1KXTA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
total genus 170
structure length 496
sequence length 496
chains with identical sequence C, E
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxtA01
2XVNA 2X8RA 2XGBA 3VMOA 4ZXLA 5I23A 5HPCA 2X05A 1MVYA 2W4XA 3SCSA 1JZ7A 4ZEPA 3AMLA 1BYAA 4V27A 3SEPA 4NX0A 4OIFA 4NSBA 1Q6CA 4UFKA 3WY1A 1I1XA 3KZSA 3U5UA 2WKLA 3UEQA 3VKKA 4E8CA 4MJ4A 2FH6A 5EMYA 2BHZA 3GXFA 4E4PA 1UD6A 3SUTA 2Y4SA 2VCBA 1QW8A 4UCFA 4BF7A 1AQMA 1D7FA 3DHUA 1JYNA 2YBTA 1CYGA 1X1NA 2CPUA 1TMQA 4U2YA 1KR0A 3OLIA 2BNJA 2WMGA 2Y2WA 4CD7A 2DSKA 4WKHA 3EDEA 1UUQA 2OYLA 1V0LA 4PEEA 5A6MA 3VSTA 3I3DA 1VJSA 1XSJA 3OBAA 2FHCA 7TAAA 3WN6A 2YBUA 4Z2KA 1UWQA 2G41A 3AIQA 1E0WA 2EQDA 3VUPA 2QPSA 2GDUA 5C71A 3B9AA 2V3DA 3QHMA 1W3KA 5EFDA 5D8ZA 1JF6A 1ODUA 4WSJA 3WDPP 3VNZA 3W53A 4GINA 4P8VA 1W32A 4BS0A 4GXPA 1OBAA 3VD3A 1HJQA 2ALWA 1JAKA 4U31A 3D4YA 1H5VA 1HIZA 2JFEX 1GOMA 3ZQ9A 1XRVA 5ECUA 3EBVA 4NF7A 3UERA 3EJPA 3VIOA 5HNNA 1VFFA 4CN6A 2ZUTA 1TQUA 1HX0A 3SCPA 1CIUA 1E6XM 1V0MA 3DDFA 5DMYA 3A23A 2D0HA 2GFTA 3W4RA 1UQZA 1ISZA 1BYDA 2FHFA 1HKIA 2J7FA 3A4AA 4U5KA 3G6LA 1HJXA 3WF1A 2ZWZA 3MMWA 3CZNA 1ESWA 2O9PA 3H55A 1JDCA 4AMCA 2ZUWA 1KGWA 1LL7A 3MO4A 2E9BA 1J01A 4AZ5A 2EO7A 1R8LA 2PWDA 3WIJA 2X09A 2DEPA 4DO4A 1TA3B 3MU7A 4AEEA 1KBKA 3KLLA 1CGTA 2YJQA 3UG4A 4F9DA 2PI6A 4KRTA 2ZX5A 3LRMA 2PWGA 4CD5A 2WVTA 3TONA 4OUEA 1BAGA 3B8SA 3VNYA 1TUXA 4PTWA 1V03A 3DX0A 2X2IA 3N04A 3BAYA 3K8MA 4AEFA 4PUEA 4S3JA 4AWEA 1WNOA 1V6XA 3T2QA 3WDHA 2DSVA 2J7HA 4PMZA 3WD1A 1K6AA 3VIGA 1D3CA 1W3HA 2EABA 3MSGA 1OWQA 4HA1A 1EHAA 4JFTA 1GOWA 5E9AA 3W0KA 2HISA 1VIWA 3W26A 3AIUA 3VIPA 5FKYA 1V0KA 1X6NA 1HJSA 3LPPA 2WK2A 1KB3A 1NM9A 1HXKA 1GONA 5CZKA 1V02E 4W8BA 2QV4A 2J4GA 1J0YA 2G4FA 3VMPA 5I0DA 4XUYA 4UQDA 3WNMA 4PCSA 1MFUA 5E0FA 5E70A 1ITXA 2F2HA 1KCLA 3VGHA 4ZENA 3AJ7A 4GI6A 1G0CA 5GNXA 5D8WA 3VPLA 4NZFA 4W84A 3LXBA 1E70M 3WQ8A 2X0HA 4M81A 2V3EA 2A3AA 3AYSA 3WBAA 4LYQA 2D3LA 3I3EA 2WMIA 3T2OA 2W67A 1E6RA 3RJYA 2ZOXA 4CN4A 2DGAA 1UH2A 3GXPA 4GZEA 4MJ2A 1WPCA 2WYSA 2RGMA 1QHZA 4UR9A 2UWFA 2VX5A 3EJRA 1GJWA 1WE5A 1QBBA 2F1BA 5BWFA 3CUJA 1VB9A 1IT0A 1JZ6A 1Q4NX 3FN9A 1LQ0A 2WMKA 1NWRA 4IISA 1PEZA 2XVPA 4NRRA 3FHQA 4MNLA 1ZU8A 3VTRA 2CCRA 1W1TA 2NT0A 3B9EA 5CQ1A 3GBEA 3W25A 1M03A 1UD4A 2ZUNA 4CU8A 3LRKA 4QAWA 3HZ3A 2VR5A 4D6HA 4PMOA 3THDA 5E6ZA 2ZXQA 3NDYA 1CLXA 4CD8A 4RE2A 3PTQA 4DWSC 1LG1A 2VOTA 4JFWA 1QOXA 1RP9A 2NSXA 2WNWA 2XM1A 2AMGA 1ZJBA 1K9EA 3WUGA 4AYSA 5GNYA 3OIHA 3MANA 2XN2A 1O7AA 4N0RA 1JL8A 3FXYA 2PWHA 1C7TA 3RM9A 2VURA 1H1NA 4OOZA 4UTFA 1W91A 5EB8A 4IPNB 1FHDA 1OIFA 5DF0A 1XSKA 3EJSA 1V3MA 1BSIA 1ZB5A 1WZAA 2VX6A 5JBEA 2CETA 1LJYA 3WNNA 3MMUA 3WQWA 5A2AA 4UQCA 1Q6FA 3VD5A 3L4XA 3DYPA 4D1JA 3S6TA 2BY0A 5CPQA 5CGMA 2BHUA 4TVDA 3FW6A 3WKZA 1EO7A 1EQPA 1CXFA 5A8MA 1J0ZA 4OZOA 3QGVA 2WBGA 1J0HA 3VGFA 3N1AA 1M04A 2G3NA 4EAMA 1AQ0A 3NDZA 1NWUA 2YIHA 2EPOA 5EFFA 5ABHA 1EO5A 3IGUA 1OT2A 3BSGA 5JUVA 3AQUA 5FL0A 2VVSA 1E40A 3O6AA 4AD2A 4B15A 2WC7A 4NXKA 1QNRA 5I77A 4JL1A 1UR4A 4D6JA 1R46A 1M01A 1W9UA 2XG9A 1V6VA 4WKAA 3BH4A 2TAAA 4UQBA 4C7DA 1PBGA 1JZ8A 1UWSA 3EMZA 1BF2A 3L4TA 1V3JA 1J9YA 1MQRA 3AHTA 2D1ZA 4X0VA 3MSDA 2VL4A 2OWCA 8A3HA 1QHPA 4J3UA 2EPKX 3ZSTA 3AXHA 1GNXA 5AYIA 5BRPA 5BROA 3DECA 4NZCA 4UOZA 1UD5A 2WVUA 5IFTA 3DC0A 2WPGA 2BY2A 2F7PA 2WMIB 3VD9A 3SCRA 3GNOA 4Z2HA 2IXUA 1CLVA 1XYFA 4AC1X 4AZ7A 1UD2A 1UOKA 3AIEA 3AHYA 3WMCA 4UOJA 3SIMA 3RO8A 9CGTA 3PTKA 1ODZA 5IFPA 4MNJA 3IJ9A 5HXMA 1ISXA 1GVYA 4AMXA 4D72A 3ARRA 1W1PA 1Q6DA 3AHZA 5CSUA 3WH6A 3N18A 2EPNA 3AYRA 3WQ4A 3EJTA 3D50A 2YKKA 3T09A 2GSJA 3K4DA 1UA7A 2O92A 1LWHA 1O6IA 4W7VA 1VBRA 3PZUA 1UWRA 1E5JA 1FFRA 5M3WA 3GXTA 3CC1A 1JYXA 1UKPA 2Y8VA 2ZUUA 1C7SA 5ABGA 5M5DA 1MWOA 1OB0A 2OSYA 2FDMA 2VZOA 2PWFA 2CEQA 5I24A 1M7XA 3ARXA 4R5EA 3F5KA 3HG5A 2WMJA 4ACZA 3FAXA 2GVYA 1B3YA 2YDQA 3ALGA 5A6JA 1EDGA 5CLTA 1J0KA 1YHTA 1Y7VA 3A21A 1KR1A 1JZ5A 1WZLA 3BCFA 1GJUA 4J3XA 5C70A 4DUVA 3UG3A 3TP4A 1G94A 3ZOAA 1OD8A 2A3HA 2WAGA 2VJXA 3CUFA 3S5ZA 3AHXA 3KWXA 1ECEA 3CHEA 4MDOA 1E4NA 3VGDA 1AVAA 2J8FA 3WEZA 3L4YA 1LG2A 2OW7A 3L2MA 4UFHA 1J11A 1JYWA 3RJXA 3BXWA 1ISWA 2BVYA 2J77A 3GTNA 4U3CA 1GOQA 4HOXA 3CLWA 2A3EA 3ZJ6A 3A4WA 5LYRA 3PZNA 3A22A 1W3LA 3WMSA 1FOBA 4PYSA 4AZIA 3ZSSA 2YL9A 1UKSA 3FHAA 8CGTA 1W9BM 2WBKA 1E71M 1KXHA 5BCAA 3RM8A 3LRLA 1B30A 1WP6A 4X0NA 1JZ4A 4M24A 3GXDA 1GOKA 4W86A 2DT1A 4H04A 1PX3A 5AYBA 3VOCA 3IJ7A 1NP0A 4AD4A 5A6KA 4BCEA 4EK7A 4LPCA 4PMYA 4D6CA 1EGZA 4Q22A 2ZXDA 1CXEA 3FNDA 4FNUA 5BXSA 2VUYA 3QHNA 2CKSA 4XV0A 3TA9A 1R86A 1HVXA 1KXTA 4W8AA 3AZSA 1XC6A 3M7SA 3VIHA 4D71A 3M07A 2OSWA 3AZRA 2OW6A 1JG9A 3S5YA 4U2ZA 2WB5A 4ML4A 1I1WA 4M80A 3WY2A 3CTTA 1E4LA 4PMRA 2WCSA 2GUYA 4WF7A 2ESCA 2WLZA 2QPUA 4HA3A 5DT7A 3PZQA 3NCOA 3VDBA 2V3GA 2J62A 5D4YA 2PF0A 2ZUVA 1WAWA 3BVWA 4TX8A 1HKJA 2YDRA 3WL0A 4AZCA 3THCA 5CLWA 2EXOA 1JI2A 1JFHA 1HP4A 4Z2GA 3DDGA 3ZJKA 2YFOA 3WD4A 1JXKA 2VVNA 1PX8A 3PZTA 3HN3A 1I75A 3U57A 4ACZB 1WO2A 1H0IA 2G8ZA 2CNCA 1FH7A 2VCAA 4U5IA 3T0AA 4IPLA 1UR2A 2EACA 3WH7A 1AQHA 5IHRA 3MKKA 5D9MA 4GO9A 4R27A 1NH6A 1ISYA 3WDIA 3A5VA 3OGRA 4XZWA 1GHSA 3ARZA 4HOWA 1E73M 5I5RA 3AROA 3W27A 1CEOA 4HMCA 2D0GA 2XHYA 1TCMA 1VBUA 3D51A 3DX4A 2VRQA 4JFVA 2XTKA 2YL5A 1R34A 4A3HA 3CZEA 3HMCA 2F7QA 3RM4A 3WELA 4MNKA 2DPEA 2VQTA 3TOPA 3ZIZA 5BXTA 3UESA 2B31A 1GQIA 1UR1A 2EPMX 1VF8A 1RP8A 2BXYA 1L8NA 5CPTA 4P7RA 3IAPA 1Q6EA 4Q7NA 4QFUA 2VNCA 3ZT6A 5F7UA 3AHVA 3OLEA 1MQQA 1X6LA 4P8WA 4BQ2A 2WKGA 3WFZA 2QHAA 1T0OA 2F18A 3W37A 1ISVA 4RL3A 1PIGA 1EDQA 7CGTA 3VILA 1VFOA 3CZJA 4XB3A 3MV01 3QOKA 5AY7A 5A95A 5AC5A 3PTMA 1J18A 1KGUA 2J7CA 4M1RA 1PX4A 3AS0A 3W38A 2Y24A 4OKDA 3ALFA 3WQ6A 2Q8XA 3WUBA 1KTCA 5DO8A 3VX0A 2XN0A 2DT3A 1YQ2A 2OYMA 3K46A 2CBVA 3MUAA 2D24A 4QP0A 2WXDM 1XYZA 1EXPA 1JD9A 4GZIA 5A6BD 3ZO9A 2J78A 3WH9A 1V08A 3ARPA 3NJ3A 3SCWA 1XGZA 2YLLA 3RILA 5CJ5A 5HOSA 4H8VA 1EH9A 3G6MA 4C7FA 3WY4A 4QLLA 1KWGA 1EOKA 1UKTA 4BA0A 1CGXA 2GJRA 4NRSA 1GOIA 1E0VA 5CXPA 2V38A 2D3NA 2IUZA 4HP5A 2ZX9A 1V6WA 1JZ3A 1HNYA 1E15A 2G3JA 1GQKA 2OWXA 2YDSA 3CZ8A 3ARYA 2W66A 5A2CA 2JALA 2XSAA 1B0IA 3W29A 3BUQA 3T0DA 1KBBA 3EDJA 1BG4A 4WLCA 1PZ3A 4M82A 5FD0A 3BVXA 1JFXA 1NOUA 1MXDA 2O9RA 1FHLA 1CXHA 1UASA 3SUSA 4AZCB 1G1YA 3N12A 4IM4A 2W61A 3VM5A 5A1AA 2YFNA 4J3SA 1V6UA 4J27A 2F7OA 3LX9A 1ZBKA 1BGGA 1KFWA 4Y7EA 2DSZA 3ZJ7A 2J79A 2OLHA 5A2BA 4FNQA 4W7WA 4B16A 2IXVA 3B9DA 1TVPA 5CSYA 3FAWA 1UR0A 3WD3A 3CO4A 5KEZA 1C8XA 2C7FA 3WQVA 1BTCA 4GKLA 3ARWA 4HMDA 2PBOA 4J3VA 5HBFA 1OSEA 1H49A 2CIPA 4GQRA 1PAMA 2D73A 2CERA 1QW9A 1E6SM 3W6LA 3L4WA 1UD8A 2NW0A 4ZFMA 3BVVA 3BUPA 6CGTA 3RIKA 1R87A 2WHMA 4ZXOA 3H54A 3CZLA 1SFSA 3PZOA 4F9JA 2BXZA 3BVTA 1UWUA 1WZKA 1ZBWA 4YPJA 3PZMA 1M53A 3HU7A 5I79A 5FOOA 3MUIA 4W85A 3WL1A 2BY1A 4H7VA 3NSMA 4M56A 4PMXA 1E72M 5BRQA 4CN1A 2W92A 1V02A 4GQQA 1E4MM 1E56A 2X2YA 1E1FA 5DT5A 3BGAA 1L0PA 3A3HA 3D4ZA 1OGSA 5E0CA 3BSHA 1NARA 3EJQA 1JNDA 3VIFA 4D6EA 2E4TA 3F4VA 3BMWA 1LWJA 3LXCA 3SUVA 2ZX6A 1U2YA 1TG7A 3TTQA 1XCXA 3CMJA 1W9DM 4MADA 1PJ9A 5E1QA 2PBGA 3HJEA 4DUWA 2DH3A 1V3IA 4UFLA 3POCA 1UA3A 4PMNA 3QOMA 3L2LA 1JD7A 3WFLA 4ATDA 4HU8A 1JF5A 1S46A 5IHSA 3AXIA 4HZ8A 1OT1A 1E55A 1SR0A 2XPKA 1JDAA 2E40A 1R47A 3SURA 1BGAA 1FP8A 2J7DA 2CESA 3QHOA 3NSXA 1HT6A 1MW0A 5GNZA 1W1VA 1VENA 4QCFA 3UCQA 4RE4A 4AZGA 3BLPX 4NZJA 3WDQA 5JIWA 3ZT7A 1TQWA 5BYWA 2C0HA 2QF8A 3EDKA 1GW1A 2VCCA 1A47A 2BY3A 4BQ5A 3BAWA 3VSUA 1R33A 4AMWA 3LMYA 4D1IA 5CGTA 2A3BA 3N11A 4UFMA 2F7RA 4AD1A 4KWUA 1C92A 1CPUA 2ZIDA 1H2JA 1PIFA 4BQ3A 3M46A 1W3JA 3RCNA 3A6OA 1TE1A 1W2PA 4GI9A 4X9YA 1CENA 1UZ4A 2YLAA 2AOSA 3CIVA 4Z2IA 1QI4A 2J74A 3WBEA 2MANA 4L4OA 4HZ7A 3ARUA 2QMKA 4NXSA 2VMFA 1XH0A 3F5LA 2DSUA 1U33A 4OGZA 2DH2A 2ZXBA 1OINA 1SZNA 3J7HA 1GPFA 4PMQA 1XV8A 3T08A 2XVLA 1DHKA 1ZJAA 3O2LA 4CD6A 4EKJA 2DT2A 4QLJA 3EJUA 3MV11 2WVVA 2VQUA 3VDAA 1D2KA 3EDFA 3CZSA 4KMQA 2C8NA 1NP2A 3AZTA 3ZMRA 4C7GA 2EPLX 1UYQA 2W91A 3U7BA 1E0XA 3CPUA 3VO0A 3KLKA 3MUZ1 3ECQA 2VX7A 3QR3A 3IJ8A 1QNQA 1F4HA 1UHVA 1K9FA 5IXEA 4DM2A 5A6LA 3CZGA 2VO5A 1EDTA 4CVUA 1GOOA 3AXXA 1PS3A 5A6AA 1WDSA 3SCTA 3VGEA 3OGSA 3PZIA 4CVWA 4HPGA 4YHGA 3WY3A 3VIJA 3NIYA 2DQXA 3ZM8A 1QNPA 2CBJA 1UQYA 2D2OA 1GORA 4UFIA 2E9LA 3CMGA 1QVBA 4ATWA 2XYLA 2D0FA 2Y5EA 3BAJA 2E8YA 4MAVA 3VIMA 3ZT5A 3CHFA 4MDPA 3BC9A 5D9OA 1V0NA 5I78A 1WDRA 1W9VA 4TVCA 2VZTA 3WQ5A 4MB1A 1CECA 5JBDA 4PRWA 1PPIA 1BHGA 4W89A 4OBSA 3MUY1 4CCDA 2XVKA 3BVUA 5LA1A 2CBUA 3WUFA 2J7BA 4H2CA 2ZX8A 1C91A 1G5AA 5DFAA 4WSKA 3SCNA 5A69A 4N42A 3PZGA 3GXNA 2DSWA 2ZUMA 3WF3A 3ZR6A 2ZWYA 3AISA 3SCQA 3NSNA 1H3GA 3ARTA 3CBWA 3JUGA 4TX6A 4URIA 3MMDA 3KL0A 4WJXA 1B3ZA 3AOFA 3EMQA 3K1DA 4FLRA 2XGIA 3D5HA 2F8QA 3KEHA 1UH3A 4UZUA 3GM8A 1QWNA 4FNSA 4MB3A 2VZVA 3DX3A 4PBGA 4PSPA 2FGLA 3SUUA 3GH5A 5A94A 3WH5A 2WANA 1JAEA 1TQSA 1KWKA 1B31A 5A6BA 4PMDA 2ZE0A 1DWHM 2VT0A 1UWTA 5A8NA 4EANA 2VTFA 4PTVA 5KZ6A 3H53A 3AS2A 4AD3A 3OA5A 3NUKA 3S2CA 2ZICA 3BCDA 1KQZA 2OYKA 1J0IA 2VRKA 1LF1A 3VINA 4QDMA 1HJWA 1JIBA 1W9PA 4WKFA 3WD2A 1E43A 3AI0A 2WHLA 1MFVA 4LGXA 4UQ9A 3N15A 3L4UA 3KL5A 3OZPA 1B90A 3PN8A 1E3ZA 2CBIA 1CGYA 2FYVA 4AIEA 1HWWA 5LA2A 3WMBA 1VAHA 2WVVB 4PTXA 3VM7A 2EADA 4CGTA 3GNRA 3OB8A 1SMAA 3VU2A 3DYOA 1JNEA 1MYRA 2W5FA 3SUWA 5ABEA 3UG5A 2XVGA 3WNKA 2ZXAA 3VSVA 4CCCA 2G3MA 1Z32X 2UY3A 2CYGA 3POHA 4J28A 4PUDA 4GO8A 4F8XA 2RGLA 5D9NA 4ZE5A 2E0PA 1HKMA 4YHEA 1E6QM 1CXKA 2D22A 2O9TA 2VX4A 1JDDA 2VC9A 2PWEA 3N9KA 1DTUA 2PB1A 1DWJM 3VVGA 2J7EA 5I2UA 3BUDA 2VRJA 4A4AA 1SYTA 1A3HA 1RH9A 4JKMA 4CU6A 1U30A 4TUFA 3VD4A 2QMJA 4AZHA 1R7OA 4KH2A 4D6FA 1QI3A 3CGTA 5EBAA 3UR7A 1US3A 5E6YA 1LL4A 2NT1A 4JKKA 1V6YA 3AFBA 4M29A 3VX1A 2WZIA 3GXIA 1NOFA 2WHJA 3OGVA 2WC3A 4MB5A 2FH8A 4JIEA 4PSRA 1H4PA 4F79A 4PMVA 4FMVA 4AY1A 4TTUA 2V5DA 2CITA 3K8KA 4B9YA 5A8PA 2G3IA 1VJZA 3WSUA 3GH4A 2D20A 1WDPA 4P7QA 2IGTA 1NWTA 4UZSA 3DX1A 3AS3A 3GDBA 1C3FA 3BAXA 4HA4A 2EEXA 1XD0A 3WF4A 4FF5A 2F61A 2DDXA 3BLBA 3CZKA 1IV8A 1XH2A 2X1IA 4HOZA 1RD6A 5GQBA 2CKRA 1CDGA 3RMEA 4DM1A 3A47A 2WZEA 4EE9A 1HN1A 4HU0A 5JBFA 3CH9A 4LYPA 1O7DC 5JIPA 7A3HA 4TXEA 3DX2A 3W82A 1EQCA 4D6DA 1WKYA 5A3HA 3D3AA 1GZJA 5DEZA 4KRUA 1GVIA 3CHCA 2YA2A 4JL2A 2JEQA 3W28A 3W24A 1HKKA 1WZMA 2BS9A 3GYCA 1HL8A 1KTBA 2GK1A 1CTNA 1HXJA 1OIMA 1TR1A 1FH8A 3GH7A 3GNPA 3UETA 3WENA 1P6WA 5FCZA 3ZR5A 1CBGA 4AD0A 3W6MA 1H0GA 4J3TA 1GUVA 2GJXA 3LPGA 3EDDA 1KGXA 1DWAM 5I6SA 2WMHA 4BQ4A 4D6GA 1QI0A 3SCOA 1IZKA 2VZUA 3VIKA 2BFGA 4K68A 1C8QA 1DP0A 3LPFA 2E3ZA 2A3CA 2JIWA 4CCEA 2JF6A 1EA9C 2WWDA 4AD5A 3RPMA 1K9DA 1MW2A 4BZYA 4GZJA 1G01A 2WHKA 1GQLA 2XIBA 4FLOA 4W7UA 2J75A 1E1EA 3WUEA 1B2YA 3WNPA 1DWFM 1CGUA 2CXGA 4FLSA 2FHBA 5A8QA 1QHOA 4JCLA 3BUIA 3BAKA 1QPKA 1GQJA 1C90A 1KCKA 2BVTA 3MS8A 1QWUA 1TFVA 4AYGA 3OZOA 2DIJA 2EJ1A 2HVMA 1J0JA 1TQTA 2UY4A 4W8LA 2F1AA 4XZBA 1H09A 3WD0A 5M03A 4HPHA 5GPRA 2UY2A 3WF0A 3SCUA 3LPOA 4FLQA 3ZJ8A 1EHNA 1OCQA 3PZVA 4CD4A 1CGVA 4ATLA 3M6DA 4HMEA 1HJUA 1R7AA 2DIEA 3U7VA 5TD4A 1UG6A 1MXGA 1BPLB 4OOUA 1XCWA 5BXPA 5BXRA 4WK9A 1VEPA 5IDIA 3SCVA 1W2VA 1CGWA 1EOMA 3AIRA 3AIBA 4FNRA 1EIBA 4AXNA 4KGLA 3VIIA 2CHNA 4RE3A 1HJVA 3GBDA 1UZ1A 1OGGA 2YL6A 1W1YA 1OGBA 2W62A 3A24A 2BV9A 5FL1A 2XUCA 1B3XA 3BLKA 3AMKA 2WVSA 5ABFA 1XH1A 6A3HA 1BVNP 1ZS2A 4MAZA 4JZ5A 1RPKA 1BVZA 3VDCA 3ARSA 1PZ2A 1G9HA 2QLYA 1H11A 3CHDA 5AC4A 1C8YA 5CG0A 4JKLA 4J7RA 1V3LA 2XIIA 2J47A 4P7NA 4H8HA 4UNIA 3I3BA 1KXVA 4P7LA 3N17A 4AIOA 2WLYA 4V28A 3VMNA 2XFFA 5A6SA 4UFJA 1WDQA 2WSPA 4PCTA 3EYPA 3PBGA 2Z1SA 2WCAA 4TVUA 4B9ZA 1K9TA 3AMDA 2GK1B 3APGA 5M17A 3T0BA 3TTOA 3MI6A 4LXFA 3VDHA 3CV5A 4NI3A 1HP5A 4JAWA 3O9NA 2J8GA 1E6PA 3VGBA 2X2JA 1W9XA 3OLGA 4JFUA 4OBRA 3OG2A 2GJXB 2WSKA 3WDJA 4E8DA 4DWSA 4AIUA 3CUGA 1KQYA 1V3HA 4KGJA 3A4XA 4P8XA 1UKQA 4H8UA 4M8UA 2YA1A 1C93A 1CWYA 5E09A 2FE0A 4LYRA 4B3KA 1CXIA 3IANA 2GDVA 1VEMA 2J25A 1H41A 1XHGA 2DT0A 1E6NA 1QBAA 1QI5A 3WDRA 1CZ1A 2WWCA 4JCMA 3TTSA 1NOWA 2XFYA 2XWEA 1ITCA 1TZ7A 2X2HA 3RDKA 1HVQA 1R75A 2XSBA 3TTYA 5HPOA 3AIWA 1HL9A 3AICA 4QLKA 1ZBCA 3AMGA 4GPNA 3IAQA 4JHZA 1E6ZA 3L4VA 3PZ9A 2YA0A 1FP9A 4UOQA 3W81A 2WCGA 3E1F1 1KXQA 4HTYA 1QNOA 4FK9A 4HZ6A 1VFMA 1UR8A 1QNSA 2BVDA 4WIWA 2YL8A 1LL6A 1E9LA 5FIPA 2OWWA 1F4AA 1R85A 4UQEA 1ZL1A 4S3KA 1JYVA 3NYDA 1GCYA 3K8LA 3WEOA 4MNMA 4PMUA 2VR4A 2XWDA 4PN2A 2JEPA 3FY1A 1BYCA 1JZ2A 5A8OA 1J12A 2W63A 4DUXA 4DO5A 1WB0A 1TQVA 4U33A 2JF7A 3II1A 2O9OA 3BAIA 2VI0A 1SMDA 4W5ZA 2ZUSA 1JGIA 1JI1A 4E2OA 3GZAA 4FNTA 3CUIA 3WEMA 3F5JA 1XSIA 4MPKA 4JFSA 2WC4A 1BG9A 3WNLA 2WM0A 1HF6A 3D52A 2BHYA 1BFNA 2FGZA 1US2A 1E3XA 4UQAA 1NWSA 4XX6A 4CKQA 1QI2A 1DWIM 3AIVA 3ARVA 4Z2JA 4CUCA 5CPSA 5ABFB 3HG4A 5D9PA 1NQ6A 5LA0A 3VD7A 1XD1A 2WW5A 4JHOA 1Q6GA 2YOCA 2GJPA 4U3AA 3HG3A 4W5UA 4LX4A 3GXMA 2XN1A 2JIEA 3UR8A 4MB4A 6TAAA 2EAEA 1UD3A 1VEOA 3OLDA 1LLOA 1B3WA 4YN5A 4AZBA 4AZ6A 1WCGA 3T2PA 1CNVA 4TTGA 1GHRA 2X0YA 4LQ1A 3DHPA 4FNPA 3WF2A 1N82A 4TOQA 3DYMA 4W87A 4V2XA 2XJ7A 1OD0A 1IZJA 1B3VA 4A3YA 1J10A 5C8BB 1OM0A 2CHOA 2PC8A 3ARQA 1AMYA 1BQCA 4DWSB 1VFUA 1MW1A 1TVNA 4P8UA 3AS1A 1BLIA 2VZSA 4P7OA 2ZX7A 4W93A 1FA2A 2J7GA 4F66A 1FH9A 2Z1KA 4ZE4A 2AAAA 4DWSD 5HDRA 4MTVA 2XFRA 3VGGA 1V3KA 1B1YA 1DWGM 1CXLA 1UKOA 2Y8KA 2V3FA 4GIAA 4L4PA 2XM2A 3BMVA 3HG2A 1ZBVA 4ACYA 1QX1A 1DEDA 2E9MA 2V5CA 4H41A 3U5YA 4GI8A 1MQPA 4PTMA 4CU7A 2E8ZA 3CUHA 4W88A 4DO6A 1UWIA 1BYBA 1E4IA 3K4AA 2WMFA 3IK2A 3WH8A 4J3WA 4AW7A 4D6IA 1UH4A 4B3LA 2WZHA 3TV8A 3BUBA 1UR9A 3EMCA 3AMCA 4Z2LA 5I3DA 3KE0A 2EBNA 3L4ZA 1HTYA 2JE8A 4AISA 1B9ZA 1E5NA 3N13A 3WNOA 1TA3A 2UY5A 4OJYA 1MW3A 1FFQA 2D23A 1VRXA 4IUGA 2OSXA 3PHAA 3LXAA 4QCEA 1JXJA 3KL3A
chains in the Genus database with same CATH superfamily
1IVTA 3UX9B 2X05A 3TNBA 2QUVA 3TBVA 1U92A 1JZ7A 4N9DA 2O93L 4HG4K 3ULUE 5AB3A 1OLZA 5M95B 5AUMA 2X6CA 3NIGF 2EVGA 1S9KC 3SBWC 4PB3A 1AQKL 4RAVB 5LNVA 1P7QA 5AB2A 1XBXA 2O5YL 3DERA 4XP1L 3PNRB 2X4SB 1F11B 3H70A 2DSKA 4TXVB 4PJ9B 3EDEA 5F7LB 3C09C 3WFDH 1F73A 3EH5B 2EINB 4RZ5A 3P40A 1AGEB 4Q89A 3QHMA 2CO3A 4GFIA 5D8ZA 3ABGA 4AW4A 4HT1L 2G50A 4NNYA 1M41A 2ATMA 3TNNA 3Q5TA 4P8VA 3VW3L 3FQWA 6TIMA 4PJFA 3N4EA 4J4PD 5HDBB 1OADA 1TYRA 3FO0H 1MY7A 8XIMA 5LB1A 3OR6A 4NQSA 3QZWG 3EHBD 2Y0SA 3E9UA 5IJVB 3TBWB 4CSZA 1BQSA 2NXIA 1TTAA 2VN4A 3OTTA 3C87A 4DGYH 4OQTL 5GSVA 4LV9A 3GAYA 4C54A 2Z31A 5DVNA 3QDJA 2DQTH 4NGHH 3AQZA 2HJKB 4XO4A 3IB4A 1IC5L 4NM8H 2CD0A 3DAQA 3RLGA 4AJ0A 1HIML 2BOEX 4YXKH 3UGUA 5J6GB 3GSVA 1Z41A 4BXSV 5B8CC 3UQNA 2APSA 4H88L 4QRAA 1UXMA 4GUJA 1SPQA 5ADPH 5EGRA 4JN6A 4ZVJA 4Q4EA 3HNSH 4RGNE 4MVAA 1H50A 3B7UX 4GAYB 2V9QA 5HVFB 1UZ6F 3HLKA 4G9DA 2WINA 3HZMB 1FVEB 1NGYA 1NWOA 1OTUD 3LKRA 5E70A 1XQKA 5E4AA 1H5BA 4ZENA 3ZDWA 1XGEA 5D8WA 5GGTL 2AL2A 2I5IA 4MMYB 3MLSL 2XTJB 1S5NA 4RNHA 2UZYA 4IIGA 4JTAA 1T5XB 4XAWH 2DQGH 2GIXA 4KTGA 4GZEA 1QZ1A 4W6WB 3G2GA 5FYJL 5IG7A 1USZA 1J9CT 3CUJA 3T2LA 1GGCL 1CI5A 4IQDA 1T1XB 5FHBL 1JGUH 1OWRM 1UZ8A 1TUPA 3H1ZA 4XC1H 4D8PA 4K2SA 2CHWA 2L8AA 5CN1A 4YK4B 4WK4B 4G6JH 5E8DH 2FEEI 4HUWA 2JIXA 5IJKA 2QIWA 4OB5H 3GDMA 2CLEA 2FZBA 4U1NA 4WNQA 2NSXA 2AGJH 4P23D 3RVVD 2CKBL 4GLRI 4MNHA 2OMWA 4LEOB 2P8MB 3D09A 4IPNB 5BQ7A 3KPNB 5G5IA 2NXGA 4GISA 2VX6A 2GW5A 1JCVA 4OLZH 5I18L 3QSRA 3M0YA 3A6CL 1Z9AA 1OE2A 5CPQA 1FPTL 2XN9E 3QP3A 2HA1A 5E24E 5L4JA 1E2ZA 1TXKA 3U25A 1RJCA 1TZIB 1NWUA 4IGHA 2QEZA 4N2DA 3X3GL 1OT2A 1A7QL 3CFEA 4B15A 2DWYA 4RBPH 2VW6A 4H6QA 1F02I 1TJPA 3NT0A 1V6VA 4D9RD 1MCEA 1N18A 1PBGA 4EAEA 3UAJC 1JZ8A 1ZGLP 1MQRA 3E5PA 4HALA 3UIYA 4YTRA 2EIMB 4J39A 3IM1A 2R69A 4RNFA 1BF5A 2IXUA 1CLVA 1NZRA 4D0DA 4WZ9A 2OL3B 3NZPA 1D8CA 3ZKXC 2A7PA 1G6RL 1P43A 2H90A 3ARRA 1GYWA 1KIRA 2XOTA 1W1PA 4ZW3A 4OJDH 5C09A 1KJ2L 3GI8L 4XN5A 4WXZA 4ZUTA 1R3KB 1F56A 3PQYA 4PCYA 1E5JA 1FFRA 3RVTC 1EXBA 4ADGA 4IPIA 3VI3B 2I24N 2OSYA 2FDMA 5HYQA 3VXSA 4ETYA 1AR1D 5K4XA 3SGEH 5LGJB 2YB1A 1T03L 4P2OB 4R5EA 5EU4B 4ACZA 4GAJH 1IR1A 2VJ0A 1B3YA 1U3HA 3P4OB 2BSSB 5T1JA 5FXCH 2RJGA 2EEDA 1OSYA 1LRNA 4MDOA 5IQ7H 4HMNA 2AQ1A 4IBVA 2HVJA 5C9UA 2QSQA 2FGWL 1JYWA 4FYQA 2I69A 3QDGB 1A5KC 2ZP0T 5CN3A 1NIFA 4R34A 4W1TA 3Q2NA 2NW2B 2OMBA 4YN3A 2FJKA 2PURA 2PA6A 3W7HA 3U2CA 5DRNB 4MCYB 3W5MA 2Y5TB 3M1OA 1AAJA 3WYRA 3W3OA 1NSNH 2YARA 2DZPA 4KFZC 4WFFE 5DJAA 4JTFA 4EK7A 5B1JA 4IBQA 2A73A 3QEHA 1ADWA 2IOOA 3W2DL 2CCLA 4H7CA 5C0BB 3WLWD 4ZNEA 1A5BA 4GUQA 3X1NA 2Z27A 3Q01A 1NUNB 5C0BD 3VXUA 4EACA 1IC7H 1E9QB 4XD6A 4I18C 4DHGA 1DQWA 3TEUA 1DQTA 1R3WA 1I1WA 2WLLA 4B7IA 8XIAA 3OSKA 1OQFA 1WAWA 4HC1A 2NPLX 4AZCA 1JI2A 1Q9KB 3IS4A 1XLJA 5IV2B 1L2UA 3H4FA 5AKSA 2OX5A 3UPBA 3S34L 4OZIF 3O9WC 2EDXA 3B6SA 3QDJE 1CDBA 4U7MA 2CNCA 4BKLB 5FJPA 4R6UA 1EGJH 4N2IA 3PNWA 1UUSA 2E6DA 5FUOH 1MG3C 5D9MA 5ICZB 3EFFA 3SDCB 2V8LA 1CEOA 1OQXA 4XX5A 4GBDA 4TIMA 3IBOA 2B31A 1GQIA 3BUYB 1W72H 4OD1L 4KDWA 4CQ8A 1HL5A 3G04B 3OLEA 5TQ2H 4GYBA 5KVDH 2PUZA 1P0KA 1F3JB 2NZ9C 4LSDA 2DTML 1EDQA 4HXAL 5AY7A 3QOKA 4IIQC 3C5SB 3V79C 4U1IA 4M1RA 3F05A 1OCBA 5AYUL 3TR9A 5AVSB 4GHRA 2ORBL 3BSZA 5L9DL 1G69A 2X4QA 3B5GA 1IE7C 3LI1A 1QOQA 3B4UA 1KKRA 1T89C 3P73A 2Z26A 3B5HA 4ODWB 4Y4FC 3G6MA 3L5WA 4N2BA 4XTIA 1KY6A 1UKTA 5C0DA 4BA0A 1KC5L 2NVDA 1E0VA 1LJMA 2RDXA 1V6WA 4M7KL 5D2NB 2VEPA 3XISA 5D1XE 4K7PX 1CDIA 3G3MA 4IM4A 3SGJC 4J3SA 4G1NA 5L4FA 3UZXA 3LH9A 4UM9D 4X2RA 1KM5A 4JPIA 2XJKA 1BD2B 2OLHA 4CDHA 1P2CA 4LARH 3SDXB 2EC9T 5DMKA 2OTWA 3LCXA 1BD2D 5AC8A 1K6QL 3WQVA 5T3ZL 2VEMA 4W6XB 3Q4DA 3TWYA 1PDKB 4O1EA 5EIVA 5KSBB 3L4WA 1CF8L 1VACA 4KUZH 3ANVA 1XX1A 5HWJA 3DG6A 3JW7A 2N7BA 1YQVL 3HB3B 2KUTA 4GAFB 1Z8AA 4BZ1A 3H54A 1HUVA 4R5VA 2VFGA 3IFPA 3VH8A 2OMZA 3SR7A 1F4YH 3L3JA 3T4AC 2HTKD 1FCVA 5DSCB 4H5SA 2KPNA 1E72M 4Q4RA 5TDOA 5KVEE 4G71B 1KXQE 4GC3A 3QCTL 2Z1BA 1J5OL 3V5FA 5CCZA 3B5TA 2VFIA 2X1RA 4BHYA 4RQQB 3TFCA 3DROB 5CJBA 4HHAA 3AFLA 2J3SA 1FRGL 1QSFD 1SJHA 1S46A 2HX9A 1OT1A 2XPKA 3R7RA 4YFDB 2JH2A 3VXQB 4OAWA 3SDAD 1M05A 3W2UA 2OP4H 4L9LA 1F3XA 5C09E 2D03H 4FMKA 4GAGH 3B97A 5E6IB 4DELA 1AANA 2X3CA 2BSCA 5TNVA 3W1TA 3O41B 3BAWA 5JQ6H 1MFAH 4AMWA 3MNWB 4TVPE 3IDNB 1F3EA 2W07A 2A3BA 1A9EB 3LZLA 4YGVB 2BVPB 4HWEH 4DK6A 5C0JB 1FX6A 3C6LB 1W2PA 4Y8DC 3VXSE 4D8AA 2NV1A 2YPLA 2Q0ZX 3BZ5A 1SYSB 4JG5A 3V4PL 4MS8D 3QIUB 2HB0A 3ARBA 5E99L 3KTCA 3ARUA 3LCGA 4WY0F 2C4FU 4QITA 1XH0A 1CLKA 1L5GA 3OJVC 3QIUD 3WQGA 2C3GA 1XGTA 3T08A 2X2UA 4Z0SA 3EJUA 4KOBA 2R56L 3C6SB 3UU0A 4OKVA 3HJ0A 5KVFE 4TRPL 1E0XA 5LCVA 4PRAA 1ZS8A 3H3KA 1QNQA 1UHVA 1WFNA 3VYNA 5HYIA 1CI1A 1SY6H 4NZUH 2GQ3A 4FI4A 3VGEA 2I27N 5CS7A 1U91B 5KMYA 4CVWA 4YHGA 3VIJA 1TV2A 1JGVH 4HH9B 2ZXCA 4JNYA 3EX3A 4LUJA 4IL0A 4PUMA 3V6OC 3M47A 3QUKB 4E41A 4JXCA 3U6RB 3ZIYA 3U7YL 3AAZB 3IGAB 2PDPA 5DJ6B 4JDEA 5AW9B 5EUOF 4KTEH 3V0VB 4ZNEE 1XZ0B 4HW6A 2MNUA 5A69A 4OT1L 5F9OH 2YBRB 2FEDD 4K23L 2E6YA 1R3RA 3MRMA 1SLUA 1QT1A 2NW3A 2YKLL 1N7KA 3MMDA 4WJXA 1B3ZA 3EMQA 3EB2A 3K1DA 2PUQT 2XGIA 3FK4A 4OLWH 3L54A 3SUUA 4Q52A 2RQEA 2ZWLT 2Y1VA 3L3HA 4OQVA 3T3PE 2FL5B 3SY6A 5DO2C 1DWHM 2Y1ZA 2VT0A 4UDTA 4JQ3A 3EGSA 4AD3A 1T83C 4XXWC 1IFGA 4YSEA 2JGYA 1MXSA 5DXXA 4G9FB 2ZFAA 4ZFOB 2V68A 3H8AA 3CQQA 3U48A 1UP0A 5D09A 1ZGLA 1PZUB 1CGYA 1HWWA 1UB3A 4PTXA 4G9FD 5DRIA 3WJLC 3VU2A 1WHOA 4FFZH 3IJHA 4IRJC 3VSVA 1H1YA 4AQAA 2RGLA 3V0IA 2VEIA 4OFYD 3P30H 3CWHA 4E0CA 3CFMA 4RR4A 3VSQA 4ZFCA 3CWGA 4LUTA 5FF6B 5DCEA 4EZLA 1RQEA 3SBWA 2FZ3A 2Q20A 4PGEB 4DW2H 4L4VE 4OLYL 2N1KA 1BFOB 4R97C 4N6RA 2FH8A 1A14H 3ERPA 1OK4A 4I0PC 4UT9H 2EKJA 5A8PA 1QPQA 1WDPA 2VLJE 4GZ7A 3BPLC 3HI5L 1KLGA 1NEZG 4C4UA 1XD0A 2RMNA 3FTSA 2KS0A 4PJGF 4CEUC 1U0QA 3LQGA 3YPIA 4KVCL 4GRWF 2EPHA 1XC4A 5T3XL 4Q0XH 4PY8I 3SBQA 4MOZA 5FA4B 3V4VB 1S3RA 2IAMB 5CCKH 1D3HA 2WUBL 3CVHH 3QQ4A 4HQVA 4X7FC 3W24A 3V5OA 1WZMA 1GW0A 3QW3A 3GH7A 4H9ZA 1KBVA 5SX5K 2DQEL 1CBGA 4AD0A 1QFHA 5F9WB 5EO9A 4J3TA 1E90A 2WKOF 1RMFH 4XP4L 4PP2B 2IXQA 1DUYA 3ULUH 2JB5H 2R59A 3CN3A 4MFDA 3RWCA 4PUUA 1II4E 2QJJA 4IXXA 2OELA 3SSGA 4GZJA 4JY6B 4LKCA 3KW3A 4Z76A 3BAKA 4QTHB 1WKFA 3SPGA 1TFVA 3O4LE 2DIJA 3FU6A 5KVMC 3QFWA 1MHEB 3GS6A 2ZZ5A 1I8JA 1CGVA 4P46C 3KPLA 1R7AA 4XVUD 4OFCA 1G7IA 4B4FA 4RGNC 1UEMA 1DZBA 3TH4T 4LCCB 3GC4A 4WK9A 4B6ZA 4TL4A 3LKQA 3MLZH 4LOFA 1FCGA 2WOYA 5EFIA 1RKRA 1ZXKA 1E4XL 3W7GA 4LAZA 1HJVA 3RWFA 4OCYH 4FOMA 4PV8A 1TYEB 2H32B 1GG0A 4N9CA 5CZ0A 4Z7WB 1BVNP 3QQ9C 5AW2B 2VUNA 4DESA 3QH2A 4IBWA 1PZ2A 3CT2A 3R89A 1PZDA 1MLCA 2G9HA 4P7LA 4AIOA 1JFQH 3GIVB 5K9KB 4F0MA 3GK8H 2WCAA 2J57A 5LAXA 3E8VA 3BHBA 4O0ZA 2J1YA 4LXFA 3VDHA 1Q6RA 4LRIC 1B0WA 4KWVA 2OKOA 4M43L 1JPSH 5E8PB 4Z7VB 3ENEA 4G1EB 3GQFA 2DKSA 3DTXB 4PODA 1AOZA 5E09A 4YR6B 4LYRA 2J25A 2VXQH 3N3TA 3F2CA 4HAFA 1NC2A 4PW4A 1GTFA 4H8WC 5HQMA 3NQBA 4S3BA 3E1F1 4C8XA 5CP7A 1IBZA 1TQXA 4TUJA 2INEA 1S7RB 3EADA 1RUQH 1HCFX 4UQEA 4E41E 2WZPA 2GG1A 2JEPA 3X13A 1KFGA 1EYEA 2H3NA 5A8OA 4DUXA 2DDQL 2VLKD 1CQYA 2V6AA 3HE7B 2EE0A 3UAJA 2WC4A 4KX7A 4G42A 4LVOB 1CS6A 3NGFA 2FYMA 3UG8A 1AKPA 4NP4L 5TH2B 2VITB 1PL9A 4ZO6A 1QPNA 3S9DB 3SDYH 4R83A 4BWWA 3NEVA 1S9WB 3EKLA 3Q3GA 2OXGB 2XH0A 3U2OA 1S7VB 2L04A 2NZIA 5I1JL 1I3VA 3ME3A 4HGWA 3UR8A 1N26A 1TLKA 2Z8VC 4ZQKA 5HBBA 3G3DA 5CJQL 3WBWA 2VH5L 1Q66A 2NY0C 1FE8L 1O0VA 1BQLL 1WAUA 3WF2A 1OSPH 5F89A 3ATDA 2P8BA 5KITA 1S7SB 4J6RL 3LKPB 3OKKA 2ADGB 3SO3C 4NWUH 5EZIH 1EJ7L 2VZ3A 4MXQC 5F9AC 1ECYA 4K07A 1A3LH 1T7XA 5DA4A 4RDWA 3G22A 1ZZMA 3B4NA 5CCGE 4LY8A 1T66C 4LSUL 5H35A 3BX7C 2DLEA 4LSSL 5G5DA 2Z35B 4US5A 1BVWA 2E8ZA 3GLZA 4Y4HC 3LGEA 1E51A 4YTSA 2KMWA 5IF0B 3GBML 3ZTEA 4ZMZA 2DJXA 4X6DF 1EGJA 5FFGA 4X6CA 1FVDA 2E86A 1VRXA 1DJSA 1TO3A 2XA8H 4PMNA 3N9SA 3IXTA 2AGTA 2Q5BA 1C9SA 3Q6GH 2PDUA 2BNQB 5IW3A 3HPFA 3KZSA 1RFDH 4U6VH 1W72A 1IEAB 4MKMA 5EMYA 5BV7C 2BOBA 3W7KA 2ED9A 3F7PC 2GC4C 4BF7A 3FFCE 5IEHA 2R9RA 2HRPH 3BZ4A 4FJ6A 3SJVB 1QR4A 2BGSA 1XSJA 4EN3B 3P0YL 4I18A 1F6AA 2FD6H 2H41A 5EF3A 4C65A 4NBYB 1Z3NA 2Y7MA 2QPSA 1CGSH 1OFAA 3ARGD 1AJZA 4RVBA 1J5SA 4EN3D 2DQUH 1W0MA 3ZKND 3CX5K 3DX7A 2VERA 5FSDC 4GXPA 4NUQA 2VQ1B 3DV4B 4YVXA 1XRVA 3O9WA 4ZTYA 2HVNA 3UERA 4F3FA 3RVUC 4ACTA 2CCVA 4O8AA 3W7OA 3RTQC 5REQA 4N8CH 4XPFL 5DI8B 2ZZ6A 1RUPH 1A0DA 2FHFA 3WKNA 2ZAIA 1OQOA 3CH0A 3CDZA 3MMWA 1JDCA 4Q9QH 3AGVA 4E42B 2GJLA 5JHMA 4M48H 4UI2A 3NIGE 1H8NA 1SHXA 5LO7A 2OMVA 4L4TB 4R9HA 4R96B 1GZPB 4ZMXA 3UJTH 1QK0A 1OM9A 4ZMTA 2UX7A 5EU6B 4ZTPH 2KLSA 4Z1AA 5DMGC 3VNYA 5T8IA 4IIQA 3U4BH 6PAZA 3QQXA 4OFVA 2YN5A 3PWVB 3DHDA 4XIAA 1ZHKA 2EKGA 4FABH 2BMKB 1JZDC 4QOKD 2YD4A 4MWAB 2P1YA 3B2VL 3LRGA 4KEMA 5EYWA 1MIEH 1HQRB 4PTTB 4EVNB 3W0KA 1INEL 5IBTL 1D6VL 3FU9A 1P7KA 4Y4FA 3TC6A 5AOLA 3GSRA 1HNFA 4LUYA 1BJ8A 1HOCA 4N22A 25C8H 3PJNA 3I2CH 3QDMB 5C9WA 1ITXA 2BNRA 3FS2A 2AEWA 1S7XB 1L6XA 3SYOA 5I6KA 5MKGB 2DEYX 2XFXA 4AT6B 4FAAB 5TE7H 3LXBA 1FNGB 2X0HA 4TLUA 5D1XC 4I7ZC 4I8DA 3T2OA 4PFHA 1UXSB 1VQTA 3SGJA 1GTHA 4JAMB 2EIZA 4AY0A 1XR9B 1XBDA 1ZLVH 1GJWA 3BP5A 3H9SB 3M7OA 3WFEH 4IP5A 3OZLA 1J05B 5J9PB 2HT3D 3CSYB 2YPIA 3H9SD 4PRPE 5DK2B 3K0YA 2UZIL 2Y7SA 4HCHA 2YQ2A 5E51A 1TPH1 2YZRA 1GPOL 4CD8A 4NNPH 1AIFB 3RI5K 3P2DA 1K5NB 3NSYA 1FJ1A 3UO8B 2I5QA 2EE3A 4NU7A 3OIHA 2DU2A 3UPCA 1DDHA 4FAMA 4JTGA 1UZ6E 5DF0A 2OMXA 4ELDA 3T4AA 5C08B 2PNDA 3QNYB 3EJSA 2X89A 1F8IA 4F7MA 1LJYA 3D39E 4M6AA 2VAAB 5C0RH 3UBXA 1B57A 5C08D 2PYEE 1JNHB 1JNLL 2OJ1A 4G8GB 5F0MB 4DP2X 4WUKL 1SY6A 5HANA 4N1EA 1QUNB 5ALBL 3GKZA 4NXKA 2LLGA 5DFWH 4D6JA 2P42B 4L3AA 4Y1AB 5JW5B 3GSNB 1RPQA 3MV8B 5T5FL 5BO1H 3NZ1A 2NMSA 1LCOA 4UDUB 4YFLF 2FB2A 1UD5A 4PBVC 3MV8D 2BY2A 3WBXA 3O2DL 5AW0B 2XH7A 2AEOA 2E7LC 1UD2A 5JXAH 1OC7A 1DYSA 4UOJA 2DW6A 4F9PC 2MTPA 2WZAA 5IMLA 1XKYA 1MJ8H 3DX6B 4BFKA 3WH6A 3N18A 2NY2C 4FQ1H 3EJTA 2WKJA 3T09A 2O92A 1RERA 3NQVA 3T44A 3LHVA 4BGDA 2FWOB 2JJVA 3O3AB 3GXUB 1SVZA 4RNRB 3QFGA 4XGZA 2EGZA 4LF3A 3DN5A 5KVEH 1X8FA 1NL0H 1K4DB 4HOMA 1V8EA 3W2KA 1W8NA 1E28B 2I5GA 1GVOA 1EDGA 2FEJA 3A21A 4OF0A 3T4WA 5HWMA 2PO6B 4AENA 1YYLL 3ZOAA 2N7SA 4KZDH 4XKYA 3CHEA 1AS6A 1TMCB 4FFZA 4WQOA 1MWAB 2HUEA 3P77B 4S2CA 3V6OA 3G5VB 3ZDZF 1O12A 5FYLE 1H3TA 4JKWA 3D47A 3WQPA 1NMAL 2BVYA 3G1HA 4U3CA 3MXWL 5I3FA 3EJJX 3P4MB 5AN7A 5DRXA 1EUUA 4HHLA 4TVPH 5F3HA 1DN2A 5C7XH 1UWXK 2WPBA 1H7NA 1YJDL 4GSDL 4X0NA 4NYUA 4JFPA 4O14A 5JHDE 1LO3H 1RJQA 4AHPA 3HLAB 3O4OC 3IJ7A 4XI5D 4BCEA 4EUPG 3P11H 2ACSA 3OJDA 3EG9B 4UT9A 2ARJA 1CXEA 4XWGL 5I66A 5BXSA 3S88L 2X0UA 5FKPB 1PZ0A 4A7UA 4PTNA 3TWAA 1IAKA 1T83A 2PP0A 3JV6B 4NUMA 4XXWA 2OW6A 1CCWB 3PPHA 2GY5A 5GGRB 1CMOA 3C2FA 1FFOB 1IBFA 5I8CA 2OQJB 5F1IB 2WCSA 5KVFH 5J1TC 1DVTA 1LYQA 5EO0A 3Q1SH 2J62A 2O6FA 1KFBA 3E2VA 3I9IA 4A2GA 2X6AA 3DSFH 2AQSA 3WJLA 3ZJKA 4F7PA 2CR3A 3PSWA 3CVHA 4WEMB 3PZTA 2XPGA 2P3ZA 1IL1B 4TTDD 1WV7T 2EACA 3SJ3A 3VFPA 1JRHI 2JK2A 3FCSA 3WUWB 4PJ5A 3MKKA 4R27A 1ISYA 2P26A 5DY2A 5C2BH 4XZ9A 2GJZB 5I5RA 4YSQA 3HMCA 5HDLA 4KNQA 4RBPK 5AW8B 1HI6A 4U1SA 3QORC 2D3JA 5ADOH 3MRPB 3TA3D 1R3VA 4QFUA 2PDBA 2BJML 1CG9A 3AYVA 1M57B 5DUBA 4M6UA 3F2BA 3WFZA 4JQAA 5HDQL 3CZJA 3CBRA 4I0PA 1X1OA 1YA5A 1CB2A 5GGSB 2BNRE 3ZKMC 2RAMA 4W6YB 2E6FA 3QJUB 1E4WL 4OCSH 3OWEA 4CNIB 5FO2A 4J1OA 5D7IF 3QDHA 3OHXC 1EFQA 4F2EA 1V08A 3NJ3A 2CR6A 2WWOA 3W86A 3OHMB 4KERA 4IM8A 2OK0H 3RPBA 1YY8B 3DGRA 5L6UA 4WJG3 3U0TB 2ZDSA 4OZIE 5BZZA 2V38A 2D3NA 3MBWA 4HQQL 3QPXL 4PCKA 2GTWB 4RKAA 3VOIA 1SVDA 1I6NA 3ARYA 4I2XB 3C12A 1PYWA 1VPOL 5FD0A 2UXTA 3TT3H 5ICXA 1HHHA 3ESOA 5D1ZD 1QBML 4H0IA 2VDKB 3D0CA 3A12A 2DSZA 2YW4A 1TJHL 4YLWA 1HINL 5DTFB 1G67A 4NASA 3MT1A 4FTVD 2CBTA 3C9NB 5FA3B 3CN2A 4OZ4A 3BSZH 6PTDA 4DZHA 5E00B 1QW9A 1DVFD 2F8XC 2W0LA 2X4UB 4NWTL 4PWHA 1H7PA 5E4EB 4CNOA 3M0XA 3JUZA 1DL7L 4HJWA 2QKSA 1Z0NA 4F2BA 2CSPA 5DYOB 4HKBB 1ZFJA 3HN8A 2VXQA 3RRAA 4RMWA 3CZLA 4YE0A 5CLXA 4P46A 4JEQA 1R5IA 3LEXA 1XIWC 3QHZH 2Q76A 3PZMA 1JWSB 4OQ1A 4W85A 4H7VA 2AV7B 4Q9BA 1YMHA 4HD5A 3CYJA 1NY1A 1TPC1 3MO7A 1AD9A 3GX9A 1RVFH 4JFDA 3DMMC 5G1YA 1OP4A 4NQEB 5ABDE 3P9MA 5EEYA 1CICC 1E9PA 1PLCA 5F9JB 4M4RA 3TTQA 2DORA 3M17B 2WQXA 3FYIB 4L8SB 3POCA 4U3HA 3QOMA 3WFLA 3ZDXB 3QUZC 4YHPA 3GI9H 1HDMB 4MXVF 2M83A 2E46A 3UJIH 1R38A 2AXJA 4HHHA 3SURA 2ZQ0A 3A5FA 4RZCA 1AE6L 3V35A 1HT6A 1MW0A 2ESVD 3IGXA 4RE4A 3MKGA 4WZHA 4R7WA 5JIWA 1H3XA 3IDXL 5EUKB 3FUFA 1OIOA 4LRIA 4B3ZA 5CGTA 4K5OA 4CVZB 3C2VA 4HIJB 4AD1A 3W3BA 4P59H 1PIFA 3VZXA 1G7JA 3RWIB 1M6UA 1KBWA 3KEDA 4IBYA 2OQYA 5HHME 1IC0A 1UT9A 3WBEA 1SRDA 5IFAL 3K74B 3GLAA 2O5ZL 1YN7A 3FHEA 1PNDA 5EOQL 4Y5YB 2R4SH 1ZJAA 3CAKA 2FX7H 4Z7UB 4M1GL 4QLJA 3MNZB 2BGNE 3LENA 4MD0B 3TN5A 2XN9A 3LQMA 5M94B 2W91A 2RH9A 3MUZ1 2WQ8A 3KPMB 1DVUA 4JFZH 1E42A 1DQQA 1NGXA 2WLKA 3ULSA 2VMDA 1SXCA 1YLBB 4WTXA 4ZR8A 2Q8LA 3TCSA 2DIAA 1CYWA 3U6XA 4PS4L 3QXTA 3HGRA 2DMCA 2Y5EA 2E8YA 1HHKA 1VKFA 4OH2A 2WXQA 4HHWA 4X7DC 3WE6A 4BFBD 4M62H 1U8NA 2CG9X 5J12C 1PXGA 4K5MA 3I65A 1NCUA 2C9XA 1L7IH 1L3NA 3ARTA 4ABWA 2G96A 4ZL1A 4BH7B 5LXGL 4FA3A 1VLXA 1HCVA 4FNSA 1A21A 4NCDA 1TZGH 1MUMA 3QUXB 1H0DB 4TM9A 4Y9CA 4G6KH 4NY2A 3N41F 1N2VA 2HXTA 1NCIA 1IZCA 3QUXD 3SCMC 3FSOA 3SD2A 4BFOA 4GY4A 3QHTC 2FJHB 5IQMA 1CFQA 1ZXQA 4L29B 5HHXL 3ZFHA 2RDTA 4B5EA 2ITCB 5E08L 3KL5A 2NXZC 3N85H 2P43B 5EWIH 1P1VA 4Y4HA 3MRDA 4LLDB 4QM1A 3GNRA 4JFFA 3N6JA 2WB1A 2ZKYA 4L9ZA 2XQBL 1FNEA 4JHAH 3WNKA 4DJFC 3HC3L 5F1OB 1MDAA 3NTCL 4PY7A 5D9NA 4E9QA 2TSYA 5BZDB 2QNEA 1YDOA 4IU3B 2G5BB 5EUOE 2XBZA 4W4OC 2IDUA 4PFEA 1EJFA 3TV3L 3IPWA 3Q05A 3O16A 3RWGB 2IH1B 1O9ZA 1R7OA 3OM3B 5LGHL 3CGTA 5E6YA 4UIKL 3ZYIA 3CX2A 1O95A 4PJ9D 4BFEA 2Z24A 5TPWH 4RFNB 3MLXL 5GGVH 4JB9L 2WC3A 2FQFA 3UY7A 4D0BB 1VFLA 2VGLM 4Z0JA 1L6PA 3OAYH 2OV0A 1R5VA 4AYFB 3KBHE 2G3IA 1F4XH 4NZ1A 2DI7A 4P7QA 5AW4B 1LDCA 2OSLB 5IHUL 3AS3A 2EEXA 5I8EB 1BP3B 2H26B 1RVKA 3WF4A 4KTDH 3DVGA 3PAUA 3FFDB 3VRLE 1CE6B 5FEZA 3EH3B 5E1IA 4C6MA 1V79A 1QLRB 1OFRA 2DD8H 1U58A 3RLSA 3HEIB 2BG5A 2WCPA 4QRUA 1GVIA 3NCMA 3RTQA 1LBLA 2A74C 1PW3A 2H45A 5FF3A 4EZKA 2BS9A 2ZVRA 4LLUB 4O5LL 2DQJH 2Z65C 4EN2A 2AV1A 1HXJA 2Q01A 3RFZB 2O4EA 4S1DD 1NCCL 1UJPA 2CKNA 5K9DA 3NXLA 2DP3A 4N8VB 4L0PB 3IN0A 2NDFA 2XWTB 3JR2A 5F1NA 4F93B 4R4FH 3VIKA 1FWCC 2ZCLH 5CZRA 3MY9A 3QEGH 1KTRL 3VXTB 1IC1A 1KENL 4K4KA 1EA9C 5HI4D 3KP1A 3PB2A 1VRSA 1X4XA 5IW1B 1CR9L 2CXGA 3IV3A 4XBEH 5JOEA 2X38A 4JFDE 2H1PL 1QPRA 2CLVA 3KWTA 1XGUB 4PJGE 4GQGA 3UTQA 3LPOA 4GUGA 4KUCD 1OCQA 3FZUC 1TWDA 4GRWE 3CFIC 3H7BB 1UWXH 4OOUA 1GGBH 2XTJD 1U8IB 1FVCA 1WFJA 3AIRA 3H26A 4AXNA 5D1XA 2YLHA 1VYSX 2BV9A 3BLKA 1HL4A 4NAMA 4HYTB 2ZA2A 2J44A 2NY3C 1RPKA 4L6OA 3NCEB 4DP1X 5D2XA 1QAWA 2YCEA 4XZHA 5CSGA 5AC4A 5CG0A 2WXGA 1NDMA 2A4ZA 4QGTA 5DCBA 4B9ZA 3KOWA 2J6VA 3APGA 1O5QA 2HT4D 5I74C 3MRKA 4QISA 2NX5B 3WLNA 5BMFH 4YHOL 1W5QA 1MY5A 2BC4B 4WUUA 1M4KA 2OKTA 2PDJA 2AABL 3JTTB 5FECA 5CSZA 1V3HA 4JNMA 4KGJA 1X4ZA 3BKJH 3FRPG 1TCRB 4HJJL 2ZCKH 4YYCA 4A1RA 1E6NA 3TYEA 4K71C 3TTSA 4U1JA 4NO5A 5HVGB 1HL9A 1HS6A 1AD1A 1AGFB 4JHZA 3DBSA 2YA0A 1OPGL 1KXQA 2VMEA 1NUGA 2UVFA 4HCFA 3VJ6A 2IV9A 3KGUA 1J8HB 2YL8A 4WI0A 4QHNA 3SPJA 1F6KA 2BOLA 1BYCA 5TK2A 3ECUA 5TE6H 1FLRL 2Y85A 1Z9OA 3DHJA 1BRLA 2OKMA 3F5JA 4JFSA 3Q2WA 2AXHA 2J8UB 4YBHA 2NX9A 2B59A 4OF7A 2OEJA 1FWGC 2Y23A 3HC0B 4Z0BL 4HJ1A 5CBIA 1NWSA 4CKQA 1QI2A 3QY7A 2RTTA 1A6AA 2CO4A 2E7LA 3WHE1 1FCBA 3NPZB 4Q7DA 3UWEA 4MQSB 4KRMB 4BH8B 3M0KA 1UBSA 3O6CA 5M2FX 1R9YA 4ZUWB 4KK9D 4AZ6A 1TV4A 4DJDD 1UW9A 4N9GA 1ITUA 3TNOA 1I31A 2GJ6E 1XGRA 1AGBA 4Y9NA 1AY1L 1QUMA 1I9JL 3O0FA 1HTIA 4P2OD 5EA0H 3UYPA 5IT2L 1EZUA 4JFFE 5F9DC 1RULL 4I3GA 2FZNA 1EP3A 2CDFA 3KOZA 5D7LE 1H7XA 1OALA 3S37L 4GIAA 1IAIH 2RFXA 3G08A 4QO1B 2XSXA 4L80A 4YDNA 3CUHA 4GD0A 4W88A 1A7OH 1SYVB 4FADA 1E4IA 1KTDA 1R5YA 1EC9A 2UXVA 3WH8A 3LLXA 2ZOKA 5HYEA 2MJWA 3QDGD 5B1BB 3EMCA 3AMCA 4Z2LA 4HULB 3RPIB 4V1DB 3KPSB 1F4WH 1Y8BA 4D3CH 4CVXB 3VXRB 3VKCA 2X7LB 3ECBB 2GJJA 5IGXL 3NVTA 4V1DD 3KPSD 3FOLA 4KU1A 4R5TA 3S9YA 2J8TA 3OF6D 2NNAA 3VKKA 2CHZA 5ESAB 2X42A 1DJYA 3UDWC 1EVUA 1TZZA 1D5XB 2Y6SC 4L4JA 4AZ8A 5HGHB 4PH8A 4KRZA 4Z08A 2Y70A 3EF7A 3GDKA 3WSQL 4UCFA 2NLJA 2KZHA 4FHJA 1D7FA 4X7EC 4BBWA 4Y8EA 3BH8B 2GZXA 2ZUXA 4K3HA 1CBVH 4NCC1 3NZ8A 4DIAA 2GI7A 1LK2A 3BE1H 3IF1A 3CQ0A 3B2UC 1EHXA 2A7NA 1ODUA 3G6DH 4NUGH 3FUJA 2OMAA 2I9TA 5JZ7C 4AX7A 1HJQA 3HAEB 2VSMB 3MA9L 2JFEX 3HUJA 3KXFB 4HCRL 3EBVA 3AU1B 4YSSA 1ZOXA 2ZUTA 3SDCD 4NEHB 2UZXB 4Y5VB 2D0HA 4O13A 1KIUB 2IBGA 1XIEA 5FYLH 1N0XL 3WF1A 4JS3A 3X2QB 3H55A 1N59B 1F2XK 1OF8A 1YX1A 1T4WA 4PJHB 1R30A 2HFEA 3BGMA 2NY4B 1MFEL 1JGEB 3EOUA 5H94A 3QORA 5I17B 4ROPA 4AXKA 3QQWA 2RCSL 3I6RA 1GR7A 1BZ9B 2PWGA 4GQ9H 4L4VA 3H2WA 3PHQA 3KX6A 2H2SD 5F93C 1WOBA 4QNPF 5F88A 1EGVA 1OFPA 5EZLB 1WCBA 1KIPA 3DX0A 1PZ1A 2C91A 2VISB 2HLFD 3W72A 4Z3FA 2DSVA 4Z95H 2VLJA 1D3CA 1AW2A 3MSGA 1XLMA 3W84A 3JVGA 3OHXA 1EHAA 1GOWA 2BRQA 5IM51 1G7HB 2DEXX 1JXGA 1IXNA 2A1WH 1XCTA 1GONA 1U93A 3WNMA 3GZKA 2B77A 1ZHLB 1KCLA 3O6FC 5J6HB 3LKNA 4NZFA 4M81A 2ENSA 4WWOA 4H19A 4U0RC 5I1GL 2FECI 1MFDH 5KYYA 3LZFH 5KSUA 5FGCE 3QIBC 1LUCB 2GTZB 3R1GL 3FGCA 5JW4Q 4WUUE 2CA3A 3TW6A 1FL6B 3QJSB 5JQHC 4RV3A 1LQ0A 3KR3H 1KXVC 4PJ8A 4IISA 4NRRA 4MNLA 4WQ6A 3BD4A 4AVNA 2NT0A 3GBEA 3HZKB 2A2QT 4K5PA 5BMWA 3MFFA 3HB3D 1DIEA 1FO0L 2ZVIA 2XA3A 2IW0A 3L5HA 1CLXA 4RE2A 3BZEB 4AIZB 2NY1B 4E2VA 2JVUA 2XM1A 2F0CA 3O4LA 2VC6A 1FZMB 2XN2A 4OD2B 4OJFH 2PWHA 5EPDA 2ZYFA 4EXKA 4S3EA 4WU5A 1T5KA 4B53A 4F37K 1QWKA 3KLSA 3S9IA 1SUHA 3QJFB 5FV1L 5D7IA 4UTAL 4BF9A 3DMMA 1J0ZA 4NRXB 3M7WA 1Y1DA 4NZ4A 3KJ6L 1MEXH 5K9CA 1CICA 4IMAA 2CO6A 4C55A 3DRQA 3KS5A 3SI9A 3WTVA 1XR8B 3OU8A 5DC2A 3C5JB 5DJZA 5I77A 2HFFB 3QUZA 4GP8B 4HCLA 1M01A 2V5LA 5FM4A 4BXVA 5E6ID 4UUJA 4UQBA 2PCFB 3N43F 1BF2A 3ETBJ 1V3JA 4J8QA 4PJAF 1I3UA 3UA4A 4UOZA 2A9BA 3EYQD 3DC0A 3NZHH 3C6LD 1UURA 2E6PA 4IOIB 5IFPA 4MNJA 5BVPL 3DO3A 1U6AL 3GWQA 3WQ4A 5D6CB 4E9SA 2PCYA 3RL2A 4BFAA 3E80A 4M7LL 1GSMA 1XF2A 2YAFA 2N59A 4Z8FL 5K9JH 4AWJC 5FYKL 1UWRA 1HQ4B 2MCAA 1JYXA 2FT8A 4P4KC 1OB0A 5DGQA 5T1MA 3F4WA 3HTWA 4K1WA 3Q06A 4Q6IA 2KLTA 3NSDA 4O9HL 1V7AA 3BLOA 2BSTA 2XG5A 4HSOA 1XUUA 1KN2H 1PO9A 3C2EA 5IOPA 3AHXA 2XTLA 2DMKA 4HBCH 5E9NA 5DUML 3BICA 4NIYE 3HG1E 2NUYA 3LD8B 2R4RL 3U2EA 2CGRH 1IIGA 1VZHA 4M1BA 1EHLL 1E9IA 2PDMA 3ZJ6A 5LYRA 4JPVH 3WMSA 1U95A 1UQSB 3I6LD 4IJTA 3U0WH 5AW6B 3GSOA 1TSRA 4ODHL 1ZLVK 4OU3A 3LN5B 3ZE1F 5K39A 2ADFH 4YQXL 5JIQA 4WW1A 1QEWA 2P8LB 4PMYA 4MA7L 4AG0A 4IOFC 4L5FE 3RX7A 2UY7B 4ADSA 2FO8A 3VXOA 1KXTA 3OZKA 3SCMA 4ZRGA 5J1SC 2X0VA 3HUJE 1RZKC 3W70A 2J2ZB 3TJHD 1GA2A 4XNUH 4JFEE 3EA2A 3EA3A 4O1AA 4QF1B 2Y36H 4FTDA 5IVZB 1BZQK 2ENJA 4A04A 2QUUA 3V5KA 5D2TA 1LP6A 3WL0A 3MOAL 4WW2B 5F1SA 1ZA6B 1KPUB 3KWSA 3MLYL 2LU7A 2PSNA 4JX6A 1XF1A 3ZDZE 2YWYA 5DD1L 4DJFA 1I75A 3QARA 1H0IA 4MQ7A 3OQRA 3QWOA 3N2CA 1JV5B 4RWYH 5HHVL 4AEIH 5IMMB 1AGCA 4W4OA 3BG5A 4ONFL 3LNDA 3MGTA 1VBUA 2C1OB 4KV5F 4JFVA 4AG4L 1NFDF 5F4SA 1I7TA 4FQCH 4E9TA 2VC2H 3O6LL 1AOHA 4D7BA 2DPEA 5BXTA 5SWZE 3L9RA 5C6PB 1NFPA 4WI6A 1GS7A 2QHAA 3W37A 3FFCA 4O02H 4PLKD 1QPOA 2CLZB 4UTKA 2DT3A 3FTGA 3RCMA 4GXUN 4DAIA 1RZKH 1I8MA 2IKJA 1XYZA 4HUUA 3NIDF 3NEOA 1P5UB 2A9MH 1MFCH 2IAMD 4Y2NA 3QR0A 1EH9A 1H3UA 4HIBA 1KDIA 3GAKA 4JK0D 1Z9SA 4NRSA 1EYWA 2NQHA 3V3WA 1JGDB 1HNYA 3MYPA 2A74A 4D9LL 1K8DA 3IJ6A 4UMBA 4QHMB 2PXYB 5G2NA 3EEZA 2OEMA 5CJOL 2O61A 4AJVA 5DK0B 1MXDA 1CXHA 2VQ4A 4N2AA 4U6YA 1G1YA 3CAQA 3IFNL 2PXYD 3WS3A 1KPRB 1M5WA 4B2DA 3AW5A 4ZO9A 1AA1B 3GMQA 3O11A 3UC0L 3CCHA 4JTSA 4ZS7L 2Q7YB 2HK1A 3ZK0A 4XBPA 3SE8H 3SKNB 1OF6A 3EH1A 5B8CA 5BUPA 4ENED 2XZ7A 2HG0A 1U8LA 3EFOA 3MHGA 3MO1A 1C8XA 2Z1PA 5DWUL 4GKLA 1ID2A 2HT2C 3G1YA 1W1IE 5FGSA 5C0QA 5CP3H 1NMBL 1UTDA 5IB3A 5LBGA 4JNZA 1MCCA 3K72B 5F2IA 2V2XA 3B9KC 5D7IE 3NA4A 3LVEA 4GMSH 4PRNA 3TLQA 5AYXA 3U1SL 2IH3B 1RY0A 1A3ZA 2VEKA 3CVDA 1MCWM 3SFWA 5TGBA 2HRLA 3VFGL 1D5MB 1HFUA 2C9RA 2GCYA 2V33A 1V7ML 4LSQH 2ZJSL 4K9EC 4F7TA 3BGAA 3IRSA 4CQAA 1X4YA 3BSHA 1HXYB 3EJQA 1JNJA 5HI3D 3NQKA 1QVOB 5I73C 1VIZA 1OABA 1JZGA 4XZUB 3R0DA 3R25A 3X14A 1Y5VA 3EX6A 4ATDA 2PGWA 1RHFA 2CIKB 3U83A 4GC4A 5IHSA 1E55A 4QWWC 3RWEB 3DZ1A 4RMVA 2C3VB 1OF2A 4ZMGA 1N4XH 4WY7L 5I07A 4KNSA 4Z1PA 4AKQA 4Q4IA 4TUOA 1A25A 3BESR 1FRBA 1A47A 2V5TA 4PRPA 4E2DA 5LNEA 1IT9H 4LQFL 1EQWA 2GUUA 1U1UA 3OXSA 4KS0A 3RWDA 5CU9A 1W3JA 4ALAC 3UP8A 1I1FB 5IB5B 1TG8A 4FCHA 1AZ1A 4ZUUB 1XPYA 4L4MA 2A7BA 4MMXB 4J4KA 1U33A 2ZXBA 1OINA 4GRWH 2Y7FA 1XV8A 3TU9A 3EXLA 4JM2B 3D39A 2W81C 3FT4B 1OSZB 4K36A 3ZKQD 5JPNB 1NUFA 3FQUA 1ILUA 4K9EH 2PYEA 3R2GA 3SQRA 2DQMA 3UJJL 1G9EA 5DJ8A 3WE1A 1XDJA 4DXVA 2LE9A 4B5XA 3MLRH 4X6EB 4JPKL 4PPTA 4X98A 3HE7D 3H6OA 4HZ1A 1OP3H 4FQXC 3RWJB 2VO5A 3Q37A 1G9NL 3OJ2C 1WT5C 3OWRA 4MXVE 1EEXA 4IKKA 2PRLA 4Z5RA 1QXLA 1J9SA 2G60L 1H7WA 4FZEH 2R1KA 5TQLA 4GX8A 2IEPA 3NACH 3KYOB 4P99A 4CMHB 1JCTA 4PV9A 2GAZA 2FJFA 5C7HA 1WFUA 1XYBA 2C0AA 1QA9A 2OLSA 5JBDA 1YNKL 5FX3A 2OCCB 5DT1H 4XPHH 4TQIA 4X80H 1YNYA 4TLKA 4MXWL 1U8CB 4WSKA 4HF5L 5DJ2A 4YU1A 4ALAH 2WZ5A 4L23A 2YCLB 4H8WH 5ENWB 3S1UA 3ZR6A 3AISA 4GYFA 4Z3EA 3G6AA 1SPDA 1F90H 2CH8A 1GC1L 3DI0A 1EC8A 1JWUB 2ZYHA 2VZVA 2JJTC 1B6UA 4AGLA 2NVCA 3S8FB 1JUFA 1TQSA 5T1DH 1SFLA 1BGXH 4AVOA 1UWTA 3GZ3A 2R8SH 2R51A 3TKFA 5DD0L 1K72A 2X88A 1HJWA 2FBOJ 1L6FA 3VYOA 1I7RA 1AJ7L 1GKQA 3H2EA 1E3ZA 4HZLB 1ZLEA 2WVVB 2DQFB 1LDSA 2YXXA 1SMAA 1PCKA 3SKJL 3P4NB 2RKXA 3OKMA 1KPVB 4XOAA 1KFCA 3I68A 2F6AA 4GO8A 1OARH 5AVZB 1OLLA 5SWQB 4M1CD 2RHGA 1NIUA 3FCUB 4PGBB 2BNQD 1RK0A 4NKCA 2BWIA 2PB1A 4DZAA 1R3IL 4K5LA 2WXIA 2ZNWA 1D7DA 2ADJA 4JKMA 1A6VL 5E95B 4LZKA 1U30A 2Q8BL 2YGQA 4I5UA 4DN4H 3UDWA 5JHDA 4XX1E 3SJVD 1HILA 1QAPA 2JTDA 2OZ0A 4XVJH 4I9WE 5EU5B 3BUVA 4HJTA 3R7MA 4FMVA 4K7FA 5IBUG 3UOAB 7TIMA 4OTXH 4IFKB 4AIXA 5IWLC 2D69A 4PA8A 4KDVA 1J8SA 1VHNA 3CV7A 4MD4A 4LLVB 3BPOB 1GOXA 2WIIB 4C1NA 1XH2A 1ICPA 3QJQB 5L6YL 4HJSA 3WAKA 5LNDA 3DK0A 2R0LH 1UVQB 2YZ5A 2ZP8A 4PJ7B 1INQB 3CHCA 3KPPB 5T1LB 2REQA 3OQ3B 4M9OA 1AR2A 3WNJA 3MHUA 3TJ4A 3KAAA 1UUNA 2P88A 1CDUA 5BV7H 5JO5A 1YDNA 4L4TD 4JPWL 3TO4C 4I1NB 2HPIA 1CD8A 3LPGA 3THUA 2P50A 1DXFA 5EU6D 1DQIA 1YKWA 2GDQA 1QI0A 3LK6A 5A3IC 2NVAA 1BA9A 1VH7A 5AZ2H 2CLPA 3S5LB 1K9DA 3UY8A 1CFSB 2IGFH 3EJYD 2CUIA 4EI0A 4IDLA 3WLBA 4MWAD 1T89A 4UIOA 3ZVVA 2YGOA 3BIBX 1KCKA 1AG1O 2A83B 3DETD 1PYMA 4W8LA 3BKMH 1DBMH 5GPRA 2IADB 3ALWA 2YGPA 4DO7A 4JRYE 2W60A 4YVPA 3QDMD 4PJDB 4NDMB 2W79A 3IIVA 2WIMA 1BPLB 3F7RA 3LSBA 3QHFH 1FH5L 2JB6A 4OZIA 4XAKE 5GS2H 4O53A 5E2VL 4LCIH 4RRPG 3O6FA 4RK8A 1TPXB 2I07B 2YQ3A 2BXVA 4IRSC 4NKIH 1UZ1A 4JRFA 2WVSA 4MY8A 3QIBA 1I8IA 5LIKX 4ZD3H 4ZSOA 4ORGB 3MCKB 3KAOA 3NQFA 1L6WA 1NM4A 2QLYA 4LV4A 3TQKA 5EIIG 4J7RA 4P7NA 3BDYH 3WAJA 1KXVA 3NQIA 1CFNA 1V93A 2JKLA 4ICNA 3IU4H 2DLTA 3ILEA 3BSMA 4LCWB 3UA3A 1YPXA 4FXGB 5DS8B 1ZEAL 4AIBA 3TW7A 3TE9A 2WXHA 5IJBC 4MYPA 4WI4A 2EUXA 2FDBP 4P8XA 4H8UA 4K94L 4KF1A 3S4SG 3ATEA 2DT0A 3NYZA 3KLDA 4KC3B 1R75A 5EOCH 4APXA 2C9SA 4G8GD 1GHFH 4RCAA 5KSAC 4ZNCD 2GGIA 4WGKA 3EYOA 4GYJA 2IWGA 3OAYK 1F4AA 5FWQA 1D5BA 4N90D 4Y1AD 2EE6A 3NQGA 4W9FC 5L88H 1L9RA 4EOWL 1E5YA 4YC2C 3A9IA 4FQHA 4UYQA 3MPCA 5CEWA 2VFEA 1DIOA 1SMDA 2QQKL 2J21A 3WEMA 2FTPA 3BEVB 5LJYH 3WIIL 2AJZB 2A0NA 1ONQB 1JPEA 1E3XA 3VXMA 4JQXC 4Z2JA 5L4MA 2PGRA 4P48A 4S3GA 4G43A 3V7PA 2PDKA 2DAVA 4Y5XB 5CC3A 1DQJA 5LA0A 4QDPA 4U28A 1IEBA 3THML 1D6EA 4WV1B 5HQLA 1WIPA 2HYMA 5F1KC 5DJ0A 3BPNB 3PBYA 4GW4B 1O6SA 3UO1H 3DVNA 4PTUA 1LLOA 3AQYA 1SXZA 2OR8A 5EPMB 4APQC 3WHE0 2DZUA 3MRNB 4I5BA 2HQAA 3KD4A 4GYPC 4F57L 4NC0B 2F74A 2IALA 4P4KA 4MZ3A 4ZX3A 2FMNA 2ATKB 3ZTJH 1SZRA 1O60A 2Q3XA 4OGYH 3W1UA 4AEHH 4XZIA 2WXNA 2PO6D 3PFRA 4WEBH 2V3FA 4G7YH 4LHJB 2QEJA 2VDMB 1T22A 3HBPA 3VCNA 1MQPA 4FP8H 3MUJA 3HQOA 2YYUA 2OJZL 3TIMA 3FIGA 1OCWL 3IXAB 2E7BA 1UR9A 5MENB 4GRMA 4AY7A 2GT9A 3MB9A 1WIOA 4XCEA 2F84A 1EIXA 4LEFA 1XCQA 4AVHA 2PDWA 4QXTA 5LVEA 1NIBA 2A6JA 4UBDC 5C0EB 2XGBA 1CCZA 3DURB 1MVYA 5F7FA 3BI9X 1RHHA 1L2QA 4M00A 3F7JA 1FAIH 4OIFA 1ETA1 2F54B 4HS6B 3P74A 1C29A 1WGOA 1UP3A 1DVYA 3GMNA 3RLHA 1OHLA 1EMTL 2AJXH 4WY0A 1YC7A 4MASA 1VESA 5LNGA 5IQ9A 3VOGA 5DU7A 4O02A 3KPTA 3LVTA 4LLWB 1XLCA 4UAOB 1M42A 3OLIA 4XNBA 1S5TA 3DBXA 2E68A 1ZSDB 3TFKC 4IRJA 1L9PA 3AIQA 3GPSA 3T0WA 4O18A 6ALDA 1W3KA 1OJXA 4FEMA 3QWQB 5D8JL 5I1IL 4R26H 4C83A 2ICWJ 3W9EB 4XNYH 3UC2A 5J11C 1H5VA 3IJYA 1CW2A 3NBNA 1CT8A 3LQZB 3MROA 5BUAA 1FXPA 1VGEL 4KKRA 4NQXB 2K7PA 2WUCH 4ZFZA 5DMYA 1XL4A 1H15A 2B7QA 3A4AA 4HYRA 3ABZA 3ZVIA 5EUOA 2FGBA 2FB4H 4FE9A 4AMCA 4HWNA 2E9JA 4AZ5A 4KQ4H 2EO7A 1R8LA 2DQ6A 3NNTA 3VE0B 4Q56A 3VGAC 2LV4A 2HTLD 2MCPL 3F4CA 2A3LA 3UPMA 4NFCA 3GY1A 4ONVA 1YY9C 1L0QA 3P54A 5GHWH 1KJMB 5F7KC 5CP3A 3K71B 4PTWA 1CB7B 3N9GL 3B2MA 4UMGA 4W9EC 3SY0B 2VHLA 3PYCA 4L5FH 3F4NA 3FA5A 1YSOA 5F6IC 3CSFA 1UWEH 3W73A 3M88A 2BB0A 4GUHA 2E1DA 1S2CA 4JFTA 2W9LA 3UYRL 3TAKA 1AD0B 3AWGA 3GNMH 1EJSC 3QO0A 4IMLB 1WYIA 4K73A 3H2AA 1N64H 1Z9LA 2YAPA 4GIOA 3V4LA 4ZSOE 2RALA 4AGNA 4RAHA 4PR5B 3HZYA 3OB0H 3FK3A 5LWYL 4OF3A 2Y06H 4C56E 3OKEA 4WTQA 3VFRB 1H3VA 4OCLC 3QJVB 2W67A 5CZTA 5FAAA 2YCJA 2EO1A 4FQIH 1A0EA 3DCPA 3AACA 1QFWI 4NRZB 3MRIB 3EYUH 3BO8B 1HE8A 2W9DH 4NAEB 5FGBC 2WMKA 1LRTA 1NCWH 1FF5A 3VTRA 4QNPE 3R0MA 4RRPM 2XETA 2NYZA 4KQ0A 2PDCA 3HZ3A 1BBDH 3NCJH 5EU3A 4WVRA 4XRCB 4V1YA 4E6MA 3B9KA 2WNWA 2A6LA 5C9JB 1ZJBA 1UXWA 4CMMA 43CAB 2X7VA 4N0RA 4M9PA 2FJGB 4PJGA 5B7YA 3RM9A 3E2HB 2WM1A 4ZXBB 4OOZA 2WSRA 1ME8A 3AXMA 1V3MA 4Y2DB 1WZAA 4NQED 5BS0B 1I4FB 4HS8L 4FIQA 4ONOA 3ATYA 1SXSA 4MHHG 5TBOA 4Y2DD 1EO7A 1CXFA 5A8MA 3QG7H 4HBQA 5D7KE 3BCJA 3KRUA 5HUPA 3QYCA 3VXME 4TN9A 5CBEB 1M7JA 4M5SA 1T21A 2R1YA 3IVSA 4DYKA 3W11D 1LHZA 3QZ6A 2OMTA 2WKOA 3MTXA 3NK4A 3ZE2F 2PCPB 1D9KC 2G4JA 3VWKC 2JKXA 3H42L 4MJ6A 3F3HA 3KRSA 1UYWH 2EYTA 1U1HA 5L2JA 1ND0A 2WMIB 3TLRA 1P4IL 1PTGA 4HYWA 2Y7NA 4C1LA 3EYFA 5I0XA 1MCPH 1VPQA 1OGPA 1QD0A 1DN0B 4OFIA 4DN1A 4Y9OA 1DR9A 4F58H 5CD3B 3QEQB 1XWVA 1EBGA 1UT2A 3T0EB 1DSFH 5K9OB 1A7PL 4X5RA 5CD5D 3QEQD 4KO5A 1EFXA 4O12A 2X4OA 3INOA 4NZ3A 1H8OA 4B3VA 3P3SA 1QO3A 1VCAA 2PTVA 2MHAA 4PWGA 1FGVH 1R4XA 4FQXA 5HPMA 1DJZA 5FO7B 5CLTA 1KR1A 2CE6A 1WT5A 4PS8A 1CO1A 1T0MB 2BFVH 3K4ZA 3W1ZA 2VAJA 3ZZLA 2WJ5A 4NUJA 3QS3A 3TSMA 1D5ZB 2J8FA 1A4KA 3HI6L 1KRAC 1YEGH 1EF3A 2BP3A 2ANUA 1JHKL 1YNPA 5I6OA 1YDYA 4H20L 4G5ZH 3TR2A 3ZDYF 3BXWA 3UH8A 4XCNB 4O50A 4XNZB 4P3DA 3GTNA 5CSBA 4JANA 1KTLB 4EI6B 4YBLB 4LVNC 3WFAA 2P44B 4K3JL 1W9BM 4MJ5B 2CAKA 3BW3A 4M24A 2YEZB 2FPYA 5EC2B 4P9HL 4GRLC 2GJ6A 2GVGA 1RBLA 1UADC 2JJTA 3RG1C 4UYPA 1FBIL 4DH2A 1X5KA 5ERWB 3KVQA 2CKSA 1DFXA 3V5CA 5FHAL 1I0BA 4N85A 2E59A 3KVPA 3SYAA 2W0UA 5D7LA 1NKRA 1NGZB 2PP3A 1WZ1L 3N4FA 2EXWC 2ZG2A 1EO8H 1U8QA 2VDQH 3ZYOA 1KFAH 1SGJA 4JO2H 2F58H 4Q6KA 1RJRA 5LUMA