1KXTA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
total genus 170
structure length 496
sequence length 496
chains with identical sequence C, E
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxtA01
3VIKA 2PWDA 2QPSA 3O2LA 3CC1A 4ATDA 1TVPA 3MMUA 2XHYA 2DSUA 4W7WA 4YPJA 5A2CA 2BXYA 4GKLA 1M7XA 2ZUNA 2XIBA 4CN6A 4ZENA 2IXVA 4D6FA 1MFUA 1W1PA 4TTGA 2XN1A 1V3LA 4H8UA 3LRMA 4PSPA 3N15A 4J28A 1JIBA 1H5VA 5FCZA 4UFKA 3TV8A 5FD0A 3L4YA 2JIWA 3AFBA 3GXNA 2WHLA 1O7DC 2NT0A 3ARUA 5LA0A 3WDJA 2E9MA 2CITA 2J7HA 4IUGA 1E4LA 3AMCA 1KB3A 1Q6FA 1NOFA 3AMGA 1BFNA 3WD4A 4OKDA 2EPNA 1W9BM 1GPFA 3A5VA 1QI5A 1JZ3A 2JEPA 4L4OA 1VAHA 1EO7A 3K4DA 2CEQA 5CSUA 4AZGA 3EJSA 2GUYA 4PTVA 5M3WA 2FHFA 1TZ7A 3ARQA 5DFAA 3QOKA 1LQ0A 1C8XA 1Q6CA 2EPMX 4CUCA 1UG6A 1JXKA 3DHUA 2CKRA 2YBTA 2EADA 5CXPA 5KZ6A 1E40A 4KRUA 1MWOA 1XH1A 1B30A 1JI1A 2VZOA 4GZJA 1CIUA 3WENA 1C91A 3K46A 4BQ4A 3BSGA 4HA1A 1VEPA 5CGTA 2O92A 5I2UA 1HL9A 2OW6A 3AICA 3WUGA 4W5ZA 1QHZA 4TVDA 3OLIA 3N17A 3WH6A 3U7VA 4CGTA 1UR9A 5DT5A 2YJQA 2D73A 1GQLA 2WPGA 2D3NA 4S3KA 2XTKA 5IHRA 3WFZA 5C8BB 6TAAA 1LL4A 5BXTA 3W6MA 1C8YA 4AISA 3E1F1 1HP4A 2W91A 1VRXA 3AQUA 1SR0A 4EANA 6CGTA 5I3DA 4WK9A 4U2ZA 5A2BA 2WNWA 2XWDA 2V5DA 2WCAA 2V3EA 3CZLA 2W62A 3FNDA 3LRKA 2AOSA 5EB8A 2WW5A 1V0MA 3TP4A 1B3ZA 1HJUA 2BY1A 4V28A 2VCBA 2XG9A 4H7VA 4W8BA 5CG0A 4NI3A 1R75A 2YL5A 4FLRA 4MB5A 1W1VA 1E4NA 4AZCB 2X2HA 2D23A 2GJPA 1VEMA 5FOOA 1WZKA 2F7QA 1MW3A 3CLWA 1UWTA 3HJEA 2VZTA 3RM9A 4R5EA 4BQ5A 1OIFA 4PUDA 1CXLA 1M01A 3BAJA 3H55A 2YKKA 2YOCA 4XUYA 3JUGA 1VFFA 4MDOA 2WM0A 3N11A 1OINA 3FN9A 5I24A 3OZOA 1JYVA 3CZEA 3EDEA 2YA2A 3VVGA 3OGRA 4PMNA 3THCA 2VMFA 4AEEA 1BVZA 3U5YA 4MDPA 4PMUA 2O9TA 3VGDA 1DWFM 2O9OA 3CHFA 2DQXA 3MUIA 1QX1A 2ZX7A 3NUKA 1FFRA 2XGBA 1GOQA 1R33A 4JFUA 3WH7A 3IGUA 3NCOA 4CU6A 1BSIA 3A47A 1KXVA 4BQ2A 4PTMA 3WNMA 2FDMA 1P6WA 1VEOA 4HZ6A 1LJYA 3WH9A 1HJVA 2VT0A 1LL7A 4RE2A 1KQYA 1US3A 1WAWA 3D5HA 2WYSA 3ARYA 4QP0A 3SCOA 1LG1A 4X9YA 1R7AA 1EHNA 3CZNA 4HMDA 3AHYA 4GIAA 4IISA 4MB4A 2VRJA 5A6KA 2W61A 5GQBA 3IAPA 4D6HA 1A47A 1UWSA 5I0DA 2VI0A 3A4XA 5CPSA 2VCAA 2DSWA 3CH9A 3AMDA 5AY7A 4FNUA 3LRLA 2UY2A 3K4AA 5A8PA 1OT1A 2CIPA 2ZXBA 1N82A 2VX5A 1NOWA 4AZ6A 5JBFA 1JZ5A 1OGBA 2X0YA 4S3JA 2A3CA 4P8UA 4Z2KA 3VIGA 3W28A 3WNOA 5JUVA 2WZIA 5IFTA 3FAWA 4PCSA 1CNVA 4UQDA 1W2VA 3AYRA 1HF6A 1QW9A 3WNLA 3U7BA 1ODUA 4CVUA 3ZT7A 3ZJ8A 2WMIA 2UY5A 3OLDA 3GXDA 4AMWA 1LWHA 3M07A 2CYGA 1HWWA 4UFHA 1U2YA 3AIEA 3VDHA 5M17A 2YA1A 2G8ZA 4B16A 2GJRA 1CWYA 5A6BA 3B9AA 1HX0A 4HA4A 3VM7A 1QWNA 3VIHA 2VOTA 2V3FA 1UH4A 2CHOA 2WHJA 1E1EA 1C7SA 2PB1A 4OBRA 3VDCA 3APGA 4HZ8A 1ZS2A 2F2HA 4MAVA 1XGZA 2WWCA 3AZSA 1VJSA 2BY2A 3L4XA 2ESCA 4PMDA 4M81A 3ARTA 2BFGA 3QHNA 4QDMA 4PMVA 1HVXA 3D3AA 4QCEA 3ZJ6A 2VX7A 1W3LA 2ZX9A 1NWUA 3WQWA 3BXWA 4NZCA 1PEZA 4Q22A 4A3YA 4WSKA 2J79A 2DEPA 3VU2A 2G41A 3WH8A 1KFWA 4QCFA 2Z1KA 3SIMA 3ALFA 2DT3A 1CGUA 2G3IA 2VUYA 3H54A 4AZHA 3QR3A 1V0NA 2CETA 2W63A 1VF8A 4PBGA 3DX4A 5I78A 2F18A 2BVYA 1QHPA 4B9ZA 3FXYA 1FH9A 5EMYA 4AYGA 1NH6A 4AD2A 2ZX5A 2A3BA 3AMKA 3WELA 3VTRA 3TTQA 3GYCA 3FW6A 1CGYA 4M8UA 1NWTA 2JIEA 3OBAA 1I1WA 1J12A 1JD7A 4W5UA 1UA3A 1KWKA 4Y7EA 3SUUA 1E1FA 1SMAA 5IXEA 3PHAA 4OUEA 3PTMA 2GK1A 2PWEA 4EK7A 1KTCA 3WH5A 1DWGM 4H2CA 3VIJA 4HMEA 4UQAA 3VILA 4OOZA 4IPLA 3KE0A 4U33A 2X2YA 4MNMA 3M6DA 5LA2A 4AD1A 2QF8A 3W37A 2GDUA 3U57A 4JKMA 4HOWA 5C71A 3TTOA 3S6TA 1E5JA 1ISZA 1QNPA 1UQZA 3ZMRA 5BXRA 2A3AA 3L2MA 5EFDA 6A3HA 2VQUA 5CSYA 1W1YA 3WEMA 2VCCA 2YIHA 4QAWA 3GH5A 4MB3A 5BRQA 2XYLA 4F79A 3M7SA 3GBEA 2Y24A 3RCNA 4NZJA 1JYWA 3NDZA 1UD2A 3BSHA 1ZB5A 3VPLA 3L4WA 1R7OA 3VIIA 1HNYA 2PWHA 1TQSA 3EJRA 1EH9A 4OOUA 2E4TA 1XYZA 1EIBA 3GXIA 3SCTA 3SCWA 4F8XA 4AMCA 2VVNA 4P7LA 5E6ZA 3MSGA 4LX4A 4D6EA 1J0IA 4D6JA 5M03A 3DYMA 2WCGA 4HOXA 4UQEA 1KGUA 3WDPP 1HVQA 4U5KA 3A6OA 3OA5A 4DO6A 5DEZA 4LPCA 5DF0A 4JFSA 1CXKA 1GQJA 3U5UA 1E73M 4MB1A 4AWEA 3O9NA 1W9VA 3BVTA 1X6LA 1J11A 1J01A 1R85A 2WSPA 1UWUA 3AZTA 1BG9A 2WMHA 5HDRA 1HXJA 3EMCA 2XUCA 3SURA 3CZGA 4AW7A 3WQ4A 3FAXA 5A69A 2Y5EA 4WSJA 4KMQA 3WNNA 4FK9A 1J0JA 2WLYA 3EYPA 2BHYA 3EJTA 4JZ5A 2AMGA 4R27A 2JF7A 3CMGA 3AXIA 1D2KA 2WMIB 4UOZA 2WCSA 5HXMA 1E70M 1UR0A 1UKOA 4GZEA 2VZUA 3FHQA 3CGTA 2ZX6A 1K6AA 3GH7A 3MUY1 5TD4A 1XD1A 4UFJA 3GTNA 1VBUA 1GVIA 3I3BA 2J7DA 1V0KA 1G5AA 1TE1A 4DWSD 2DH2A 1H2JA 3MUZ1 4HOZA 1M03A 2OSXA 3ZR5A 1R87A 1TUXA 5GNZA 4W86A 5D9NA 3BUPA 2VQTA 5BCAA 1Q6DA 3ZO9A 2WZEA 4FNTA 4J3VA 3WMBA 3AXHA 1OM0A 3WF1A 1H0IA 4UQCA 1IV8A 4BZYA 1J0ZA 1W3KA 1ZBCA 2VZSA 1M04A 3UETA 5FL1A 1CLVA 4W88A 4CVWA 1HN1A 4NRRA 4XX6A 5HPCA 4HZ7A 2JFEX 1W2PA 3DYPA 3AHVA 5I77A 1E5NA 1MVYA 3VINA 4TX6A 1CGXA 5E6YA 2VR4A 4C7FA 1JZ2A 1E6RA 1KXHA 1QPKA 2WWDA 2O9PA 3SUSA 3D4YA 1KCKA 2JE8A 4EAMA 2EAEA 1VIWA 1B9ZA 3KL3A 2XM1A 4RL3A 1Z32X 1Q4NX 4DUVA 1UH2A 2Z1SA 2ZIDA 1KXQA 3BMVA 4JFVA 3BUQA 3WQ6A 3DX3A 3W82A 3LPPA 1VFUA 3LXCA 4Z2LA 4H04A 4OZOA 1QOXA 3BAKA 5LYRA 2VNCA 1PX4A 4UFLA 2XVGA 1WDQA 3IANA 3GNPA 3IJ9A 1NOUA 3NSNA 4HMCA 1I75A 1ZJBA 3WL0A 7TAAA 2IGTA 1UA7A 2FE0A 4UQBA 2C7FA 3MS8A 3NSMA 1PIGA 1GQIA 9CGTA 1B3YA 2FHCA 1WZLA 3MI6A 2XVKA 4NZFA 3RM4A 3J7HA 1JGIA 3T0BA 3NYDA 3OZPA 3PZNA 4UTFA 1VB9A 3W38A 4JL2A 3F5JA 5A2AA 5ABGA 2BHZA 3AJ7A 3BUBA 3WUBA 4F9DA 1D7FA 1EDQA 1PX8A 4AZ5A 2EABA 1CXIA 2G3MA 4P7RA 2GDVA 4PMOA 2YA0A 1E6XM 1EGZA 5KEZA 3BH4A 1EXPA 2WBKA 5AYIA 4YN5A 1BQCA 3PZUA 2DH3A 2ZE0A 3VD9A 4GO8A 1BYAA 1LG2A 3RIKA 1TA3A 3W4RA 3LXBA 4AXNA 3WMSA 1JYXA 3BVWA 4C7DA 1HIZA 4LGXA 1EQCA 2DT0A 1V03A 1WDRA 3BAIA 4AIOA 1OT2A 1JAKA 2WMFA 3BGAA 1R47A 3BVUA 4M82A 1T0OA 5DO8A 1B3XA 3PZGA 1J0HA 1GOMA 3AHZA 2E0PA 3PTQA 1G1YA 4CKQA 3GDBA 3WD2A 3VNYA 1CEOA 2VTFA 1BG4A 1EOMA 5ABHA 2FYVA 4P7QA 4D6IA 3UR8A 1DTUA 4UFIA 4BF7A 3T0AA 1H09A 3SCSA 1V02E 2DSKA 4JAWA 1V6VA 2DSZA 1X1NA 3BLPX 4UZUA 3VGFA 3MV01 2WAGA 2YDQA 2UY4A 2XN2A 2GJXA 5D8WA 2DIEA 4AZIA 1WCGA 3VD4A 3BVVA 3WDRA 5CGMA 2OYMA 1OIMA 4L4PA 4GZIA 3CO4A 2VRQA 1JYNA 3CHEA 4WJXA 3WUEA 4GQRA 3DC0A 3WF0A 5ECUA 2D24A 3ECQA 1GJUA 1RP9A 3VDBA 1C3FA 5D8ZA 3UG5A 3W24A 3W81A 3KZSA 3GM8A 4PMXA 2F7PA 1E0WA 3POHA 1BPLB 2OSYA 2EPOA 1B1YA 2EXOA 2DT2A 2EO7A 5FKYA 2NW0A 1GOWA 1VFOA 1DWIM 1DP0A 2CERA 1Q6GA 2OLHA 3A22A 2PC8A 1ZBVA 3ARRA 1FH7A 2J25A 4Z2HA 4CU8A 3VSTA 2JF6A 3ARSA 2CHNA 1CBGA 5A3HA 3EJUA 1R34A 2ZXQA 3CTTA 1ZBKA 1L0PA 2XPKA 4CD6A 3EJPA 2BS9A 3POCA 4J7RA 2WMJA 4DUWA 4OBSA 5A6SA 3SCRA 5CZKA 4M56A 1GOKA 4NF7A 2JEQA 5GNXA 2QPUA 1BAGA 4J3XA 1UQYA 3VKKA 3ZT5A 3CUHA 1DWJM 4D6DA 2WVVA 1XCWA 2PF0A 3IJ7A 1CTNA 1C8QA 2XFYA 1JI2A 1UD3A 3B8SA 4U3AA 2BVTA 2WVSA 3UG4A 4ZXLA 4H8VA 2DSVA 4Z2IA 3AMLA 3AHXA 1R46A 3CPUA 3D52A 3N12A 3VMNA 1HJWA 2IUZA 5M5DA 4FF5A 3NSXA 1V02A 1PX3A 1UUQA 3BAWA 4FLOA 1ECEA 1B2YA 4UCFA 5A8OA 3BAYA 3K8MA 4PTXA 2ALWA 1GUVA 1O7AA 1HJXA 1FOBA 3HG4A 1TFVA 1JDCA 1SZNA 3WD1A 4JHOA 3KWXA 3AS3A 1B3VA 2J8GA 1R86A 2BNJA 5BWFA 2UY3A 4N0RA 4LYRA 5JBEA 2QMKA 1C92A 1KGXA 2FH6A 1AQ0A 3CZSA 2ZUMA 3GBDA 2EPLX 2WSKA 3MANA 5IFPA 3KEHA 3UCQA 3BLBA 3HN3A 2AAAA 3I3DA 2A3EA 5A95A 4GI9A 1UOKA 2W66A 3MMDA 1UZ4A 3MMWA 1A3HA 3AISA 4P8VA 2EQDA 2OW7A 3BCDA 1E9LA 2CNCA 4GPNA 1PJ9A 2PWFA 1UYQA 4U5IA 2F7RA 5BYWA 3UR7A 4YHEA 4TOQA 4MJ4A 2RGLA 4Z2JA 3PZIA 3KLKA 3AOFA 2EACA 2ZUUA 4ACZA 3WBAA 1WDSA 3MV11 1JZ6A 3OGVA 3IK2A 1K9DA 5CPQA 1XV8A 1QVBA 1QNRA 4K68A 2YL6A 1BYCA 1MW2A 3LPFA 2OSWA 4XZWA 3SUWA 3A24A 5JIPA 1JXJA 3VDAA 2YL8A 2BY0A 4B9YA 3AI0A 3NDYA 1H49A 1RPKA 1LL6A 1UKQA 2BVDA 2ZX8A 3CMJA 2XWEA 1X6NA 3AYSA 1WP6A 4Z2GA 4ZXOA 3EDJA 3VIFA 3TOPA 4WF7A 1BGGA 4B3LA 4IPNB 1JZ4A 2W92A 2VVSA 1GCYA 4BA0A 4W89A 2ZWYA 1ZL1A 4J3SA 3T2OA 1ISVA 3QGVA 4J3TA 3CUJA 1QW8A 1XSJA 3BVXA 3PTKA 3K8KA 2J4GA 3RJYA 3PZQA 1E72M 2DGAA 2J74A 2GSJA 3UERA 4JKKA 1UZ1A 1E3XA 1PZ3A 5IDIA 3AHTA 2EJ1A 1FHDA 4W85A 4MTVA 3WKZA 4AIUA 5A6LA 2PI6A 2WBGA 3KL0A 2J7GA 1TG7A 2CBUA 3TTYA 3HG3A 3AS0A 4KRTA 2G4FA 2QV4A 1E6PA 5EBAA 3N18A 1QNQA 5CPTA 1E15A 1MXGA 4FNRA 2YLAA 1HL8A 2W67A 4D1IA 1JNDA 1E6NA 2WHKA 3ALGA 3W0KA 3WY3A 3EMZA 1HKMA 1HJSA 1VENA 4GINA 5A6JA 2FH8A 2OYKA 5DMYA 1H0GA 1JNEA 3PBGA 2XFFA 1MW0A 1XH0A 1W9XA 1W91A 5ABFA 4KWUA 1V6YA 2IXUA 3G6MA 3AIUA 1BGAA 3W6LA 2V5CA 4AD3A 1RH9A 4P7OA 4LQ1A 1E3ZA 5I79A 4UQ9A 1E4MM 1V6WA 2VZVA 1EO5A 4F9JA 4MNKA 1BLIA 4GO9A 1PIFA 2WVVB 1G0CA 4GXPA 3PN8A 1Y7VA 1H41A 1J18A 2CCRA 4JKLA 1JF5A 2XSBA 2HVMA 4WIWA 3PZMA 4X0VA 4F66A 2YBUA 1L8NA 2WVUA 4W8LA 2D1ZA 4M29A 3RMEA 1EDGA 1NM9A 5DT7A 2YFOA 1BYBA 4UFMA 4AZCA 2D0GA 3CZ8A 3W29A 1H1NA 3RM8A 3VIMA 4FNSA 3EMQA 1LF1A 4PEEA 1FHLA 3W25A 3VOCA 3L4ZA 4D72A 2VX4A 4E2OA 1GHSA 4FNQA 4E8DA 1NP0A 3WNKA 4J3UA 2X8RA 3PZTA 3DX2A 4E4PA 4MPKA 1K9EA 1W3JA 3I3EA 4LYQA 5A6BD 3CZKA 1CLXA 1KCLA 4TXEA 5GPRA 3VGBA 1JFXA 3UESA 2PBOA 1W9PA 2GFTA 3WQ5A 5IHSA 1EHAA 3GXFA 4KGLA 4QLJA 5A6MA 3BAXA 4KGJA 1PPIA 3AZRA 2EPKX 4HP5A 2DIJA 1K9FA 2WB5A 2WLZA 3WQ8A 3VUPA 2Y4SA 3IJ8A 1WB0A 2GVYA 1G9HA 2X2IA 4NRSA 3RDKA 1IZKA 3WBEA 4MNLA 5CLTA 1PAMA 3S5ZA 3MU7A 1BYDA 1E71M 4NX0A 2NSXA 4IM4A 1GONA 4GQQA 3CV5A 1GVYA 1KBBA 3VD5A 4DO5A 3WUFA 3SUTA 2FGLA 1EQPA 3UEQA 2CKSA 3M46A 2FHBA 5ABEA 1KXTA 1WZMA 5LA1A 1KR0A 3CUFA 1XYFA 3MUAA 4D1JA 1JDDA 3BMWA 2VR5A 3EBVA 1TQVA 1WDPA 4AMXA 1H3GA 3GNRA 2ZXDA 3EDDA 5E0CA 1V6XA 3RJXA 1I1XA 3VO0A 1ESWA 5JBDA 2CPUA 5FIPA 4PYSA 3F4VA 3AS1A 2DPEA 2J75A 5HOSA 3WN6A 3VX0A 1V6UA 4PCTA 1U30A 4M1RA 3WEOA 3T09A 1VFMA 2FGZA 4AIEA 1GNXA 3MO4A 3N04A 3IAQA 3EDFA 1UD6A 1H4PA 2G3NA 4TUFA 2GK1B 1QI0A 2MANA 4U3CA 1DWHM 1MQQA 3ARZA 2QLYA 3BUIA 3W27A 1KTBA 2F1BA 1YHTA 4ML4A 3ZR6A 1IZJA 1MYRA 3OGSA 4PMZA 3SCVA 4DWSC 1S46A 1BF2A 5I23A 2VRKA 4B15A 1MFVA 2X09A 4WKAA 5AC5A 2YDSA 1KQZA 5BXPA 3HZ3A 4MAZA 1QNSA 1NWSA 3DECA 2ZXAA 1UKTA 1MQRA 2D0HA 1B31A 3PZ9A 4A4AA 2OWWA 3VSVA 3OLEA 3F5KA 2OYLA 3AIVA 3ARPA 2ZUTA 2QHAA 4H41A 5BROA 5AC4A 4NSBA 1CXHA 3DX0A 3RO8A 2RGMA 5BRPA 4JFWA 4P8XA 4J3WA 2DT1A 3II1A 1DWAM 1NARA 2Q8XA 3ARWA 4XZBA 2BV9A 4ZFMA 4CN1A 4AY1A 5I5RA 4JHZA 1B3WA 1GZJA 4CD5A 1CGVA 5A1AA 4U2YA 1OBAA 1CDGA 3HU7A 1FP8A 1SFSA 5ABFB 4N42A 3HG2A 2V3GA 1BVNP 4WKHA 1JZ7A 2ZOXA 1OB0A 3L4VA 3VD7A 1CENA 4PSRA 3PZOA 4W87A 1WNOA 1CGWA 4JCLA 3WD0A 1UKSA 1GW1A 1UD4A 1JG9A 1VJZA 1CXEA 2ZUWA 3ZSTA 3A23A 2J7CA 3WEZA 3A4AA 1V3HA 2EBNA 1E0XA 1R8LA 4PMRA 2BHUA 1AVAA 1ISYA 3BC9A 1M53A 5A94A 4B3KA 1E56A 1G94A 3LXAA 1QHOA 2VL4A 2ZUSA 1AMYA 5CQ1A 3LPOA 4EE9A 4JCMA 1OGSA 1UR8A 2C8NA 5D4YA 3QHMA 3HMCA 3WNPA 3WY1A 3SCUA 3VM5A 4AD5A 1UD8A 1ISWA 4HA3A 3VIOA 2XM2A 4TVCA 3ZJ7A 3DDFA 3EDKA 4ZE4A 4X0NA 4MJ2A 2J62A 2C0HA 2V3DA 1V3JA 1ZBWA 1EA9C 1HKIA 8A3HA 1TVNA 2ZUVA 3MKKA 1XRVA 1W3HA 4URIA 1U33A 4AZ7A 1AQHA 2Y8KA 3FY1A 7A3HA 4OIFA 4CCCA 4ZE5A 4KH2A 3AIWA 2O9RA 3WDIA 2E8ZA 3H53A 3QOMA 1UD5A 1FP9A 5D9OA 3T2QA 3TONA 2XIIA 1OD0A 3K8LA 5I6SA 1XHGA 1XCXA 3THDA 1US2A 4A3HA 2VO5A 1TQTA 4CD7A 1E6SM 1ITCA 4D6CA 2OWXA 3WY2A 4JL1A 3AIRA 3ARVA 2XGIA 3WF4A 3F5LA 3L4TA 1UR1A 2WC7A 3BCFA 2VX6A 3ZJKA 3RPMA 1HKKA 1UR2A 1V3IA 2VURA 2PBGA 4MNJA 1HTYA 3ZM8A 5JIWA 2V38A 2W5FA 1ZJAA 3SUVA 3TA9A 3LPGA 1E4IA 1BTCA 3CHCA 4LYPA 4PMQA 3DDGA 2VJXA 3GZAA 1PBGA 1TR1A 2WMGA 4E8CA 4P7NA 4JFTA 4W84A 1TQWA 3B9EA 3SEPA 4CCEA 5HPOA 3WD3A 1CXFA 4GI8A 1IT0A 1K9TA 1OSEA 2WK2A 2CBVA 1GHRA 1J10A 4J27A 2D3LA 1Q6EA 2CBIA 5D9PA 4AD4A 4CU7A 4DO4A 2D0FA 3S5YA 1UKPA 4W93A 1EDTA 1ZU8A 3PZVA 2X0HA 1XH2A 1MW1A 1W32A 1WE5A 2XVLA 1JDAA 4BS0A 3VMPA 2J78A 1XSIA 1E6QM 1HXKA 1XC6A 2E9BA 4QFUA 4DWSA 4PMYA 4PRWA 2W4XA 4TVUA 3CHDA 3OB8A 1QNOA 3A4WA 3W53A 1QWUA 3N13A 4HPHA 5A8QA 4DUXA 3ZOAA 2YDRA 1GOIA 3GNOA 1JD9A 4D71A 5HBFA 4H8HA 4JIEA 1CGTA 4NXKA 1CECA 3WFLA 2CESA 3D51A 1ODZA 4HPGA 1J0YA 2WANA 1NQ6A 2NT1A 2DDXA 2J77A 3OIHA 2WC4A 3D50A 3T08A 8CGTA 3ZIZA 1TA3B 1E55A 4UOJA 3A21A 3N1AA 3LX9A 2G3JA 1OD8A 5AYBA 4UOQA 1GJWA 3NIYA 1V0LA 1SMDA 2X1IA 3NJ3A 4FNPA 3WF3A 3AS2A 3DHPA 4D6GA 1DHKA 3CIVA 4TTUA 2YFNA 3WDHA 4UR9A 3VSUA 1HP5A 4FLQA 3ZT6A 2CBJA 4NXSA 4AEFA 4BQ3A 5A8NA 2X2JA 4DM2A 4U31A 3N9KA 3WQVA 1TCMA 4HU8A 4QLKA 2E3ZA 1LLOA 3G6LA 1CYGA 3T2PA 1MQPA 1PZ2A 4CN4A 1XD0A 3WMCA 2D2OA 1AQMA 1RP8A 2XJ7A 3WDQA 3WIJA 4V2XA 1DEDA 2TAAA 5E9AA 2Y8VA 3AXXA 3L4UA 3BLKA 2OWCA 1H11A 5D9MA 1G01A 2J7BA 1HJQA 3OG2A 1V3MA 4XV0A 4ATWA 1SYTA 2J8FA 2GJXB 5CJ5A 2EEXA 5EFFA 1HT6A 1C7TA 3AROA 3VIPA 2VC9A 3SCNA 1F4AA 3OLGA 3VGHA 3ZQ9A 4ZEPA 4FMVA 1W9DM 1OWQA 2JALA 2WHMA 3CBWA 3VGGA 2WC3A 3UG3A 1FH8A 4YHGA 2UWFA 4AC1X 1E6ZA 2X05A 4OJYA 1MXDA 2Y2WA 1QI3A 2WVTA 5HNNA 1OCQA 2F61A 5GNYA 3W26A 1D3CA 3AIQA 3QHOA 1KGWA 3AIBA 4AD0A 3HG5A 2BXZA 2E40A 1GORA 3CZJA 2J7FA 4M80A 2XVPA 4ATLA 4EKJA 5A6AA 1QBAA 2F8QA 4CD4A 1UWQA 3EJQA 5E70A 3WY4A 1YQ2A 4UNIA 3ARXA 3RILA 3VGEA 3L2LA 1VBRA 3VD3A 3WF2A 4TX8A 4C7GA 3KL5A 2WKGA 1J0KA 1V3KA 2J7EA 1C93A 1E0VA 1GOOA 1NWRA 4RE3A 4W8AA 1WPCA 4UZSA 4HTYA 4Q7NA 3GXTA 4PTWA 1CPUA 1QI4A 2WZHA 2D22A 2ZWZA 3A3HA 4W7VA 4WKFA 2XVNA 1UR4A 3LMYA 3DX1A 2XSAA 1JF6A 2ZICA 3ZSSA 4RE4A 3KLLA 5FL0A 4PUEA 2YL9A 1XSKA 5E1QA 3SCQA 5F7UA 1QBBA 2QMJA 1UASA 2BY3A 1QI2A 1FFQA 1JAEA 2WXDM 2D20A 1W9UA 3VX1A 1PS3A 2CXGA 1KWGA 3S2CA 1NP2A 3WSUA 4BCEA 4FLSA 2HISA 3WL1A 2WMKA 4AZBA 4MADA 3O6AA 4AYSA 1RD6A 5E0FA 1OGGA 4OGZA 1UHVA 1JZ8A 1HKJA 1GQKA 1ITXA 4CD8A 1J9YA 2E8YA 4V27A 4XB3A 2J47A 1LWJA 4W7UA 3B9DA 1UH3A 2F7OA 1ISXA 3DYOA 3VNZA 4QLLA 1C90A 2PWGA 4P8WA 1WKYA 3CUGA 5BXSA 1BHGA 4ACYA 1E43A 3GH4A 4M24A 4DM1A 1JFHA 4CCDA 1UWIA 1KR1A 5E09A 3FHAA 5C70A 4LXFA 4HU0A 1KBKA 3BUDA 1V08A 1W1TA 2E9LA 4PN2A 7CGTA 4DWSB 5CLWA 2XFRA 3SCPA 2YLLA 1UWRA 3VMOA 2F1AA 1TQUA 1CZ1A 3MSDA 1O6IA 4GI6A 3TTSA 2B31A 2A3HA 1WO2A 3T0DA 2XN0A 1WZAA 1TMQA 1B90A 4WLCA 5A8MA 1JL8A 3K1DA 1FA2A 3GXMA 1EOKA 3D4ZA 3GXPA 3CUIA 4ACZB 1F4HA 2WKLA 1B0IA
chains in the Genus database with same CATH superfamily
3M16A 3N2MA 5LKYA 3H4GA 3HZYB 1A7PH 4DGUA 1W37A 3MLSL 5EN3A 3PGFL 1TTCA 1QACA 3ZKMD 3ITOA 4Y9BA 2WV8A 2PPFA 4F7PA 3ULAB 3T6VA 2GJZB 3GLEA 4WGKA 5KYNA 1BFNA 5FGBA 3WD5L 1FL3A 4G5ZL 4ICCX 4DJDA 1VGKB 3RWDA 1CD1B 2AV7B 3L3KB 4O19A 1CBVL 4O8AA 4ODBD 3K4DA 4TUJB 5DHEA 1GKQA 5C0FB 5BXFB 5M3WA 4JQXC 4FEMA 5AUMB 1TQBB 5D2NE 3UJTH 3QRLA 3WHXB 2W9LA 3IE9A 3L3HA 2HRWA 1BM7A 3T9PA 1ZOXA 4O14A 3UTOA 1XLGA 2C14A 4BH7B 1JQXA 3ZTDC 1WA3A 1E0UA 3BZEB 4CGTA 1G7QA 4L3AA 5ETUA 4PJAF 5EG6C 3RVVD 2Y1HA 5KYUB 2X4TB 5HHPA 2D4FA 1WT5C 3AQUA 4S10A 1KO0A 4WK9A 3LHAA 3ABMB 3LH8A 2YEVB 1EP2A 4FXGC 4M7TA 1T5KA 4H1LH 4Z0SA 1FN4A 2DYPB 4G8FA 5KSAD 4J3BA 1QNZH 1IGJB 3W01A 1FV1B 4LUSA 1W5NA 4BFOA 2HFEB 3IRDA 3UVIA 2WXOA 4BQ5A 2BOGX 4TLUA 5B4MD 5KYYA 4XCYA 3RPDA 2JJUA 5D6DA 3LKNB 5EIVA 2B81A 1QTPA 1L3NA 1ROWA 1DLHB 2W95A 4P5RA 1U3ZA 2XQBH 2NQHA 2QF7A 3DJZA 4PGBB 3OKKB 1KXVA 3WNMA 4IMGA 2BNUA 4G8GE 5EHFA 3UT0A 4J6RL 5G4NA 2QDEA 1IQ8A 3DDMA 3OQ8A 1MF2L 5GQBA 2W61A 1MVUB 2DTSA 1F6KA 1RZJL 4HZ1A 5DZ9A 3TBSA 2WWMD 3CU1A 5AY7A 4UILH 1I7RB 4QHLB 1EFQA 1MSPA 2CIPA 3GTFA 3QUXD 4ODVL 3W56A 1IGML 4AQ8A 4K9JA 2NCEA 2V2HA 1FC2D 3W2DH 4AE0A 5HPMA 3VRLE 2WWNA 1ODUA 3IUHA 1K5NB 2QVHA 4GRMB 5JHMA 2J5LB 5FJRA 7REQB 3W39A 3AG1B 1P0NA 2J6WA 2POTA 1JPGA 1Q0YH 3O6YX 1SFTA 3STEA 1D6EA 2HJFA 1LRQA 3AB0B 4L1DA 1KTDB 1HX0A 1XIIA 1QWNA 1CUOA 3W1TA 2FSEA 4OBRA 2EKJA 5E9XA 2XFGB 2APFA 3RPKA 4PMVA 5KTLA 3ZJ6A 1W3LA 4ENLA 3EX3A 4D3CL 4HIJA 4A3YA 4NT6A 2AVGA 3ZE0B 3PANA 3JTSB 4XZUA 4MNQE 4X22A 3UP6A 4DSYA 2VUYA 2Z28A 3NOIA 2CETA 3THQA 5IF0B 3T2LA 3AAMA 4XE5B 3FVMA 3NPUA 1MFCL 3GZ3A 4HQVA 2I5IA 3QJHB 2OCZA 1JTTA 4AHOA 4MZ8A 1RU9L 2APXA 4B3ZA 1DJZA 4H8WH 3U6RB 2FX7L 2ZADA 5KSUA 2CWNA 1IAMA 3DVNB 3FYPA 1SDAB 4ZX3A 3FJ4A 2WLKA 4XRCB 3QKEA 4I1NB 1EAJA 5TFSL 4F79A 4XIAA 1E4WH 1VCBC 2FYYB 4IRJC 2IH3B 3O1NA 2RFXB 4LYKA 5C9WA 5DJXA 3OO2A 1T7LA 4FQQA 3IRSA 3HI6L 1QK0A 1HNYA 2VDMH 4X83A 4ETYA 2P3ZA 2LW3A 3GXUB 5FYKU 2NMSA 2QSTA 2J9YA 3GXIA 4JHWL 2CLEA 1C5BL 3RHGA 2QHLA 4GRLD 5GGQH 4YXLL 4NRXB 2PTXA 4FX6M 2A0LD 4ZUWB 4E9SA 4BKSC 2H6PB 3IXTB 4G8EB 1II4E 3PY9A 1X6LA 2CHWA 2AQQA 1J01A 3S9IA 1UJPA 2VABA 1ONQA 3UDWA 4QUOA 2A7NA 4WW2B 1OW0A 3LS5L 4CQDA 1E5ZA 5I6LA 2V8LA 4JDTH 2WTOA 3U0PA 5ESVA 1HC1A 3BZFB 2A6KB 2EDDA 4MQ7A 4JZ5A 4LF1A 2NR6C 5HQEA 1TO5A 4Q6KA 4XN5A 4US6A 5C2UB 1BD2E 5HATA 2XY1A 4JNZA 1S3KL 4G2DA 1KZYA 3EYFA 7PCYA 5MEOB 4U1IB 3BWUF 5BV7B 4OIBA 3DBSA 3G9VA 1H2JA 3ULSA 4JLRA 4E6MA 2BFVL 1PV8A 1Q6DA 3FT2A 3VB8A 1DFXA 4ZYKA 5TE4H 5T3ZD 4XZLX 3P81A 1GC1C 2A85A 1LTDA 4XC3H 9PCYA 4AGLA 1TZHA 1EIXA 3G6AB 5FL1A 2R4SH 3EKZA 2A9ML 4CVWA 4NRRA 5HPCA 3FU6A 1T3FA 1W2KT 4PJEF 4IKNA 2F6UA 5F9OH 4L37A 1EXUB 2WWDA 1F6FB 3ZY7A 2Z1SA 3DSNB 3WIHH 4AWSA 2O6EA 4XD6A 4C6PA 4DT2A 3SDAA 4V15A 4FIRA 2RALA 3H12A 3LZLA 3W2JA 5EMJA 1OCCB 3QIWC 3DOSA 1XR2A 4G8IA 3ZL4H 3FYOA 5D1ZC 9CGTA 3WZ0E 1TX2A 4R7DB 1CN4A 4B5TA 3PZNA 2FIKB 3MRIB 1ORSA 2WZTA 3T0EB 4GKNB 5GSRB 3UBXB 1HDMA 1YQVH 5MERA 4YBLB 1UYWL 4NQEA 2X4OB 5F6IB 2ERJC 4B7IA 3PG8A 5PCYA 4YN5A 3IVSA 5C0GA 4WV1C 3AWOA 3WO3B 2PDUA 5T5FH 4PCYA 4LEBA 4LGXA 1XAKA 1OQOA 4WUUB 1PYFA 4UDUA 5B1KA 3GM0A 1DVZA 3IMSA 2FX9H 5EOQH 2ZKHH 1AE6H 2IAND 4MA1C 3GDBA 1A49A 2VTFA 3IFLL 1DTUA 3SIKA 3OBKA 2F84A 4M51A 2A4ZA 1VBHA 3NPVA 5H2BA 2NUYA 3I2CH 2JTDA 2WAGA 3GJFK 1TUPA 5D7IA 2JKEA 1NCAL 3KGRA 5GIRB 2VDLB 3GMNA 4PR4A 3WFEL 1EP3A 3V0WH 1RZFH 3JVGC 1XYAA 4JPVH 4N2FA 5I6KA 4A04A 5CZVL 2X0VA 4OJDH 2NDGA 1MUMA 2MNWA 2DZWA 3B2UD 2LLLA 1QSEB 4NN7C 5AOIA 3E9AA 1FH7A 4HQQL 4ZS7H 1R6VA 3ZU8A 3MY9A 1KN4L 2XN9A 3EYSH 3T8XB 1L0PA 3EJPA 1TJGH 1YEIH 3Q67A 4IKKA 4P2QB 1UQYA 5IREA 4PWJA 4XNAA 1QNIA 4M6UA 1HZLA 2WVVA 4X98A 4JREC 3NRPA 2X1RA 3N2CA 4IBUA 3ARFD 4QRUA 1T2XA 4RPQA 4KDTA 4NZRH 3B2MA 1H19A 5JDSA 4LCUA 4TLSA 3RTQB 4AV4A 1OE2A 4P5MA 1A6AB 4PRNB 5LBVA 1NBQA 1D5RA 1JPSH 2E7MA 1N12A 4A2FA 3KYOB 1BKHA 4N2NA 1T22B 1S9YA 2E5CA 3PP3H 4TMCA 3B8TA 3N2BA 2BNJA 5BWFA 2PMQA 4PTDA 2GYSA 4DGWC 2VEKA 4P2VA 2OYPA 2Q86B 2PW2A 4QG8A 4YHKH 2P45B 4YEEA 5LIYX 2W66A 3QR2A 4NBZB 2VLRD 1QBLL 4YX2H 3AISA 3BCDA 3EYQC 2M8XA 2NY3C 1OFDA 4KPHL 1WIUA 1G7QB 1BDYA 5ETUB 4OT7A 2XG4A 4PTUB 4N0YL 1K9DA 2QHRH 5KAQF 5HHOD 1BAWA 3C09B 3SCMC 1PD6A 1BYCA 2OSWA 4XOEA 4IM8A 3O3AA 3NDYA 4KMTH 3WS3A 4XD4A 2NY6D 4ZXOA 4LS0A 1FN4B 4B3LA 4L4MA 1QVOB 4G8FB 1KIUB 4IFRA 4YDLC 3WNJA 1CFBA 1GAFL 1SPQA 1I1AA 1OCNA 3BVXA 3LQLA 1OAJA 3QT2A 3QDJE 4MFDA 5ICXA 1XAUA 2EJ1A 5KYYB 4XCYB 4FXLA 1V7YA 5B8CA 4G9DB 3BQ5A 1FWWA 1ZGDA 3H9SE 4B50A 1JRBA 1G1CA 4UBDD 4OZHF 2VRAA 2RH0A 2WQSA 5KN5A 4LU5L 2JNZA 1LZOA 2W0KA 4BF5A 1F4YL 4DERA 3KOXA 2OBGA 4EPBC 2NV2A 1HJSA 1VENA 3CIWA 3F04A 4PRID 2BNUB 2XFFA 4PJIF 3O05A 3HGRA 4AMKL 4MAUL 4Y5VA 4WFGD 4RGNC 1UADC 1V6WA 3SB3A 4AKOA 1T5AA 4DI8A 1DIEA 1DQKA 3ULUL 1KLUA 4JKLA 4A6YH 5AAMC 4UFMA 5F4WA 5HPMB 3VI3E 4PP1C 3EEZA 5I8EA 1TQCC 4N8UA 4JPKH 4Y1AA 1V6TA 3JWOC 1QR1B 1MIMH 4DNLA 1D6EB 3UABA 3AITA 3CZKA 1JEZA 2HJFB 1DQLH 2VDPH 5E8PA 1NMAH 3BN9D 2A1WH 3Q5TA 1IGWA 2G3ZA 4MMYA 4D9QD 4JO2L 2YPVH 5DVMA 3SBRA 4UUJA 4O0ZA 4I85A 3WTXA 3KUMA 1RA0A 2NY2D 3KYAA 1CG9B 4IM4A 1F90L 1XYCA 2FB4L 1WBZA 3TBTA 4HIJB 2XH7A 4LRTA 4NT6B 3LTYA 3CUFA 4U4IA 4WI9A 5C6WH 5SX4H 1AKJB 3G6JE 2HS8A 1EYWA 1J5IA 1MJ7H 2C19A 1NEPA 4RMBA 5LXGL 2BG5A 1RZJC 1YX1A 5EU7C 2A0NA 5C0EA 4JIIX 4LOUC 4Y89A 3QRGL 3NURA 5DVLA 3BP6A 1M56B 3NZHH 2C16A 1IAKA 1WA1X 2DVTA 3ME0A 4BCXA 1M7DA 2D7TL 4RZKA 1UWXH 2DJ4A 1ZUAX 3V0DA 3MGOA 4QYOA 2XA8L 3HTLX 1KFLA 4A4AA 1Z6JT 1NC2D 5DJXB 2APVA 3G1FA 1QSFD 5LGHH 3LQZA 1F61A 3M64A 4ONFH 4H0GA 2DL2A 1MI5E 3RO8A 3RJDA 1DWAM 3O3DA 4XCCH 4C55A 2WBXA 5F1NA 3TVAA 4HYWA 1M42A 1J8RA 1NGQL 3OPZL 1IGIL 3V6ZB 4PN6A 2ZOWA 3SGUA 4OQ1A 3DGBA 2UWEE 2FZDA 1TVBA 4WFED 4W87A 5CEWA 3W7PA 3BD4A 5HGAB 4ZAKC 1OJXA 4L8SB 5F1OB 2VABB 4Z7NF 4OW6A 1AVAA 4YO0A 2AJZB 5T1KD 3DGDA 4UINL 5ESVB 3VI2A 3CHSA 4LCIL 4DWHA 4GLEA 1SXCA 4TVCA 3QDJB 3EYFB 3V7MA 2G50A 2J8HA 4MJ2A 2ENPA 2RHEA 2VSCA 3H9SB 4ZFOB 1CF8H 1CJYA 4JLRB 5CS7A 1JHKL 4PD4J 2WJEA 1YO4A 4ZYKB 2BSCA 4ILDA 1MFEL 3ZHNA 4WZ9A 3KP1A 2E5DA 2EG7A 2O93L 2YXGA 4P3DA 4NWUL 3QUYD 1UWGH 2J88H 3B4YA 4QE5A 3LSOB 3U1QA 4NM8L 2GIMA 1L6FA 4E42B 2UXTA 4MXQC 3CAVA 1YDVA 3HIJA 1D6VH 3UFYA 1KOAA 3MRNA 3DUUA 3PHQB 4W9DC 3L9RA 3EB2A 3UXIA 5AZEH 1AZUA 5F7MC 3W9ZA 1W31A 1WGOA 1YADA 1DQMH 1ZAIA 4YR6A 5HPOA 4NQ1A 1XISA 2ZA3A 1D9KB 3FA3A 3GB6A 3QFWA 1WBHA 4LVBA 4ZSTA 3DOSB 3N1PC 4G8IB 4F8PA 3T8LA 1H9DA 1OFPA 4QNEA 3WAKA 5F44A 4DPPA 4QX4A 1LUCB 1UB6A 3BLIA 1ORSB 4Z7WF 4LDCA 3P11H 4YHZL 4H7ZA 4DUXA 1DJSA 1XL6A 1HILA 3L5IA 1IAIL 2A6IB 2C1PA 4CQAA 3WLQA 4MD0A 1X97A 9XIAA 3T0XA 3SY5A 1W72L 5C7ZA 3W71A 4ZZ9A 1SGJA 1CB2A 2C9SA 3WF3A 4UDUB 3ITCA 4GQ9H 2H3NA 1KEGH 5DLMH 1RK0A 5JW4Q 4Z17A 3ZUCA 2R0WL 4UTWC 3MCLL 1XD0A 1QPOA 3WMCA 4TOYL 2XJ7A 4HS6B 4JO1L 1HJQA 5D7IB 1KFAH 2WXGA 1DSFL 4KKLD 1GYUA 3ZQ9A 4FMVA 2ZZ3A 1SJCA 4C6CA 3V0FA 2I07A 1XZ0A 3DFQA 4B5UA 3U25A 5JHDA 4PIRF 5KVEE 4JDYA 4TVPE 1T40A 1JRHH 2BXZA 2ILLA 1JBJA 3RWIB 1E9QA 2GCYA 4AX3A 2YAEA 4TSCL 3SPJA 5E70A 2H8PA 4KJPD 3U7WH 4WTZG 4C7GA 3VXME 1A5UA 4RE3A 3TNNB 4N28A 3FUEA 3TZVD 4WHYG 1C08B 2WZHA 3MX0B 4ABWA 4Z3IA 2B1OA 2XVNA 4G3YL 4X98B 2XSAA 4BUHA 4UWMA 3LV6A 3TJHD 4QRUB 2ALRA 3WXWL 2RQEA 1EEZB 2AVFA 3G0SA 3U36A 4AC7C 3VX1A 4LCUB 1GTFA 2NUPA 4KJYA 3MJWA 4P5MB 4Z7QF 2YCJA 4I5RA 4HWBL 1AODA 1J9YA 1RK6A 3M0XA 4DJEC 1EANA 4WRLA 5A7BA 1U95A 2VQ4A 2VGBA 4EIGB 2JQAA 1IGFH 3MYJB 5B38A 4PJ9B 1J5TA 4G43A 1L9NA 1S9YB 3TWAA 2W59A 4ACYA 5D1XA 1X38A 2DP3A 4ZQOA 4M24A 2V2XB 4QTGA 1JFQL 4ZBJA 2HUHA 2PW2B 3QQ9C 3FS9A 3QEGH 4LCCC 3VMOA 2A5HA 1SW0A 4HH8A 3MDJA 4XXCA 1QABA 1FAIL 2OK0L 3QXBA 2NNAA 3MRLB 1GZQB 2R4RH 1R9FA 3VWKB 1F4HA 2WKLA 3DIVA 2APBA 1TVPA 2EDNA 3P82A 4PVNA 4Q4EA 4LKXB 2BXYA 5CCHE 2IXVA 2R2CA 2A9NL 4Q2ZA 3D85A 1Y0LB 2UYLA 1OSPL 2YD9A 5KVGL 4GBXA 1X5ZA 3QZAA 5AVTB 1OGAE 3IMUA 1RH8A 3APDA 4JNXA 1LQ2A 1Z9AA 1GKRA 1GY2A 4MXVE 3U7YL 4XMLL 3ZWTA 3X3GH 1W9BM 1VS1A 1I1AB 4EP8C 2PODA 2FWLB 3U30C 4L4OA 1JPST 6XIMA 3U2EA 1XGRA 2F5BH 3U2SA 2H0FA 4TNFA 3T1GA 2XWZA 4M7ZC 4ETQB 2IWGA 3TT1L 2ADGA 2CGZA 4PJBA 3IDUA 1TMHA 1JI1A 4XP4H 5I73C 2JKNA 1N18A 3G1XA 1VEPA 3KLQA 2IKIA 1QHZA 1FVPA 3N17A 3CSTA 4X4ME 2I24N 4ES4A 3E9UA 3H4FA 4LMQI 3QNZB 2CUAA 4M93C 2XTKA 1TFHA 3H23A 4CVZA 4Y5VB 1LL4A 4AISA 3WE6A 4ZO9A 4U2ZA 4FERA 4YSTA 4V1DD 5HJYA 1FH2A 4HS8L 2B0SL 2DJUA 3FNDA 2OX5A 2P48B 4KZCA 2XH4A 4RMUA 2BVQA 3DRQA 1KLUB 3GSQA 1O7SA 2YL5A 1DUYB 1AOHA 2UZXA 2YXWA 3TAKA 4HBKA 5I8EB 4ZG1A 4XPGH 3JUZA 1KFKA 3V8CA 3CZEA 2V5TA 4L3CB 4J35A 4LGRB 2OAAA 4Q97A 1UPMB 4YVNA 4XZ4A 1TEGA 3AGWA 4OLUL 4UB9A 2ICSA 5BZAA 1DJXA 4I0PD 2Q2EB 3QIBD 4K3DH 4MOZA 3NA4A 2CLVA 2VT0A 4K9EC 3MZTA 5L8JB 1TDQA 3P60A 2FJFB 1US3A 3TBTB 2EGZA 1LG1A 1TSIA 3VXMB 4LWWA 5KZMA 1A47A 3EXTA 2ZWNA 3LCYA 3CXDL 4HK0A 4O12A 2APWA 2GBUA 1P48A 4S3JA 4YC2C 1YTEA 2WZIA 4HNLA 3WLLA 5FAJA 4PBXA 2ZBTA 4H1LA 5E5UB 3DHJA 2PXYC 5H4YA 3JV4A 1EX5A 2GLKA 3OLDA 3CJPA 4HUVB 2EP6A 1MFDL 3BWAA 2WLLA 3B2PA 1ZHLA 3SDDC 1NL0L 2ZCHH 1L6YA 1EUUA 4LPTA 1R17A 4R4BA 4QYOB 3F7JA 3ZDZF 1AW2A 3NPSC 2ZCLH 4JMNA 1BW8A 3SZKC 5GGUA 1ZPTA 1Q7ZA 1TTRA 3FTWA 4DFIA 1MHPL 1C5DA 2XTLA 3DFYA 3BXWA 2XI9A 3R0KA 4H9MA 3O3DB 4QRPE 2Q8BH 5KJRH 5F1NB 3IKKA 2V9DA 5FDWB 4MX7A 3L3OC 1KCVL 4X5QA 5GS2D 5I1IH 5D96C 4FQXD 1TLMA 1YC7A 5DHYA 3TJ4A 3N4AA 3VI4A 3MCKA 4UT9L 3MMTA 3LZRA 4YO0B 4TXVB 1E1FA 5IXEA 3AFLA 5J9PA 3PRZA 5DO2C 3D2UA 5HDOA 4JGMA 3PDDA 4DQWA 3NM3A 4Z3JA 4MNMA 2A6JA 3SYCA 1T41A 1HS6A 1QR4A 1K3UA 3FOLB 3QHTC 4LLWB 4QLRA 2EDMA 1S7UA 2QULA 3DIPA 5EFDA 3PQYA 1XLCA 3STLB 3VNLA 4DHGA 2NQDA 4RGOL 3IRPX 5TF0A 3LM3A 4U10A 2OB3A 4XE0A 3WFDH 1NINA 2Y36H 1WC7A 4KRLB 3GTIA 4E68A 5A40E 4NQCE 1EC7A 2RB8A 2RJMA 4PVBA 3EGDB 1XYZA 4P3DB 2FQEA 1AQFA 5C08D 1MDLA 1DBAH 3AWEA 3FVDA 1GPWA 4JAMA 3AU0A 1K1DA 1J05B 3A4EA 2P7TA 2JKJA 3W1NA 3DUUB 5JOFA 1QOQA 3R79A 3UBPC 4HYTB 2Z92B 3DIDA 5CN2A 1H7XA 3KOYA 5HGDB 2IJ0C 3BGJA 2QJDA 2VN3A 5GGTL 3C8HA 1ICPA 4FK9A 3KFTA 4YR6B 1BVWA 1EC9A 2BHYA 4BZ1H 3AXIA 4O57A 4WI0A 2DBLH 4PJAA 1TTJA 1V55B 2O4EA 4YHPB 4ODSH 1OEPA 3ZN6A 2ICWA 2TODA 4HG4J 1S7WA 1AA1B 5CR1A 3SE8H 3GTTA 1OM0A 1IV8A 5C97A 4KV5F 2ZPKH 2C1PB 4PU2A 1NDVA 2TMDA 3TNMA 4GYBA 2JFEX 2VDKL 1PDKB 1SDDB 5DURD 1CGXA 3U2ZA 3HAEG 3PM6A 2WYHA 3OXSB 5FDYA 4F58H 5IG7A 1RCXB 4O2EA 1QPKA 2XZZA 2X44D 5E0KA 1RK0B 5E2WL 1IR1A 2EYRA 1QSVA 2JE8A 3MLYL 1EVTC 4ANWA 3KL3A 5DHDA 1QEWA 2HA1A 1SLVA 2XDHA 3D07A 2OR7A 4Z2LA 1AZ2A 4ANXA 1F4WH 2VNCA 1U8KB 4YLQT 4E2VA 5GRXG 4UV7H 4AGOA 5DCEA 3UTTE 4OWGA 5DD6B 1YDNA 1MCQA 2IH1A 3WL0A 1DVSA 4FNLH 1LCOA 3B06A 1XX9C 3TYAA 4IBLT 3O0FA 2I07B 3O4OC 1XZ0B 1SQ2N 2NWRA 3IFNL 3OAYK 3D3VA 4Y4FD 2TRSA 5K9OA 5L7XL 3TESA 5C9KA 4JGNA 3WLSA 1EDQA 1MCOH 4FP8L 1UBSA 2H8PB 2J8UF 1OP5K 3D39A 1EGZA 3UGVA 4N8VG 1IBYA 4XVSH 2ISVA 1GGCL 3SN4A 6PCYA 4IRZH 2OMAA 3ZXAC 1I9IH 3V6OC 3T2NL 3W86A 3BKML 1ICTA 1XR8A 2Q8LA 1R47A 4FP1A 2RCSL 1T0OA 5CFAA 1J0HA 3AHZA 3E0FA 2VKZG 3SO7A 1XB8A 3G18A 1O5PA 4P5KB 1CEOA 2KZHA 3Q2DA 3STPA 2IQ9H 2RDUA 3LLFA 1FC1A 3U36B 4L4TE 2QEZA 3TC6A 3M7FB 1NAMH 1H8LA 3CASA 4ZMVA 2PGEA 3LGDA 2NUPB 3MRKB 1SF3A 3WIHA 4IRSA 1RUKL 1HHIB 5D8WA 2DQGL 1KCRH 4GZIA 3CO4A 1AR1D 3VJ6B 1MKFA 3IV8A 5B38B 3WF0A 4QAIA 3L5WA 4G43B 1I7TB 3MBXH 3OV6A 3H8AA 1ZK9A 3POHA 4GH3A 5FX3A 5JQ6L 4LLVA 1HNFA 1A3LL 2DT2A 4DBEA 3II3A 4I4WA 4TTDC 3I9GL 4K3GA 1HZKA 4E9LA 1E5BA 4NZTH 5IQNA 1HAUA 1YEGH 2NY5H 3OAZK 2BSBA 5CJXC 2ZXQA 4Q4IA 1ZBKA 1SM9A 1KJ3L 2GTWA 4RZBA 2FDBP 4RDZA 3AU2A 3WIFA 2FJGB 4UQ3A 3VKKA 4I18B 2QGDA 4LVHB 4NUMA 5T5FA 3U1SH 1GTNA 3GSMA 4YWIA 3PWIA 3D7PA 4N87A 4K4KA 1D7KA 2CBPA 1F56A 3BTNA 4FLOA 2LLEA 1B2YA 1TJIL 4ZMLA 4EBQL 5I3GA 2WIIB 3RCYA 2B5IB 3W7DA 1JDCA 3VOJA 4JW3A 4JHOA 2JWYA 3WO4C 1XGRB 3TW6A 2VLME 3AU6A 4ZMYA 1QXLA 3H4HA 5ACMA 1AQ0A 1RFDL 4BFKA 4MZ2A 4PJ8A 1K3ZA 2ADGB 2DZBA 5C7XL 4PGEB 3CSYA 4FC3E 2VJ0A 3MMDA 1KM5A 4TQIA 3ULVD 1NCGA 1SDYA 4U1GC 2OW7A 2Q7YA 3OKDB 4I87A 1GPOL 1PE1A 2V30A 3VUSA 4GAFB 2O6PA 5I17A 3DROA 3H8NA 2DQCL 1U58A 2NQZA 3IMBA 3KLKA 5JZ7D 1XV8A 5T3XL 3OR7A 4CVZB 1B5TA 4GMSH 1GVOA 3WE6B 3NJVA 3AI0A 1OD9A 3K2UH 3OTTA 1H49A 4N5ED 5D1ZI 3HC0B 2HVOA 2OX5B 4MXWL 3DRQB 5H37G 4QITA 3CH8A 1EGMA 1Q7QA 2Y6ZA 4MFEA 1KJVB 2IOIA 3QGVA 2JJTC 4MHHI 3LCLA 3PTKA 3K8KA 3SN1A 4QROA 4MGGA 4YXHL 2WM1A 3BVDB 2PCPB 1DBJL 4PUUA 4JO4L 4WIQA 4PJEA 5D7SH 1X44A 1E8WA 3HG3A 3AS0A 2Y1ZA 5SWZE 3QW3A 1ILUA 2IKJA 1QNQA 3QWNA 2AEWA 3FF7A 3EEGA 2HN7A 1UPPA 3WUZA 1CICB 4UTAL 1M5WA 1CFVH 1MY5A 2CLVB 5A6JA 3K6DA 1B2WH 1Q0EA 3DXAE 1XH0A 4YQXH 2IXUA 2QGCA 3W6LA 4XTRC 5KS9F 4ENZA 2P50A 8PAZA 4HK0B 3K72B 3HPJA 1XWYA 3PZMA 2X4PA 1N70A 3GC5A 4K7PY 3WBWA 2D0GA 4L4TB 1C16A 2O30A 3JV4B 3EF7A 1FHLA 1U3HB 3QUKA 4L7ZA 3NZPA 4XNXL 2W65A 4HT3A 4H20H 4K8RH 3BWAB 1QRNA 5C2XA 4KKBC 4W4OC 2C3HA 4O53A 4TXEA 4UTHA 5EEYA 4TL4A 4M5YL 4R4BB 2I60L 4GISA 3K4WA 2QQKH 3VFGL 3AZRA 2X6CA 4Z8FL 5D7EA 4LKCA 5DT1H 2WLZA 1KTLA 4PRPE 2QQNL 5EEUA 3RDTD 4UTMA 1I8JA 1RBAA 4RX4D 5AAPA 1C5DB 5H2ZA 4HUWA 3ZE0E 1ID2A 3RDJA 1U5VA 2VR5A 2NY0B 4MX7B 4M03A 5D03A 4HJEA 4L8CB 4QDGA 3EDDA 5KOMC 5AL0A 2NQJA 1U3YA 4WDUA 3I6GB 3H3KA 3PWJA 2LT9A 1V6UA 5DMLA 3IAQA 5IVXF 1X9LA 5J9PB 1G7JA 4ATTA 4LCWA 1HCFX 4A6YA 2AMXA 2QVNA 1VADA 1MQQA 3W27A 5I1HH 3G0XA 3KM8A 2A6JB 2ZNXA 1SJHA 3PFMA 4PMZA 4IMEA 1IGYA 4DWSC 1SZEA 1QD0A 3GF8A 2PEVA 2CK2A 4YHLL 3G3MA 1MFVA 1S7UB 1VFBA 3A9IA 2IPTL 4XZHA 5G2WA 3PQYB 2DVXA 2E7CA 3VTAA 4HJJH 4RA0C 5B1AB 1IC5H 3DX5A 4XAKD 1VHNA 4JGUA 2YPVA 1NARA 4WUIA 1B0RA 3T3MF 4XNYH 3BLDA 4Q9QL 4JHZA 1C1EH 4U1NA 5IOPB 3NABH 4JAMB 4YE4L 2PYEA 4ORIA 5F71A 4I5BA 2LTQC 5LBSH 2P7TB 5JOFB 4LEOB 1MFAH 2RR3A 4WK4B 4M7JH 3WEZA 3EO1B 1A0QH 3PWLB 2GL5A 3USZA 1F5WA 4LJ3A 5A94A 3QZMA 3QHMA 3JWOL 4WI0B 4M7LH 3CL7A 4L4LA 4JYDA 1V7NL 3B0PA 2EG6A 4PJAB 4HUMB 3NSYA 2Q8ZA 2V3DA 4FCHA 5AOLA 2XWCA 4HISA 5ADOH 1LBMA 3WJWA 4OQTH 4IQDA 5K1JA 3FY1A 4LS1A 4G6MH 5SWZB 1L9PA 1HEHC 1YJDH 4IBSA 3L68A 4L9XA 4HBCH 3HE6C 4X5XA 4N0UA 3LHVA 1WH0A 5D02A 3IGLA 3JWNG 3PSVA 1OD0A 5JMOC 1XRSA 4S2CA 5I6SA 3TNMB 3WJJA 4U1LB 1US2A 3GK8H 2CW6A 5T33H 3DXAB 2ID5A 2AEOA 3ZJKA 3RPMA 4DN3L 1FNEB 5B7MA 5IG7B 1NSNH 4WJEA 2O56A 1VBJA 2BP0A 7FABH 2OELA 3MODH 1BTCA 4Y9MA 4OZHA 1ZT4A 1A7RL 4AVJA 5ICZA 2HT3D 4FQ2L 5T8GA 4J2PA 5KG9B 1LJMA 3EX4A 2EUXA 4MLIA 4ECNA 2CBIA 4LRNL 1FFPA 1W8OA 3GSRB 4PJIA 3VQ2C 1W32A 4CNOA 3PL6B 4OV6F 4WK0B 1I8KB 4UMGA 3LIZH 4S0TD 3E80A 4ZUUB 3T0EE 3L7FB 3CHDA 4G9FA 2D3VA 5J3HD 5AW4B 5BQ7A 3CN4A 2NTSP 4R0LB 4AM0A 4KKAD 4PRPB 4IIZA 4AV5A 1FWBC 4MUPA 3CVHH 3WTVA 5D7JA 4KFZC 4WUUE 2J88A 4N9OB 3V4UL 4PMJA 3LQAC 3EOAB 2BP3A 1OXYA 3IIOA 1J8HA 3LDVA 5HHXH 2E5BA 5IFHL 3MZ2A 3WQVA 2R94A 5I09A 2E3ZA 3IWPA 4FTVE 1PS9A 1A3RH 1ZVYA 1TZIA 2PMZA 2C1IA 3VE9A 4L6OA 2J7BA 4NSKA 4IRSB 5D1QC 4P46D 1BXUA 3V1PA 2VQ1B 5CZXD 1BZ9A 4NZ5A 2D7MA 3F7VA 3MOQA 1CLZL 3ANYA 3D4GA 2J4WL 5AHMA 3QTGA 2WVTA 2KZWA 4KHXH 1FYHB 1GYVA 3UMNA 3RZCA 2AQVA 4LLVB 2IFGA 2OTDA 1SOKA 1QSEE 3AXLA 5FEPA 3W88A 5FYLH 2EIBA 3T4WA 3SYOA 3GKWH 1XGDA 2GTWB 1OK0A 4BK5C 2DEYX 4P2QE 4A22A 4UQ3B 2R1WB 2Z29A 3A3HA 3LMYA 2DJMA 3E38A 3DX1A 1NA8A 2YXFA 1ACCA 4MJ5B 1J8VA 3VG9B 3THML 1FFQA 1TT6A 3HPFA 2NQLA 2VSKB 2F54D 5ALBL 3B37A 5E51A 3NOYA 2XZ7A 4GS7C 2WMKA 4WUKL 3FKRA 4KK8C 3CFMA 1OPGL 3APTA 1JUKA 2WINA 3O9WC 4KEMA 3SGEI 2OU4A 4LVNB 1W3NA 2VXNA 3TCEA 4CKVX 4P8WA 4AENB 2J24A 3O3RA 4HU2A 1DJGA 4XCNA 3A12A 1A6WL 3GJEA 4JG1H 1EBGA 3K80A 2IAMB 3GU1A 1SJXA 4M6OH 3L9BA 3C8KA 1H51A 1A6TA 4GT0A 4PJ8B 4G7EA 2I56A 3FO2A 4AUYA 2CE6A 1CZ1A 4KEUA 5C0IB 4MD5A 4HGKC 4R84A 4U1HA 3T0DA 4N2IA 3LV3A 1RIUL 2UUDK 1EJVC 2GY7B 2OJZL 5EY5A 2IAAC 1U58B 3GSNH 5GRUL 1KY6A 3F83A 1B0IA 5DD5H 2PWDA 5D2TA 1BEYL 1F97A 2DSUA 4OFCA 4RNIA 4IU3A 4RAVA 2QDHA 4OIAA 4X80H 1ZLUH 4TTGA 1V3LA 1RURL 3M86A 4JY5L 2GQ3A 2C4FU 4GCXA 4XHQA 5I5MA 1CB7B 3H7RA 3SQBA 3C2VA 3AMCA 4OLYL 4W9KC 3WFBH 4OKDA 1GIGL 3SSJA 5IROC 3RL2A 4M3HA 1S8DB 1VAHA 3TMLA 2CR3A 3OVPA 1ME7A 3FU5A 3MKCA 4PJEB 4JFEA 3AZUA 2WYTA 3GIZL 1IEBB 2D2JA 1URLA 3Q43A 1RAMA 3TEWA 1XLDA 1XWVA 4N9DA 4BKLA 2YQBA 2HN7B 1WIOA 3UJJH 3PABA 4W5ZA 4JN8A 1Q6RA 1BBJB 4GIPD 1VRSA 4XVOA 2VW6A 3KR3L 4LE8A 4ZSUA 5EMLA 2IMRA 1XS2A 5AC8A 5C2CA 4W9HC 4S3KA 4IGBA 3WFZA 2G60H 5BXTA 1VRXA 3SGKC 3UZEC 1UJQA 4OGAD 1YYLH 3TA3A 1EPFA 4GG8A 1V0MA 4M1DH 3F64A 1UW9A 4E3TA 4V28A 1FHNA 1MNUH 3NCMA 4FTVB 1NC4D 5DGQA 4Z7WA 1JULA 32C2A 2GJPA 3W5MA 3TYEA 1C16B 1O7DE 4LB8A 3MRGA 3W2LA 4ODUB 5CCJA 4YL9A 4K2UH 3C08L 2DLFH 2W65B 3MI2A 1QRNB 2V0AA 3N11A 3FK4A 2FL5B 4PODA 4N5UA 4DK5A 1DWFM 4O4VA 4L4JA 4R26H 2CBQA 1GOQA 4DTGL 4ZTOH 2GSIB 1ZHNA 2VXUH 5C3IA 3NCOA 4AWJC 2AJVH 3V6FB 5I1CL 2OR8A 1H3VA 1R0AL 1O5RA 4HZ6A 1LJYA 4XN4A 1KQYA 1E2WA 4XVDA 1R7AA 5HAOA 1EHNA 3F4CA 1RPUA 2WNXA 3VXNA 3ENLA 2PP8A 3QFDA 3LNHA 2VRJA 1ML1A 3U7AA 5CPSA 1S2WA 1QEXA 3FDKA 1XUUA 4JANA 2VX5A 3PWJB 4HN4A 1OGBA 4Z2KA 3PDGA 4Q4OA 1UXLA 4EPEC 1GKPA 3BANA 3ZT7A 3UCDA 5XIMA 5ISZA 4F7PB 2W9EL 4JQIH 1G7JB 1PZUB 4KY1L 1OTUD 1VADB 3TXVA 3FUMA 4HPOH 3HE7D 1NQKA 4CLMA 1SJHB 1FL3B 1AZRA 3RWDB 5GZOD 2K8QA 3EX1A 3S34L 4HA4A 3E6HA 3IU4H 5D70L 4OAWA 4DZ8A 2CHOA 2O5ZH 2CIIA 2WUBL 2FMOA 4HK3N 2BY2A 4LOEA 2EAWA 2E1WA 4HNTA 4BHUI 1BJ1H 3MV8A 5LGZA 4JS7A 2ZX9A 3L3HB 3L45A 2E68A 4B91A 4OLVH 4ODXA 4Q8OA 5B39G 2Y8UA 4U1NB 1H6UA 1R2RA 2G41A 2NNXA 2PYEB 5LB1A 1BBDH 4LALA 2GQHA 2ISDA 3LENA 2G3IA 4I5BB 1G5GA 1ZHBA 5DDHA 1VF8A 4O0QA 3NL5A 5HHPB 2A3BA 3WELA 2V2DA 2AJ3A 3B6SA 3OBAA 1A8JH 3P3SA 4FJYA 3CK0L 4UIKL 2BP5M 4H2CA 3BZDA 1RVFH 3VFNA 2AJSL 2CDFA 3MVTA 2H4EA 4LUSB 3IN0A 5LA2A 4FYQA 3W37A 1PLGL 2DFAA 3WIIH 1GOHA 2QSQA 3UNDA 3SO5A 4F33A 4MA8L 1S5HA 4AV0A 1ODAA 1UZ6E 3P8JA 2I5YL 1RIHH 4WTQA 2BSRA 3STCA 1ZK5A 3IPFA 1R7OA 2PWHA 2JQZA 2VR6A 4N0UB 4K9EL 3MRQA 2PF8A 2NY1C 1BG1A 4RFEA 4D6EA 5ILTH 2Y63A 3TNOA 1LO0H 4LPCA 5DHVH 4G56A 4M6ML 1QUNA 5DF0A 1IB5A 2LAAA 4Y1SA 3N3TA 2HPMA 5FSDC 3R7QA 1FCUA 1R85A 4NENA 5EORH 1JGDA 4TPRL 1FWJC 5K9JL 3TBSB 2COVD 1XMEB 4OZHB 1YXCA 3W72A 3B8IA 1XTLA 5D4HA 3QJVB 3NACH 2AK1L 3VXGA 5ICZB 1J0JA 5T5NF 2WLYA 4QIRA 3EYPA 4PG2A 4I48A 1GYAA 3DVGA 4ZD3L 2B1AH 5D2VA 1IO4C 3KPSA 1FFPB 3W39B 1JPGB 1T66C 4PJIB 5GGRA 4KZDH 4M7LT 2J27A 4QLWA 4FJZA 1HEZA 4HJTA 2WXRA 5I00A 4NP4H 1LQAA 5FYKL 1R87A 3QIUA 4LSRL 4XWOD 4Q8BA 2Z6FA 2Q8AH 4YSEA 4GXUN 3WG6A 2FSEB 1HSBA 2WZEA 4NQEE 5DC4B 1XIEA 4AQZA 1J0ZA 4AM0B 1W3KA 1ZBCA 2BWQA 1I0DA 1P7QA 2QYGA 2HWZH 1K5WA 3FH8A 4MMZA 2L7EA 1Z9SA 5A6IA 1QKZH 5KBPA 1L2QA 2WXLA 1T20A 4ZXBC 4XZUB 4KKPA 2Z7WA 1JNNL 3T8VA 2O9PA 2PDMA 1UCBL 2CBOA 1BAFH 1F8TL 3RURA 3O4LD 1Q4NX 3AUVA 2CUHA 4LLAA 5HJ3A 3CK5A 1TZIB 1CD9B 5CU9A 4MRCA 4OZIF 3WGUB 1G0DA 5D7IE 4NSKB 2AJUH 4PCKA 5AW6B 1CI5A 4BZ1A 3QI9C 3PLYA 1BZ9B 3F7VB 5KSUB 1OHQA 5JIKA 4AC4A 3RVXD 3RZCB 4P59L 3OZPA 3TIEA 3O41A 1UZGA 4CC0A 1Z42A 3C60D 2PTYA 5CCZA 4JHAH 1QOPA 1SM3H 4M8QA 2NLJA 4FQQB 2Y0FA 2XN9E 4JE0A 4MA7L 1E6XM 3MBFA 1IC0A 3V4PH 1N5YL 4PUMA 3W4RA 3LXBA 4KWOA 4X9IA 3OP2A 1F76A 5GGSA 3KHOA 5CZ0A 4WXYA 2JJSC 4HW6A 2BZCA 3MCOA 1HKWA 5TE6H 4FDWA 5E6UB 3I6LD 1SFHA 4CKQA 6FABH 3B9KC 3LZFH 4RLDA 3A3YB 5KVDH 3VFWA 2H2SC 3UR8A 3URQA 2UZPA 1ONQB 5FYJD 2F5AH 1K02A 2D03L 3EJJX 4RNRA 2PDXA 2WINB 4ZZKA 3U0PB 1TPXC 4MQ7B 4KI5E 4ERIA 3R4IA 5ECUA 5AKRA 2H45A 4FFWC 2P3YA 2F7PA 3SDCD 3MLZL 4U6HA 4F9LA 3GJEB 4X4ZA 1FLRL 3TBYA 2GI7A 3ULSB 4P9HH 3MROA 3SE6A 3RJOA 4R33A 4MJJA 4G7EB 1VFLA 3FO2B 1A5OC 3FT2B 3BX7C 4LIQL 4Z7NB 4ZPTA 4U1HB 3X1GA 2ATMA 3LV3B 5F88A 2QPXA 1TZHB 4F7EA 2X6UA 4C6MA 4NF7A 2EICA 2ED6A 2QPUA 1SHWA 1DIOA 3LMJL 4B96A 1T3FB 2V68A 3J07A 3QUZD 1P0BA 2WQDA 4RAVB 4GEJA 4IRZA 3A9BA 1B3OA 3NDYE 1CTNA 4L37B 1W8GA 3ERXA 4G6JL 4U3AA 1BECA 4Z2IA 3AMLA 3P93A 4XBEL 1V02A 2Y6TE 2YW3A 4ADUA 3CDZA 4B4FA 1DBKH 3ATEA 1NAMA 4WO4D 2EO1A 3SDAB 4LL1A 5F9WC 4P4RA 5C6TH 3ESOA 3S37H 3TH3T 5E6IC 5K69A 4JFEB 1KBGL 1WFJA 3BP5A 3SGGA 3GKZA 3W1MA 4LLMA 1WWBX 3Q9QA 3XISA 3H42H 4G1EA 2FLBT 4BKLB 5KJ7E 5I71C 4XN9A 4KXZI 1DQJA 3O81A 2DBJA 4GPNA 1HDMB 5MERB 1LRTA 4NQEB 3PABB 2DI8A 5I3JA 3DBPA 3BG9A 1XP3A 1IBZA 3IK2A 2P80A 1AQKL 4UAOB 2X89D 5C0GB 2EXWC 5TJWK 3N91A 4AUBA 4RESB 1LL6A 5IQ7H 1AJ7H 2IBZY 5EBGA 5MI0C 5CR8A 4GG8B 4L2LA 3VIFA 5F3BA 3D34A 1JPTL 4M43H 4HMNA 2R1XA 6ALDA 4NY2A 4Z7WB 1GGIH 1F41A 3H9HA 32C2B 1U1JA 2G0KA 4IPIA 5H2BB 3MOAL 2RA1A 4PFEA 4Y1AE 3QZ6A 2X1QA 4P2OC 1IAII 4LHUA 3FT4A 4J4PC 1DBBH 4JZJC 3GMNB 3QORD 1I3UA 2AI0L 3HC3H 2W79A 2IGLA 2A9DA 4NAEA 3JZEA 1GR7A 1N8OE 3MHUA 1HL8A 1ZHNB 1JSYA 4ZFCA 3LEPA 1H0GA 5J1AA 2XN9B 1I6NA 1QMUA 1L2UA 2O0TA 3Q2WA 3MW7A 1JR1A 4ZNEA 1A1MA 4R6UA 2PCQA 3B2XA 3VOHA 2WVVB 5TDOA 2FQIA 2B1HL 1EZWA 3WS6C 3A0OA 3HKFA 3RMEA 3G3LA 2C9XA 4KUCD 1M9HA 3U9PL 4YZWA 5JDSB 1PEWA 3TBBA 1SO5A 2R69L 2R8SL 4EN2A 2Z31D 3L4ZA 3VXOA 2J8UA 4G80A 4RXGA 5JXEC 3IJYA 2P5ED 3GG7A 3E6HB 3OZLA 4OAWB 4LBAA 4H8QA 2CR6A 2CIIB 1BZDA 4R96A 3RRQA 3W9DA 2C9VA 2XSKA 1AGEA 2VDIA 5KSWA 3N6QA 3NFNA 3GG8A 2CO1A 5CLTA 3C6LC 3QZOA 4RISH 4OU1A 4YSAA 4Z7QB 1MCNA 3DX7A 2R56H 2DTML 3L7RA 4D1JA 2XG4B 4AMXA 3LB6C 1X6UA 1ZHBB 2AEQH 3R11A 1T0MA 3O3AB 5DGRA 3WS3B 2DQ6A 2FQGA 3B6SB 2FGZA 5F7YC 5D71H 4UBPC 3D4CA 1S9VA 2CDFB 1C12A 3Q13A 1KTBA 1R3RA 3HNSL 4EO5A 3N06B 3MNZA 3AQXA 3MV9A 1Y1UA 4WKAA 5ICXB 4F33B 4LF2A 3NZ1A 3HQOA 5B8CB 3PZ9A 2Z7KA 2Q09A 2VAJA 3UR5A 2A77L 2OCCB 2BSRB 3RVUD 2AKRA 3EKCA 4MNGA 4ZMTA 1WZ1H 4IFKA 3LBOA 5KN5B 3EADA 3S97C 4XN2A 2ZE3A 4MZRA 1UXSA 3WQEA 5TF1H 5DLCA 3UZWA 3W1PA 3MRQB 2EH7L 4YCPA 2YXXA 1E9ZB 4N1CA 2HPIA 1B9BA 4NIRA 3U79A 3VG0H 2QSVA 3DJSA 4X5RA 1MEXL 4MWAD 4XO6A 2PP9A 2P1YA 2F7FA 4U6XA 1UKSA 4WFFD 3PPFA 1W0MA 1E0XA 4R2GC 2KBGA 5LJYH 1ISYA 4GK8A 2VXVL 2IVFC 1XYBA 4FXKC 1K8CA 1WV2A 3IVTA 4I48B 3RRXA 1OGSA 3K2GA 4LT9A 4KFNA 3KPSB 4PB0H 1CQKA 4Z0XA 4Y1AB 4FQCL 3X1BA 4Q0XH 1RZ8A 2PGFA 3QYNA 1ETZA 4U0RC 3JWNC 5E8PB 2XSXA 1FORH 5G55A 1DQDH 1VC4A 3C2SA 2O9RA 4MMYB 4HIEA 3CSBA 1AO7A 4UUJB 3QFJA 2UX6A 2V7HA 4C91A 1RA5A 4HWNA 1L6SA 3TAOA 1WBZB 1A7QL 2HV5A 2XGIA 4PY8I 4R7VA 3VOFA 4UM9D 2V37A 1FPTH 3Q2LA 3QW4B 2DM2A 4MNJA 5AOJA 4RZ6A 4C56A 5LBSA 1IVLA 5CEYA 1ZLSH 1SO6A 3ETSA 3MU3A 1HHHA 5C0EB 3N25A 4N86A 1CZ8H 1K9TA 1TJXA 2QUVA 4QNPF 3BP6B 2D3LA 1IAKB 3ME0B 4FYSA 1M7DB 3PXLA 2CWRA 4M6QA 3MI3A 3REWA 2XVLA 3RU6A 4NUWA 5E93A 2N4IA 4QI3A 5AG9A 1FXPA 1DE4A 3IPEA 3MGOB 5KS9A 4I9AA 1XLAA 4JFHD 2W4XA 4TVUA 5KVMC 2MNRA 1KENL 4OQTA 2YBGA 4KW2A 2OJ1A 3MJGX 5IJKA 2YMXH 4EZJA 1N0XH 3IRZA 3LQZB 4DY1A 1CECA 2CCVA 3WEXA 2IKHA 4YZFE 4BXSV 1B54A 3ZHDA 4MCYA 2QUTA 3N1AA 1MQKH 3QEQA 5LIXX 1XF1A 1PLCA 1BD0A 3FU9A 2PD5A 1OX4A 2CBJA 4NXSA 2X2JA 2K70A 3NCEB 1TVBB 3G6LA 3ZDZB 5I8OL 3MCG1 1PZ2A 3N2XA 3VFWB 3MLWH 4KTDL 1OM3L 1DEDA 4CSTA 3L4UA 4D8LA 2O55A 5EB9A 4M6PA 2J8FA 3UGUA 2N7SA 4P99A 4JO3H 3M1BA 4ZEPA 3E6EA 4XCEA 3H56A 3F7QA 4JRYD 1E6ZA 1J1OL 2W3ZA 5HJDA 3TQPA 5FECA 4OM1H 3OXRA 4QJ1A 2WP3O 2PR4L 2OGJA 1WWWX 3A67H 5BZXA 3LIZA 3GLAA 2WNKA 2BWIA 3ZS4A 3M0ZA 4AH2A 3WY4A 3RILA 1NANI 3VD3A 4ZPTB 1FA4A 5IVXA 3QBUA 4RSYA 4O02H 4F2FA 2K4WA 4F7EB 4HTYA 3CVHA 3UIYA 3D25A 3HIZA 3QV8A 4XVTL 1ACYH 5C09A 5DRNA 1OC7A 3LNIA 1P5UC 3MRNB 4S11A 4ORZC 3SHSA 4XCFH 5I18L 2BY3A 3UAEA 3L9RB 2DEWX 4OD1L 3T65A 3MLSH 4CNIA 3GS0A 2ZTKA 1SJEA 3G5VA 2FPVA 3CDZB 1NAMB 2V2CA 3FXIC 1P1VA 2YUVA 3PGDA 3B9DA 4NNPH 1VCVA 4G5ZH 1CBVH 5C0BD 3T6CA 1K6WA 3GH4A 3BP5B 1WAPA 4LLMB 4PJBE 4G1EB 2HSIA 1UB6B 1NAKH 4TQEH 5EIQA 1RV6X 2HWGA 3R5EA 4QOKD 2RQ8A 4LNRA 2ZT9C 3NQCA 4HCGA 3GXMA 4L23A 1HILB 3KZ8A 1MOEA 5SWSD 2OR9H 4MD0B 5C55A 3VNDA 1J9TA 3LQAL 2HTMA 3W76A 1N8FA 1KRMA 2YN3A 5F7LB 3EO0A 2H3NB 2Z1PA 3EKGA 5F3BB 2ZZ4A 1VFSA 3CV7A 2R1XB 3TU9A 1FGVL 4A2GA 3AMGA 3UXDA 1JNHA 3GI9L 3V0UA 1S7QA 2OQLA 2HKFL 2JEPA 3NJFA 4IFOA 1IC7L 4TUKL 3FT4B 1OAKL 1U8QA 1T0PB 3QOKA 2HAZA 3ZQXA 2QVFB 5B7EA 5CXPA 5JHDB 3DTXA 1SO3A 4NAEB 3G8RA 5TQ2L 1E9QB 4LSPL 2GCYB 3WN5A 2Z1VA 4BSVA 1DDTA 1T6VN 4JN1H 1F58L 3LKRA 4BFIA 5FCUL 3CS2A 3ZTCC 3BURA 5DT5A 2YWZA 3ZTJG 4HFWA 4R5TA 3MHZA 1KD0A 3QW9A 3GSNA 3W6MA 2WGNB 4NJAH 5C1MB 2BRQA 1M05A 1WUNT 3OKYA 2XWDA 4E5XA 4UIMA 5C2GA 1NGPL 1NCWH 3LHWA 1IM9A 2LFGA 3WQFA 5SX5H 3BT2L 1WK0A 4NI3A 1LK2A 3WQOA 5DC9B 2ZCGA 4KO9A 1MRCL 1KFJA 4BCZA 4KJYB 2ZZ5A 3HJEA 2J8UB 3OG3A 1ZJHA 2GGHA 5AFAA 4JEQA 3M5YA 3L0NA 4GQPH 1VFFA 4G1MA 4S1RH 1U95B 2W9DL 3IJYB 4HVXA 2Q10A 4X6EA 5AKTA 1FVCA 4RFOL 4P4KC 2Z65C 3O6FA 2E25A 5D1XB 4FULA 5E4EC 2ZX7A 1KLFA 1JP5A 1Q85A 1G6CA 3W9DB 1BSIA 4APQD 1AGEB 3IS4A 3MBDA 4EIBA 4PTMA 4FG6D 1X9UA 4XVJL 3NFNB 1FRBA 5G5IA 4WI8A 1KLYA 4KNTA 3SJVA 2C1OA 2WYSA 3E0VA 3RAJL 1MIEL 1MWAH 1OAZL 1CIDA 4MVBC 3B04A 3DX7B 2NNAB 5I15H 5B7YA 4JHMA 3UY7A 4F48A 1DVFA 1BA9A 1WDAA 4DQOH 3CH9A 2WSDA 2DSWA 4M5SA 1RZ7L 4E9XA 3NMEA 1A9BA 4YBHA 5F7WC 4DJFA 4Q2ZB 3CU7A 1GY1A 3D85B 4PFMA 2UYLB 4GBXB 1S9VB 2CG9X 5FF2A 3M41A 2BSEA 3DG6A 1C12B 4JR9H 2M83A 3TN0A 1LWHA 2ISWA 2I85A 3M07A 5IMLA 1MEIA 3LYEA 3TU6A 5DK0A 5M17A 3MNZB 5A6BA 1D3HA 2OI9C 1S3HA 3PQYE 3U2SB 1GZGA 1INDL 3VM7A 2P5WD 5E2UH 3SZ6A 3VTTA 4XBSA 2BOFX 1C7SA 1KGCD 1XGZA 1NWPA 2HS6A 4DYEA 3MLVL 4IU2A 1U4FA 1CTOA 3V55A 4PJBB 4QDMA 4IFKB 3F6LA 2Y7SA 2VX7A 1NUNB 1HINH 1UOZA 4MS6A 3F03K 3VU2A 4JHWH 2FGBA 3CFKA 5HGHA 5ECGA 4W4QA 5DD1L 1A7NL 3GYCA 2KI6A 3GC2A 3IDNA 2BVQB 2P88A 3AQZA 1P6FA 3GSQB 1NFAA 1KTCA 1DWGM 4RMVA 2UZXB 2XTJC 3PJWA 3LS5H 4JQIA 4US5D 3TYFA 3V4VL 4PJAE 6A3HA 4Z0XB 3ELFA 3GH5A 4WQOA 3DENA 5T91A 1RZ8B 2XYLA 2PURA 4IMKC 3CNKA 5KW9H 4XMTA 4PLJD 3V0JA 2E5EA 1FY6A 2VFDA 4C54A 1Q9OA 1UUNA 3BJSA 4RV3A 1XLJA 2JJVA 5EU3A 3PNUA 5J89A 4HIEB 1A9EA 2VMDA 1AO7B 4HT1L 3QFJB 3ITVA 3DYMA 4IK6A 2FCBA 1EBAA 2WD0A 3JU2A 2NY6C 3K0WA 1CU4H 2A9MH 1SSGA 2EDHA 4EI5D 2NX9A 2EIKB 2N3JA 1BQRA 5HHVL 1O0VA 2QKIC 3JRKA 2NZ9D 3OF6A 2XWTA 2LU4A 2JELH 5C86A 1BFVH 5CEYB 1BTMA 5JYLA 3GB7A 2E6FA 5JA9A 1HHHB 3GZPA 2L7JA 5L0QB 2P76A 3T3PF 3OVRA 3EJTA 4H1LB 5I0ZA 4K7VA 2A6NA 1T0NA 1JNLL 1RL1A 3H26A 3UFIA 3PWAA 3HHSA 3MUY1 2WLLB 4N9GA 5CZRA 5TD4A 4DP0X 1ZHLB 3REWB 3S88H 2C3ZA 3P7YA 1DE4B 3RGVA 5KS9B 3D3VE 1D2PA 3P0VL 2NCMA 3DOHA 4L9ZA 3ZO9A 3OAWA 3S6OA 3TOYA 5GGUB 1SFDA 1WRFA 4W88A 1IEQA 3P61A 3H22A 3WEXB 4XC1L 2NW2A 4MCYB 3OMAB 1TVHA 2E7DA 2WJDA 2VR4A 3XIMA 3Q05A 2E6QA 2AQSA 2R1PA 5DHVA 5AYZA 1GSKA 1IFRA 1WVZA 4EAMA 4YHNA 1B9ZA 2DRUA 4RL3A 5DHYB 3C5ZA 2YD8A 1WICA 3VI4B 3MCKB 1IC4L 2R0ZH 2DICA 4AY7A 5E2VL 4YHIA 3NA9L 1UACL 1A1NA 1ITUA 2GJNA 3D2UB 4XBMA 3BN9C 4F0LA 1C9DA 4UU9A 4XCEB 2G5BA 1L9QA 3WFEH 3L65A 3ARBA 3N2JA 2L5HA 2NY2C 1O94A 3K6IA 3TE9A 5JO5A 2XZ9A 5ENLA 5A2AA 5ABGA 5J8LA 3D0VA 1WC7B 1PX8A 2MKLC 3ULUF 3QV6A 5T8IA 5TQ0H 4OF7A 3TVMA 3B5TA 3BO9A 2L4OA 2ISSA 3U4KA 4KKCC 2PO6C 2DH3A 5CC5A 2O4MA 5CC3A 1EUAA 1EQCA 5GS0D 4GUCA 3MLPA 3F62A 3QKZA 3SB0A 4NPYA 1Y65A 1B3XA 1MUCA 5DRNB 4QDWA 5HDBF 3K6OA 2QSCL 2Y25A 3T65B 4BI7A 2AKMA 1SJEB 3OMNB 3G5VB 4WHBA 2UY4A 3S42A 2RDXA 2DQFA 3QJSB 3VD4A 2AF2A 2VM3A