1HQ 3HOZG 4PZ7A 2EIFA 1Z9FA 2AHOB 4R4CA 3A5UA 3K7UC 3H0GG 1YNXA 3LGJA 4QY7A 2YV5A 5ELOA 1XMQQ 1J5EQ 1JB7A 4J15A 1KD1C 2A19A 1VQCA 2BA1A 3BJUA 5C3EH 4JI8L 3I4NG 4YHHL 3HOVH 1XPRA 2B29A 1N8RC 2C35B 1RIPA 2KHIA 4IO9A 2UUBQ 4AIMA 2WAQG 3S1RH 1XPUA 1JJ2A 1VQJA 5IP7G 2JA8H 4DR6Q 2JA5G 1PFSA 1YBYA 4HIDA 1VQDA 2PI2A 4YCVA 5C0XG 3G71A 1N34Q 1H95A 2ZTDA 4P74A 4IFDI 1IBML 3U58A 4YWMA 4MNOA 4H02A 2JEAI 5HGQA 2NZHA 1N34L 3ERSX 1S3OA 3UE0A 4C3JH 1W2BA 3KF6A 2Q2IA 3HOUG 2UUAL 1ASZA 4IOCA 2L15A 3CF5A 1SN8A 1K0RA 2K75A 4GOPA 4AQYQ 1HNZL 3GTQH 1EOVA 1KRSA 4A4IA 1IBKQ 4DV4L 1WI5A 4R4OA 4JI3L 1VCIA 3MEFA 1E1TA 4YCWA 4DUYQ 3UDIA 4BY7G 1J6QA 2MNAA 2Y0SG 4C3IH 3EIVA 4KI0A 3CCJA 3CCQA 2UXBQ 1SROA 1TWHH 1D8LA 2JA6H 3PUZA 4UP7A 1N33Q 3CAMA 3ER0A 4LF5Q 1UE6A 4OWTB 4NXNL 2VQFL 1FJGQ 4IPHA 2R6GA 1X3EA 1KC8C 4GKKQ 1L1OB 4GKKL 2KBNA 2N3SA 2OCEA 1PH6A 4JYAL 2Y0SE 2VQFQ 3PCOB 3NEMA 4LFBL 1EFWA 1QVFA 3KYHC 4GLAC 1DGSA 1Q46A 4X65L 1K9MC 1VQOA 4GN5A 2Q2HA 4IJHA 3F2DA 3L7ZC 4DAYB 2YTYA 3TS0A 4JI7Q 1N32L 2I5LX 3HOWH 1SMXA 3CCSA 4DR2Q 1T9HA 1HNZQ 4AQYL 3HKSA 4LFCQ 3L0OA 2HHHL 2KCMA 3AFQA 3M3YH 1AH9A 1G291 2PMZE 1C0AA 1E3PA 1PH7A 3B6YA 1A0IA 3H3VI 2JA7G 1KIXA 3U4ZA 2R92H 3CC7A 3M4PA 5AJ3L 5ELNA 4BBRH 3KJPA 1G6PA 3MXNB 3J81i 3T1YL 1HR0W 1G51A 1Q82C 1NMFA 3J81c 1TXYA 3CW2C 3AEVA 4X62L 1WYDA 2VUMG 2IT1A 3CC2A 1PV4A 1WOCA 3ICEA 2F3IA 1W3SA 4LWCA 2F4VL 1Y14B 4DUZL 4LFAQ 2KENA 1QVCA 4A3KG 1V1QA 1GVPA 5GADC 1VS0A 3CC4A 4B3MQ 4B3TQ 2IX1A 4X66Q 1E22A 4JV5L 1GO3E 1V43A 3GDEA 3TQYA 1JJCB 2KCTA 1Q81C 2YYZA 4KHZA 5M3MH 1CKOA 1U5KA 3BZCA 4HJ9A 2VNUD 5IYDH 3I7FA 1IBLQ 1PA6A 3G4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1B A;  2ID0 A;  2UU9 L;  3OTO Q;  3CXC A;  2CWP A;  4DR2 L;  4OON A;  4IFD G;  2CQO A;  4A3M H;  1HR0 Q;  4R1J A;  4A3B H;  2JA7 H;  2AKW B;  4JOI C;  3G48 A;  3E9H A;  4DKA C;  3RN2 A;  3FKI H;  4DV0 Q;  3I55 A;  4A3G G;  1L1O C;  2JA6 G;  4K0K L;  4WJ4 A;  1Z47 A;  4DK3 C;  1Y1W G;  3J7A 5;  3PIP A;  1HZB A;  2D0P A;  3RLO A;  2NVY H;  4X62 Q;  5LMN L;  4A75 A;  4A76 A;  1VQ7 A;  1VQ4 A;  3BZK A;  4K0K Q;  4UPA A;  3U50 C;  4LNQ A;  3GTK H;  2B3G A;  4C3H H;  4YY3 L;  4X6A H;  4DV2 Q;  1XNR Q;  1K3R A;  1CUK A;  1NBW A;  3TS2 A;  1KQS A;  3GTG H;  1KL9 A;  2PQA A;  2I5H A;  3I4M G;  1D7Q A;  3K7A H;  3CCM A;  3J7Z C;  4DV6 L;  4GNX C;  1YJ9 A;  1OXX K;  4IPC A;  2K5N A;  4BBR G;  4POF A;  4JG2 A;  3RNU A;  4LF4 Q;  3W1G A;  1N32 Q;  1VQ9 A;  4JBM A;  1JJG A;  2MQH A;  4PZ6 A;  4RG1 A;  4B3T L;  2A8V A;  1X65 A;  2LXK A;  1Y1V G;  4DV7 Q;  1IYJ B;  2ZTE A;  3TRE A;  4QGU A;  1YHQ A;  1CKM A;  2Z6K A;  4LUO A;  3CCR A;  4DV5 Q;  5FLM H;  3CCL A;  3SGI A;  3H0G H;  4A3J H;  3S1M H;  3S15 H;  1NJI C;  4DPG A;  2CWA A;  4ALP A;  4EQ5 A;  1YJN A;  1JMC A;  2BH2 A;  4LF7 L;  3K81 C;  2VS1 A;  2ATW A;  4KLK A;  3T1Y Q;  2PQA B;  4GKJ L;  2OTJ A;  1YIJ A;  4LF5 L;  4DV3 Q;  1ASY A;  4JI4 Q;  3S17 H;  3FHW A;  3NEN A;  4KHP Q;  4LF6 L;  3PUV A;  4OWX B;  1UEB A;  3S24 A;  1Q86 C;  3H3V H;  1BBU A;  2IHF A;  3UDF A;  2QA4 A;  4XTC S;  4AYB E;  3TRZ A;  1YHB A;  2ZJR A;  4IJL A;  1XPO A;  4HJ7 A;  4A3G H;  2VQE L;  2NN6 I;  2OQK A;  2ALY B;  4JI7 L;  3T1H L;  1XMO Q;  4A3L H;  2ASB A;  4JI4 L;  2R93 H;  1SLJ A;  3GO5 A;  4O2D A;  5IP9 G;  5FLM G;  1VQE A;  1Y1V H;  1EQR A;  4GKJ Q;  4JI5 Q;  2E5L L;  1UWV A;  5LMU Q;  4JI0 L;  2MO0 A;  1OXU A;  4HJ5 A;  3I4M H;  1QZH A;  4MZ9 A;  1PH8 A;  1O7I A;  5JEA G;  3DLL A;  4MTN A;  5JEA J;  3WWV A;  1PH4 A;  1R9T H;  3ZJY C;  3RZO H;  5IE8 A;  4DR6 L;  4GN3 B;  1PH9 A;  2E5L Q;  3GTL H;  1K83 H;  1FL0 A;  1LYL A;  4A3F G;  1OXS C;  5M5X H;  2JE6 I;  1X3G A;  2JK8 A;  4BBS G;  5BR8 L;  2UUC L;  1Q8K A;  2BA0 A;  1I6H H;  3EBE A;  2VQE Q;  5E7N A;  1XMQ L;  2YTX A;  2Q2T A;  4LF4 L;  4A3D G;  1VQM A;  3PF5 A;  2QGQ A;  3FP9 A;  1IXR A;  1IBK L;  3M4Q A;  4A3L G;  2HT1 A;  4DV1 Q;  4A3J G;  4A3I G;  4DK6 C;  4LF6 Q;  4QQB X;  4XIG S;  1X55 A;  1HNW L;  4P72 A;  4Y52 H;  4DR1 L;  4DV2 L;  2UUA Q;  1XNR L;  1L2F A;  4LUZ A;  4DV3 L;  3S16 H;  1PYB A;  1P8L A;  1EUJ A;  3S2D H;  4DR4 L;  1M1K C;  3HOY G;  5C44 G;  1CKN A;  2E2H H;  3KFU A;  4PG3 A;  1K73 C;  1WJJ A;  2AMC B;  2VW9 A;  2D0O A;  3UDG A;  1MJE A;  4A3E H;  4LF8 L;  2R7Z H;  3PUY A;  4JOI A;  1VQN A;  4HIO A;  1VQ6 A;  2HIV A;  2K14 A;  1CKN B;  4JBW A;  4P75 A;  4DR3 Q;  4B3R L;  2WB1 G;  1VQA A;  3CME A;  4OWW B;  4L5Q A;  3CPF A;  4TVA B;  1VQI A;  2E2I H;  4YHH Q;  3K8A A;  5GAG C;  4IFD J;  3I2Z A;  5GRO A;  4PMW A;  3KDF B;  2VUM H;  1HZ9 A;  1I5F A;  1GD7 A;  2NVQ H;  3E0E A;  5C0X I;  1GKH A;  1VQG A;  1HNX L;  3UE1 A;  1HZA A;  3AQQ A;  1QUQ B;  1E1O A;  2CFM A;  1X6O A;  4FDB A;  1CSQ A;  1VQ8 A;  1LUZ A;  3M7N A;  2R7D A;  3CCE A;  2KHJ A;  4DUZ Q;  4BY1 H;  3RR5 A;  5C4X G;  1NMG A;  2N49 A;  2IX0 A;  1YZ6 A;  1V9P A;  4A3M G;  2JQO A;  1WFQ A;  3JC6 6;  2GVB A;  4B3R Q;  4IPG A;  4LF9 L;  4YCU A;  3PO3 G;  5LMN Q;  4DV5 L;  4WJ3 M;  1AE2 A;  1FGU A;  1SFO H;  3KLW A;  1Q12 A;  1VQL A;  1VQK A;  3CCV A;  3CP0 A;  2Z6K C;  4DV0 L;  1PH3 A;  3E9I A;  4DV7 L;  5JJK A;  2OTL A;  1UE1 A;  1IZ6 A;  1AE3 A;  3ULJ A;  4NXM Q;  1TWC H;  1VQB A;  3M9B A;  2ZJP A;  3RN5 A;  2UU9 Q;  4JI1 L;  1BBW A;  4EX5 A;  4JI6 Q;  5DLQ E;  4BXX G;  4BBS H;  3A74 A;  4UP8 A;  3CCU A;  2DGY A;  5IP7 H;  2JA8 G;  3AYH B;  3OYY A;  1B7Y B;  3NBH B;  4JBJ A;  4ME3 A;  4DV1 L;  4A3F H;  1YJW A;  2NVT H;  2R7Z G;  2N8N A;  5M5W H;  1PH2 A;  3TEH B;  2WAQ E;  4R4Q A;  2OQ0 A;  4X66 L;  5H1S E;  1A62 A;  2GVA A;  4B3S L;  4IOA A;  4JV5 Q;  5JJI A;  1VQF A;  2K52 A;  2EQS A;  4LUV A;  1JT8 A;  3I4N H;  4X65 Q;  4A93 G;  1VQP A;  3F1Z A;  2K50 A;  1E7Z A;  4IPD A;  5BR8 Q;  5LMN W;  2UUC Q;  2OWO A;  3GD7 A;  4OX9 Q;  3F2B A;  3K0X A;  1XJV A;  4QJF A;  2RCN A;  4BA2 I;  2H5X A;  4QL5 A;  2Z0S A;  4LF9 Q;  3GTO H;  3S1Q H;  3S1N H;  1Q7Y C;  2N78 A;  2PI2 E;  1WCM G;  2V1C C;  5HY6 A;  3STB D;  4NB3 A;  3ULP A;  5IYC G;  1FJG L;  2RF4 A;  4JI2 Q;  1HR0 L;  3RLF A;  2MFI A;  3HOW G;  4A3C H;  2UXB L;  4TQU S;  2XGT A;  4JI5 L;  1RL2 A;  3ULL A;  1CSP A;  1WCM H;  5M3F G;  1EYG A;  1K8G A;  4DR7 L;  3M4O H;  2R7F A;  4DR5 Q;  3CD6 A;  2EXD A;  3NEL A;  3DM3 A;  4JI3 Q;  3HOU H;  5J3B A;  2UXD Q;  2HHH Q;  5C4X H;  2R92 G;  5IT9 c;  2LXJ A;  2E2J H;  2YU9 H;  1TWF H;  4Y7N H;  1KHI A;  1PHJ A;  2MO1 A;  1YVC A;  3CMA A;  5M3M G;  5IWA L;  5IYD G;  1GM5 A;  3PO2 G;  3CPW A;  4DR7 Q;  1OTC A;  3IRB A;  2R93 G;  2CCZ A;  3I4O A;  3HOZ H;  2IHE A;  4BXX H;  1NTG A;  4GS3 A;  4GN4 B;  3KF6 B;  2WB1 E;  4X64 Q;  4A3D H;  2UXC Q;  4JYA Q;  4X64 L;  3G6E A;  4LF7 Q;  4A3K H;  2K5V A;  3OW2 A;  1L1O A;  5AJ3 Q;  4R4I A;  1LTL A;  4YWL A;  4DR1 Q;  1HNW Q;  4OXP A;  3PIO A;  4C2M H;  4NXN Q;  3Q8D A;  1TWG H;  1S72 A;  5IWA Q;  1I50 H;  2A1A A;  2WP8 J;  3PGZ A;  1X56 A;  2E8G A;  4JI8 Q;  5IYB G;  3RZD H;  1Q1E A;  1QUQ A;  3HOX G;  5EAY A;  4R4T A;  1EWI A;  3K80 C;  4LW1 A;  3PF4 A;  1J5E L;  4LFC L;  5M3F H;  4UP9 A;  1FVI A;  1YI2 A;  2VZA A;  1N36 Q;  2QEX A;  1SRU A;  4L5T A;  3STB C;  4P71 A;  1N36 L;  2UXD L;  3PSI A;  3F2C A;  3KJO A;  4A3B G;  3KDF A;  2YTV A;  5IYC H;  3FKI G;  1YEZ A;  1L0W A;  3J81 j;  1MJC A;  4AYB G;  5M5Y H;  3GTP H;  4DAM A;  1Y1W H;  2BH8 A;  2K4K A;  4LFB Q;  4A3I H;  4NXM L;  4O0A A;  1P16 A;  4RMF A;  3JAM c;  1U0L A;  4JBK A;  1N9W A;  1XTD A;  2RHS B;  4A93 H;  3GTM H;  2JA9 A;  5C0X J;  2UXC L;  3HOV G;  3HKZ E;  1HH2 P;  5FLX c;  4HIK A;  5IYB H;  1S40 A;  1X54 A;  1XMO L;  1X9N A;  2Q2U A;  2JJQ A;  2I0Q A;  3S14 H;  3AFP A;  3EN2 A;  3I56 A;  4DUY L;  2VL6 A;  1X3F A;  2ZTC A;  5GQO A;  2JEB I;  2K5H A;  4HJA A;  3HKZ G;  4A3E G;  1PH5 A;  4B3S Q;  1BKB A;  4OO1 G;  4DV4 Q;  5GAH C;  3OTO L;  3CQZ H;  2IY5 B;  1XNQ L;  3PO2 H;  4NPS A;  1I94 Q;  1IBL L;  2LSS A;  1C9O A;  2CKZ B;  5FJ8 G;  4GNX B;  1HNX Q;  2JA5 H;  4KHP L;  5IY0 A;  2B63 G;  4DR5 L;  2ES2 A;  1EIY B;  3HOY H;  2F52 A;  1BVS A;  2HQL A;  3A0J A;  4P73 A;  3S2H H;  4POG A;  4B3M L;  1LM0 A;  3KOJ A;  5FJ8 H;  5C44 H;  1IBM Q;  4JI2 L;  4LFA L;  1UE5 A;  2DUD A;  1M90 C;  4BY1 G;  2I5M X;  4DR3 L;  2PNH A;  2B63 H;  2F4V Q;  1I3Q H;  2RHQ B;  1HZC A;  3HOX H;  2XTI A;  4DNI A;  3KF8 B;  3JAM i;  4OO1 I;  2UUB L;  5C4J H;  2NN6 G;  2GN5 A;  1HJP A;  1SR3 A;  1QZG A;  4L5S A;  5JJL A;  3GTJ H;  4QIW E;  1OXV A;  4OX9 L;  2AWO A;  4AH6 A;  2ZJQ A;  3PV0 A;  4GNX A;  4DR4 Q;  1EIF A;  5GAE C;  1JE5 A;  1TWA H;  1B70 B;  1NE3 A;  2NZO A;  4DV6 Q;  3D31 A;  1A8V A;  3W1B A;  1I94 L;  1PH1 A;  1XNQ Q;  3PUX A;  1UE7 A;  3H15 A;  4APV A;  1MKH A;  1MIU A;  5IP9 H;  1QVG A;  2ZM6 L;  3PUW A;  5C3E G;  1YHA A;  3BU2 A;  4YWK A;  4JI1 Q;  4HJ8 A;  2FXQ A;  4YY3 Q;  4JI6 L;  1OXT A;  3VDY A;  1NY4 A;  3J80 i;  1KRT A;  1K8A C;  2WFW A;  1YIT A;  3A5Z B;  4L5R C;  5K36 G;  1E24 A;  1A63 A;  3RLN A;  4BY7 H;  4GLX A;  4JC0 A;  2HIX A;  2NVX H;  2AWN A;  1EQQ A;  4LF8 Q;  4HIM A;  4GOP B;  4GLV B;  4GOP C;  4JCV E;  1C7Y A;  1SE8 A;  2D62 A;  5LMU L;  4JI0 Q;  3J80 c;  1VQ5 A;  4UY8 C;  3U4V A;  3W5O A;  1IL2 A;  2VY3 A;  3UDX A;  3HFZ B;  2ZM6 Q;  3M85 A;  3L2P A;  4A3C G;  1PVO A;  1KXL A;  3PO3 H;  3F8T A;  1B8A A;  1N33 L;  1KAW A;  1VQH A;  4PZ8 A;  4BA1 I;  3D0F A;  1PYS B;  3T1H Q;  3HOZ G;  4PZ7 A;  2EIF A;  1Z9F A;  2AHO B;  4R4C A;  3A5U A;  3K7U C;  3H0G G;  1YNX A;  3LGJ A;  4QY7 A;  2YV5 A;  5ELO A;  1XMQ Q;  1J5E Q;  1JB7 A;  4J15 A;  1KD1 C;  2A19 A;  1VQC A;  2BA1 A;  3BJU A;  5C3E H;  4JI8 L;  3I4N G;  4YHH L;  3HOV H;  1XPR A;  2B29 A;  1N8R C;  2C35 B;  1RIP A;  2KHI A;  4IO9 A;  2UUB Q;  4AIM A;  2WAQ G;  3S1R H;  1XPU A;  1JJ2 A;  1VQJ A;  5IP7 G;  2JA8 H;  4DR6 Q;  2JA5 G;  1PFS A;  1YBY A;  4HID A;  1VQD A;  2PI2 A;  4YCV A;  5C0X G;  3G71 A;  1N34 Q;  1H95 A;  2ZTD A;  4P74 A;  4IFD I;  1IBM L;  3U58 A;  4YWM A;  4MNO A;  4H02 A;  2JEA I;  5HGQ A;  2NZH A;  1N34 L;  3ERS X;  1S3O A;  3UE0 A;  4C3J H;  1W2B A;  3KF6 A;  2Q2I A;  3HOU G;  2UUA L;  1ASZ A;  4IOC A;  2L15 A;  3CF5 A;  1SN8 A;  1K0R A;  2K75 A;  4GOP A;  4AQY Q;  1HNZ L;  3GTQ H;  1EOV A;  1KRS A;  4A4I A;  1IBK Q;  4DV4 L;  1WI5 A;  4R4O A;  4JI3 L;  1VCI A;  3MEF A;  1E1T A;  4YCW A;  4DUY Q;  3UDI A;  4BY7 G;  1J6Q A;  2MNA A;  2Y0S G;  4C3I H;  3EIV A;  4KI0 A;  3CCJ A;  3CCQ A;  2UXB Q;  1SRO A;  1TWH H;  1D8L A;  2JA6 H;  3PUZ A;  4UP7 A;  1N33 Q;  3CAM A;  3ER0 A;  4LF5 Q;  1UE6 A;  4OWT B;  4NXN L;  2VQF L;  1FJG Q;  4IPH A;  2R6G A;  1X3E A;  1KC8 C;  4GKK Q;  1L1O B;  4GKK L;  2KBN A;  2N3S A;  2OCE A;  1PH6 A;  4JYA L;  2Y0S E;  2VQF Q;  3PCO B;  3NEM A;  4LFB L;  1EFW A;  1QVF A;  3KYH C;  4GLA C;  1DGS A;  1Q46 A;  4X65 L;  1K9M C;  1VQO A;  4GN5 A;  2Q2H A;  4IJH A;  3F2D A;  3L7Z C;  4DAY B;  2YTY A;  3TS0 A;  4JI7 Q;  1N32 L;  2I5L X;  3HOW H;  1SMX A;  3CCS A;  4DR2 Q;  1T9H A;  1HNZ Q;  4AQY L;  3HKS A;  4LFC Q;  3L0O A;  2HHH L;  2KCM A;  3AFQ A;  3M3Y H;  1AH9 A;  1G29 1;  2PMZ E;  1C0A A;  1E3P A;  1PH7 A;  3B6Y A;  1A0I A;  3H3V I;  2JA7 G;  1KIX A;  3U4Z A;  2R92 H;  3CC7 A;  3M4P A;  5AJ3 L;  5ELN A;  4BBR H;  3KJP A;  1G6P A;  3MXN B;  3J81 i;  3T1Y L;  1HR0 W;  1G51 A;  1Q82 C;  1NMF A;  3J81 c;  1TXY A;  3CW2 C;  3AEV A;  4X62 L;  1WYD A;  2VUM G;  2IT1 A;  3CC2 A;  1PV4 A;  1WOC A;  3ICE A;  2F3I A;  1W3S A;  4LWC A;  2F4V L;  1Y14 B;  4DUZ L;  4LFA Q;  2KEN A;  1QVC A;  4A3K G;  1V1Q A;  1GVP A;  5GAD C;  1VS0 A;  3CC4 A;  4B3M Q;  4B3T Q;  2IX1 A;  4X66 Q;  1E22 A;  4JV5 L;  1GO3 E;  1V43 A;  3GDE A;  3TQY A;  1JJC B;  2KCT A;  1Q81 C;  2YYZ A;  4KHZ A;  5M3M H;  1CKO A;  1U5K A;  3BZC A;  4HJ9 A;  2VNU D;  5IYD H;  3I7F A;  1IBL Q;  1PA6 A;  3G4S A; 
#chains in the Genus database with same CATH topology
 4IFD G;  2CQO A;  1NAP A;  4ABN A;  4A3D B;  1A15 A;  3M3Y B;  2PZW A;  3I55 A;  1RJT A;  1Z47 A;  1Y1W G;  3PIP A;  1HZB A;  1MSH A;  2NVY H;  3RLO A;  4B08 A;  1TII D;  3P7J A;  3BZK A;  1II3 A;  3EFX D;  3MWY W;  1B4O A;  4LNQ A;  3LWE A;  2B3G A;  3IAY A;  4C3H H;  5M5X B;  1K3R A;  4G57 A;  4NMZ A;  1KQS A;  5F2D A;  3CU7 A;  2G9D A;  1TS3 A;  3GTG H;  3K7A H;  5D3I B;  3CCM A;  3HEJ A;  1OXX K;  4IPC A;  4DAP A;  3RNU A;  5E4W C;  3W3A A;  5M5W B;  2A68 D;  4RG1 A;  1HCZ A;  2CQA A;  1Y1V G;  3JAM L;  1SXT A;  1CKM A;  2Z6K A;  2IL8 A;  3CCL A;  4A3J H;  3S15 H;  2IX3 A;  5A2Q L;  1NJI C;  3F2U A;  4LF7 L;  3S14 B;  4RA8 A;  3ONA B;  4GKJ L;  4MTK A;  4LF5 L;  4XQN A;  1ASY A;  3NEN A;  3AMU A;  3PUV A;  5HGT A;  4O42 A;  1G6Z A;  1Q86 C;  4WFN 3;  2QA4 A;  2Q8R E;  3MVV A;  3SVM A;  4KMU C;  1O7Z A;  4HJ7 A;  4HSP A;  1XMO Q;  4A3L H;  1PRT C;  4O2D A;  1C4Q A;  5ELC A;  2XWB B;  5FLM G;  1QJO A;  1Y1V H;  5FO7 B;  4GKJ Q;  4JI5 Q;  1JOR A;  2FMC A;  1UEA B;  2MO0 A;  1QG7 A;  2I07 B;  4MTN A;  1FNU A;  3KLS A;  1PH9 A;  4EQP A;  3H0G B;  1FL0 A;  4HCE A;  2F0W A;  3K5O A;  1HQR D;  5M5X H;  1I6H H;  4C3H G;  3EBE A;  2A6E C;  2YTX A;  4A3D G;  1QWY A;  2QGQ A;  1PDQ A;  3M4Q A;  3J81 L;  2HT1 A;  4KD3 A;  2WV6 D;  4DGZ A;  4Y52 H;  4P72 A;  3C1F A;  1GUT A;  3NE5 B;  4XT3 B;  1M1K C;  3KFU A;  5C44 G;  1CKN A;  3DWQ A;  4H0L C;  5KYI A;  2VW9 A;  3A8J E;  3MXP A;  1LT4 D;  4OHJ A;  1MJE A;  3S15 B;  3A55 A;  2NYZ D;  3PUY A;  5KRU A;  4JOI A;  1VQN A;  2K01 A;  1I4X A;  3FVQ A;  4DNR B;  4BWG B;  3IFD A;  3E0J A;  4JBW A;  4B3R L;  3CPF A;  3J7Y W;  4IFD J;  3ND9 A;  2F0G A;  4ZKC B;  1HZ9 A;  1KAB A;  5C0X I;  1GHK A;  2HCC A;  1HNX L;  4A3G B;  1EQT A;  3AQQ A;  1QUQ B;  1CSQ A;  5J22 A;  2R7D A;  3CCE A;  1YZ6 A;  1ENC A;  1DZ1 A;  3JC6 6;  1WFQ A;  4B3R Q;  3DEP A;  4YCU A;  3D4D A;  2F03 A;  5C6A A;  4XDX A;  5LMN Q;  3GTO B;  1VQK A;  4XYQ A;  2Z6K C;  1YNN D;  5JJK A;  2P5Z X;  4C3H B;  1ZKO A;  2JP1 A;  3ERO A;  4BBS H;  4UP8 A;  3CCU A;  2DGY A;  4DV1 L;  2NVT H;  1B7Y B;  4ME3 A;  5EPL A;  3Q24 A;  3R3O A;  4X66 L;  5JJI A;  4IOA A;  4LMQ D;  2F0I A;  2K52 A;  2ICI A;  4ILW A;  5M3M B;  2K50 A;  5LMN W;  4IPD A;  3Q22 A;  2UUC Q;  5CV8 A;  5L37 A;  4ZLT F;  1ET6 A;  3IFT A;  1PTO B;  2EDG A;  4QJF A;  4BA2 I;  2H5X A;  4QL5 A;  3OMC A;  2V1C C;  1WCM G;  2XNA C;  4DAY A;  3RLF A;  4A3C H;  3VA5 A;  3ULL A;  5EKK A;  3HOW B;  2EXD A;  3KLR A;  5I9O A;  2HHH Q;  1KDA A;  5IT9 c;  2EVB A;  1EYD A;  1NNX A;  1YVC A;  1OTC A;  1STH A;  5JPN C;  2CCZ A;  2ZT9 C;  2IHE A;  4GS3 A;  2CH4 A;  4WJW A;  4ZQ3 A;  4X64 L;  1VMP A;  1BQQ T;  5AJ3 Q;  1TWG H;  2RSO A;  3OOC A;  3JAM E;  4JI8 Q;  5I9P A;  4V0B A;  2F0Q A;  2NN6 H;  1YI2 A;  3OPO A;  2VZA A;  1QNU A;  1N36 Q;  5CC4 A;  3GTQ B;  1SRU A;  3STB C;  1I4R A;  3KJO A;  1JR0 D;  3TDQ A;  1YEZ A;  3J81 j;  1MJC A;  4AYB G;  4XQQ A;  4LFB Q;  1PTO C;  3JAM c;  1OO9 B;  2EY1 A;  2JA9 A;  2PW5 A;  2N55 A;  3HOV G;  3HKZ E;  5FLX c;  2A6H C;  2K33 A;  3HP3 A;  5IYB H;  2RBM A;  1X54 A;  1A2T A;  3C1E A;  3RZD B;  2JJQ A;  2DJF C;  2Q8T A;  3EN2 A;  1TQO A;  1X3F A;  2R3Z A;  5GAH C;  4C3I B;  4LAA A;  2O4X A;  2JA5 H;  2KEE A;  1K0S A;  5IY0 A;  2B63 G;  2ES2 A;  1BVS A;  1EIG A;  3BG3 A;  4OIJ A;  1CFM A;  4B3M L;  2LS0 1;  1M90 C;  4DR3 L;  3MZ5 A;  2F0F A;  5EBC A;  2XTI A;  5DNF A;  2BCO A;  5JVH 3;  2F0U A;  3TP5 A;  1HJP A;  1SR3 A;  1B9M A;  5JJL A;  3KBG A;  2O2L D;  4QIW E;  4OX9 L;  2AWO A;  1AP0 A;  4ME5 A;  4DFA A;  5FO8 B;  5GAE C;  2ENB A;  2L4N A;  1B70 B;  4DV6 Q;  2D5D A;  5KNC A;  4IUU A;  4UAI A;  5IGG A;  1UE7 A;  3K7A B;  1BO0 A;  1MKH A;  1MIU A;  5C3E G;  4JI6 L;  1JOO A;  3VDY A;  1NY4 A;  1SNM A;  4RCO A;  1TY0 A;  1PRT B;  5K36 G;  1E24 A;  1A63 A;  3RLN A;  3T51 B;  3QOJ A;  4GLX A;  3BVZ A;  5EJW A;  2NVX H;  4LF8 Q;  1EZ8 A;  4CKE A;  2E2I B;  4GLV B;  1AFP A;  5ELB A;  2XRS D;  1TWC B;  2D62 A;  3J80 c;  4UY8 C;  3W5O A;  3UDX A;  4A3C G;  1PVO A;  2AQ2 B;  1B8A A;  1KAW A;  1VQH A;  1K3B C;  2F3W A;  3D0F A;  3NTH A;  2B2W A;  3A8I E;  3PO2 B;  4PZ7 A;  5KNB A;  1B50 A;  2F1M A;  5I2X A;  1YNX A;  2YV5 A;  2A19 A;  3BJU A;  1Y8P B;  5C3E H;  4JI8 L;  2ZXR A;  4IO9 A;  5FKA C;  3T53 B;  1JJ2 A;  5IP7 G;  1SMY C;  4A3M B;  2JA8 H;  2JA5 G;  4K8I A;  4KN7 C;  3RD4 A;  2ZTD A;  4IQZ A;  4R8I A;  3U58 A;  2MP1 A;  4MNO A;  4H02 A;  2JEA I;  1SFO B;  2HUG A;  2KED A;  2L1B A;  2NZH A;  1S3O A;  3LWU A;  1SE4 A;  4CKB A;  1B44 D;  1ASZ A;  4IOC A;  3MTS A;  2L15 A;  3O13 A;  1PYW D;  1K0R A;  2JA5 B;  4GOP A;  1LV9 A;  4A4I A;  5HUR A;  1WTR A;  1E1T A;  3FPU B;  4YCW A;  4DUY Q;  3UDI A;  1F2M A;  4FF2 A;  2EYO A;  3X3N A;  4HMI A;  2Y0S G;  2FJ2 A;  3EIV A;  4C3I H;  3S1M B;  1TWH H;  4KY5 A;  2JA6 H;  4IUR A;  1PZK D;  2Z9H A;  4OWT B;  4IPH A;  4F8M A;  1X3E A;  1KC8 C;  4OL7 A;  4JYA L;  1DON A;  1SE2 A;  3S1N B;  1QVF A;  4GLA C;  4OEM B;  1EU4 A;  4X65 L;  2Q2H A;  4IJH A;  5D3D A;  2YTY A;  3FMC A;  1K8O A;  1STA A;  2X69 A;  5KYL A;  1HNZ Q;  1E2W A;  5CYU A;  1SND A;  4F88 A;  3I70 A;  2VUM B;  3HS0 C;  2KCM A;  3AFQ A;  3M3Y H;  2PMZ E;  1E3P A;  3B6Y A;  1O80 A;  1LO5 D;  2DN8 A;  1KIX A;  2R92 H;  3VYT A;  1SYF A;  4BBR H;  3KJP A;  2PZT A;  2PO4 A;  3T1Y L;  3HGB A;  4FNF A;  1NMF A;  1K83 B;  1NR4 A;  4QB4 A;  1DD2 A;  1B1Z A;  1KLG D;  3CC2 A;  1M8A A;  1RHP A;  1A3V A;  2L12 A;  2QF7 A;  1YNJ C;  1GVP A;  2F0O A;  1HUN A;  3CC4 A;  5EBD A;  4XYO A;  1GO3 E;  2RDH A;  3GDE A;  1CK1 A;  1AZP A;  3BYT B;  3T13 A;  2VNU D;  4K8J A;  4A3I B;  1IBL Q;  1PA6 A;  1G91 A;  4OIK A;  3WOE A;  4OON A;  4A3M H;  2KQ3 A;  4R1J A;  4RGN A;  1ET9 A;  4DV0 Q;  4K0K L;  2JA6 G;  3TBI B;  2SNM A;  1S5D D;  2D0P A;  1PTO H;  5LMN L;  5CV6 A;  5BN3 A;  4MN3 A;  5ELE A;  2HDL A;  4I7Z C;  1O7L A;  2DJG C;  1ONL A;  1EY0 A;  2PQA A;  1WCM B;  1ZYR C;  2K5N A;  4LF4 Q;  2E74 C;  1AZQ A;  3LNN A;  1YNJ D;  5IIF A;  3TRE A;  4QGU A;  4ULL A;  2FMM A;  1B3A A;  3MXG A;  5EPK A;  4DV5 Q;  2A6E D;  1JE4 A;  3SGI A;  3H0G H;  3S1M H;  4K2L A;  4EQ5 A;  1YJN A;  2SEB D;  2BH2 A;  5TSS A;  2PQA B;  1F77 A;  4PMB A;  5JOB A;  4IUT A;  4B9X A;  4DXG A;  4KHP Q;  3S24 A;  3QG1 A;  3UDF A;  2B2U C;  4RKL A;  2OQK A;  2ALY B;  4C1N I;  4ID6 A;  2R93 H;  4ZUI A;  3GO5 A;  1WVL A;  4Z9C B;  1UWV A;  5LMU Q;  1OXU A;  1QZH A;  1O7I A;  3DLL A;  1PH4 A;  3RZO H;  5IE8 A;  4GN3 B;  3GTL H;  4CJ2 C;  5BN4 A;  1K83 H;  3MA2 B;  1QCB D;  4YIJ A;  1OXS C;  4K14 A;  4BBS G;  2KEC A;  2UUC L;  4FXK C;  1XMQ L;  2Q2T A;  5EGT A;  1EWC A;  1SEB D;  2FHT A;  1BUV T;  1H9K A;  1IBK L;  3MFG A;  3R2T A;  5DM6 3;  4A3B B;  1HNW L;  4DR1 L;  1Y1V B;  1L2F A;  3S16 H;  3N6R A;  4RWS C;  5C4Z A;  1EUJ A;  3C2P A;  4DR4 L;  2MJ8 A;  3VYR A;  4DAV A;  4RAU C;  4RHR A;  4A3E H;  2R7Z H;  2WKD A;  1L0Y B;  5AFW A;  3HOZ B;  5IT9 L;  2Z4I A;  2B8G A;  4DR3 Q;  3NQT A;  4BBS B;  4OWW B;  1VQA A;  3CME A;  2F3V A;  4TVA B;  1HTP A;  2XWJ B;  3I2Z A;  5GAG C;  4IUQ A;  4PMW A;  4RGT A;  1H9S A;  2NVQ H;  2F0D A;  5C4X B;  4HCS A;  2KOL A;  3PO3 B;  1BBX C;  1K28 A;  3K6O A;  1ZEQ X;  3QR8 A;  3UE1 A;  1PXU A;  1X6O A;  4UDU C;  3GV6 A;  3KUP A;  2IX0 A;  2JQO A;  2BDN A;  4LF9 L;  1SNP A;  5I6W A;  4DA2 A;  3D6W A;  4DV5 L;  4WJ3 M;  1SFO H;  1Q12 A;  3PQI A;  1VQL A;  3CP0 A;  1G2T A;  4WRD A;  2L0C A;  3ULJ A;  2UU9 Q;  1FNW A;  3RN5 A;  4JI1 L;  5DLQ E;  5CV7 A;  4RFB A;  1FYC A;  3NBH B;  4JBJ A;  3TEH B;  4B3S L;  1XYI A;  1X3Q A;  1GHJ A;  2EQS A;  4LUV A;  4MHE A;  5I2Y A;  2B2V C;  1QIL A;  2JA7 B;  3I4N H;  4X65 Q;  1JT8 A;  4A93 G;  1VQP A;  3F1Z A;  1E7Z A;  3K59 A;  2OWO A;  3GD7 A;  3F2B A;  2ICE C;  2PMZ B;  1I4Q A;  1EY5 A;  2Z0S A;  3GTO H;  3S1N H;  1LTS D;  4X3T A;  2L9H A;  2RF4 A;  2MFI A;  1WTV A;  5CV5 A;  1U4L A;  3NPP A;  2D2C C;  4JI5 L;  4CJ1 B;  1CSP A;  3DMU A;  1EYG A;  4DR7 L;  3H09 A;  3IKJ A;  2GA4 B;  1CZW A;  2RA4 A;  1K8M A;  3V96 A;  3HOU H;  5C4X H;  1FR3 A;  2R92 G;  4C56 C;  2LXJ A;  3OMG A;  2E2J H;  2YU9 H;  4Y7N H;  3T56 B;  2EJF C;  3EQL C;  2L55 A;  1GM5 A;  5IWA L;  5IYD G;  4U67 3;  4DR7 Q;  3IRB A;  2AQ1 B;  3I4O A;  1STN A;  3HOZ H;  1S5E D;  3KF6 B;  4A3D H;  2UXC Q;  3AU7 A;  4LF7 Q;  2H4O A;  2K5V A;  3OW2 A;  1L1O A;  2QIL A;  4ODG A;  4X3S A;  4PNY A;  1MBY A;  2F4I A;  1SYD A;  1HNW Q;  1RTN A;  1ILQ A;  1S72 A;  5IWA Q;  5ELF A;  2A1A A;  2O5J C;  4XT1 B;  2DY7 A;  5EAY A;  1J9O A;  1GUS A;  4LW1 A;  1CQV A;  1U4M A;  4LFC L;  1FVI A;  4HN7 A;  1MI2 A;  2UXD L;  3PSI A;  2F0H A;  5DAU A;  4FVM A;  3ERQ A;  5K36 H;  4N9T A;  2K4K A;  2IW3 A;  2JA6 B;  1P16 A;  1TU2 B;  4RMF A;  4JBK A;  3I73 A;  2RHS B;  4BBR B;  4A93 H;  3N52 A;  4K2K A;  2MHV A;  3R2I A;  2C9O A;  3MC0 B;  1X3P A;  2R7Z B;  1S40 A;  4C3J G;  2E75 C;  2I0Q A;  3S14 H;  3AFP A;  2O5I C;  2ZTC A;  2JEB I;  3C3L A;  4HJA A;  3HKZ G;  4B3S Q;  1BKB A;  1TY2 A;  4DV4 Q;  2EXZ A;  3OTO L;  2JN4 A;  4FXD A;  2B39 A;  4DR5 L;  2K5Q A;  5T1I A;  3A0J A;  3D4R A;  4P73 A;  3S2H H;  4U68 A;  3RMH A;  5C44 H;  3KOJ A;  3D6C A;  1IBM Q;  3NTI A;  4L6T B;  2F4V Q;  2I5M X;  2RHQ B;  1V1P B;  4PQX A;  1HZC A;  3HOX H;  3JAM i;  3KF8 B;  2UUB L;  3HZX A;  4L5S A;  1BCP D;  4AH6 A;  1W6J A;  2ZJQ A;  2RVL A;  1EIF A;  1PRT F;  1JE5 A;  1GUW A;  1SMY D;  1F2L A;  1F9Q A;  3E3X A;  4Y7N B;  1I94 L;  1IW7 C;  1PH1 A;  1XNQ Q;  3H15 A;  1BR9 A;  2K5D A;  2XIW A;  4YWK A;  4JI1 Q;  2FXQ A;  5CMD A;  1OXT A;  2PPB C;  3OIQ A;  2Z1C A;  1KRT A;  3A5Z B;  2K6A A;  1EQV A;  3S2D B;  4ZRZ A;  2NVX B;  3RZO B;  1ICF B;  2V4D A;  2F0M A;  4HIM A;  3CRK C;  4GOP B;  1WD1 A;  2M00 A;  1SE8 A;  3GP7 A;  5LMU L;  1SSO A;  1D1K A;  5LL6 X;  1IL2 A;  4G7O C;  5COY A;  5M9O A;  1EY8 A;  3M85 A;  1GUN A;  4ZCK A;  4BA1 I;  1EY7 A;  3T1H Q;  1DYQ A;  2E2D C;  2EY6 A;  3LGJ A;  5ELO A;  4N9P A;  3VR6 A;  3ND8 A;  1JB7 A;  2BA1 A;  2NTS A;  4YHH L;  4TRD A;  3P75 A;  1N8R C;  2KHI A;  3NBI A;  4A3E B;  1D6E C;  1IW7 D;  2PI2 A;  4YCV A;  5C0X G;  3G71 A;  1SYB A;  2EE1 A;  5HGQ A;  1KNE A;  1TS5 A;  4C3J H;  2AQ3 B;  3A7L A;  3KF6 A;  1XWE A;  2UUA L;  3AB9 A;  1TS4 A;  3K0Y A;  1Y69 U;  2K1B A;  2K75 A;  5IGD A;  1HFG A;  2E76 C;  1KRS A;  2OXP A;  4DV4 L;  1Q8I A;  5C3W A;  3MEF A;  1HTL D;  3EJI A;  2J7Z A;  1J6Q A;  2MNA A;  2E2H B;  4RGO S;  4KV6 A;  4IN3 A;  4UP7 A;  3V2T A;  2Y0S B;  1UE6 A;  2VQF L;  1SNO A;  1FJG Q;  4GKK Q;  5FLX E;  1L1O B;  4IFD H;  2OCE A;  1PH6 A;  2Y0S E;  2LKV A;  2NVY B;  1IKL A;  1DGS A;  1Q46 A;  1D5X C;  1K9M C;  1E2Z A;  3NBH A;  1QB5 D;  2MUY A;  2RQX A;  3L7Z C;  4JI7 Q;  1N32 L;  1SMX A;  3CCS A;  4DR2 Q;  4AQY L;  1RKN A;  1JWU D;  2BE5 D;  5DEH A;  1IKM A;  5CBE E;  1PH7 A;  4HMJ A;  4IAL A;  5EKL A;  2R92 B;  2JA7 G;  3U9O A;  3U4Z A;  4AYB B;  3CC7 A;  3S1Q B;  3NWT A;  1JCK B;  1FNV A;  1NR2 A;  4QF4 A;  5ELN A;  3J81 i;  1HR0 W;  1WTP A;  1G51 A;  5KND A;  1E0B A;  4F7X A;  1CM9 A;  4QMG A;  1LTA D;  3RUZ A;  1SYC A;  3A56 A;  2F3I A;  4IUN A;  1W3S A;  1VF5 C;  4H44 C;  3D8G A;  1Y14 B;  4LFA Q;  2KEN A;  1V1P A;  1V1Q A;  4ZYS A;  1BDO A;  1B2T A;  1VS0 A;  5C0X H;  4B3T Q;  1JIC A;  3SK5 A;  5FO9 B;  4JV5 L;  1WTO A;  1V43 A;  1Q81 C;  3SK8 A;  1CZG A;  1I4G A;  4HJ9 A;  5IYD H;  4KN4 C;  3G4S A;  1Q1B A;  2JSO A;  5JEA H;  3L9A X;  3OTO Q;  1PZI D;  2CWP A;  2DY8 A;  5D65 A;  2UU9 L;  1HR0 Q;  2K03 A;  1C48 A;  2CHB D;  1QNK A;  1CQF A;  2AKW B;  2NUC A;  3BDC A;  3G48 A;  4JOI C;  3RN2 A;  2JA7 H;  1F9P A;  1L1O C;  4WJ4 A;  4FP5 D;  4CDD C;  4HED A;  1R4Q B;  2PW7 A;  4X62 Q;  4A76 A;  1VQ4 A;  4K0K Q;  3U50 C;  1Y8N B;  4X6A H;  4DV2 Q;  3TS2 A;  5CV9 A;  3DHQ A;  1KL9 A;  3I4M G;  2F0L A;  4DV6 L;  1SYG A;  4GNX C;  4KD4 A;  3MHB A;  1STY A;  2OT2 A;  1DOL A;  3A8K E;  1VQ9 A;  4JBM A;  2MQH A;  4PZ6 A;  4B3T L;  1JJG A;  2A8V A;  1X65 A;  2WII B;  4K5X A;  4DV7 Q;  1JWS D;  2F0E A;  1D1I A;  3OSO A;  5M5Y B;  3MEH A;  4E6I A;  1Z7T A;  4DPG A;  2CWA A;  4ALP A;  1CA6 A;  1JMC A;  2CH4 W;  3K81 C;  3DEO A;  3G6J B;  2ATW A;  3T1Y Q;  1SNQ A;  2OTJ A;  4G7Z C;  2XN9 C;  1YIJ A;  1MSG A;  4DV3 Q;  5CGK A;  4JI4 Q;  3FHW A;  2IWH A;  5FOB B;  3HKZ B;  1BBU A;  1RCV D;  1LT5 D;  4XTC S;  2ZJR A;  4IJL A;  1XPO A;  3S16 B;  4A3G H;  2NN6 I;  3T1H L;  4F87 A;  1LTI D;  3Q0A A;  2ASB A;  4JI4 L;  2QCP X;  3KK7 A;  5IP9 G;  3I8Z A;  1PLF A;  1TVX A;  4DN4 M;  1I4H A;  1HA6 A;  2RDG A;  4JI0 L;  3I4M H;  4HJ5 A;  4OGQ C;  4MZ9 A;  2OEO A;  1NUC A;  5JEA G;  3GTJ B;  3ZJY C;  3LX0 A;  4CGY B;  3SXH A;  2A68 C;  4MIU A;  4A3F G;  1DJR D;  1Q8K A;  2EYP A;  3J81 E;  2BA0 A;  4IZ8 A;  4J8Q A;  2VQE Q;  5E7N A;  1LT3 D;  3I90 A;  3OIP A;  2NVT B;  1ICW A;  4A3L G;  4R9W A;  3VYS A;  4DV1 Q;  2ZXO A;  4DK6 C;  1X55 A;  2TSS A;  4DV2 L;  2UUA Q;  4LUZ A;  1JOQ A;  1PYB A;  3S2D H;  4EQN A;  4RKB A;  4I7A A;  3BS1 A;  1WJJ A;  1K73 C;  3IL8 A;  2D0O A;  3UDG A;  4LF8 L;  2PYK A;  2L5T A;  2JA8 B;  3VR2 A;  4BY7 B;  2HIV A;  1CKN B;  4P75 A;  4L5Q A;  4YHH Q;  3K8A A;  3GTG B;  4CKC A;  5GRO A;  2VUM H;  4J1M A;  2HD3 A;  1I5F A;  3E0E A;  1RDP D;  4CHT B;  1HRJ A;  1I6V C;  1VQG A;  2H1E A;  5J39 A;  1E1O A;  3M7N A;  2RDF A;  2KHJ A;  5C4X G;  2BOS A;  3FKI B;  1V9P A;  1XX8 A;  5C44 B;  1VDZ A;  4A3M G;  3J7A F;  2GVB A;  1U4P A;  2KCC A;  4IPG A;  1AE2 A;  1FD7 D;  2VB3 X;  3GQB A;  3CCV A;  1NCV A;  1PH3 A;  3BVM A;  2OTL A;  1AE3 A;  1KLU D;  1GOZ A;  1ENF A;  1VQB A;  3M9B A;  2ZJP A;  4EX5 A;  4BXX G;  4K6L A;  5IP7 H;  2JA8 G;  3AYH B;  3OYY A;  1WTQ A;  1IHZ A;  1PZJ D;  1H9J A;  2R7Z G;  2WAQ E;  4R4Q A;  2OQ0 A;  4JV5 Q;  3DWP A;  1A62 A;  5DM7 3;  4QQB X;  1SNC A;  1Y8O B;  4WOR A;  1WTW A;  5BR8 Q;  3EVQ A;  2LMC B;  1S5F D;  1XJV A;  3OWE B;  2MGS A;  1GUG A;  5JPM C;  4M8A A;  3T16 A;  1WD0 A;  2N78 A;  5CV4 A;  3STB D;  3ULP A;  4NB3 A;  2NB0 A;  1FJG L;  4RHS A;  3DUZ A;  3QJY A;  4C3J B;  3I91 A;  1WCM H;  1K8G A;  4DR5 Q;  3NEL A;  2WAQ B;  4I65 A;  4JI3 Q;  1H9M A;  4CBV A;  3R93 A;  3OWF A;  2M9V A;  4KY7 A;  2KUM A;  1DOK A;  1KHI A;  1I4P A;  4JK1 C;  4A93 B;  2EYF A;  5M3M G;  2CW0 C;  4JW0 A;  3CPW A;  3A7A B;  2A5H A;  1BF4 A;  2R93 G;  4KJN A;  2MPM A;  4BXX H;  1NTG A;  4GN4 B;  3DXJ C;  1EEF D;  2WB1 E;  4X64 Q;  2I46 A;  2NBF A;  1PFB A;  4A3K H;  1KTK A;  3TP6 A;  1LTL A;  4YWL A;  4DR1 Q;  2B2Y A;  2BDO A;  4OXP A;  4C2M H;  3PIO A;  1I50 H;  1F2Z A;  2WP8 J;  5IYB G;  4FF4 A;  1Q1E A;  3G7L A;  3M7G A;  1EWI A;  3URY A;  3K80 C;  3VR3 A;  3PF4 A;  1J5E L;  3FDT A;  1IYV A;  5LHY 1;  2KA7 A;  1HFN A;  2EZV A;  1N36 L;  1DXM A;  4QUF A;  1J8I A;  3KDF A;  2YTV A;  1JOK A;  2FIN B;  3TP8 A;  2Z4H A;  4DAM A;  1Y1W B;  1GUO A;  4K5V A;  3K57 A;  4O0A A;  1EYA A;  1XTD A;  2AUK A;  3TZD A;  5J1Z A;  4N8F A;  2A69 D;  4FF1 A;  4UHV A;  4HIK A;  1ROD A;  5D14 A;  1XMO L;  1X9N A;  2CW0 D;  3I56 A;  3HOV H;  2VL6 A;  2K5H A;  2DNE A;  2EJM A;  4OO1 G;  4NKL A;  4G7H C;  4L8J A;  3PO2 H;  1I94 Q;  4NDX A;  5A35 A;  2LSS A;  2CKZ B;  1QOH A;  4GNX B;  3HOY H;  5KEE A;  1EIY B;  2F52 A;  4RCN A;  4POG A;  3KLS X;  1F2Y A;  4X3U A;  1U4R A;  1LM0 A;  5FJ8 H;  1A2U A;  2R93 B;  4LFA L;  3NK9 A;  1I3Q H;  1PFM A;  1G8Z D;  4OO1 I;  3NXW A;  3A54 A;  3D4W A;  5C4J H;  1LT6 D;  1QZG A;  5IGC A;  1DM0 B;  4QUC A;  4GNX A;  4DR4 Q;  3T4A C;  1TWA H;  1VF7 A;  2NZO A;  3PIO 3;  2EPB A;  3W1B A;  2A69 C;  3PUX A;  1QVG A;  4APV A;  1TKW B;  5IP9 H;  3PUW A;  1K8A C;  2CVR A;  3I4M B;  1KDC A;  3MXU A;  3NQI A;  4JC0 A;  5IT9 E;  3HOX B;  2HIX A;  4KY6 A;  2AWN A;  4C3I G;  4GOP C;  2RKS A;  2WKC A;  4JCV E;  4JI0 Q;  2NVQ B;  3SHL A;  2K5W A;  1ESR A;  2WB1 B;  5LL6 S;  1V8Q A;  1N33 L;  3PO3 H;  1TR5 A;  5IOD A;  1RTO A;  5I6Y A;  4DNT B;  3HOZ G;  2AHO B;  4R4C A;  5C3X A;  1XMQ Q;  4PMC A;  1BCP C;  1KD1 C;  3HOY B;  1VQC A;  3I4N G;  1MHW C;  2B29 A;  4KKS A;  2F0J A;  3S1R H;  3HRZ C;  4DR6 Q;  1JC7 A;  1PFS A;  1YBY A;  2EYJ A;  2F0K A;  3BZD B;  3QO2 A;  4IFD I;  1RF2 D;  1S5B D;  1IBM L;  1HPC A;  4L63 B;  1BCP F;  1N34 L;  5IGB A;  2JXM B;  1W2B A;  3TZU A;  5CBA E;  1T5X D;  3GTK B;  3SK6 A;  4HTH A;  5A2Q E;  1HNZ L;  4C1N K;  1EOV A;  2YU9 B;  1KAA A;  1BNZ A;  3CRL C;  1VCI A;  4BY7 G;  1EU3 A;  3K58 A;  4M1U B;  3SR1 A;  4KI0 A;  2X6L A;  2VB2 X;  1SRO A;  1D8L A;  3PUZ A;  1N33 Q;  3ER0 A;  5JJZ A;  4LF5 Q;  1I3Q B;  4NXN L;  3M4Y A;  5ISR A;  4HAE A;  3ZYY X;  4DF7 A;  3P20 A;  2KBN A;  5K5P A;  2VQF Q;  3PCO B;  3NEM A;  3KYH C;  4LK1 C;  3HOU B;  4GN5 A;  1JB3 A;  5C4J B;  3F2D A;  1AEX A;  1VMC A;  3VA7 A;  3TS0 A;  3MAQ A;  2E2J B;  2I5L X;  5IGE A;  3HOV B;  4LFC Q;  2HHH L;  2WAC A;  3VR5 A;  1G29 1;  3FEW X;  5C3E B;  2XRQ D;  1A0I A;  4FF3 A;  3BVG A;  2OF1 A;  3M4P A;  2EJG C;  1HXY D;  2K32 A;  1S5C D;  3MXN B;  4J6H A;  1Q82 C;  4TSS A;  1TXY A;  4QIW B;  3AEV A;  1WYD A;  1EY9 A;  4FYD A;  4OEL B;  1PV4 A;  4KKU A;  3ICE A;  1F9R A;  4LWC A;  5C5L A;  2F4V L;  1FGB D;  3S17 B;  1QVC A;  4A3K G;  4NP5 A;  2K7V A;  3QWN A;  1X32 A;  1SJE D;  2K28 A;  3SDZ A;  2K04 A;  3H91 A;  3PIP 3;  2IX1 A;  1E22 A;  2EY5 A;  4KK7 A;  1A3T A;  2YYZ A;  4KHZ A;  5M3M H;  1CKO A;  1U5K A;  2F0T A;  3J80 E;  4LJZ C;  4H7B A;  3I7F A;  1LTR D;  1EEI D;  4DU9 A;  2ID0 A;  3CXC A;  4DR2 L;  1TWH B;  2F0N A;  4Q0F A;  2B2T C;  2LY7 A;  4A3B H;  3FPP A;  1CT1 D;  4DKA C;  3E9H A;  2A74 C;  3FKI H;  4A3G G;  1JQY D;  2PCF B;  2PQE A;  4DK3 C;  3J7A 5;  2B2Y C;  3DWA A;  4CDC C;  3K5N A;  4A75 A;  3S1R B;  1VQ7 A;  1NSN S;  2SDF A;  4UPA A;  5FLX L;  3GTK H;  3H3V C;  4CJ0 B;  1UAP A;  4YY3 L;  3TME A;  1XNR Q;  1BXT A;  1CUK A;  1NBW A;  4KHV A;  3I4L A;  3I72 A;  1ESF A;  2EOT A;  1D7Q A;  2I5H A;  1QE6 A;  3J7Z C;  1YJ9 A;  1O78 A;  3QOL A;  4BBR G;  4POF A;  4JG2 A;  3W1G A;  4DK0 A;  1N32 Q;  1ENA A;  5JAV A;  2LXK A;  1IYJ B;  1S4Z A;  1XTC D;  2ZTE A;  1Q90 A;  3OW7 A;  1YHQ A;  1LTG D;  4LUO A;  3CCR A;  5FLM H;  1DCZ A;  1UNS A;  1STE A;  4XQJ A;  2NZ1 D;  1SAP A;  4KTA A;  2VS1 A;  1EL0 A;  4KLK A;  5COR A;  1GXD C;  3S17 H;  4LF6 L;  4S3S A;  4ZAI A;  1WTH A;  2C5C A;  2PZU A;  4OWX B;  1C8C A;  1EOT A;  1UEB A;  3H3V H;  2QW7 A;  2IHF A;  3R8B A;  4AYB E;  3TRZ A;  1YHB A;  3Q6S A;  1PTO F;  3SE0 A;  2ZXP A;  2VQE L;  1GJX A;  4JI7 L;  3FRP B;  1SLJ A;  1H9S B;  1VQE A;  1EQR A;  2K05 A;  2E5L L;  1LAC A;  3GV3 A;  1D2B A;  5JEA J;  3WWV A;  1R9T H;  2G5D A;  4DR6 L;  2E5L Q;  5E3F A;  1HQM C;  5C4H A;  1LYL A;  2JYO A;  3W2D A;  2JE6 I;  1X3G A;  2JK8 A;  4EGV A;  5BR8 L;  4H13 C;  2KJX A;  1AN8 A;  3K5L A;  4LF4 L;  2EYH A;  1VQM A;  3PF5 A;  3FP9 A;  1IXR A;  1LLR D;  4Q5V A;  2M2L A;  4A3J G;  4A3I G;  2KCN A;  4LF6 Q;  4XIG S;  5KIX A;  1HA5 A;  1XNR L;  3H6M A;  4DV3 L;  4JPB W;  1P8L A;  3OHX C;  3HOY G;  2E2H H;  4PG3 A;  5EQ0 A;  2AMC B;  5C5M A;  3CKI B;  4NW2 A;  4HIO A;  1VQ6 A;  4X3K A;  2K14 A;  2FFK B;  1PRT D;  5M3F B;  5NUC A;  2WB1 G;  2IJ0 A;  1JWM D;  2E2I H;  1VQI A;  2XSC A;  3KDF B;  2HQE A;  4GZY C;  1GD7 A;  1U9R A;  3TN2 A;  1IL8 A;  1MGS A;  3GTP B;  1GKH A;  1DOM A;  2J0T D;  1HZA A;  2CFM A;  1VQ8 A;  4FDB A;  1LUZ A;  1O7Y A;  4DUZ Q;  1F9S A;  4BY1 H;  3DM1 A;  2TMP A;  1NMG A;  2N49 A;  3PMF A;  3RR5 A;  5E1F A;  3PO3 G;  1D5M C;  1FGU A;  3KLW A;  2G9H D;  1R9T B;  4DV0 L;  3GTM B;  1CHQ D;  3E9I A;  4DV7 L;  1ML0 D;  1UE1 A;  1IZ6 A;  1T5E A;  4NXM Q;  1TWC H;  1LTT D;  1PMR A;  1BBW A;  4JI6 Q;  2B2V A;  3NSW A;  2SNS A;  3A74 A;  1SE3 A;  4N8X 1;  4A3F H;  1YJW A;  2PNR C;  2N8N A;  5M5W H;  1PH2 A;  2KVM A;  5H1S E;  2GVA A;  4O1N A;  1VQF A;  2F0P A;  5ELD A;  2RCF A;  2Z8L A;  2QEJ C;  4OX9 Q;  1G2S A;  5BN5 A;  3K0X A;  2RCN A;  1CTM A;  3NWS A;  4LF9 Q;  3S1Q H;  3SEB A;  1Q7Y C;  2PI2 E;  5HY6 A;  5IYC G;  4JI2 Q;  3U9S A;  2LFN A;  1HR0 L;  3HOW G;  2UXB L;  4TQU S;  2XGT A;  1RL2 A;  5M3F G;  3M4O H;  2R7F A;  2EYL A;  3CD6 A;  1PTO D;  3UI2 A;  3DM3 A;  3NHH A;  3CQZ B;  5J3B A;  5JVG 3;  2UXD Q;  1RD9 D;  1YNN C;  1TWF H;  2NTT A;  1PHJ A;  5IOC A;  1V1O A;  2MO1 A;  3CMA A;  3S2H B;  3PO2 G;  4BY1 B;  3P1H A;  3V05 A;  3H94 A;  3J80 L;  4JYA Q;  3G6E A;  4R4I A;  4NXN Q;  3Q8D A;  4HSV A;  1CI3 M;  3PGZ A;  1X56 A;  2E8G A;  5IGF A;  3RZD H;  1QUQ A;  3HOX G;  4R4T A;  5M3F H;  2QDL A;  4UP9 A;  2QEX A;  4L5T A;  2B8F A;  1KNA A;  4P71 A;  1M4V A;  4A3F B;  3F2C A;  4A3B G;  5IYC H;  4QCL A;  3FKI G;  1L0W A;  2Q8I B;  5M5Y H;  3GTP H;  1Y1W H;  3E5S A;  4BS9 A;  2BH8 A;  4A3I H;  4NXM L;  1U0L A;  1STB A;  1N9W A;  3TSS A;  3GTM H;  5C0X J;  2UXC L;  1HH2 P;  1MD2 D;  1CA5 A;  1PFN A;  3L3O C;  5FK9 C;  4OO1 H;  2EY2 A;  1TWA B;  4RH6 A;  2L11 A;  3D3R A;  2Q2U A;  4B9W A;  3BDL A;  4CDF C;  2SOB A;  4DUY L;  1PH8 A;  2QKI C;  5GQO A;  4A3E G;  1PH5 A;  2AUJ D;  3CQZ H;  2IY5 B;  1XNQ L;  4NPS A;  1IBL L;  1HNX Q;  1C9O A;  5FJ8 G;  2D9U A;  4KHP L;  3VR4 A;  3NP8 A;  1EZ6 A;  2HQL A;  1A6X A;  1BOS A;  3QB3 A;  4KKT A;  1KDB A;  4JI2 L;  4IUP A;  1UE5 A;  2DUD A;  2B63 H;  4BY1 G;  2PNH A;  3ITP A;  1E2V A;  3TP7 A;  1B3Q A;  4DNI A;  5CR3 A;  1Z6H A;  2NN6 G;  2GN5 A;  2Z6B A;  3GTJ H;  4V19 0;  1OXV A;  4PV1 C;  2VXW A;  3Q23 A;  3SK4 A;  3PV0 A;  1XXG A;  3MFY A;  1TT2 A;  4JVZ A;  1NE3 A;  3D31 A;  1A8V A;  1EWH A;  1TWF B;  1ZXT A;  1HHV A;  1UUP A;  2ZM6 L;  2A6H D;  4EQO A;  1YHA A;  3BU2 A;  4HJ8 A;  4K6D A;  3MXN A;  3S9W A;  4YY3 Q;  2IPK D;  3J80 i;  2WFW A;  2N88 A;  1YIT A;  1AW7 A;  5T1G A;  4ZK9 B;  4L5R C;  4BY7 H;  3KF8 A;  2F0V A;  1L0X B;  1EQQ A;  2XVS A;  3K5M A;  4FO2 A;  2KHS A;  3X3M A;  5KGU A;  1C7Y A;  1VQ5 A;  3U4V A;  2DNC A;  1EIH A;  2VY3 A;  1TS2 A;  3HFZ B;  2ZM6 Q;  5EPJ A;  3L2P A;  3NUC A;  1KXL A;  3KBX A;  3F8T A;  4PZ8 A;  3J7A V;  1PYS B;  2A73 B;  3WOF A;  2EIF A;  1Z9F A;  1SBB B;  3M4O B;  3A5U A;  3K7U C;  3H0G G;  1J5E Q;  4QY7 A;  3WDN A;  4J15 A;  4CDE C;  1BCP B;  2NWG A;  1XPR A;  5G3L F;  2C35 B;  1RIP A;  1SJH D;  4AIM A;  2WAQ G;  1B9N A;  2UUB Q;  1XPU A;  1WTX A;  1VQJ A;  3GTL B;  1D5Z C;  4HID A;  4ZKB B;  1VQD A;  1N34 Q;  1IYU A;  1H95 A;  4G4K A;  4P74 A;  4YWM A;  1HUM A;  4RGM A;  2BE5 C;  3ERS X;  3UE0 A;  3HOU G;  2Q2I A;  2J4X A;  3EA6 A;  3CF5 A;  4FXG C;  1SN8 A;  1EFI D;  4AQY Q;  1LTB D;  3GTQ H;  1IBK Q;  1STG A;  1WI5 A;  4IUV A;  4R4O A;  4JI3 L;  5EKI A;  1SDF A;  1EYC A;  3HG9 A;  4DK1 A;  4DXF A;  3CCJ A;  3CCQ A;  2UXB Q;  2B2W C;  2HCI A;  4TKO B;  3CAM A;  3I3C A;  5I4D A;  3C46 A;  2EYM A;  2R6G A;  4GKK L;  2N3S A;  4KJO A;  3BYY B;  1I50 B;  2B2T A;  4A3J B;  4LFB L;  1TWG B;  1EFW A;  1I6H B;  2B2U A;  4A3K B;  1VQO A;  4XXE A;  4DAY B;  4K5W A;  4C2M B;  1EY4 A;  3HOW H;  1T9H A;  3HKS A;  1Q3L A;  3L0O A;  1R4P B;  4ZUJ A;  4EVO A;  1AH9 A;  1C0A A;  3H3V I;  2X6G A;  5G3L D;  3VYU A;  5AJ3 L;  3NTK A;  1SYE A;  2RSN A;  1EY6 A;  1G6P A;  3BDO A;  3J81 c;  1B53 A;  4HR7 B;  3CW2 C;  4X62 L;  2VUM G;  2F0S A;  2WIN B;  3QIA A;  2IT1 A;  1ZYR D;  2B63 B;  1ILP A;  1WOC A;  2HDM A;  1H9R A;  4DUZ L;  3CHB D;  4R8N A;  5GAD C;  1W6K A;  4B3M Q;  4X66 Q;  2R61 A;  1CHP D;  3TQY A;  1LAB A;  1JJC B;  2KCT A;  3E6Z X;  3I4N B;  3BZC A;  5E4X A;  4P2C B;  1A3U A;  2QDB A; 
#chains in the Genus database with same CATH homology
 1Q1B A;  2ID0 A;  2UU9 L;  3OTO Q;  3CXC A;  2CWP A;  4DR2 L;  4OON A;  4IFD G;  2CQO A;  4A3M H;  1HR0 Q;  4R1J A;  4A3B H;  2JA7 H;  2AKW B;  4JOI C;  3G48 A;  3E9H A;  4DKA C;  3RN2 A;  3FKI H;  4DV0 Q;  3I55 A;  4A3G G;  1L1O C;  2JA6 G;  4K0K L;  4WJ4 A;  1Z47 A;  4DK3 C;  1Y1W G;  3J7A 5;  3PIP A;  1HZB A;  2D0P A;  3RLO A;  2NVY H;  4X62 Q;  5LMN L;  4A75 A;  4A76 A;  1VQ7 A;  1VQ4 A;  3BZK A;  4K0K Q;  4UPA A;  3U50 C;  4LNQ A;  3GTK H;  2B3G A;  4C3H H;  4YY3 L;  4X6A H;  4DV2 Q;  1XNR Q;  1K3R A;  1CUK A;  1NBW A;  3TS2 A;  1KQS A;  3GTG H;  1KL9 A;  2PQA A;  2I5H A;  3I4M G;  1D7Q A;  3K7A H;  3CCM A;  3J7Z C;  4DV6 L;  4GNX C;  1YJ9 A;  1OXX K;  4IPC A;  2K5N A;  4BBR G;  4POF A;  4JG2 A;  3RNU A;  4LF4 Q;  3W1G A;  1N32 Q;  1VQ9 A;  4JBM A;  1JJG A;  2MQH A;  4PZ6 A;  4RG1 A;  4B3T L;  2A8V A;  1X65 A;  2LXK A;  1Y1V G;  4DV7 Q;  1IYJ B;  2ZTE A;  3TRE A;  4QGU A;  1YHQ A;  1CKM A;  2Z6K A;  4LUO A;  3CCR A;  4DV5 Q;  5FLM H;  3CCL A;  3SGI A;  3H0G H;  4A3J H;  3S1M H;  3S15 H;  1NJI C;  4DPG A;  2CWA A;  4ALP A;  4EQ5 A;  1YJN A;  1JMC A;  2BH2 A;  4LF7 L;  3K81 C;  2VS1 A;  2ATW A;  4KLK A;  3T1Y Q;  2PQA B;  4GKJ L;  2OTJ A;  1YIJ A;  4LF5 L;  4DV3 Q;  1ASY A;  4JI4 Q;  3S17 H;  3FHW A;  3NEN A;  4KHP Q;  4LF6 L;  3PUV A;  4OWX B;  1UEB A;  3S24 A;  1Q86 C;  3H3V H;  1BBU A;  2IHF A;  3UDF A;  2QA4 A;  4XTC S;  4AYB E;  3TRZ A;  1YHB A;  2ZJR A;  4IJL A;  1XPO A;  4HJ7 A;  4A3G H;  2VQE L;  2NN6 I;  2OQK A;  2ALY B;  4JI7 L;  3T1H L;  1XMO Q;  4A3L H;  2ASB A;  4JI4 L;  2R93 H;  1SLJ A;  3GO5 A;  4O2D A;  5IP9 G;  5FLM G;  1VQE A;  1Y1V H;  1EQR A;  4GKJ Q;  4JI5 Q;  2E5L L;  1UWV A;  5LMU Q;  4JI0 L;  2MO0 A;  1OXU A;  4HJ5 A;  3I4M H;  1QZH A;  4MZ9 A;  1PH8 A;  1O7I A;  5JEA G;  3DLL A;  4MTN A;  5JEA J;  3WWV A;  1PH4 A;  1R9T H;  3ZJY C;  3RZO H;  5IE8 A;  4DR6 L;  4GN3 B;  1PH9 A;  2E5L Q;  3GTL H;  1K83 H;  1FL0 A;  1LYL A;  4A3F G;  1OXS C;  5M5X H;  2JE6 I;  1X3G A;  2JK8 A;  4BBS G;  5BR8 L;  2UUC L;  1Q8K A;  2BA0 A;  1I6H H;  3EBE A;  2VQE Q;  5E7N A;  1XMQ L;  2YTX A;  2Q2T A;  4LF4 L;  4A3D G;  1VQM A;  3PF5 A;  2QGQ A;  3FP9 A;  1IXR A;  1IBK L;  3M4Q A;  4A3L G;  2HT1 A;  4DV1 Q;  4A3J G;  4A3I G;  4DK6 C;  4LF6 Q;  4QQB X;  4XIG S;  1X55 A;  1HNW L;  4P72 A;  4Y52 H;  4DR1 L;  4DV2 L;  2UUA Q;  1XNR L;  1L2F A;  4LUZ A;  4DV3 L;  3S16 H;  1PYB A;  1P8L A;  1EUJ A;  3S2D H;  4DR4 L;  1M1K C;  3HOY G;  5C44 G;  1CKN A;  2E2H H;  3KFU A;  4PG3 A;  1K73 C;  1WJJ A;  2AMC B;  2VW9 A;  2D0O A;  3UDG A;  1MJE A;  4A3E H;  4LF8 L;  2R7Z H;  3PUY A;  4JOI A;  1VQN A;  4HIO A;  1VQ6 A;  2HIV A;  2K14 A;  1CKN B;  4JBW A;  4P75 A;  4DR3 Q;  4B3R L;  2WB1 G;  1VQA A;  3CME A;  4OWW B;  4L5Q A;  3CPF A;  4TVA B;  1VQI A;  2E2I H;  4YHH Q;  3K8A A;  5GAG C;  4IFD J;  3I2Z A;  5GRO A;  4PMW A;  3KDF B;  2VUM H;  1HZ9 A;  1I5F A;  1GD7 A;  2NVQ H;  3E0E A;  5C0X I;  1GKH A;  1VQG A;  1HNX L;  3UE1 A;  1HZA A;  3AQQ A;  1QUQ B;  1E1O A;  2CFM A;  1X6O A;  4FDB A;  1CSQ A;  1VQ8 A;  1LUZ A;  3M7N A;  2R7D A;  3CCE A;  2KHJ A;  4DUZ Q;  4BY1 H;  3RR5 A;  5C4X G;  1NMG A;  2N49 A;  2IX0 A;  1YZ6 A;  1V9P A;  4A3M G;  2JQO A;  1WFQ A;  3JC6 6;  2GVB A;  4B3R Q;  4IPG A;  4LF9 L;  4YCU A;  3PO3 G;  5LMN Q;  4DV5 L;  4WJ3 M;  1AE2 A;  1FGU A;  1SFO H;  3KLW A;  1Q12 A;  1VQL A;  1VQK A;  3CCV A;  3CP0 A;  2Z6K C;  4DV0 L;  1PH3 A;  3E9I A;  4DV7 L;  5JJK A;  2OTL A;  1UE1 A;  1IZ6 A;  1AE3 A;  3ULJ A;  4NXM Q;  1TWC H;  1VQB A;  3M9B A;  2ZJP A;  3RN5 A;  2UU9 Q;  4JI1 L;  1BBW A;  4EX5 A;  4JI6 Q;  5DLQ E;  4BXX G;  4BBS H;  3A74 A;  4UP8 A;  3CCU A;  2DGY A;  5IP7 H;  2JA8 G;  3AYH B;  3OYY A;  1B7Y B;  3NBH B;  4JBJ A;  4ME3 A;  4DV1 L;  4A3F H;  1YJW A;  2NVT H;  2R7Z G;  2N8N A;  5M5W H;  1PH2 A;  3TEH B;  2WAQ E;  4R4Q A;  2OQ0 A;  4X66 L;  5H1S E;  1A62 A;  2GVA A;  4B3S L;  4IOA A;  4JV5 Q;  5JJI A;  1VQF A;  2K52 A;  2EQS A;  4LUV A;  1JT8 A;  3I4N H;  4X65 Q;  4A93 G;  1VQP A;  3F1Z A;  2K50 A;  1E7Z A;  4IPD A;  5BR8 Q;  5LMN W;  2UUC Q;  2OWO A;  3GD7 A;  4OX9 Q;  3F2B A;  3K0X A;  1XJV A;  4QJF A;  2RCN A;  4BA2 I;  2H5X A;  4QL5 A;  2Z0S A;  4LF9 Q;  3GTO H;  3S1Q H;  3S1N H;  1Q7Y C;  2N78 A;  2PI2 E;  1WCM G;  2V1C C;  5HY6 A;  3STB D;  4NB3 A;  3ULP A;  5IYC G;  1FJG L;  2RF4 A;  4JI2 Q;  1HR0 L;  3RLF A;  2MFI A;  3HOW G;  4A3C H;  2UXB L;  4TQU S;  2XGT A;  4JI5 L;  1RL2 A;  3ULL A;  1CSP A;  1WCM H;  5M3F G;  1EYG A;  1K8G A;  4DR7 L;  3M4O H;  2R7F A;  4DR5 Q;  3CD6 A;  2EXD A;  3NEL A;  3DM3 A;  4JI3 Q;  3HOU H;  5J3B A;  2UXD Q;  2HHH Q;  5C4X H;  2R92 G;  5IT9 c;  2LXJ A;  2E2J H;  2YU9 H;  1TWF H;  4Y7N H;  1KHI A;  1PHJ A;  2MO1 A;  1YVC A;  3CMA A;  5M3M G;  5IWA L;  5IYD G;  1GM5 A;  3PO2 G;  3CPW A;  4DR7 Q;  1OTC A;  3IRB A;  2R93 G;  2CCZ A;  3I4O A;  3HOZ H;  2IHE A;  4BXX H;  1NTG A;  4GS3 A;  4GN4 B;  3KF6 B;  2WB1 E;  4X64 Q;  4A3D H;  2UXC Q;  4JYA Q;  4X64 L;  3G6E A;  4LF7 Q;  4A3K H;  2K5V A;  3OW2 A;  1L1O A;  5AJ3 Q;  4R4I A;  1LTL A;  4YWL A;  4DR1 Q;  1HNW Q;  4OXP A;  3PIO A;  4C2M H;  4NXN Q;  3Q8D A;  1TWG H;  1S72 A;  5IWA Q;  1I50 H;  2A1A A;  2WP8 J;  3PGZ A;  1X56 A;  2E8G A;  4JI8 Q;  5IYB G;  3RZD H;  1Q1E A;  1QUQ A;  3HOX G;  5EAY A;  4R4T A;  1EWI A;  3K80 C;  4LW1 A;  3PF4 A;  1J5E L;  4LFC L;  5M3F H;  4UP9 A;  1FVI A;  1YI2 A;  2VZA A;  1N36 Q;  2QEX A;  1SRU A;  4L5T A;  3STB C;  4P71 A;  1N36 L;  2UXD L;  3PSI A;  3F2C A;  3KJO A;  4A3B G;  3KDF A;  2YTV A;  5IYC H;  3FKI G;  1YEZ A;  1L0W A;  3J81 j;  1MJC A;  4AYB G;  5M5Y H;  3GTP H;  4DAM A;  1Y1W H;  2BH8 A;  2K4K A;  4LFB Q;  4A3I H;  4NXM L;  4O0A A;  1P16 A;  4RMF A;  3JAM c;  1U0L A;  4JBK A;  1N9W A;  1XTD A;  2RHS B;  4A93 H;  3GTM H;  2JA9 A;  5C0X J;  2UXC L;  3HOV G;  3HKZ E;  1HH2 P;  5FLX c;  4HIK A;  5IYB H;  1S40 A;  1X54 A;  1XMO L;  1X9N A;  2Q2U A;  2JJQ A;  2I0Q A;  3S14 H;  3AFP A;  3EN2 A;  3I56 A;  4DUY L;  2VL6 A;  1X3F A;  2ZTC A;  5GQO A;  2JEB I;  2K5H A;  4HJA A;  3HKZ G;  4A3E G;  1PH5 A;  4B3S Q;  1BKB A;  4OO1 G;  4DV4 Q;  5GAH C;  3OTO L;  3CQZ H;  2IY5 B;  1XNQ L;  3PO2 H;  4NPS A;  1I94 Q;  1IBL L;  2LSS A;  1C9O A;  2CKZ B;  5FJ8 G;  4GNX B;  1HNX Q;  2JA5 H;  4KHP L;  5IY0 A;  2B63 G;  4DR5 L;  2ES2 A;  1EIY B;  3HOY H;  2F52 A;  1BVS A;  2HQL A;  3A0J A;  4P73 A;  3S2H H;  4POG A;  4B3M L;  1LM0 A;  3KOJ A;  5FJ8 H;  5C44 H;  1IBM Q;  4JI2 L;  4LFA L;  1UE5 A;  2DUD A;  1M90 C;  4BY1 G;  2I5M X;  4DR3 L;  2PNH A;  2B63 H;  2F4V Q;  1I3Q H;  2RHQ B;  1HZC A;  3HOX H;  2XTI A;  4DNI A;  3KF8 B;  3JAM i;  4OO1 I;  2UUB L;  5C4J H;  2NN6 G;  2GN5 A;  1HJP A;  1SR3 A;  1QZG A;  4L5S A;  5JJL A;  3GTJ H;  4QIW E;  1OXV A;  4OX9 L;  2AWO A;  4AH6 A;  2ZJQ A;  3PV0 A;  4GNX A;  4DR4 Q;  1EIF A;  5GAE C;  1JE5 A;  1TWA H;  1B70 B;  1NE3 A;  2NZO A;  4DV6 Q;  3D31 A;  1A8V A;  3W1B A;  1I94 L;  1PH1 A;  1XNQ Q;  3PUX A;  1UE7 A;  3H15 A;  4APV A;  1MKH A;  1MIU A;  5IP9 H;  1QVG A;  2ZM6 L;  3PUW A;  5C3E G;  1YHA A;  3BU2 A;  4YWK A;  4JI1 Q;  4HJ8 A;  2FXQ A;  4YY3 Q;  4JI6 L;  1OXT A;  3VDY A;  1NY4 A;  3J80 i;  1KRT A;  1K8A C;  2WFW A;  1YIT A;  3A5Z B;  4L5R C;  5K36 G;  1E24 A;  1A63 A;  3RLN A;  4BY7 H;  4GLX A;  4JC0 A;  2HIX A;  2NVX H;  2AWN A;  1EQQ A;  4LF8 Q;  4HIM A;  4GOP B;  4GLV B;  4GOP C;  4JCV E;  1C7Y A;  1SE8 A;  2D62 A;  5LMU L;  4JI0 Q;  3J80 c;  1VQ5 A;  4UY8 C;  3U4V A;  3W5O A;  1IL2 A;  2VY3 A;  3UDX A;  3HFZ B;  2ZM6 Q;  3M85 A;  3L2P A;  4A3C G;  1PVO A;  1KXL A;  3PO3 H;  3F8T A;  1B8A A;  1N33 L;  1KAW A;  1VQH A;  4PZ8 A;  4BA1 I;  3D0F A;  1PYS B;  3T1H Q;  3HOZ G;  4PZ7 A;  2EIF A;  1Z9F A;  2AHO B;  4R4C A;  3A5U A;  3K7U C;  3H0G G;  1YNX A;  3LGJ A;  4QY7 A;  2YV5 A;  5ELO A;  1XMQ Q;  1J5E Q;  1JB7 A;  4J15 A;  1KD1 C;  2A19 A;  1VQC A;  2BA1 A;  3BJU A;  5C3E H;  4JI8 L;  3I4N G;  4YHH L;  3HOV H;  1XPR A;  2B29 A;  1N8R C;  2C35 B;  1RIP A;  2KHI A;  4IO9 A;  2UUB Q;  4AIM A;  2WAQ G;  3S1R H;  1XPU A;  1JJ2 A;  1VQJ A;  5IP7 G;  2JA8 H;  4DR6 Q;  2JA5 G;  1PFS A;  1YBY A;  4HID A;  1VQD A;  2PI2 A;  4YCV A;  5C0X G;  3G71 A;  1N34 Q;  1H95 A;  2ZTD A;  4P74 A;  4IFD I;  1IBM L;  3U58 A;  4YWM A;  4MNO A;  4H02 A;  2JEA I;  5HGQ A;  2NZH A;  1N34 L;  3ERS X;  1S3O A;  3UE0 A;  4C3J H;  1W2B A;  3KF6 A;  2Q2I A;  3HOU G;  2UUA L;  1ASZ A;  4IOC A;  2L15 A;  3CF5 A;  1SN8 A;  1K0R A;  2K75 A;  4GOP A;  4AQY Q;  1HNZ L;  3GTQ H;  1EOV A;  1KRS A;  4A4I A;  1IBK Q;  4DV4 L;  1WI5 A;  4R4O A;  4JI3 L;  1VCI A;  3MEF A;  1E1T A;  4YCW A;  4DUY Q;  3UDI A;  4BY7 G;  1J6Q A;  2MNA A;  2Y0S G;  4C3I H;  3EIV A;  4KI0 A;  3CCJ A;  3CCQ A;  2UXB Q;  1SRO A;  1TWH H;  1D8L A;  2JA6 H;  3PUZ A;  4UP7 A;  1N33 Q;  3CAM A;  3ER0 A;  4LF5 Q;  1UE6 A;  4OWT B;  4NXN L;  2VQF L;  1FJG Q;  4IPH A;  2R6G A;  1X3E A;  1KC8 C;  4GKK Q;  1L1O B;  4GKK L;  2KBN A;  2N3S A;  2OCE A;  1PH6 A;  4JYA L;  2Y0S E;  2VQF Q;  3PCO B;  3NEM A;  4LFB L;  1EFW A;  1QVF A;  3KYH C;  4GLA C;  1DGS A;  1Q46 A;  4X65 L;  1K9M C;  1VQO A;  4GN5 A;  2Q2H A;  4IJH A;  3F2D A;  3L7Z C;  4DAY B;  2YTY A;  3TS0 A;  4JI7 Q;  1N32 L;  2I5L X;  3HOW H;  1SMX A;  3CCS A;  4DR2 Q;  1T9H A;  1HNZ Q;  4AQY L;  3HKS A;  4LFC Q;  3L0O A;  2HHH L;  2KCM A;  3AFQ A;  3M3Y H;  1AH9 A;  1G29 1;  2PMZ E;  1C0A A;  1E3P A;  1PH7 A;  3B6Y A;  1A0I A;  3H3V I;  2JA7 G;  1KIX A;  3U4Z A;  2R92 H;  3CC7 A;  3M4P A;  5AJ3 L;  5ELN A;  4BBR H;  3KJP A;  1G6P A;  3MXN B;  3J81 i;  3T1Y L;  1HR0 W;  1G51 A;  1Q82 C;  1NMF A;  3J81 c;  1TXY A;  3CW2 C;  3AEV A;  4X62 L;  1WYD A;  2VUM G;  2IT1 A;  3CC2 A;  1PV4 A;  1WOC A;  3ICE A;  2F3I A;  1W3S A;  4LWC A;  2F4V L;  1Y14 B;  4DUZ L;  4LFA Q;  2KEN A;  1QVC A;  4A3K G;  1V1Q A;  1GVP A;  5GAD C;  1VS0 A;  3CC4 A;  4B3M Q;  4B3T Q;  2IX1 A;  4X66 Q;  1E22 A;  4JV5 L;  1GO3 E;  1V43 A;  3GDE A;  3TQY A;  1JJC B;  2KCT A;  1Q81 C;  2YYZ A;  4KHZ A;  5M3M H;  1CKO A;  1U5K A;  3BZC A;  4HJ9 A;  2VNU D;  5IYD H;  3I7F A;  1IBL Q;  1PA6 A;  3G4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...