1KXPD

Crystal structure of human vitamin d-binding protein in complex with skeletal actin
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
457
structure length
438
Chain Sequence
LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPLKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vitamin D-binding protein and its complex with actin: structural basis of the actin-scavenger system.
pubmed doi rcsb
molecule keywords ACTIN,ALPHA SKELETAL MUSCLE
molecule tags Contractile protein/protein binding
total genus 162
structure length 438
sequence length 457
ec nomenclature
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00273 Serum_albumin Serum albumin family
D PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kxpD02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kxpD03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kxpD01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kxpD04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1kxpD05
4LA0A 4L8UA 2BX8A 3V09A 1KW2A 4E99A 2BXEA 2BXQA 4G04A 5FUOA 1HK3A 3B9LA 3JQZA 4F5TA 4LUHA 1J7EA 2BXCA 4L9KA 4K71A 4EMXA 4JK4A 2XVWA 2BXIA 3B9MA 3TDLA 2BXOA 4LB9A 1MA9A 4OT2A 2VUEA 2BXBA 5IIUA 2BXNA 1E7CA 1N5UA 5ID7A 1HA2A 2BXDA 4LUFA 4Z69A 1HK1A 4N0FD 1E7HA 2VDBA 5DBYA 1BJ5A 3LU7A 2XVUA 2BXFA 1E7BA 2XVVA 1HK5A 2VUFA 3LU6A 1GNJA 5IIXA 3CX9A 1HK2A 2BXPA 2BXGA 2I30A 1E7EA 4L9QA 2I2ZA 2BXMA 2BXKA 4G03A 4HGMB 2XSIA 1E7GA 4IW2A 1TF0A 4ZBRA 5IJ5A 3A73A 5GHKA 2YDFA 2BXHA 1HK4A 5ID9A 1E7FA 4PO0A 3SQJA 3V08A 4N0UD 5IJFA 4HGKA 2BXAA 5IJEA 2XW0A 1O9XA 4J2VA 4IW1A 3UIVA 3V03A 2XVQA 4BKEA 1BM0A 1H9ZA 1E7IA 4F5UA 5HOZA 1KXPD 4S1YA 1AO6A 2BXLA 5DQFA 5IFOA 5IIHA 1E7AA 1J78A 2XW1A 1GNIA 4ZBQA 1E78A 4OR0A 1LOTA 4LB2A 4F5SA 4K2CA 1UORA 4F5VA 1BKEA 3LU8A 3JRYA
chains in the Genus database with same CATH superfamily
4LA0A 4L8UA 5D7GA 5GINA 4C31B 1MIVA 2ROHA 2BX8A 2NQOA 2Z8KA 3V09A 1KW2A 4E99A 2BXEA 2XMOA 2BXQA 4G04A 5FUOA 4GDXA 1HK3A 3B9LA 2LXTA 3JQZA 2KBZA 4F5TA 4LUHA 1LNSA 1J7EA 2BXCA 4L9KA 2Z8IA 2NNWA 3SIVB 1VZSA 4K71A 2QMCA 4EMXA 3WHQA 4JK4A 2OZBB 2XVWA 1KDXA 2BXIA 3B9MA 1MM8A 3TDLA 2BXOA 4NAWB 4LB9A 4D7XA 1MA9A 4OT2A 2VUEA 3W1SA 3NVIA 2BXBA 3M99C 2EFHA 5GIOA 5IIUA 1NT2B 1VFIA 4N3ZA 3GQUA 2AJEA 1MUSA 1E7CA 1N5UA 3FNMA 5ID7A 1HA2A 2BXDA 2CKXA 2EFDA 2V36A 3BPJA 4ZC6A 3NVKA 4LUFA 3ECPA 4Z69A 1HK1A 4N0FD 4OTUA 4Z9OA 1E7HA 2VDBA 5DBYA 1BJ5A 3GQXA 2DBXA 3WHSA 4ZUXV 3LU7A 4BY9C 3KIKA 2XVUA 2BXFA 4TQ1A 4GDLB 3H37A 5BPKA 3NMUA 1E7BA 1MIYA 2XVVA 1HK5A 2VUFA 3KJLA 1GNJA 3LU6A 4FK5B 5IIXA 4DHXB 3CX9A 1HK2A 2BXPA 3GA9L 3PLAA 1MIWA 2QHBA 2BXGA 4ZBKA 2DYOA 2I30A 1E7EA 4L9QA 2I2ZA 2BXMA 2GUTA 2BXKA 4G03A 2K0NA 5B5TA 2KWFA 2JUHA 4HGMB 1FOUA 1E7GA 2XSIA 3G9KD 4IW2A 3A75A 3WHRA 1TF0A 4ZBRA 2LXSA 2E0YA 5IJ5A 4FIPB 4FJCB 3SIUB 3A73A 3FWCC 3NVMA 4ZCGA 5GHKA 2YDFA 2BXHA 1HK4A 5ID9A 1E7FA 4PO0A 1JNBA 1H5WA 2DG5A 4MBEC 4OTTA 3SQJA 3V08A 4N0UD 5IJFA 4HGKA 1MUHA 4W4UB 2AGHB 4M70B 2BXAA 5IJEA 2XW0A 1O9XA 2DBWA 4J2VA 4IW1A 2LQIA 1SB0A 3UIVA 4G01A 3V03A 2XVQA 2LQHA 3FWBC 4BKEA 3ICXA 1BM0A 3MHSB 1H9ZA 1E7IA 2Z8JA 4F5UA 2E0XA 5HOZA 2LOQA 3H3AA 1KXPD 3JRYA 4S1YA 2EFEA 1AO6A 5GIPA 2BXLA 2DYMA 5DQFA 3MHHB 5IFOA 4GDKB 4TQ0A 2EFCA 4I9OA 5IIHA 1IJGA 1E7AA 1J78A 2XW1A 1GNIA 3VQIA 1TXUA 4ZBQA 1E78A 4OR0A 2QM6A 1LOTA 2DBUA 4LB2A 4F5SA 4K2CA 1UORA 4DM0A 2OT3A 4GG2A 4F5VA 1BKEA 4WA6B 3LU8A 2BXNA
chains in the Genus database with same CATH topology
4LA0A 4L8UA 5D7GA 5GINA 4C31B 1MIVA 2ROHA 2BX8A 2NQOA 2Z8KA 3V09A 1KW2A 4E99A 2BXEA 2XMOA 2BXQA 4G04A 5FUOA 4GDXA 1HK3A 3B9LA 3JQZA 2KBZA 4F5TA 4LUHA 1LNSA 1J7EA 2BXCA 4L9KA 2Z8IA 2NNWA 3SIVB 1VZSA 4K71A 2QMCA 4EMXA 3WHQA 4JK4A 2OZBB 2XVWA 2BXIA 3B9MA 3TDLA 2BXOA 4NAWB 4LB9A 1MA9A 4OT2A 2VUEA 3W1SA 3NVIA 2BXBA 3M99C 2EFHA 5GIOA 5IIUA 1NT2B 1VFIA 4N3ZA 3GQUA 2AJEA 1E7CA 1N5UA 3FNMA 5ID7A 1HA2A 2BXDA 2CKXA 2EFDA 2V36A 4ZC6A 3NVKA 4LUFA 4Z69A 1HK1A 4N0FD 4OTUA 4Z9OA 1E7HA 2VDBA 5DBYA 1BJ5A 3GQXA 2DBXA 3WHSA 4ZUXV 3LU7A 4BY9C 3KIKA 2XVUA 2BXFA 4TQ1A 4GDLB 3H37A 5BPKA 3NMUA 1E7BA 1MIYA 2XVVA 1HK5A 2VUFA 3KJLA 1GNJA 3LU6A 4FK5B 5IIXA 4DHXB 3CX9A 1HK2A 2BXPA 3GA9L 3PLAA 1MIWA 2QHBA 2BXGA 4ZBKA 2DYOA 2I30A 1E7EA 4L9QA 2I2ZA 2BXMA 2BXKA 4G03A 5B5TA 2JUHA 4HGMB 1FOUA 1E7GA 2XSIA 3G9KD 4IW2A 3A75A 3WHRA 1TF0A 4ZBRA 5IJ5A 2E0YA 4FIPB 4FJCB 3SIUB 3A73A 3FWCC 3NVMA 4ZCGA 5GHKA 2YDFA 2BXHA 1HK4A 5ID9A 1E7FA 4PO0A 1JNBA 1H5WA 2DG5A 4MBEC 4OTTA 3SQJA 3V08A 4N0UD 5IJFA 4HGKA 4W4UB 4M70B 2BXAA 5IJEA 2XW0A 1O9XA 2DBWA 4J2VA 4IW1A 3UIVA 4G01A 3V03A 2XVQA 3FWBC 4BKEA 3ICXA 1BM0A 3MHSB 1H9ZA 1E7IA 2Z8JA 4F5UA 2E0XA 5HOZA 2LOQA 3H3AA 1KXPD 3JRYA 4S1YA 2EFEA 1AO6A 5GIPA 2BXLA 2DYMA 5DQFA 3MHHB 5IFOA 4GDKB 4TQ0A 2EFCA 5IIHA 1IJGA 1E7AA 1J78A 2XW1A 1GNIA 3VQIA 1TXUA 4ZBQA 1E78A 4OR0A 2QM6A 1LOTA 2DBUA 4LB2A 4F5SA 4K2CA 1UORA 2OT3A 4GG2A 4F5VA 1BKEA 4WA6B 3LU8A 2BXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LA0 A;  4L8U A;  2BX8 A;  3V09 A;  1KW2 A;  4E99 A;  2BXE A;  2BXQ A;  4G04 A;  5FUO A;  1HK3 A;  3B9L A;  3JQZ A;  4F5T A;  4LUH A;  1J7E A;  2BXC A;  4L9K A;  4K71 A;  4EMX A;  4JK4 A;  2XVW A;  2BXI A;  3B9M A;  3TDL A;  2BXO A;  4LB9 A;  1MA9 A;  4OT2 A;  2VUE A;  2BXB A;  5IIU A;  2BXN A;  1E7C A;  1N5U A;  5ID7 A;  1HA2 A;  2BXD A;  4LUF A;  4Z69 A;  1HK1 A;  4N0F D;  1E7H A;  2VDB A;  5DBY A;  1BJ5 A;  3LU7 A;  2XVU A;  2BXF A;  1E7B A;  2XVV A;  1HK5 A;  2VUF A;  3LU6 A;  1GNJ A;  5IIX A;  3CX9 A;  1HK2 A;  2BXP A;  2BXG A;  2I30 A;  1E7E A;  4L9Q A;  2I2Z A;  2BXM A;  2BXK A;  4G03 A;  4HGM B;  2XSI A;  1E7G A;  4IW2 A;  1TF0 A;  4ZBR A;  5IJ5 A;  3A73 A;  5GHK A;  2YDF A;  2BXH A;  1HK4 A;  5ID9 A;  1E7F A;  4PO0 A;  3SQJ A;  3V08 A;  4N0U D;  5IJF A;  4HGK A;  2BXA A;  5IJE A;  2XW0 A;  1O9X A;  4J2V A;  4IW1 A;  3UIV A;  3V03 A;  2XVQ A;  4BKE A;  1BM0 A;  1H9Z A;  1E7I A;  4F5U A;  5HOZ A;  1KXP D;  4S1Y A;  1AO6 A;  2BXL A;  5DQF A;  5IFO A;  5IIH A;  1E7A A;  1J78 A;  2XW1 A;  1GNI A;  4ZBQ A;  1E78 A;  4OR0 A;  1LOT A;  4LB2 A;  4F5S A;  4K2C A;  1UOR A;  4F5V A;  1BKE A;  3LU8 A;  3JRY A; 
#chains in the Genus database with same CATH topology
 4LA0 A;  4L8U A;  5D7G A;  5GIN A;  4C31 B;  1MIV A;  2ROH A;  2BX8 A;  2NQO A;  2Z8K A;  3V09 A;  1KW2 A;  4E99 A;  2BXE A;  2XMO A;  2BXQ A;  4G04 A;  5FUO A;  4GDX A;  1HK3 A;  3B9L A;  2LXT A;  3JQZ A;  2KBZ A;  4F5T A;  4LUH A;  1LNS A;  1J7E A;  2BXC A;  4L9K A;  2Z8I A;  2NNW A;  3SIV B;  1VZS A;  4K71 A;  2QMC A;  4EMX A;  3WHQ A;  4JK4 A;  2OZB B;  2XVW A;  1KDX A;  2BXI A;  3B9M A;  1MM8 A;  3TDL A;  2BXO A;  4NAW B;  4LB9 A;  4D7X A;  1MA9 A;  4OT2 A;  2VUE A;  3W1S A;  3NVI A;  2BXB A;  3M99 C;  2EFH A;  5GIO A;  5IIU A;  1NT2 B;  1VFI A;  4N3Z A;  3GQU A;  2AJE A;  1MUS A;  1E7C A;  1N5U A;  3FNM A;  5ID7 A;  1HA2 A;  2BXD A;  2CKX A;  2EFD A;  2V36 A;  3BPJ A;  4ZC6 A;  3NVK A;  4LUF A;  3ECP A;  4Z69 A;  1HK1 A;  4N0F D;  4OTU A;  4Z9O A;  1E7H A;  2VDB A;  5DBY A;  1BJ5 A;  3GQX A;  2DBX A;  3WHS A;  4ZUX V;  3LU7 A;  4BY9 C;  3KIK A;  2XVU A;  2BXF A;  4TQ1 A;  4GDL B;  3H37 A;  5BPK A;  3NMU A;  1E7B A;  1MIY A;  2XVV A;  1HK5 A;  2VUF A;  3KJL A;  1GNJ A;  3LU6 A;  4FK5 B;  5IIX A;  4DHX B;  3CX9 A;  1HK2 A;  2BXP A;  3GA9 L;  3PLA A;  1MIW A;  2QHB A;  2BXG A;  4ZBK A;  2DYO A;  2I30 A;  1E7E A;  4L9Q A;  2I2Z A;  2BXM A;  2GUT A;  2BXK A;  4G03 A;  2K0N A;  5B5T A;  2KWF A;  2JUH A;  4HGM B;  1FOU A;  1E7G A;  2XSI A;  3G9K D;  4IW2 A;  3A75 A;  3WHR A;  1TF0 A;  4ZBR A;  2LXS A;  2E0Y A;  5IJ5 A;  4FIP B;  4FJC B;  3SIU B;  3A73 A;  3FWC C;  3NVM A;  4ZCG A;  5GHK A;  2YDF A;  2BXH A;  1HK4 A;  5ID9 A;  1E7F A;  4PO0 A;  1JNB A;  1H5W A;  2DG5 A;  4MBE C;  4OTT A;  3SQJ A;  3V08 A;  4N0U D;  5IJF A;  4HGK A;  1MUH A;  4W4U B;  2AGH B;  4M70 B;  2BXA A;  5IJE A;  2XW0 A;  1O9X A;  2DBW A;  4J2V A;  4IW1 A;  2LQI A;  1SB0 A;  3UIV A;  4G01 A;  3V03 A;  2XVQ A;  2LQH A;  3FWB C;  4BKE A;  3ICX A;  1BM0 A;  3MHS B;  1H9Z A;  1E7I A;  2Z8J A;  4F5U A;  2E0X A;  5HOZ A;  2LOQ A;  3H3A A;  1KXP D;  3JRY A;  4S1Y A;  2EFE A;  1AO6 A;  5GIP A;  2BXL A;  2DYM A;  5DQF A;  3MHH B;  5IFO A;  4GDK B;  4TQ0 A;  2EFC A;  4I9O A;  5IIH A;  1IJG A;  1E7A A;  1J78 A;  2XW1 A;  1GNI A;  3VQI A;  1TXU A;  4ZBQ A;  1E78 A;  4OR0 A;  2QM6 A;  1LOT A;  2DBU A;  4LB2 A;  4F5S A;  4K2C A;  1UOR A;  4DM0 A;  2OT3 A;  4GG2 A;  4F5V A;  1BKE A;  4WA6 B;  3LU8 A;  2BXN A; 
#chains in the Genus database with same CATH homology
 4LA0 A;  4L8U A;  5D7G A;  5GIN A;  4C31 B;  1MIV A;  2ROH A;  2BX8 A;  2NQO A;  2Z8K A;  3V09 A;  1KW2 A;  4E99 A;  2BXE A;  2XMO A;  2BXQ A;  4G04 A;  5FUO A;  4GDX A;  1HK3 A;  3B9L A;  3JQZ A;  2KBZ A;  4F5T A;  4LUH A;  1LNS A;  1J7E A;  2BXC A;  4L9K A;  2Z8I A;  2NNW A;  3SIV B;  1VZS A;  4K71 A;  2QMC A;  4EMX A;  3WHQ A;  4JK4 A;  2OZB B;  2XVW A;  2BXI A;  3B9M A;  3TDL A;  2BXO A;  4NAW B;  4LB9 A;  1MA9 A;  4OT2 A;  2VUE A;  3W1S A;  3NVI A;  2BXB A;  3M99 C;  2EFH A;  5GIO A;  5IIU A;  1NT2 B;  1VFI A;  4N3Z A;  3GQU A;  2AJE A;  1E7C A;  1N5U A;  3FNM A;  5ID7 A;  1HA2 A;  2BXD A;  2CKX A;  2EFD A;  2V36 A;  4ZC6 A;  3NVK A;  4LUF A;  4Z69 A;  1HK1 A;  4N0F D;  4OTU A;  4Z9O A;  1E7H A;  2VDB A;  5DBY A;  1BJ5 A;  3GQX A;  2DBX A;  3WHS A;  4ZUX V;  3LU7 A;  4BY9 C;  3KIK A;  2XVU A;  2BXF A;  4TQ1 A;  4GDL B;  3H37 A;  5BPK A;  3NMU A;  1E7B A;  1MIY A;  2XVV A;  1HK5 A;  2VUF A;  3KJL A;  1GNJ A;  3LU6 A;  4FK5 B;  5IIX A;  4DHX B;  3CX9 A;  1HK2 A;  2BXP A;  3GA9 L;  3PLA A;  1MIW A;  2QHB A;  2BXG A;  4ZBK A;  2DYO A;  2I30 A;  1E7E A;  4L9Q A;  2I2Z A;  2BXM A;  2BXK A;  4G03 A;  5B5T A;  2JUH A;  4HGM B;  1FOU A;  1E7G A;  2XSI A;  3G9K D;  4IW2 A;  3A75 A;  3WHR A;  1TF0 A;  4ZBR A;  5IJ5 A;  2E0Y A;  4FIP B;  4FJC B;  3SIU B;  3A73 A;  3FWC C;  3NVM A;  4ZCG A;  5GHK A;  2YDF A;  2BXH A;  1HK4 A;  5ID9 A;  1E7F A;  4PO0 A;  1JNB A;  1H5W A;  2DG5 A;  4MBE C;  4OTT A;  3SQJ A;  3V08 A;  4N0U D;  5IJF A;  4HGK A;  4W4U B;  4M70 B;  2BXA A;  5IJE A;  2XW0 A;  1O9X A;  2DBW A;  4J2V A;  4IW1 A;  3UIV A;  4G01 A;  3V03 A;  2XVQ A;  3FWB C;  4BKE A;  3ICX A;  1BM0 A;  3MHS B;  1H9Z A;  1E7I A;  2Z8J A;  4F5U A;  2E0X A;  5HOZ A;  2LOQ A;  3H3A A;  1KXP D;  3JRY A;  4S1Y A;  2EFE A;  1AO6 A;  5GIP A;  2BXL A;  2DYM A;  5DQF A;  3MHH B;  5IFO A;  4GDK B;  4TQ0 A;  2EFC A;  5IIH A;  1IJG A;  1E7A A;  1J78 A;  2XW1 A;  1GNI A;  3VQI A;  1TXU A;  4ZBQ A;  1E78 A;  4OR0 A;  2QM6 A;  1LOT A;  2DBU A;  4LB2 A;  4F5S A;  4K2C A;  1UOR A;  2OT3 A;  4GG2 A;  4F5V A;  1BKE A;  4WA6 B;  3LU8 A;  2BXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...