1KXTA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 170
structure length 496
sequence length 496
chains with identical sequence C, E
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxtA01
3CZGA 2WZIA 3CHCA 1EDQA 3EJPA 2WMIB 1CLXA 2WVTA 1UHVA 1MYRA 1HJUA 3RIKA 3MS8A 3AIRA 1KBBA 5JBEA 3MMUA 5ECUA 2GJRA 1FFRA 2NT0A 1EDGA 5A8MA 1BFNA 2AMGA 1I1WA 4FK9A 3F5LA 4HOWA 2DEPA 4B15A 2E9LA 2VL4A 4U31A 4W5UA 4IPNB 4YHEA 3WBAA 3N1AA 5FOOA 5D9MA 2FYVA 5E6ZA 3LXAA 3QHOA 3VPLA 2CCRA 1EO5A 4ACZA 2XTKA 4ACZB 4KWUA 5A94A 2VQTA 3RO8A 1G94A 3AMDA 3SCTA 3NJ3A 2V5DA 1UD5A 5E9AA 1AVAA 3LPFA 1HL8A 5A8QA 4HZ7A 2PC8A 2ZE0A 1M7XA 1R7AA 2WC3A 4EANA 3CZSA 1H0GA 1BG4A 3VIFA 2V3EA 3EDJA 4NZFA 2ZOXA 3WMSA 4N0RA 2F1AA 2O9TA 4W89A 3AXIA 2F1BA 4JIEA 3PZUA 3BH4A 2YKKA 3KLLA 3K4DA 2HISA 1OCQA 4UFIA 4F8XA 4UZUA 1RPKA 3CZEA 3DDFA 1UR2A 2V3FA 3CHDA 1XCXA 4QP0A 4BS0A 3WMBA 3LPPA 5CPTA 3VD3A 4Z2JA 1ESWA 2DH2A 3AZSA 2VZTA 1JDAA 3D50A 4DM2A 1V0KA 1W1VA 3GNRA 4DM1A 3M07A 3TONA 3B9DA 1UH2A 1R34A 1ISZA 1R46A 4CVUA 3TA9A 4J3XA 2HVMA 4UFLA 2F7QA 2VCAA 1AQ0A 1XYFA 1SFSA 3BCFA 1CGYA 1BVZA 3DHPA 1E9LA 2X0YA 3MMDA 4MNLA 4W87A 4FLQA 5FIPA 3U5YA 1VBUA 1ODZA 3WKZA 4U2YA 1BSIA 3FHAA 4PMXA 2G4FA 3QHNA 1BYAA 3D4ZA 2J8FA 2JE8A 5JBDA 1GOIA 3WQ8A 3OZPA 3GH7A 2ZX7A 4X0NA 3GDBA 1QI5A 3SIMA 5C70A 3L4VA 5AYIA 2J75A 4PRWA 1UWIA 4ZE5A 3IK2A 5CGMA 4GI9A 4U33A 3GM8A 4RE4A 1WP6A 1JZ2A 1E70M 4H04A 3AICA 2XSAA 4FLSA 5BXTA 2O9RA 1CDGA 4IM4A 1UQYA 3SCWA 1E4NA 2EAEA 3NIYA 3VX1A 2XIIA 3GNPA 4PMRA 1GJUA 5A69A 2VX7A 1CTNA 2YL8A 3MSGA 1Q4NX 5A6BA 3OLGA 4AIUA 3FN9A 4BZYA 2PWHA 2VVSA 5I24A 1ZS2A 2O9OA 2A3HA 2CITA 3O6AA 4EKJA 4AZGA 1K6AA 1E56A 1GHSA 2F7PA 1GORA 2ZIDA 1V3LA 4WK9A 1ZB5A 5BRQA 3AMCA 4AZ7A 1UR8A 1EQCA 3OBAA 3UESA 5GQBA 1JAKA 1V03A 1C91A 3AMLA 1SYTA 1OGBA 3EBVA 3ZT5A 3IGUA 4NI3A 1UQZA 2JF6A 4P8VA 5EBAA 1NH6A 1HVXA 1OM0A 4ZE4A 1WO2A 2WNWA 3VSTA 1VFOA 2GK1B 2DSKA 4OUEA 2XVKA 4AMCA 2J79A 4FLRA 2D1ZA 2F18A 1GW1A 1DWAM 5A2AA 1OIMA 3CMJA 5DEZA 4UFHA 2WMJA 1RD6A 2WSPA 3EMCA 1BTCA 2OYMA 2VTFA 4AEEA 3N13A 4E2OA 2DT3A 1C8XA 4S3JA 3A4WA 1M53A 3EJUA 3QOMA 4JCLA 4AXNA 3AQUA 2YIHA 3BSGA 4F9JA 1HNYA 2D3NA 9CGTA 1JDDA 2FGZA 1QI2A 3PZ9A 1CYGA 1SMAA 2YA0A 1B0IA 2WVVA 3I3EA 1UA3A 1NWSA 4M82A 1HJWA 3BAWA 3WF2A 1QWUA 1KTCA 5D9NA 3ALFA 2WPGA 2F7RA 4F79A 3K4AA 2PF0A 3WF3A 1VFMA 2BY1A 1CGVA 3N9KA 3CUFA 1V6XA 1H11A 5CSYA 3VDAA 3CZKA 3N18A 3THCA 4PCTA 4Q22A 4QAWA 3CZNA 3AIUA 1KB3A 4LYQA 1LL7A 2X2IA 4H8VA 4GXPA 2PWFA 4YN5A 3NDZA 1UWSA 4HZ8A 2BXZA 3WH8A 3MV01 3ZR5A 2X1IA 1ITXA 1G5AA 1J10A 5HBFA 4H2CA 2QPUA 3VM7A 3EJTA 1BAGA 1GOWA 1H41A 4UTFA 3A5VA 2J7GA 1HP5A 3BAKA 3EDFA 1BF2A 2WC4A 1JZ3A 4BQ5A 2X0HA 3M6DA 2EO7A 4R5EA 2ZX5A 1H3GA 1KBKA 3L2LA 2DSVA 4KRUA 4UQDA 1NOUA 3VIOA 3DC0A 3CBWA 2E3ZA 3TTSA 2EACA 1R7OA 4AZBA 1QNPA 4Q7NA 4PTVA 1US3A 2JALA 4J3UA 2X8RA 1QVBA 2OSWA 4JZ5A 4NZJA 1B3XA 4WKAA 2G41A 4U3AA 5ABFA 2G3JA 4LGXA 1E6NA 3BGAA 2WKLA 1KR1A 4W85A 3W27A 3UEQA 5I79A 1BHGA 1LLOA 2GSJA 2JFEX 2QHAA 1UH4A 1FFQA 7A3HA 1ODUA 5FKYA 3W0KA 5A1AA 1UKSA 2DT1A 1B30A 2VZSA 1CXKA 3VU2A 4HOZA 1V0LA 5AYBA 1R75A 3ZJ8A 3ARUA 3TTYA 3AMKA 3CMGA 3K46A 1ZBWA 1C93A 4JL2A 5A2BA 2WVSA 4NXKA 1FHLA 1JL8A 2DH3A 1Q6DA 4D6CA 4OBRA 5CZKA 5E09A 1C7TA 4MAZA 3AYSA 3SUTA 1E6QM 1JNDA 3MMWA 1JDCA 1CGUA 1QNQA 3BUIA 4U3CA 3KL5A 1CIUA 4MB4A 4Y7EA 1K9TA 4EK7A 1NQ6A 6TAAA 2JEQA 1KXHA 2UY2A 2OYKA 4UQCA 3OGVA 4J28A 2G3MA 4N42A 4P7OA 1YHTA 2E8YA 3I3DA 2CHNA 8CGTA 2D20A 2PB1A 3W25A 3RM8A 1PIGA 2WCAA 1J0KA 3WEZA 2CBVA 4ZEPA 6CGTA 3WY3A 2G3NA 1LJYA 2GDVA 1ZJBA 1E72M 1RH9A 1TA3A 1UASA 5HOSA 4X0VA 1XSIA 3NCOA 1BYBA 3WQ6A 2WM0A 4WF7A 4P7NA 4D6JA 3SCNA 1B2YA 5A6JA 3ARPA 1E6ZA 3A4AA 1IV8A 2XUCA 2D0FA 3CV5A 2XG9A 2PWGA 3D5HA 4CN6A 5BXSA 1SZNA 5CG0A 1Q6EA 2YBTA 4CD4A 5HPOA 1DWJM 1R87A 3GH5A 4GZIA 3KWXA 2E0PA 3VINA 1CENA 1PX4A 3S5YA 3K8KA 3VIKA 4B9ZA 5BXRA 3IJ7A 1ZU8A 4KMQA 4OZOA 4E8CA 2ESCA 4UR9A 4OGZA 1DWHM 4S3KA 1WDPA 4D6GA 4KGJA 1OGGA 1H4PA 1EGZA 1HX0A 4MB5A 2XIBA 1V0NA 1YQ2A 3HJEA 1E6PA 3EDEA 4DUWA 3CUJA 5CJ5A 2WBKA 1EO7A 1L8NA 3EMQA 2MANA 3CC1A 1XH1A 2XN2A 2WCGA 1GOOA 1GOKA 1K9FA 2J47A 3WF0A 2ZUTA 3HG3A 3KL0A 3PTKA 4GI8A 4PYSA 3AXHA 3RJXA 4IUGA 1MQPA 1UG6A 1CXLA 1JYVA 3GTNA 1W2VA 3VUPA 1E3XA 3WN6A 2WLYA 3W24A 4AZCB 4Z2LA 4NZCA 4JHOA 3ARVA 1JD9A 4TX6A 4AYGA 3WH7A 4JFWA 5GPRA 4OOZA 1TZ7A 3BAYA 3DX4A 5CXPA 2CKSA 4CU7A 3VIIA 3A21A 5I77A 2X2JA 3EJQA 1A47A 2WMIA 2X2HA 1X1NA 3T2QA 4MADA 2EPMX 1V02E 1TUXA 4ZXLA 1EIBA 5I78A 1OT1A 1FHDA 1TQVA 4PSRA 2D73A 3MANA 3T0AA 1UWTA 2J7EA 4LX4A 2DQXA 4HU8A 4HP5A 2CBIA 4JKMA 3A47A 1TG7A 2CNCA 1J18A 2W61A 3SEPA 2V3DA 3DX0A 3CUIA 3TTQA 4D72A 1EA9C 3FY1A 1ZBCA 3MUZ1 3BCDA 1HL9A 5A2CA 1PAMA 1V6YA 3WBEA 4PMNA 3VX0A 2J74A 4D1JA 1MW0A 2YDQA 4CN1A 4KH2A 4MTVA 2WYSA 4AD3A 2OSYA 2D22A 3AXXA 4UOJA 1ECEA 3QOKA 3W6LA 3NUKA 3UG5A 2Q8XA 2Y8KA 1EXPA 1E5NA 4QDMA 1UYQA 2W4XA 3HG4A 4OBSA 1SMDA 4FNSA 4JHZA 2ZUVA 3WDPP 1LL6A 1PPIA 2BVTA 1KGXA 2VR5A 3EJSA 1W9PA 4Z2IA 3IJ8A 1V02A 3W4RA 2ZUMA 3T2PA 3VDBA 2EPLX 3LXCA 4PSPA 2ZWZA 2GFTA 2G8ZA 4C7FA 1ZJAA 1OSEA 1R8LA 3KZSA 1DHKA 5AC5A 2A3BA 2QMJA 1R86A 3ZT7A 1I75A 4DWSC 2WSKA 1GONA 4OIFA 4GZEA 4U2ZA 4CGTA 2VCCA 1HKKA 1GHRA 3W81A 1QX1A 4F66A 2BY2A 3AFBA 1DWFM 4DWSD 1HKMA 3WDRA 1WZAA 3L4XA 4PMUA 5JIPA 3PZIA 2WANA 3VIPA 4FNQA 1VJZA 4WSJA 2E4TA 3MU7A 1NWRA 2WWCA 1PIFA 1UD4A 3WFLA 4ACYA 1WZMA 3BAIA 3GZAA 3U7BA 5HDRA 4ATWA 1VBRA 1TVNA 1JFXA 2DSZA 4CKQA 1NOFA 2PI6A 5IDIA 3DYOA 1LWHA 2G3IA 1MFUA 4NRSA 1B3VA 2BV9A 1T0OA 4J3SA 3WNLA 1B3WA 5M5DA 5IFPA 1V6VA 4DUVA 2BHUA 3AIBA 2V5CA 3WQVA 2X2YA 4D6FA 1HJVA 3OA5A 3BUPA 3FW6A 2XFRA 1DP0A 1JZ7A 4GIAA 3RJYA 1JF6A 3T09A 3NYDA 1NP2A 2QLYA 2VO5A 3WEMA 5A6AA 2Y5EA 4HPHA 1EOMA 2J25A 4HZ6A 2VURA 4TXEA 4TUFA 3AZTA 3F5JA 3GXIA 5E0CA 1DTUA 2WK2A 4EAMA 1TQWA 3IJ9A 3VGDA 2D3LA 3H55A 1MQQA 1U30A 4UQBA 4P7LA 3BVXA 1W1YA 3HG2A 3EMZA 4B3LA 3LXBA 2W63A 2ZXQA 3NSMA 4FF5A 4B16A 3O2LA 5DT5A 4PMQA 1MXDA 3WQ5A 2DT2A 4F9DA 5EMYA 5E0FA 3ARTA 4BQ4A 1XC6A 2XSBA 2C0HA 3AMGA 1KQZA 2YFOA 1W3JA 3CHFA 2JIWA 3UG3A 3PZMA 4AD5A 1A3HA 2F61A 2YL5A 3W82A 1U2YA 4R27A 5C71A 2XVLA 3ZIZA 5D8ZA 2BHZA 3UR7A 3VDCA 3ZSTA 1C8YA 3ARYA 4PUDA 2BVDA 4FNRA 4WLCA 3RMEA 3THDA 1ZBVA 1GPFA 1XGZA 1UKPA 3BUBA 4W8BA 2WKGA 1HT6A 1K9DA 5CLWA 1W3KA 5E6YA 1E43A 3OZOA 3GBEA 1LWJA 1FH7A 1V08A 3T08A 1JZ6A 1PEZA 2J7HA 1JZ4A 2ZXBA 5A8PA 1MWOA 3PZVA 4UOZA 4AWEA 1P6WA 2J7CA 3VNZA 1ISXA 1NWUA 4PBGA 3QHMA 1C92A 2O92A 3MUAA 3AI0A 3HU7A 3UERA 2Y2WA 1TE1A 3GXFA 1UKQA 4J3WA 3ARRA 5JBFA 1QBAA 4A3YA 2X09A 4MJ2A 4QLLA 4UCFA 5C8BB 3H53A 1UR0A 2WMFA 3WL0A 2OSXA 4AZHA 2F2HA 4RE3A 5A6KA 3OLDA 3OGSA 2XN1A 2IUZA 1BVNP 5D9OA 4M29A 5A3HA 2AAAA 2WCSA 3ZMRA 4CUCA 2E8ZA 4NRRA 5CPSA 1JZ8A 3VNYA 1JG9A 1UZ4A 3BVTA 3H54A 3DX3A 1R33A 1M01A 3CH9A 2VQUA 3BC9A 4NXSA 4FNUA 4C7DA 1OT2A 3BAXA 4PMVA 2UY5A 3ARQA 1OIFA 5JIWA 3KLKA 1E4IA 2D2OA 5GNXA 1FP8A 1IZJA 1HKJA 4OKDA 1JXKA 4PN2A 3WD4A 1EQPA 1RP9A 2ZWYA 2VR4A 1HJSA 1QNSA 2WHJA 2VX4A 4HTYA 2EABA 5D4YA 5IFTA 1IT0A 1V3IA 4WJXA 1F4AA 4AIEA 5IXEA 3GXTA 4DWSA 4M56A 3SCOA 2VT0A 3A22A 2VRJA 1CLVA 3WDQA 4W5ZA 1VEOA 2DT0A 4Z2GA 4AMWA 1E1FA 1E6SM 2J62A 4W93A 4D6IA 1I1XA 4XB3A 5DF0A 3WNPA 4BCEA 1H49A 4LPCA 3M7SA 4W8AA 4CVWA 5CLTA 5AY7A 4AZCA 2EEXA 2VX6A 4E8DA 1CGTA 3IANA 5LA0A 4JFUA 3BVVA 4DO4A 1WNOA 4TTGA 1HN1A 1Q6FA 3GNOA 1BYCA 5FL1A 2GJXB 2XPKA 3WUGA 3MUIA 3ZJ7A 3WEOA 1QNRA 4XV0A 3VGFA 3VM5A 2O9PA 5A8NA 3RCNA 2EPNA 3T0BA 2ZX8A 4V2XA 5DFAA 2XM1A 1CEOA 4ATDA 1HKIA 2F8QA 1PS3A 2C7FA 3WFZA 3W38A 1G0CA 3PTQA 1KGWA 2F7OA 3AIWA 3PZTA 1KCKA 2WHLA 4H8UA 2GJPA 1UA7A 4W88A 4WKFA 2GVYA 4CCDA 3LRMA 1AQMA 3NSNA 3T0DA 3SCUA 1J0HA 1WE5A 4HA4A 2VMFA 4MNMA 1VEMA 3SUWA 1MQRA 2XFFA 3WD2A 1XD0A 2YLAA 4A4AA 3PHAA 5DO8A 3ZJKA 3SCSA 4D6HA 3JUGA 4RE2A 4U5IA 3S5ZA 2YFNA 3VILA 2W91A 2BY3A 3SUVA 1HWWA 3AS3A 1VB9A 4PMYA 3IAQA 1WDRA 3DDGA 1WZLA 2J7DA 1C7SA 1GVIA 4PTXA 4J3VA 3BXWA 3VIHA 5EFDA 1EHNA 2VC9A 4A3HA 1U33A 1QHOA 2ZUWA 3GYCA 1OWQA 2X05A 1UWRA 3AJ7A 3PN8A 1CWYA 1JYWA 4QCEA 3ARSA 1JFHA 2ZICA 4HA1A 3N15A 2V3GA 4LXFA 1LL4A 1UOKA 4GPNA 1X6LA 3A24A 3NSXA 2YOCA 3LPOA 2WB5A 2VI0A 1BGAA 2J4GA 4K68A 4PTMA 5HXMA 4TX8A 1BQCA 2XWDA 1WZKA 1V6UA 2RGMA 1NM9A 1J9YA 5I6SA 4AZ5A 1FOBA 4AIOA 1BPLB 3OLIA 3OGRA 3ZJ6A 1MW2A 1PBGA 2WZEA 3RPMA 1HJXA 4ZFMA 3N11A 5LYRA 4UQAA 5GNYA 4QFUA 2GK1A 3VMPA 1C3FA 1XH0A 3CUGA 2XJ7A 1EH9A 1EHAA 2UY3A 1WDSA 2FHCA 2CIPA 3PZQA 4BA0A 2Z1KA 1W9DM 3ECQA 3BAJA 5CSUA 4AD2A 3W28A 1OD8A 5BYWA 3POHA 2EQDA 4AW7A 2YA1A 4PMDA 1D7FA 3WY1A 3E1F1 1V0MA 4AD0A 1E0XA 1LG1A 2A3AA 5A6MA 1G1YA 2CBJA 1GCYA 4CCEA 4OOUA 2D0HA 3DECA 1W9XA 3OB8A 4UFMA 2D23A 1QBBA 1L0PA 1ZBKA 3S6TA 3MKKA 3BVUA 3VO0A 3CZLA 2YJQA 2WMKA 1W91A 3D51A 2WVUA 2CERA 1FA2A 1OGSA 1QI0A 3U57A 3SCQA 2J8GA 3DX2A 2VRQA 5CGTA 2XN0A 3MUY1 3VVGA 2GDUA 5BCAA 4AY1A 3VD9A 2OLHA 1HXKA 5FCZA 1HVQA 8A3HA 1Y7VA 1UD8A 1H2JA 3CZJA 1ISVA 2DDXA 4KGLA 3WNOA 1GQJA 1J12A 3D4YA 2NW0A 5M17A 2EJ1A 5A6SA 2VZUA 1FP9A 3MSDA 1MFVA 2E40A 3ZO9A 3ARZA 2FE0A 1WAWA 3AISA 3VD7A 5E70A 3VMNA 1W3HA 2Y24A 2VUYA 3OIHA 1EOKA 1LQ0A 3BUQA 2J77A 1BYDA 1TFVA 1HP4A 4GZJA 2ZXDA 3MI6A 3N04A 4H8HA 3CUHA 4CU8A 4HA3A 1Q6CA 1PZ3A 2J7BA 3WDJA 3WY2A 3CLWA 1E0VA 1DWIM 3CHEA 4E4PA 4M80A 1QHPA 1JI1A 3BMWA 1VIWA 2FGLA 4AD4A 1V3HA 4QLKA 3SUUA 3II1A 2YLLA 1O6IA 5IHRA 2QF8A 1WKYA 3HN3A 1KWKA 4NF7A 2FHBA 1QWNA 4HMDA 2CESA 2D24A 4D6DA 2CKRA 2CETA 1TMQA 2VX5A 3AHTA 1VJSA 5BXPA 3L2MA 3ZT6A 2E9BA 3UETA 2YA2A 1DEDA 3KL3A 5ABFB 5GNZA 2Z1SA 1UR1A 4HOXA 3VDHA 4CD6A 4UNIA 4P7QA 4ML4A 3K1DA 2AOSA 4B9YA 3GXMA 3OLEA 2WW5A 4RL3A 4BF7A 2W67A 4GKLA 1D3CA 2D0GA 2ZX6A 2VRKA 1J0IA 4M1RA 2PWEA 2A3CA 2VZOA 4AYSA 1C8QA 2DPEA 1H0IA 1GQIA 4FLOA 2JEPA 5I23A 2WLZA 3VSUA 3WUBA 1QI4A 5BROA 3VGBA 1H5VA 1MVYA 1UZ1A 1ISWA 1UWQA 1BG9A 4CD5A 4PEEA 5EFFA 3SCVA 3AIEA 4V27A 3L4ZA 1F4HA 4PMZA 4M81A 3WUFA 5A8OA 2GJXA 1NOWA 3VIMA 1B90A 1X6NA 3WNKA 1UD3A 3RM4A 1UR9A 4W86A 2Y8VA 1E71M 4LYRA 2B31A 3WDIA 4GI6A 4MPKA 1KXQA 1W3LA 4GINA 2WMGA 3VMOA 1CZ1A 2VCBA 3WELA 4L4OA 3GBDA 2EXOA 4MB3A 1GZJA 4HU0A 2FH6A 4UZSA 3NDYA 1B3ZA 4AMXA 3BLPX 2BS9A 1TCMA 1H09A 3WIJA 5IHSA 1KFWA 4NX0A 3D3AA 3BUDA 1JYXA 1GQLA 3WQ4A 4DWSB 3AS1A 4H7VA 2EBNA 3FNDA 3ALGA 2A3EA 3CZ8A 1KQYA 3W37A 3AIVA 1JGIA 2EPKX 4UFJA 4AD1A 1VAHA 2WHKA 2TAAA 1VEPA 2NT1A 1OBAA 4YPJA 1H1NA 3PZGA 1PZ2A 1HF6A 2OWCA 2OW7A 1TQSA 3LX9A 4W84A 3AYRA 2PWDA 1K9EA 5D8WA 3FAWA 1UD2A 3WY4A 1G01A 4ATLA 2XVPA 2VZVA 3L4TA 3WD3A 1OB0A 4TVDA 3A23A 1KWGA 4M24A 2WZHA 2XYLA 3HMCA 4YHGA 2ZUNA 2QPSA 4UQ9A 1UH3A 5KZ6A 5KEZA 4KRTA 3WD0A 3CGTA 3W29A 4JFTA 1J01A 1ZL1A 1C90A 4JCMA 3G6MA 2YDRA 3L4UA 3D52A 3DYMA 3SURA 4MAVA 4M8UA 2VJXA 4W7WA 1J0JA 4CD8A 1G9HA 3ZOAA 1KXVA 2WBGA 5ABGA 2BHYA 1JF5A 3LMYA 2WC7A 1VFFA 2IGTA 1E55A 3LRKA 1UD6A 4WIWA 4DUXA 3WMCA 3ZSSA 2VNCA 4PCSA 1DWGM 3B8SA 1R85A 5I5RA 4AC1X 1PX3A 3SCPA 4GO8A 3DX1A 3AS2A 3WH5A 2FHFA 2WHMA 3KE0A 3VIGA 1UKOA 4HPGA 4Z2KA 2XVGA 3VD5A 1JI2A 1HTYA 1CNVA 3A3HA 1ISYA 1TVPA 2EPOA 4AZ6A 3W6MA 1KCLA 3TP4A 2JIEA 4CU6A 1S46A 3I3BA 1NP0A 3CIVA 4WKHA 1XD1A 3AS0A 5HPCA 3PZOA 1CXIA 3VGGA 1Q6GA 4W7UA 3VTRA 1OD0A 1JYNA 4DO6A 2BFGA 2WWDA 1UR4A 4X9YA 4QCFA 2ZX9A 3WNMA 2EADA 1CXFA 2OW6A 4J27A 1D2KA 2W62A 1W9UA 1QNOA 2BVYA 5CPQA 1E6RA 3GXDA 2C8NA 1GOQA 4CN4A 1NWTA 4H41A 2WAGA 5M03A 4MNKA 4V28A 1W2PA 1XCWA 2YL9A 3W53A 3AHXA 3MO4A 1E73M 3SCRA 4L4PA 4FMVA 2XVNA 2XGIA 3HG5A 3N17A 1QW9A 3BLBA 4OJYA 1GJWA 2CYGA 3AOFA 5M3WA 4TTUA 1UWUA 1JIBA 2ZXAA 4MB1A 1QW8A 4U5KA 3WF4A 2ALWA 1XH2A 4P7RA 1B9ZA 4TVCA 5FL0A 2UY4A 4GQRA 1BLIA 1CECA 3UR8A 1J0YA 1JAEA 2RGLA 1PX8A 5FD0A 3W26A 4UFKA 2YL6A 1WB0A 1E4LA 2CBUA 1CXHA 1HXJA 3GXPA 3WDHA 4UQEA 3CO4A 3PBGA 3SUSA 1E15A 3WL1A 4C7GA 5LA2A 1WPCA 3F4VA 2DIJA 4IISA 3AZRA 4MJ4A 3N12A 1E5JA 3L4YA 1LG2A 1V3MA 4MDPA 3QR3A 1B3YA 3POCA 1JZ5A 1E1EA 1CBGA 1GNXA 1M03A 3ZM8A 4GQQA 5I3DA 1V6WA 1AMYA 2VVNA 1CXEA 1GUVA 4JKKA 1W1PA 2OYLA 2XGBA 3UCQA 4CD7A 3VD4A 1E0WA 2Y4SA 4P8WA 1MW1A 2YBUA 3EDKA 2ZUUA 4IPLA 3B9EA 1HJQA 1E6XM 4LQ1A 1OINA 2DGAA 2DSUA 3PTMA 1JXJA 5TD4A 4MNJA 4XUYA 1VENA 1J11A 3AHVA 2J7FA 2BNJA 2W66A 3M46A 5DMYA 3VGEA 3G6LA 3FAXA 4BQ2A 5ABHA 3VKKA 1IZKA 1FH9A 5A6LA 2OWXA 1EDTA 4W8LA 1UUQA 3B9AA 4XZBA 4MDOA 3T2OA 4DO5A 1US2A 2IXUA 7CGTA 3RILA 5D9PA 2DSWA 4P8XA 1QI3A 2QV4A 3AROA 3KEHA 1O7DC 1VFUA 3WNNA 3F5KA 4ZXOA 1V3KA 3BMVA 3FHQA 1TA3B 3RM9A 5JUVA 4UOQA 1NARA 3K8MA 1ITCA 4W7VA 1RP8A 3LRLA 1R47A 1W32A 3BSHA 4HMEA 2FH8A 1MXGA 4FNTA 5ABEA 1W1TA 4BQ3A 3WD1A 1WDQA 2QMKA 2IXVA 3ARXA 3IAPA 2CPUA 1Z32X 2XM2A 6A3HA 3ARWA 1XSJA 1CGXA 4JL1A 1XHGA 1TQUA 1GVYA 1KR0A 1W9BM 3APGA 5I0DA 1XYZA 1E40A 3L4WA 2E9MA 3A6OA 2XWEA 3EJRA 3GXNA 7TAAA 4JAWA 1GQKA 1SR0A 1XV8A 3ZR6A 4D71A 5EB8A 3AHZA 2PBGA 3WH6A 5I2UA 2GUYA 1AQHA 1M04A 4B3KA 2NSXA 4WSKA 2WXDM 4HMCA 1BGGA 3RDKA 4XX6A 4AZIA 3OG2A 2J78A 3K8LA 3O9NA 2VOTA 3VSVA 3QGVA 1KGUA 1B31A 2YDSA 2UWFA 3CTTA 1CPUA 1MW3A 3LPGA 4PTWA 1KXTA 2XFYA 4D6EA 1JNEA 4GO9A 3WH9A 2WVVB 5BRPA 3TTOA 3HZ3A 3U7VA 2PBOA 2ZUSA 1O7AA 1N82A 1XSKA 3ZQ9A 3EDDA 4FNPA 4J7RA 4JFSA 1TQTA 1WCGA 2OWWA 1FH8A 3U5UA 1PJ9A 3TOPA 2V38A 4J3TA 2JF7A 2BY0A 4JFVA 2FDMA 3AIQA 4AISA 4ZENA 3J7HA 1J0ZA 1UKTA 1GOMA 3MV11 3UG4A 4TOQA 3VGHA 1VF8A 3A4XA 4XZWA 5DT7A 3WENA 1QOXA 2DIEA 1E4MM 3PZNA 1KTBA 1JD7A 2CHOA 3FXYA 5AC4A 1CGWA 4JKLA 3WUEA 4AEFA 1XRVA 3DHUA 4P8UA 5E1QA 1TR1A 4URIA 3BLKA 2CEQA 2BXYA 3DYPA 3WSUA 1V3JA 3EYPA 3WF1A 3TV8A 1LF1A 2W92A 5HNNA 1QHZA 4LYPA 1W9VA 5A6BD 1QPKA 4NSBA 2W5FA 1HIZA 1B1YA 3VIJA 5CQ1A 4PUEA 2CXGA 4QLJA 3GH4A 1VRXA 4CCCA 5A95A 3WQWA 4D1IA 3VOCA 4EE9A 3S2CA 5F7UA 1E3ZA 3AHYA 5LA1A 4Z2HA 3CPUA 3BVWA 4TVUA 2WMHA 5BWFA 2XHYA 4PMOA
chains in the Genus database with same CATH superfamily
4IBQA 2OYPA 3LV3A 4LRSA 2VW6A 4HJJH 2J8TA 3EJPA 3RN6A 1YADA 4S1DD 3RY4A 4PFEA 1VFHA 1CLXA 2WWMC 2WVTA 2FJHA 4KO7A 2NRDA 5AB3A 1HJUA 4I6KA 3V5DB 2YEZA 4F93B 5I0ZA 4W68A 3FFCA 2VUOA 1CL7L 5JBEA 5IFJB 3IV8A 3BANA 4AH2B 1E8WA 3R0UA 1FFRA 1GW9A 2VABB 2C79A 3PFQA 4NO2A 4OCMC 4V1YA 2ZCHH 5TGBB 1W15A 2NT0A 3KR3L 4NQEE 1PCSA 2KDGA 5DLCA 3O11A 5EU7C 1DBMH 1I7RB 3GMRB 3QARA 3F5LA 1KUMA 2ARJB 1EJUC 4GOSA 1YEIH 3KW3A 1TSHA 5A5WA 4K73A 3TMLA 2REQB 4WUUE 2D2CC 3Q8EA 4NNPH 4IPNB 3QFJB 2NYZA 5IQ7L 2O61B 2WXKA 4CVXA 3AAMA 1ZT4A 4YHEA 1I9JH 4LQFL 4XWOD 5HR7A 2PDUA 3NRQA 5FOOA 5D9MA 5DR5L 4P2YA 3MBDA 5I0VA 2C3ZA 4XPFL 1XF5B 3E96A 4WUUD 2N7BA 3IBEA 4XH2A 3U9UB 5E6SB 3AZUA 2ZQKA 4QT5A 4WU5A 1JWSA 3TJPA 3U0TB 4NUWA 4ACZB 4WGHA 5TJWK 3NJLA 1T83A 1D9KC 4AQAB 1XGEA 5B7MA 1KM2A 3RWCA 2QTVA 3UYCA 4OZGB 3ES6B 4C1LA 4ZS6C 3VI3A 3M5YA 1G94A 2B77A 1QZNA 3QXDB 4WUUA 1NMCB 3NJ3A 3SCTA 2ROXA 3EIFA 4IOIA 4OAWA 4W9DC 4GS7B 3WMLA 1AVAA 5I8EB 1TZIB 4XNMA 5GGSB 4TX9A 1UB3A 3LPFA 3OZYA 4QITA 1IGML 3LCLA 5A8QA 1R5IB 1QEXA 3N40P 1NGYA 2K45A 4OZFH 5BZWA 4QDGA 3CU7A 2OTUB 5HVHC 2WC3A 5T8IA 2ZF8A 1PYMA 2NYYD 4ICXA 1WIOA 4UTCA 4OZHE 1V5JA 3CHXA 1A9EB 4MWFA 1H0GA 4G1EB 1BPVA 3C6SB 4OCSL 1ACYL 4YSTA 4R90H 4GW1B 4NZFA 3RX7A 1PZCA 1QCWA 5CBAA 4OE7A 4B5XA 5C0QA 1JXDA 1ZLWK 4QPEA 5K1NA 3SBWC 1YJDH 5ANMB 3IKCA 4LOFA 4OF5A 4JIEA 1DFXA 4OJFL 2YKKA 3NCBB 4JRLA 3MKGA 2AXHA 5FECB 1KMGA 2PWUA 3K4DA 2EUWA 3LAFA 3WD5L 2HISA 1I8LA 1JK9B 3QDGB 4UT6L 1FI8C 1FV1A 1IEAA 4NZTH 1QTYT 5C2BL 4ZS7H 4FFWC 4G6FD 3NZ8B 1UUNA 5FO8B 2QCDA 5DDHA 3NVDA 3QE5A 2C1OB 2A6NA 1FYTD 3DDFA 5F6IC 4GW5B 3CHDA 4QM1A 3WG6A 5B80A 3V4LA 4O57A 3MFFA 5I71C 3MRHA 2Z93B 4K7FA 1M7DA 5D1XE 3VDGA 3TUUA 1ESWA 4XBPB 3AZSA 2XISA 1IJ9A 1CFTB 4JYFA 3VA2C 3D50A 4DM2A 2EDBA 1K8YA 3EG9A 3FUNA 4MJ6A 1OJXA 4UR8A 1AO7D 2CDGB 5KZMA 3MXWH 4N9GB 3GRWL 4JFED 4ABWA 3D0CA 5CJOH 1HAWA 3BLIA 2AQTA 2EUXA 1WIUA 1XCFA 3QUXD 1JPTH 1PTGA 2JKEA 4I48B 3SZ8A 1AD4A 2Z25A 1SXBA 1BREA 4GG9A 2BGNE 1M7IB 1OK4A 1Q65A 3EYFA 2VMJA 5D7KD 4H6KA 4C4KT 1JK8A 3B2VH 2NY1B 4PY8J 4UFLA 5HPMB 1JJUA 1O6VA 3GSRA 3T65B 4XNDA 1US0A 1XDLA 3W56A 4XIAA 1CT8A 4V1DE 4HJGA 2QQQA 5D7LA 1ILSA 5HDWA 3V5KB 2OMYA 2V5SA 3T1GA 3VXMD 1E9LA 4E0RA 4F2MB 4XPAH 2A1WL 2Y2YA 2LU7A 4JM2D 2DQEH 3KLAA 4PRPB 2PP1A 1ZV5A 3C2SA 4MNLA 3U0HA 4KKNA 2VAAB 4UNLA 4FLQA 3U5YA 4RGMC 1LDCA 3QUKB 4K3EH 4GUPB 3AQYA 1FCUA 4F7PA 1MRFL 1FHGA 4NC1C 1OEPA 3CXDL 4U2YA 4P5UA 4XAZA 4YVVA 1HJCA 2X53A 3VFVB 1EC8A 1WBHA 4N25A 3ORWA 5IFAH 3LEXA 3RY5A 1DLHB 3JVAA 4IDLA 4WDXA 4F8QA 1BYAA 3DHFA 4YTUA 1XIBA 5J3HC 2JE8A 1XP3A 4Y2DA 4UQ2B 1GOIA 1UM4L 5JW4R 1W0VB 4O2CB 3JS3A 1DQLH 3TBCA 2AJ3A 4CQ8A 4DBUA 3DVNA 1PZ0A 4E9RA 1SNRA 5H4YA 1P4IH 4AMAA 4FA8A 5IV2B 12E8L 4FOMA 1P1VA 1AZRA 4LB4A 3RL1A 3SZKC 3VWJD 3ECUA 1Z7AA 4YH6A 4XO3A 4BFBD 3WQCA 3AU1A 2PPAA 4H1LG 3ULVE 1FVDB 1VPOL 2AK4E 4PRAB 3TIEA 5J5RA 5G1MA 2O5YH 2ISDA 2GSGB 5G4EA 3CCHA 2R0ZL 2J75A 2VXNA 4PRWA 3TVMA 3IK2A 4XUGA 4ZMTA 3R89A 3WQOA 1W6WA 2WNXA 3OX8A 2B9AA 4J3OH 2DMGA 4PJ9A 3GM8A 3QFWA 4RE4A 5XIAA 4O52A 5MEQA 2Q71A 4ZSOA 3HW7A 4ZQRA 1EBHA 4NWTH 4RXFA 1JV5A 4ZTEA 1EEXA 3EFOB 3P3TA 4FLSA 2GJJA 2WZ0A 3FRPG 2CMRH 3NQDA 1TJXA 1RUMH 3K2UL 4L2YA 3OJMB 3MLPA 1T0MB 3MV9E 4MKVA 4M9OA 3MR9A 1UQYA 3CFEB 3HA1A 3TESA 3SCWA 1ZA6A 2A83A 4ALAL 5JPMC 3E0VA 1CFVH 1TO5A 1NEPA 2PD5A 2NDFA 1SBBA 3B2XA 3QCUH 3KXFA 4UM8A 1S9WA 2BWGA 1S7UB 1KELH 4FG0A 2GOKA 2I7GA 3LHWA 1ZK9A 1VA9A 3O45B 1CTNA 5EBWA 4BA8A 4GFSA 5A6BA 4M93C 1XCTA 3T6WA 3QFDB 1XZ0B 3QDMA 4KX7A 3GSXA 1GC1L 1F11A 2QFPA 4XO5A 5E8NB 2P9RA 4U4IA 5GGTA 5AEAA 2HXAA 4FNLL 4HGMA 1ZS2A 1P1XA 1YMME 5GGVY 4GNKB 1FNSH 2HRPH 2A3HA 2CITA 1MAML 1OY3B 4KIRA 2H9AB 2L0DA 2VD9A 4FYTA 2EC9T 1XF0A 1G7HA 1BXAA 2FO4B 3VQMA 3H3PL 2BSCA 3L3KB 4PW9A 3AMCA 4LFHD 4B41A 3TQ0A 1EQCA 3HLAA 2VSMB 2AV7B 3OBAA 3QJHB 2V6HA 4DZHA 1KELL 3GR7A 2INZA 2X88A 4XPBL 3E3QC 5KS9E 3AMLA 1EVUA 3D05A 1SYTA 5E00B 2Z92B 3OTTA 1OGBA 2POTA 2EE2A 2IDQA 3C3NA 3HAEB 3EWXA 3UPMA 4WHBA 3TX9A 4KKCC 1JQXA 1M1XB 5T3XL 2PABA 3PWPB 3FH5A 1M05A 2OXHB 2CLZA 6ALDA 4YC2B 1ONRA 3OB0H 2AV1B 1CLZH 2XN9E 3QCTH 4JG1H 3T77B 5IB2A 5F1UA 3WK2A 1WO2A 4X83A 5GGRA 3VSTA 2NNFA 3LN9A 4OUEA 5BZDA 3I68A 3CN2A 1HKVA 1JCJA 2XVKA 3UNDA 2QUVA 1E5ZA 1TCDA 2J79A 4L37A 5KMYA 2IFFH 4FLRA 4Y4FA 1I31A 3C52A 4F91B 3N6JA 4NNXA 5A2AA 4PV8B 1N8IA 1RUKL 1IAIL 3KPOB 1CB2A 4WUKL 2HG0A 3C60C 4IDJL 5DEZA 3IJYA 3U7WH 4B9IA 5L2JA 3BLLA 3CLEL 5F0MB 2WMJA 3QZAA 4UFHA 4YTTA 3R0NA 4FKHA 3FT9A 2ED6A 4QRPE 1PLBA 4HJWA 4LAOA 3B2MA 2OYMA 1J1PL 4FXKB 1CDHA 2UV8G 3VTAA 2DT3A 3MA7B 5CC5A 4WIQA 3QIBB 1P7TA 3SQMA 3UWZA 4XO9A 4C5ZA 1I8LC 4GIPD 4AXNA 2DL9A 2EGZA 3IAGC 1X7SA 4AG0A 4GY4A 2WLKA 4LIQH 2ZOOA 4HEME 1YW1A 2W65A 5HI3C 3BQ5A 3LN3A 2YPKA 1UURA 1WQVT 2HT4D 5EO9A 3BQ6A 4PCKA 3B8WA 2FGZA 2UZIH 5DJCB 3WS6A 1NBYB 1TQBC 2QUMA 3PZ9A 1SMAA 2C4XA 3MTXA 1E67A 1H5BA 4XVTL 2J6VA 5FEZA 4R3SB 2ZADA 1TNMA 5KBMA 1CLOL 4UTWC 1PLAA 3EXSA 3V4UH 5C6PB 3OPZL 1NAMH 4DIAA 3UCRA 4L8CB 3BAWA 1Z9SA 4PJXF 1N5YL 5D7LD 4KVCL 3LOTA 2ADFH 2I7OA 4ISVA 5D9NA 3RURA 1GOFA 2YQGA 3Q8FA 4DP4X 3PANA 3QHFL 1GSMA 3GUTA 4NENA 1U8PB 4Y5YA 4F0RA 4YMZA 1KPUA 4RSYA 2DJSA 1NC4B 3FCBA 1DYZA 3S4TA 2X0UA 4RX4D 4ZUSA 3RPTA 2FWUA 5EC1A 1IAOA 1FIEA 3TC6A 3GJFA 5ESVA 3SGKC 4LPVA 1DANU 4AWJC 4QCIA 3IMSA 1XB3A 3SKUD 1MPAH 3QEQD 1WYJA 4EN3A 1ZGLM 4KZEL 4HIXL 2XPZA 1LT8A 4PG2C 2BIHA 3CZKA 4JO4L 3PAJA 2DQMA 2FGWL 5B4MD 2FDSA 3CZNA 4JR5A 4XBJA 3THCA 4XVSL 1TELA 5T33L 1MEWA 1FO0L 2ZC8A 3AIUA 2OB3A 3G18A 2GSHA 3CB8A 1UENA 4LCUB 4TV6A 4C83A 5IBLD 4G7QB 1F3RB 3V0FA 3V75A 2X2IA 3N2CA 1SU5A 4IL2A 4DW2H 4GXPA 3MRDA 2QT6A 3NA4A 1U8HA 1BF8A 4KXCA 1DE4B 1HL5A 3C08H 3PY9A 5DFWH 1UOWA 1EIXA 4IEFB 1OM3H 1UWSA 3NDZA 1SEBB 2D7TH 1ITXA 4HZ8A 3WH8A 1G5AA 4GRLB 4TMCA 5BS0E 4M4PA 2ISFA 4HMNA 3DMMB 3EJTA 5EU6A 4BK9A 2OR7A 3DX7B 4ODHL 4OGYH 1Y65A 2OPJA 3WK0A 5D1ZA 3QZWG 1EAPB 3CDYA 3K30A 4LDOB 4L65A 1L0QA 3OSKA 4WHTB 4UV4H 1HP5A 4JJ5A 1TQJA 2QJJA 3VI4B 1JZ3A 3TXAA 4HUUB 3R79A 1GVRA 1ZHLB 3PGFH 1XF3B 2EO7A 1FVCB 3Q2WA 1USZA 1TCRB 4N6RB 5T3ZL 4JBRA 1ASOA 2HTLD 3KPSA 3PQYE 3C75A 3BJLA 4ZAKB 4HPOL 4IIZA 5LWYL 4WI0A 1V93A 3MTWA 3DC0A 4NZ3A 2Y07L 4G8EA 5F7EL 3PU7A 3Q13A 1P4LA 4NQQA 3BPWA 3TWCH 4PFHA 1QBLL 3I10A 3TTSA 3QUZA 3X1FA 1H7OA 3S9DB 5BRBA 1GWJA 1X38A 1T6MA 3MU3A 4ENZA 1W5NA 1KCBA 5GS1B 3FA3A 3QZWB 1QLRB 2JCWA 3OPUA 4JFQA 4P5RA 1US3A 5E8EB 3E5PA 3UR2A 4J3UA 1U1JA 3TJLA 3EA3A 4EVNA 4JM4H 1TZOA 5CC3A 2X1WL 4HK6A 2AEOA 1VACB 5T3ZD 1B3XA 1A4KA 3OHXA 3DI1A 5GJPA 1GA2A 1CF1A 1A5KC 3QW3A 4UMAA 2ERJC 2ADIA 4N5EC 4U3AA 5CUSH 4QHLA 1KEML 5E2VL 3NURA 2WKLA 1IKNA 3S9IA 3ARFC 1T0PB 1OGTB 4G6FB 1SF5A 2G30A 4NL1A 5I79A 4GG6E 4BR1A 1BHGA 2AEPH 1LLOA 1N9PA 3INOA 2VRAA 3D9AH 4JHAL 5CP3A 2GSJA 2QIIA 1DBML 4PUJA 5E6IB 5D2XA 4PZVA 5FKYA 3OYZA 2DM3A 5BOOA 2AQ2A 3TX4A 2ZYIA 1CO1A 2EYSB 1CFNB 2J6XA 5TBOA 2Y3NA 3KYMA 3QXTA 5CR1A 2Y63A 5L7XH 1RVKA 5GJNA 1CXKA 1V0LA 4KRPD 3Q0HA 3B4NA 4UINL 4LAZA 5K9KB 1TZGH 2YUZA 5ADPH 4ZOCA 2ISWA 2R2CA 3E3HA 5J57B 5EBLB 2EKJA 3D2UB 2RA1A 3FFCE 2EXYC 1EGJH 1HS6A 2HTLC 2X6BA 3H3PH 2H3DA 4QJ5B 2X0SA 4HTBA 3ARUA 2VLRD 4BXVA 3OQEA 3NJNA 3M5VA 3K46A 3ESNA 1F9CA 2D7OA 5AVVB 4HJGB 1IC7H 3ARBB 4IIQC 3RPIA 2WVSA 1IKFH 3RTQA 5A2BA 1V7NH 2W0PA 3G6DH 4MHHI 3L3JB 1NGPH 3WEBA 1JL8A 3NCXA 2DH3A 3JZEA 1RK5A 4H9ZA 1J8RA 4S2BA 4D6CA 4YL9A 4NEHB 2PDXA 3QIUB 2FX9L 4AYDC 2RACA 4E41A 1QAPA 4OD1H 1YY8B 2R2BB 5IIEB 3SUTA 1E6QM 5DD1L 2KHAA 1LO2L 2W0FB 2VISB 1OY0A 4MA7L 3V52L 2Y85A 3W71A 1TQBB 4KY2A 1MQKL 4BBWA 4R3UA 5D1QC 1UWGH 3PGCA 1LDSA 4MB4A 2ZA1A 3T0EB 4C6BA 3VXPB 2M26A 4APQA 1KPVB 2BDNH 2X4RA 3EO9H 3VG9B 4AM0Q 4PVBA 3WD5H 1JVLA 1NGPL 4DJEC 1PL3A 2ED9A 1GZQB 2J8UB 1DUYA 4FD0A 4BGDA 1RK7A 4YE0A 5HJ3B 5EH1A 4Q6IC 5AUMB 4PJIF 5CH9A 2O6FA 1ZKAA 1Z5YD 1HZKA 3EYOB 2IAMB 2VN5A 5E4AA 3PWLB 3D07A 4QTHB 1W5QA 2D20A 3G0XA 2R59A 1K3ZA 3NJFA 4AC7C 2R0WL 4MJIA 2EDLA 4RNFA 3TCEA 3MHGA 4ZEPA 1HYRC 2Z4TA 2JQAA 3IFLL 2ZRXA 4F4RA 1IFGA 3LZLA 4RWYH 4JO1L 1IL1B 4GEJA 1KB5L 3ASNB 3EA2A 1LJYA 3V4PH 3I9GH 4M48L 4TQTA 5GGUA 3FU3A 3T5WA 1KG0A 2K9UA 2WV3A 3DPDA 4HKXB 5T1KB 1E72M 2PDNA 5DY2A 1AO7E 1D5IH 1XZ0A 5CO1A 2XU2A 1UASA 3LM3A 2GI7A 2NY1C 1LBFA 2YCJA 3TQKA 4L1LA 1H60A 4ZFCA 4RDQG 1CLOH 4R9XA 2VKXA 3G8EA 3NCOA 1JF1A 1S9WB 5KVMC 2BOEX 3VA8A 2IAMC 2VERN 4IOFD 3WQ6A 1T99A 4I9JA 2WM0A 5IKCB 3MV9D 2GOUA 3CO8A 4ZJ9A 3NQ7A 5FACA 3S47A 4I2XB 4JKWA 4H9VA 5DJZA 2FIQA 1K8IA 3KPLB 5DVMA 5E2WL 1KLGB 4AKPA 3FQ1A 1IV8A 1CFSA 2G9HA 4LU5L 5E2JA 2XUCA 4GQGA 3GG8A 3IIOA 3KYNB 4PRNA 3D5HA 1RZ8A 1WCBA 1IEQA 4CN6A 5I5IA 4PWEA 5IF0B 1C8VA 4J1UA 4GFIA 1I8AA 2PYEB 2CM5A 3SJVB 5CG0A 4GY7A 3SRFA 4MQXC 4PP2A 5CFAA 1GKRA 1V7AA 3XINA 1TJGL 3NIDE 3QK0A 3OZMA 5CFHA 2E7FA 2YS4A 1OWRM 2E9GA 1J1OL 1OE1A 3G5YB 1IEVA 3TVMB 9XIAA 3MMEB 1BOGB 1QTPA 4N8VA 1CENA 1SQ2N 4WNQA 4R7WA 4DFIA 3K8KA 4XD5A 4Q58C 3W3BA 1K2DA 2XA3A 4XMTA 3IJ7A 1VRDA 2B7PA 1ZU8A 3L5WB 4D6IA 2GBUA 1UXSB 1KULA 4LSBA 1JMZA 4R4BB 1RVFL 3IJ6A 1NDZA 4JX4A 3FYOA 1YC7A 2ESCA 3MRHB 1K5NB 2XTJE 4K7FB 3R8GA 4PTUA 4WOZA 4Y9FA 7REQB 4KV5E 5E8DL 5BVJA 1MMFA 3B8DA 3ARBC 4D6GA 4GRMA 1A66A 2GGJA 3QEQE 1UZ8A 2JELL 3NTCL 1GKOA 3GMMB 4MB5A 2XIBA 5BW7C 1V0NA 3C4UA 3QQ0A 4GKSA 3EDEA 3RIAF 2HK1A 1V8HA 2WQRA 2HJKA 3MHZA 4AH7A 3SY6A 3SYPA 4WX2A 4HUCA 2ACRA 1B2WH 3QQ9C 2HUHA 4XRCB 1IWAA 5DMLA 4N2FA 5EC2B 3EMQA 4NJAL 1XH1A 4G7VL 5CCKH 4Q74A 1GOOA 1CC3A 2FZBA 3WHXA 3IGXA 1EP3A 2QCLA 2J47A 1N70A 3GUWA 4FEZA 1OTTC 1PG7W 4HT1L 4C55A 2ZKHL 5C0FB 1NFGA 5CD3B 4Y2DC 1YEKL 3WJLC 5GZOD 3RJXA 5I2IB 3PJTA 4QXIA 1YEYA 1CXLA 5ANME 4NQDD 3HNSH 3CWNA 1FH2A 3U46B 4OCNC 1EL3A 2PXYD 3D3VD 1W2VA 4M7LL 3SPJA 3QMRA 1QO2A 2QPEB 3V0GA 5TFSH 3IRCA 3T6QC 7PTDA 2E6JA 2NCEA 3HOJA 5CZXD 4S3DA 2V9UA 2WLLA 4PRIB 4AYGA 5EOTB 4ZUVB 4DAIA 3QPXL 2FB4H 2VDPL 4YDIH 1TTPA 4JFWA 2OMVA 2EEDA 2XXCB 4JO3H 3RDTB 4GXUN 1J96A 4ISVB 2VENA 4K8GA 3WO4C 5C08E 1ZTMA 3DX4A 5CXPA 4QRBA 3BZ4B 4UIKH 1Z9PA 3A21A 3V4VH 2IXQB 3VFOB 3ELQA 5BS0B 3LCWA 5FKPB 5EZJA 3EJQA 5A16A 1A47A 4AM0A 2WMIA 2X2HA 2W60A 1PBYA 1QUPA 4MA7H 2P3YA 4K7VA 1X1NA 4DKEH 4L7ZA 5EV7A 5E8PA 5JORA 1BBDH 1V02E 4ZXLA 3CQPA 4I7ZC 1KY6A 1VF5C 4GIRA 4O15A 1OT1A 4M6OH 2X16A 1TQVA 3QAZB 2ACUA 2YZ8A 3QI9A 2UZIL 2WYTA 1K7FA 1ZE3C 3T0AA 4QCIB 2J7EA 3QYQA 1D7CA 5DK0A 5AW8B 3S5LB 5FYJL 4HP5A 3FS9A 4Q4IA 3C5XA 3HEIB 4AFYA 1U8IB 4U1NA 1J18A 1JVOA 2XQ0A 2W61A 2G60L 2DQCL 4NNAA 2V3DA 3HBGA 5SWSB 4IEFA 4YZFE 1NFDF 1D3HA 2ATPA 1KM5A 3GSNL 3CUIA 2WB7A 3RNKA 2PPEA 3MV8A 1M6UA 4FFZH 4LUTA 4RDWA 4D72A 3NIGB 1E3FA 1WBZB 3FY1A 3DRQB 3QVAA 2F54E 3MUZ1 3GC4A 5FKAA 2XWTA 1TF4A 4Z95H 1F86A 3IIXA 3KP1A 5T26A 1PD6A 3FT3B 5CD5D 3VX0A 3PAVA 4PBDA 1E1CB 1MW0A 5TE4H 4KEVA 2YDQA 3WBWA 5C0IB 4MZ2A 3STLA 4CN1A 2W0KA 2RB8A 2CQVA 5AWNH 2J12B 4WJG3 4O5LL 2D22A 3W7LA 5KVGE 4UOJA 5L6UA 3UZEC 2BNUB 3MA9L 3RWGA 3MDUA 3P77A 4FP8L 4NU7A 5KBLA 3KVPA 1ZDSA 4HCRA 5AZ2L 1HILB 4HEMA 3QOKA 1Y0LB 1YZZA 3SGJA 4PJ8B 1L7IL 2E5EA 3ULUC 5DYOA 4L5FL 1KPUB 3IGKA 1VR6A 3W6LA 3EH5B 4ELMA 1AD9A 3D0LB 3QAQA 3F65A 4L1SA 3HVNA 2BWQA 1EXPA 5DUBB 1E5NA 2NX9A 1KRMA 4F37K 3VOFA 1NL0H 3JWOC 1NCBL 3UGEA 4FCAA 1DTNA 4B9CA 3KBPA 4KJWC 5AENA 3HG4A 4OBSA 1AY1L 4NM8H 1MEXH 4FNSA 4XN4A 4E9XA 1S2EA 2WLMA 2Y7QA 4OTXL 2Z29A 4XNBA 2YXXA 5IHUL 3NCWA 1W8OA 5D2TA 2F68X 3N44B 4I4WB 5C0ND 2QADB 4WK0B 4X8GA 5F2FA 2R69A 1B5TA 1OGPA 1OHZA 3IJ8A 1V02A 2FEDC 1JGDB 2EXYD 4U6YA 5C0BB 4Z1YA 4LVHC 1E65A 4PSPA 3IIVA 3F4WA 1YAIA 2Z7WA 2QKIB 1ZJAA 3HPXA 3MP4A 2OCCB 1MJJB 5CNHA 1KNOB 2BG5A 2BIQA 1R8LA 3NQ8A 5IROA 3E0LA 2BSSA 1VBHA 1W72H 5AC5A 2WWKT 3HV9A 2C1PB 1E6JH 4KT2A 3SIZA 3ZT7A 3W85A 1YEDB 4B5TA 1I75A 2OO6A 2WSKA 3OPSA 3DA0A 4FFYA 1DJIA 3KM2A 4YSRA 5KS9A 4IFKA 3UZWA 4R34A 3SRDA 3VGAC 3PQYD 1GHRA 4TV3A 1EDYA 3IDXH 4KTEH 1AXTL 4R33A 1PO9A 4M3HA 3W75A 1HH9A 1QX1A 1TTFA 2AW2A 3BDBA 4UNTA 4Y19E 4AL8C 4HXBH 3C2EA 5J7CC 2VKZG 4K1GA 3B5TA 5IEHB 2Z7YA 1DWFM 1NFKA 1W6TA 3IMTA 4UB0L 3BQUB 1NFIB 2BTMA 3MLVH 3R8HA 2A9NL 3IGLA 1K3UA 5L8KB 4WW1A 4OCSH 1H7NA 3PZIA 3DTXA 2D03H 2WANA 2MOGA 3HNSL 4FNQA 3UYOD 4HUNB 4HV8A 3VIPA 2E4TA 1NWRA 1YMMA 4BM7A 5EMUA 3WFLA 3GB7B 5IF0A 1IC7L 2EDDA 3MBWB 2BCKB 3GZAA 4Q8TA 2Z28A 1KM3A 5C9JB 4MCYA 5CLXA 5IY5B 5GRYA 4ATWA 1EYEA 3QQWA 1JFXA 4KCVA 2XTJD 4JAMB 5IB3A 3HC3L 3VOIA 2O6DA 5HDBF 3RWHB 5C9RA 3KXFE 3TEXA 4D8PB 4D8ZA 5JO5B 4NIKB 4QTIL 4Y4KB 3UWEA 5K93A 4ZMWA 3GXUB 3QPQD 1AG0A 2BIPA 2FQDA 3QXUA 4X8XA 5B22A 3B9VA 4PJXB 4DPBX 5IFJA 1W0MA 3TEUA 4OFDA 5FB8B 1H3WM 4NJGA 1ZOXA 5JR1H 4ECLA 1MHHB 4LO9A 4QGCA 3HHMA 3V55A 2NY2D 3W9EB 2CLHA 1G7MA 1LZOA 4E36A 4OQTL 4ERAA 2AQOA 1DBAL 4U6VL 3WNLA 1S5TA 1SHSA 4AX3A 5GS0D 1HEZB 3MYOA 2WQ8A 5I6PA 4UB9A 5L9FA 5EDXA 5AB1A 3CG8A 3CZFA 4HH9B 3TPUA 3KS5A 2FLMA 5CIPH 4DETA 2G2NA 3ABLB 1OFBA 4KNSA 1W3IA 3AIBA 5H91A 3HJ0A 2AQ1A 1OE2A 1XEUA 3PWLA 4UOW1 4JZJB 2X2YA 3MRFB 3GBNH 4DTGL 3LDVA 5IRPA 3FSOA 3ABKB 1PL9A 5IMOA 1L9RA 3O4OC 4XCYB 3UZXA 5DJYB 2QNEA 5GZND 1FWXA 2OMWB 2OELA 1ES0B 2J88A 1MF2L 2FFIA 4JGDA 5IQMA 1JHTB 2C7UB 3P1VA 1S9XA 5T1MB 1GJIA 3RJYA 3B5GA 5EN3A 4MJIB 4TVPE 3T09A 2WOQA 3FX4A 2NQJA 4GSRA 4RNRB 5EKYA 2BK8A 3OMIB 4IU3B 1NP2A 5I03A 4LNRA 5E51A 3WEMA 3ES8A 3JVGA 3TT3L 5A6AA 1M9HA 4M6MH 2ZG1A 1J8VA 1W5PA 3NO1A 4O50A 1SPQA 4V1XA 1T66D 2RGSA 1NGYB 4JVUA 2XQYG 5CHNB 5DZOA 5FYKL 1EOMA 2H0JA 5GZOA 3BICA 4Y8FA 1KLGA 1WICA 5J6GA 4NZUL 1FAIL 1F3EA 3NZGA 4JY8A 3EZJB 2WTOA 2A9MH 3BW4A 3UWYA 1DYSA 3KYNA 1NMBL 4MNHA 4PRNB 5HHQA 5MEND 1DTUA 5EUKA 3VXQA 4IGMA 1F5WA 4FI6A 1TQWA 2VJ8A 5FHAH 2R1LA 4Q6YA 1U91A 1QFHA 5D5MB 3VGDA 2D3LA 1K8IB 3KPLA 4JFEB 5TK4A 1OCCB 1IEHA 1MQQA 3P0WA 4US5D 4X2PA 3F85A 4Y4HD 5H94A 4MJIE 3M1BB 1M5WA 2CZFA 3QQ3A 2MOQA 5DHEA 3SQOH 3VH8G 2J13A 5KSAD 1CQKA 4ZMNA 1Z41A 4B9GA 3KGUA 2ZXQA 3QQNA 1YEHL 1RJLA 2EEFA 5E95B 3BW3A 3DERA 4B16A 4DPQA 3O2LA 4RFOL 5IW6A 4HN8A 4BHYA 1MXDA 5EMJA 3CVIH 4KOBA 3WN5C 2R82A 3NEOA 4JHBA 4OJAA 3MLZL 3STZA 2KLSA 3IV3A 5EYWA 4ODBD 4WENB 3T0EC 3UXKA 3EX6A 1G6RH 4E3TA 2YGVA 3M0JA 4OFYA 4DPRA 4CNSA 3EHBC 1OP5K 3SM0A 3X1BA 3C0LA 4O10A 4ODSH 3RCMA 3A4EA 2IADB 5JQIB 1KQZA 5FDYA 5A6IA 3N43B 4UTAH 2JIWA 3BGMA 1DVUA 3UH8A 3PZMA 2FATH 1A3HA 4LEQA 4ZDHA 1XFCA 3VXRD 4P23C 2PNDA 1NBVH 4LUTB 1NCTA 3GD1C 3U36B 1WD9A 5JIMA 1ILUA 1UQSA 2V17H 2WB1A 1HIML 3PF2A 5C6WH 5C71A 3ITCA 2XVLA 1CWVA 2HJFA 3GEWB 2BHZA 3TURA 3F7KA 3ZSTA 4N2GA 4F7KA 4WLCA 3W1PA 2FWSA 4H9TA 1GGBL 2VFEA 1LEGA 5DJ2A 1XGZA 1NGWA 4RGND 4UTAL 4ONHA 4UB0H 1JPFB 3I02A 2WKGA 1S7WA 4XPHL 1ETJA 3DGGA 4FQ2L 4GBXD 2K6WA 3MBXL 4BFNA 1W3KA 4JFDD 5E6YA 4TLKA 2HS8A 2VABA 3JSSA 4Y1AB 2IH1A 4N22A 4G7YH 1T6VN 1QD0A 3M7WA 2HUEA 1E2ZA 1SM3H 3LZQA 3OKLB 4YBQC 4EOUA 4AT6A 3CU2A 3SQLA 2P24A 4V15A 5EO0B 1NC2A 3S5LG 1HCYA 5AW3B 2AJUH 1D9KB 2FJGB 4YR6B 1W0WA 3UYRH 1A5OC 5FUOH 2FYMA 2WJZA 3PWIA 1RIUL 3HMXH 4QRTB 3T55A 3U6WA 4IWWA 3B1TA 3JTTA 1PEZA 3MVTA 1DQLL 3Q43A 2ADAA 2ZXBA 4A29A 5A8PA 3L68A 3KMDA 2AANA 3GKWL 3RVUC 2XGZA 2WD0A 2FNBA 1PDYA 3PZVA 5IMKB 1PWMA 1N8OE 2J7CA 3GC2A 4QNPE 1DORA 3GX9A 5LCVA 2WZAA 4NZDA 3D9AL 3IJIA 2DI8A 3QI9C 4PBGA 2DEWX 3QHMA 1C92A 2YCIX 1XO8A 3H2OA 1EWHA 1SBSL 3HU7A 4NS0A 3GJFH 3AGVA 3ULUH 2OFJA 4YHNA 4GH3A 3DX6A 3QWRA 4FQJL 4MBOA 3RWDB 3BJFA 3OEXA 2XNAA 4MNGA 2YSTA 3LV5A 4AGPA 4QHUB 2Y70A 1QBAA 4HAFA 4ML9A 1THFD 2YXWA 3NG5A 5DHXB 5E5MB 1T41A 3W7GA 4NPYB 1LRNA 2CLVB 3Q8AA 4NYLA 1P2CA 1ZXKA 1UWYA 43C9A 1ORSB 2QV5A 2FEEL 3SCMA 5C0EA 1C5DB 1EBAA 2GAZA 1XFPA 5BZXA 2DQHH 3LNDA 4B95C 3QUMH 3OOQA 1MCOH 1F41A 2QZQA 4QHKJ 2NR6C 4MAYB 3RG1C 4IHOB 2EVJA 5ID1B 1XCTB 2XN1A 1ETB1 2OI9C 2VQ1B 1P0KA 2WXQA 4JZNA 3CFJA 3UTPD 1ZEAH 4PMVA 4XP1L 5AHLA 2A74C 4LSRH 4OKVB 3ROLB 5I1AB 1THAA 4M29A 1O95A 3BKCL 5IBXA 2WCSA 3PDOA 1MCEA 3VWJC 2E8ZA 4R6UA 3C8KB 1AI1L 1JRCA 5CPSA 3RAOA 3VNYA 3BVTA 1EJ6A 3DV6A 4DHLA 4TR9A 4L9DA 2BW4A 3OWRA 1NY1A 1WEJL 5SX4H 1GEQA 1R33A 3WEAA 3V5DA 2Z93A 5C97A 4S0HA 1EFZA 2PYEA 1G9NC 2V9TA 3HE6B 3LQMA 1KB5B 3BARA 3TYFA 4O4VA 4Q32A 1G6RB 1W16A 3R2GA 2QQNL 2X4TB 3D87B 4GXVH 5JIWA 3KLKA 3TTEA 4E6MA 3S3CB 1E4IA 5GNXA 2A74B 1X5ZA 2P48B 2BM3A 2OJEB 1J4EA 4KHXH 5J1AB 1QSZA 4MZYA 1HKJA 2C9VA 4OKDA 3QIBC 5B7EA 3M64A 1FO0H 1JXKA 3P5ZA 5TPWH 2DLIA 3OODA 3KX6A 1AW2A 3QW9A 3KP0A 5CC6A 1OVZA 3FC8A 1RP9A 3PL6A 1MLBB 2SODB 1IWPA 4UM9A 4JY4A 2IPGA 3V4VB 4KITB 4JK0D 4WQ6A 6REQB 4LAQL 2VX4A 1RIVH 1BMZA 4KPHL 3IWUA 1GS8A 3NM3A 2XC8A 1J2BA 3UTZA 4L4LA 4P2AA 2IAMD 4IOFC 3OR6A 1M56B 5AKVA 3K6SA 4WJXA 3W88A 2GSIA 5F7FA 1F4AA 4AIEA 1NL0L 32C2A 1AOHA 3ESMA 2TRYA 4NKOA 1II4E 3QIWD 1DEEB 1K70A 3A22A 2XN9A 3THMH 3QV8A 4IOIB 4KHTL 3MA7A 2LE9A 4GUQA 2VRJA 1CDIA 3RY6A 4ECNA 5CEZD 1NAML 3FHEA 3GKFA 1AFVL 3I6SA 1PIIA 4B9KC 5ALCL 4OIIL 1VFTA 2DT0A 1MI5A 5J8OA 3HPJA 4AMWA 4Z2GA 1E6SM 2OMTB 2MIZA 1M68A 2NW3B 1VD6A 3GVQA 4LMQI 2J62A 3RU8H 3BUYB 4L3EA 1X5JA 4G83A 3QIWB 2WAQA 5FYJU 3WNPA 1X1ZA 3MCOA 3F00A 3BO9A 4BCEA 5EBMB 5MP6H 3M7SA 4XAPA 4CVWA 4DF0A 3TN0B 2DWXA 2FZ9A 2W80C 4B4HA 3S3SA 3IKCB 1KLYA 4JFYB 4ANUA 2F6KA 2INEA 1N0XL 3RQ3A 1YEHH 3HV8A 5AZUA 5D71L 3F7VA 2FPTA 2CCLA 4JFUA 5F96H 5EU7E 3BVVA 1KJ2L 5CBBA 1SHWA 3T3ME 1OEZW 4I7VA 4B92A 4GKZB 1FDZA 4JNMA 2DQDH 4NAFB 1I53A 4JFFD 4P23A 5I1HH 3VXMB 2Y6ZA 2GJXB 4LB8A 3DIFA 3VFMB 3H9SD 2XG4A 2W9DL 4XC3H 1NC4A 1LNUA 3STZB 3SDAC 3DETC 3V9CA 2P0OA 5BO0D 1CF8H 2O4QA 3NQBA 1ZK5A 2AXWA 3UD6A 5CSGA 3B34A 2XWJA 4K39A 2F8XC 4DYEA 3QLLA 3CWHA 2PDJA 4XAWL 1ZA6B 1HSAA 3RX8A 3T0BA 5JOFA 2DIKA 2EPNA 2ZYFA 4OF8A 4I5XA 4IRJC 3LCHA 4LBSA 1YN6A 4JTCA 3ZDZF 1CEOA 3EAKA 3R8QA 2F6AA 1AGCB 1PS3A 2FJFA 4HZLB 2PDQA 3SAZA 1B0GB 4DH2A 3W38A 5DTFB 1G0CA 5JPNB 4LPUA 4C83B 3NAVA 3PTQA 1F11B 1RZIB 4AUYA 1KGWA 2EE3A 4BFFA 4Z1DA 2XA8L 4GOAA 5GJSH 1MJUL 3O6FA 4AENB 3HG1A 5MENE 3V4VL 4INFA 4QHRA 3V0WH 1IJNA 2GJPA 4W88A 3UYPA 4JRYE 4H7ZA 1DBKL 4LSDA 2F53A 2R27A 1F4WH 3S0CA 3SJVE 4MXQD 2FZ8A 2DI7A 4G6AC 4W9CC 1EUTA 1QBLH 5BO1L 4WO4B 2RFXA 3T0DA 3FDWA 2NMSA 4GXFA 1LM8V 3I2CL 5EOQL 4JKNA 4HA4A 3IVKB 2HB0A 5KZCD 3SUWA 2IANE 3QDME 1MQRA 3WD2A 1F3DJ 2LHAA 1XF2B 2P76A 4A4AA 3GE7A 1ETA1 3PHAA 5DO8A 1NZRA 5MF5A 4DJFD 2V68A 5LXEA 3W5NA 2KZBA 4XP5H 2GK0A 2YK1H 5E6RB 5C0DA 2Q86B 3ATEA 4WHYH 5BZDB 5HGGS 3ZDXE 1M7PA 3KS6A 2A77H 2AJ3B 3FTZA 4MZIA 3MLRH 4F15B 5M95B 1RJZA 3FUIA 1OCOB 2YFNA 4K9EL 2ZWNA 3QNZA 4TYUA 5G1TA 3ZYOA 5TNVA 1VB9A 4FPSA 4MDRA 3M1BA 4QD2E 5FW7A 1WZLA 5ANHA 1PKNA 4KKAD 3EH4B 1XS2A 1FZOA 3WLOA 4Y9MA 5LGJB 2GBVA 5EORL 3CVBA 4XNXL 4HJTA 4MNQD 5H8MA 1VZGA 2BP1A 4GY0A 1W80A 2J8UE 3FRUA 3K7UA 2JI2A 2J2ZB 4ONOA 5EOCL 5HSFA 2ICSA 2Z1WA 4CA4A 3N1PC 2YC1A 3O8XA 4P2QA 2APTA 2DQHL 4JMNA 1QHOA 4TUJB 4NZRL 5DURB 1SJBA 2Z1XA 3F58L 3S2NA 4MLSA 4MQXD 4ZW3A 2QJDA 1OWQA 4Q8WA 2Z6IA 3PN8A 2QUUA 2XQBH 4CSSA 1XH3A 2CLFA 2DVTA 3NQCA 3PPGA 5AZ0A 4WTZA 4NKDB 2NY0B 3EXRA 1ZRQA 3DXAE 4K23L 2ZT9C 3O45A 2BP3A 5HHVL 1AQ8A 2AL2A 3BPLB 1LL4A 4FHJA 5CZVH 4TIMA 1H8NA 5LKYA 1X6LA 4WI8A 4B53A 3A3WA 2YOCA 1HH9B 3VWJA 3SE8L 1AXIB 2WB5A 1YBQA 5BV7B 4L8BB 1P5UB 2VI0A 2LABA 1BGAA 2CLEA 3K4WA 4TMBA 2WQXA 4NSKA 3LNMA 3QWNA 3DN5A 4PTMA 3WEXA 1UOLA 1GS6X 1SO6A 3RZCA 2YD2A 3QA3B 5MP6L 2L8AA 4KJPD 4N85A 3O1NA 5BXFA 2OGYA 5C6TH 3HS0B 4F2MA 4XVDA 1SXZA 1XGRA 4Y19B 2RGMA 3BN9C 5E9XA 1NM9A 3UTPE 3PJWA 5C2CA 5I6SA 1I8KB 1Q66A 5HJLA 4K2UH 3S6CA 4JRWA 5IW6B 3MY9A 3P40A 5IQ9B 1BPLB 5D2NC 5LG1A 3ZJ6A 3AFLA 3W1RA 5J56B 3FUHA 3RPMA 3H7UA 3RR4A 4QE4A 1HJXA 4XTDA 5F2GA 1J9SA 3L2NA 2ODOA 2DORA 3NZPA 3V7PA 2VUKA 3AG2B 4UQAA 4LMQE 4KWSA 1OAZH 4FCHA 1XTMA 1Z6JT 4CILA 1Z3GH 5D1XA 5ITFB 1SMOA 1C3FA 5E6IC 5JQHC 3MFGB 2N1TE 2Q7NA 3E8UH 1GYMA 5CPLA 4KWOA 4ETQA 4M6AA 2CIPA 4ODUB 2B7QA 3ABGA 2FECI 2FX8L 1OTSC 3BOVA 3GT6A 1IM3A 1Q9KA 2NLYA 4HSAC 3B05A 4MA1C 1KEGL 4GFTB 1EEPA 3V1HA 3W28A 5BYWA 4QLWA 1TKWA 3PJUA 3C5ZD 4Q14A 1JXGA 4PMDA 4XI5D 5CLZA 2BRQA 5FX3A 2XJKA 1LCOA 4NWUH 2PZNA 4S38A 2ESVE 3SSJA 1BZ8A 2A7PA 1BXUA 1DVFD 3E1F1 4OM0L 3R1GH 1TVHA 1V0MA 4YHLH 3QYCA 1PB0A 2D4FA 1GGTA 3BP4A 3P0YL 4AD0A 1QUNB 3UJJH 2C7UA 2A3AA 4RWYL 4DJDD 4PMEA 3ZQWA 4E5TA 4NPYA 5GS0H 4OZHA 4QE1A 3GLCA 5K9CA 1XAUA 1TXKA 2A0LC 2QFRA 3O6LH 4JFPB 2QADC 2D0HA 4JPKH 3OB8A 3QUZB 3RJDA 1LT7A 3T9PA 3W1MA 1GTFA 1FWTA 1ZAJA 1IC5L 4XTRC 4DWSC 2GY5A 5BW6A 2I25N 2XTSA 2ZRUA 3UVIA 1SYSA 1ZBKA 3LQLA 4A05A 5HYQB 4HWEL 3RVWC 4ZAKC 3CUXA 3CZLA 4PE8A 4JJOA 1YYML 4YDKH 4ZFZB 2Q5BA 1OG0A 3VI4E 1ZALA 2WVUA 1MHEB 1LOSA 3K2GA 4OKVA 3M0KA 3LPWA 2R8SH 3U57A 3IBOA 2PLMA 4C8XA 5D7EA 3JWOL 4JFEA 2XN0A 4MHHG 3EWWA 2P10A 4H88L 3L3GA 4JUTA 3LLFA 5J1TC 4N87A 5BCAA 3GZKA 4JDEB 3G1YA 4HF5L 3DO3A 2CWXA 4PBWD 1X5YA 3BGFB 4YK4C 2A6KA 1ZVYA 4LT7A 5I1EL 1MKFA 1HVQA 1WGVA 4BK5A 1SJVA 1FL3B 1LOQA 4FZ8H 3CZJA 3CEUA 4POYA 1E5CA 1ISVA 1L2QA 1WZ1L 4KGLA 4JZ5A 3WNOA 3ITYA 2NY6D 3CLEH 1NBCA 3AB0C 5IB1B 4FTVD 4Z77B 1J12A 2GBAA 4N26A 4UUJB 1J86A 3D4YA 3QC0A 2NW0A 1JVNA 3FB5B 4Y5VB 4YWGH 1MJ7H 2EJ1A 3TN3A 4RW5A 2AJZA 2VDLH 2WLJA 5DJDB 1HKLL 4B5ZA 3FDKA 5JHDD 4Y4HA 3HBPA 1FP9A 3V7AE 1XR2A 1B0RB 4IRZA 2FTPA 1BM3L 5FA4B 1SO3A 2WJFA 1KFJA 3NQKA 2ZAIA 4AV4A 1IGJA 3OR6B 4MRCA 3SKOB 2CIKB 5D6DA 5B39B 2HVJB 5JPMA 2Q8BL 4LNYA 2YPLB 5TE6H 3E6EA 4C6CA 3OIHA 1NPJA 1GAFL 3ITTA 1TJMA 3U0WL 3WI9A 1EOKA 2E27H 3GO1L 2RH0A 1ZLVH 2J77A 3WQDA 4X9FA 1WKYA 1C1EH 4CNOA 4A55A 3MI6A 3ZDXF 3BWAB 3N04A 3ANUA 2P80A 3CUHA 4HNOA 1UZ6E 2VFDA 2DDQL 1OP3H 3WDJA 3WY2A 3CLWA 1DWIM 1V54B 2VXSL 4PREB 5ETUA 1HCFX 4LPXA 1OZQA 4EI5B 4YMPA 5FSDC 1SVZA 1OZTG 1A6ZA 3BMWA 3RU8L 1U8NB 5E8OA 1P5VB 4JY6A 1V3HA 3VB8A 4PIRF 1PD0A 4MKSA 4QLKA 3SUUA 5CEXB 2EG8A 2Z0UA 3II1A 5GZNA 3N2OA 4MS6A 2AJXL 4FFYH 2NV9A 2R29H 4BH8A 2RDUA 4B2DD 3V0TA 1AOZA 2V5JA 1QWNA 3TO4B 4PUWA 4X61A 2OEMA 3ZL2A 4ZSUA 2NQ5A 4DEFA 2WQSA 5HULA 2VX5A 3VTTA 1ZGLB 1S5HB 1S5VA 3EYSH 2XWCA 2VC6A 3L2MA 5BXPA 1R3HB 3L9YA 3ZT6A 2XY1A 3CJJA 3TYGH 3ZDYB 3FU0A 4NC0B 1QFWI 1BD2D 3HGSA 4AEIH 1TETH 4GBXA 2YA2A 1J5TA 2YXFA 2AEWA 1KRBC 4HSQA 3KL3A 1ETZB 3WSQL 4YN3A 2BGSA 2VWTA 1I1RA 2HJLA 4LF1A 1RUML 3K2UH 4N0UA 5F0JB 3EOAA 1X98A 1G69A 2Z1SA 3AXKA 4YYCA 1PKLA 1DJWA 3LB6C 2TSAA 5IBXC 1UBPC 3C8HA 3UZEA 5K2ZA 4KTDL 4PJ9D 1FVEA 1TMLA 5IGXL 2LLGA 3ZK0A 4L4TB 4P5MA 2O7SA 4P7QA 3VFTA 2ZRWA 3EAUA 2XN9B 2ENPA 1KFAH 2AOSA 3MGAA 1V5XA 1FL6B 1VADA 3HFMH 2WW5A 3IVSA 2XNAB 1RZ7L 5AB0A 3AG4B 4P4KC 2E7HA 4NUMA 1D3CA 2XA8H 4S3CA 2ZX6A 3CT2A 2BSLA 4NO0D 4OIAA 2PTTA 3OVGA 2DPEA 1O6SA 3OTRA 1GQIA 1BF6A 2R2HB 4ZMYA 2X7VA 5KVEL 4YGVB 1T8XA 1QQDB 2X4PA 4IKLA 2A79A 3SJVA 4XAWH 5EZIH 1P4BL 1BQSA 4PJFF 1IT8A 3GIPA 3CQHA 4GISA 2X2UA 4OCLC 4S2CA 4XBGB 4AYEC 2F2KA 1BG9A 4CD5A 4R7OA 4N2KA 1FJ1A 2EIJB 4OV9A 1U3NA 4Q7IA 3PDGA 4JM2A 3L4ZA 2JJSA 2PRLA 3IFPB 4JFDB 3NSCA 5DC2A 4M81A 1NOWA 4NJAH 2DTML 3KBMA 3TEWA 3B7SA 3MV7D 1MJUH 4FFVD 3ECWA 1HZLA 4QF1B 4HS8H 1NUGA 1QRND 4UBDD 3B6SA 5DK2A 1UR9A 4HHMA 4FQHB 4PJAA 4EDWL 1FSKB 4IYKA 4GY1A 1E4WL 5C55A 4CC4A 4A67A 1T1YA 3UP1A 3SJNA 4LYRA 1TTQA 2OZ4L 4AGOA 4PLKD 5J89A 2VEKA 4JG0H 5H4ZA 4I9AA 3RX2A 5HNTA 3BT2H 4MDJA 3QORA 2OZ3A 3ZKXC 4NQVB 1B4RA 1IXOA 2QUNA 2H4EA 4F0MA 4MPKA 1QZ1A 2X4UB 4PYHA 1SPDA 3O0LA 1DQQB 3PUOA 2W6RA 5BJTA 1O66A 3V6FA 1SOKA 2OV0A 4JHMA 4OI9A 4QUOA 1AKJB 5B39G 3EEZA 1S2AA 1E28B 3K2KA 3EYOA 1JHLL 2IAMA 4X5XA 5JIDA 4L4OA 4GACA 4MY8A 4IPJA 2YPVA 3L3DA 5D1XD 5H8DA 5AALA 3M0XA 4K7PL 1MCHA 1CLZL 2QPFA 4ZMAT 2V7HB 4NQSA 1CF8L 5ADPL 2AK4B 1SJXA 1P7KB 2PPDA 3EGSA 4UNVA 4XMVA 5T3XE 1H7WA 3VKBA 4ZX3A 5A2KH 4MA3B 2BS9A 3BLPX 4OF6A 4Z3EA 3LERA 2YXVA 4NKDA 2IPTL 3N3EA 4ZQKB 1KFWA 1VYSX 4GNJA 3I9PA 1KG0B 3SB3A 2V5MA 3D3AA 2N7AA 3QV6A 5DXXA 3EOTL 2HKFH 2EYRB 5BRZE 2ED7A 3QS2A 2C26A 5HJDA 5IJBC 1LBLA 1YNYA 4N8CH 3MKCA 5BZZA 4JPIB 3ZY7A 5KVGH 4I6VA 4ADUA 5DRWB 1HHHB 1MI5E 3LOWA 4ZFOB 1YBQB 3HURA 1DQMH 3EB2A 1KQYA 3FU6A 4RQQB 3FU7B 4WO4D 3IWPA 2YPLD 3S88L 5LBGA 1HTIA 1JEZA 1QFUH 1VFSA 4N0CD 4KETA 2Y0FA 1EAJA 2JMRA 2NY5H 3BO8B 3S3BB 3M1CA 2YB1A 1BFOA 2VSKB 1AK5A 1FWGC 4ROPA 1UUOA 2WBJD 1WCBB 3AM8A 1VAHA 2W79A 1ADOA 2TAAA 1DE6A 5AAWC 1Q9OA 2BMKB 4UT9A 3GD6A 4AH2A 2X40A 4FTVE 3DJTA 4J3BA 5IQLA 3P2VA 4V1DA 4UTJA 2LU4A 4OB5L 4M02A 3QIUC 5E2TL 1HF6A 5DBUA 5AHIA 1UB6B 2OW7A 2X1PA 2Y7NA 1UVQB 2V5LA 1A6AB 2EICA 1OADA 5KVFE 3SBRA 3DEQA 3DUUA 5AHFA 4YBHA 4MQ7B 4PRBA 4IKNA 2ZOLB 4XCEA 1S1RA 1KIRA 1AI1H 4DI9A 2HMID 5F9OL 5A6TC 3G5WA 1IO4C 4P3DB 4PB5A 4MD4B 5FOBB 1WA0X 1XF4B 1F7BA 4R4BA 4NUGH 1BFSA 3RL2A 4MWAB 3WSQH 4L3CB 1GZGA 1NIEA 3BYTA 3MYJB 3TL5A 3V8OA 1A6PA 1CD9B 4X6FB 4UWMA 4Z5RB 4A2SA 3L4TA 3TEYA 2GPZA 2MCPH 5EWIH 1AL7A 1DE5A 2P8BA 4MF4A 3WD3A 5FF0A 4PJCE 2P3ZA 3ULVL 2D7QA 1EJVC 1KWGA 1LHZA 1R2TA 3S98A 4EI5D 2HKAA 2JKNA 4G8GB 1KIUA 2DJUA 1MFCH 1NTHA 2QPSA 4JR9L 4L1XA 1AJ0A 2M83A 4L9LC 5AUMA 5CCZA 5LXXA 4EZJA 5LXGH 4PBEA 1GY1A 4XXDB 5F6IB 1W1A1 1R3WA 1JPEA 1PY9A 2IEPA 4H20L 4LP5A 1F90H 3CGTA 4WJKB 5DHMC 1XGPB 3M17B 4DGVH 1RZFL 4JFTA 1RJQA 3IGAB 3WAJA 3DKHA 4XSMA 3IETB 4EUPA 1KPRB 4L29B 1Y1DA 4NQXB 4W9HC 3VFRA 1IEIA 1XW8A 3L4UA 2YDRA 2GQHA 2X9ZA 2GI0A 5EN2A 3D52A 3RZCB 1ZZMA 3LG3A 5FSEC 4MAVA 1KM0A 2XPGB 3N2JA 5JIIA 3IJHA 3RVXC 5KBDA 3PP4H 2VZ3A 5ABGA 2P50A 4HK3N 1EZUA 5ANMA 5F70A 3LMYA 4OZHB 1VFFA 1ZVSA 3VFUA 4I3SH 3ZLHA 3WMCA 3U7YL 2YMXL 3ZSSA 4PCSA 5E9DD 1BF5A 2XV2A 1DWGM 1OG6A 3PNRB 1B3JA 3FQWA 4Z0BH 2BP8A 1WFMA 1ONQB 3N1GC 1WAAF 1MOEA 4WI5A 5E2UH 2RMNA 1MFDH 2F53D 4I4WA 1CURA 3QPZA 5EF0A 3L3KA 3LS5H 2Q86A 1SY6A 3BZEA 4G1NA 3HLAB 4Q6XA 3Q1SL 2QSQA 3B7UX 3QZMA 1WFJA 4EN3B 4H5SA 3S37L 4F1SA 4WJEA 4IIQA 4NIYE 1M2OA 2YWZA 3NAAL 5IP4A 1UKOA 4FI4A 3TC9A 1S7SA 3IIZA 1EO8L 3CXDH 3IDNA 5M1TA 3VXSE 2O6EA 3A3HA 1AC6A 4H0HB 1KKRA 4JN1H 5B1CA 2EPOA 3KYOA 5IVXF 5C7ZA 2BVWA 1KCLA 3UADA 1FLRH 1GPOH 3VXRA 3FIGA 3EGDA 2V63A 1NGZA 1WC7B 3SN4A 3TP4A 2JIEA 1CDCA 2BSTB 3MV8D 5T9BG 1KN4L 2CIKA 4YXHH 3QCTL 4JG1L 3TBSA 1AGFB 5B39A 5I6XC 1T1WB 5JHLH 2X6VA 4M7ZC 4DWHA 1FWEC 3IJSB 4UT6A 3ZLGA 1NUDA 3H9SA 4EIVA 2HPOA 1VHCA 1OF2B 4XXCC 4IKKA 5AYUH 4I0KA 3TBYB 5I82A 4JN7A 2XWTB 2FIRT 4G7YL 1EGMA 5FKAB 3PHOA 3GMQB 2X1UA 3KCOA 4S1QL 4W7UA 1I4FA 4B5SA 1QW7A 1CYXA 2BCKA 4XO6A 3ABOA 4G8AC 3CASA 2A85A 3CVHA 5HGBB 3MRIA 4Y2OA 2K1MA 2EADA 5EFIB 4J27A 4PIBA 4PJ7B 1AJ2A 3PBUA 3GMPA 2RKXA 2W62A 4NN7C 4UZGA 2VD8A 3CFUA 1BTMA 1HH6A 1NGQH 4G3YL 5D38A 4S1SH 2DU2A 2RDXA 2R1YA 1P4LB 4OT7A 1FRGL 2DM7A 2OCJA 3CSYB 1T2XA 3ZDYF 4CNIB 1GOQA 5M03A 1G6CA 2IH1B 3HG1D 3ISRA 1INQB 3PB2A 1T21B 2OL3H 4GUCA 3WIHH 1BQRA 4CC4C 2NVAA 4QHNB 3UTQA 2YL9A 5CC7A 5ABAA 1DBBH 1IQWL 1Z0MA 1Y07A 5HP5A 3MOBH 2BERA 2LR4A 2I1OA 4XPBH 5C09B 4CDGC 1RI8A 3UPAA 1FC2D 4QDPA 1ZHKB 4YDJA 1N12A 2BP0A 4UT6H 2YR1A 1YEWA 3RU8X 1ADQL 2EZ0C 2MTAA 5F9WB 2WPBA 2PMZA 5ISZD 3P62A 4XT1C 4OJYA 1XI3A 2A9ML 3VRLE 4P4RB 3EXTA 3OB0K 3TAKA 2QR0A 2BVUA 4GCAA 4LKCB 1DBJH 5CCGE 3HQOA 5CIPA 4OV5A 1FCBA 1CUOA 1ACYH 1OZMA 4XOAA 1G9ML 2IW0A 3MSYA 4GI4A 4E4FA 3UC0H 4PRTA 4TVCA 2FR4B 1JK8B 4GQRA 2WZ6A