1KXTA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 170
structure length 496
sequence length 496
chains with identical sequence C, E
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxtA01
2Y24A 4NSBA 4CU8A 1UOKA 3DHUA 2D73A 4HOXA 1BTCA 4DM1A 3RIKA 1QHOA 4W5UA 2ZX7A 3EJUA 4LQ1A 1J10A 1BGGA 2BHUA 1W3LA 2E8YA 1V08A 4R27A 5D8ZA 1KGXA 1PIGA 3OGRA 4JL1A 2O9RA 1B30A 4FNUA 1UH4A 1LL6A 5ABEA 2VJXA 2UY3A 1HKMA 2DT3A 2XWEA 3L4WA 3VVGA 2F7RA 3T08A 1D7FA 1TQUA 2DEPA 1W1PA 3ARQA 3HJEA 4UQ9A 4M82A 3KWXA 3OZOA 4J28A 2WCAA 2XHYA 4TXEA 4FLSA 5HXMA 1CNVA 1QWUA 1PBGA 3QHOA 4MPKA 3BUBA 1IZKA 2CBIA 5IHSA 3K1DA 4CCEA 3PZUA 4UQEA 5I3DA 5A6BA 1HJXA 1JXKA 3HN3A 2FYVA 3L4YA 4JCMA 1B31A 2W63A 4A3HA 1GOQA 3BVVA 1DWFM 2BVDA 4W5ZA 2VC9A 3MMWA 2WMJA 4DWSC 1QI5A 1W2PA 4LXFA 1UZ1A 3K46A 3IJ9A 3L2LA 4D71A 1K6AA 3CHEA 4H8VA 1YQ2A 1Q6GA 4A4AA 4ZXOA 5FL0A 1V3HA 2CXGA 2IXVA 4TX8A 1BFNA 2ZXAA 4KRUA 4CN6A 1KXTA 3OG2A 2ZXDA 3AMDA 4OIFA 1HJWA 1WKYA 5FKYA 1B2YA 2BV9A 2J62A 2D23A 2WM0A 1EQPA 3UCQA 2Y8KA 4Y7EA 1UQZA 1CXEA 1OGGA 1TQTA 4N0RA 2EACA 3RCNA 5I78A 3L2MA 3IAQA 1CGXA 1UWUA 3I3DA 1HP5A 3EYPA 4C7FA 5I5RA 1B3VA 2UY2A 1EGZA 1UHVA 4TVCA 3TTOA 4P7NA 3NDZA 3WH6A 2AOSA 4NZCA 1M53A 3ZT7A 3OLIA 4AMXA 1B1YA 1BLIA 2ZOXA 2X2YA 1HX0A 1HWWA 1XH0A 4D1IA 4V28A 3WY1A 2PWEA 4UQCA 2G3JA 1OGSA 2PBOA 2E4TA 1HXJA 4GKLA 2XN2A 2GDVA 4CD4A 2EXOA 4UZUA 3HG5A 2WXDM 1E70M 3VIPA 1BHGA 3BLBA 4PCSA 1B3XA 2X1IA 4KWUA 3FAWA 4OBRA 4JZ5A 4PMYA 3N15A 4JCLA 2DH2A 1B3ZA 5BYWA 1E56A 2E3ZA 3M6DA 4NI3A 1LWHA 3A24A 2WVSA 2XVNA 3A4XA 2J47A 2YDRA 3O9NA 5CSYA 2F2HA 4W89A 3KL5A 3AIVA 3ECQA 5AYBA 3UERA 3FNDA 4XZBA 2DDXA 1GVYA 1JZ2A 1NWSA 3CUIA 2EBNA 1UWTA 1R8LA 3EDKA 3VMPA 3EBVA 2WVVB 2QLYA 1ZU8A 4MADA 4JL2A 3CH9A 4P7QA 4P8WA 1E71M 4AZGA 2WBGA 3AZRA 1XV8A 3W27A 5DMYA 3WELA 1GCYA 4UOZA 3DX0A 2Y8VA 2ZIDA 3ZQ9A 3HMCA 4P8XA 3WEZA 1MFVA 3VINA 2JF6A 3VUPA 2ZX5A 1MW0A 1LWJA 3VIJA 1PX8A 2W5FA 3F5LA 1ZS2A 5CG0A 4ML4A 4TTGA 1V6UA 1DWAM 1QPKA 3WDPP 1KFWA 2BXYA 2WZEA 1E72M 3KE0A 2V3DA 5A8PA 5IXEA 1E4NA 4EANA 4DWSA 1J0HA 3PZTA 4YHEA 1OCQA 1UD4A 5CPTA 4EKJA 3D52A 2WW5A 3VSVA 3K4DA 5M03A 3EDEA 3B9AA 4DWSD 3ZSTA 1AVAA 1BQCA 1ISXA 1V0LA 4C7DA 4HP5A 1ZBKA 3A4WA 2FGLA 3WDHA 4ZXLA 1XD0A 4BCEA 3LRMA 4WLCA 4AC1X 2CPUA 4D72A 1NM9A 3VU2A 1YHTA 5E09A 4WKFA 4CD8A 2E9BA 1R33A 3AMCA 2FGZA 2ESCA 1DEDA 3DDGA 3MMDA 3W37A 2J79A 2ZUTA 1QNQA 1VIWA 1ZJBA 1W2VA 2O9OA 2VX5A 4AZIA 2YA1A 4L4PA 3W38A 2AAAA 4NXKA 1E6RA 3WQ6A 2DSVA 1ODUA 4CCDA 4Z2GA 4CU6A 1WO2A 2WMFA 4F9DA 1MWOA 3QGVA 4B16A 4DWSB 2G4FA 4QFUA 2OYMA 1VENA 2WC3A 4GINA 3UG3A 1O6IA 2CHNA 4QCEA 4B9ZA 1UQYA 5A6SA 5HOSA 3ZJ7A 1C8YA 4UFMA 4FNTA 4NZFA 3RMEA 3WNMA 1TQWA 1GJUA 3WMSA 5EB8A 4CVWA 2ZWYA 5A2AA 4U3AA 3BCDA 4W84A 1TCMA 1BG4A 1KQYA 3AIWA 2QMJA 1BVNP 2VR5A 4D6DA 3KEHA 5A94A 2FE0A 1SMAA 1R85A 1QBBA 5M17A 2O9TA 1MYRA 1B9ZA 1HKKA 5C70A 4ACYA 1TQSA 2FH8A 4R5EA 2QHAA 4UFLA 1FH7A 1W3KA 2DSUA 5JBDA 2XN0A 2E0PA 2G3IA 3OBAA 5BXRA 3QOKA 2VQUA 2WC7A 3IGUA 1PZ3A 1FHDA 4D6FA 2J7BA 1QW8A 1XH2A 3W28A 1UA3A 4M8UA 4P8VA 1CGYA 1XSIA 1V3KA 3LXAA 1UR9A 3SCPA 3WQ4A 2XM2A 1G94A 1MW2A 1R75A 1KXQA 2ALWA 9CGTA 3WD0A 3WY2A 1H09A 1NARA 2IXUA 4FNQA 4PN2A 3BAKA 3WY3A 1V0NA 4AD5A 3WFLA 5BROA 1FHLA 2WCGA 3CUGA 4E2OA 2YBTA 4PYSA 4P8UA 3IJ8A 1W9DM 1JGIA 4B9YA 3BSGA 3WKZA 5E1QA 2WPGA 3BUPA 5IFPA 2VUYA 1JL8A 1C3FA 1ZB5A 2PB1A 4M24A 3H55A 4YHGA 2DQXA 5A6JA 1QX1A 5DT7A 2X09A 1TA3A 1HJQA 2CBJA 1QI2A 1IZJA 3GXIA 4TX6A 1E1FA 4W86A 1H11A 1X1NA 1BPLB 2BY1A 3TTSA 2VL4A 4AD0A 3H53A 2WLZA 4CD5A 3AQUA 3DYMA 1UD8A 3WF2A 1HVXA 1LL7A 1SR0A 1CGTA 3VGFA 4PTMA 5M3WA 3FW6A 2VO5A 3KL3A 3VIKA 4GZEA 2D0HA 3UESA 1MXDA 3W0KA 3N04A 2WMIA 4PSPA 1XGZA 2YFOA 2ZXBA 3G6LA 4JKMA 3CZSA 3WF1A 1ZL1A 2EPLX 2A3EA 1CXKA 4JKLA 1W1YA 4Q7NA 1R34A 4LPCA 1JYVA 2CBUA 5GNZA 3LRKA 1HJSA 2NSXA 2CCRA 1TZ7A 4GO9A 1H41A 4Z2KA 3F5KA 3VDBA 5DF0A 1H4PA 3NDYA 2V5DA 5C8BB 1JDAA 4UFHA 3GNOA 3ZT5A 2J74A 2V38A 1EH9A 3DYOA 4JFUA 2JIWA 1UKSA 1WB0A 3CZJA 2WWCA 3SUTA 4FF5A 3AHVA 2E8ZA 1FH9A 4J3WA 1KXHA 3WNPA 2D2OA 2WSPA 4B3LA 2ZICA 1WZAA 3BMVA 1B90A 3MUZ1 3CHDA 3RO8A 1E3ZA 2D22A 4JAWA 2WHMA 4X0VA 3HG2A 1H3GA 2XIIA 3LPPA 2OLHA 5EFDA 2QPUA 1GOKA 1VFFA 2WKLA 2YLAA 2WZHA 3K4AA 3WH5A 3SCUA 3T0DA 3DX4A 1UR0A 3O2LA 1KGWA 1KCLA 2XSBA 3VM7A 2VX6A 1UH2A 4BQ2A 4JFVA 2G3MA 3RM8A 1BYCA 1MQPA 2X8RA 1US3A 2UY5A 4HA4A 1HP4A 3AS2A 4JHZA 1E73M 3IAPA 1QNSA 4PTVA 4MJ2A 1XD1A 1IT0A 1SMDA 1UYQA 7CGTA 1KGUA 1VFOA 4IM4A 4J27A 1E0XA 2WBKA 1HF6A 2XGIA 1VFMA 1E4IA 1RP8A 1UWRA 3W53A 4OUEA 4DUWA 3A5VA 3EJRA 2VOTA 1K9EA 4J3VA 3GXNA 3AZTA 3EDJA 1KCKA 3A4AA 3CUHA 1GQJA 3ZMRA 3VIHA 3UG5A 1OD8A 3PTKA 2YJQA 5E0CA 3OA5A 3A23A 3WD2A 3I3BA 2DIJA 2YL6A 5JBEA 1CYGA 1M01A 1E5JA 4OJYA 1K9FA 4C7GA 3D3AA 2Z1KA 4GIAA 1GJWA 2WZIA 1R87A 3QOMA 4PEEA 4Q22A 1CIUA 1E4LA 1GW1A 4H8HA 3KZSA 3VDCA 2RGLA 3A21A 3ALFA 1A47A 3WD1A 3ARWA 1J0JA 1JI2A 3AMKA 2WKGA 5FCZA 3VD9A 1F4HA 3O6AA 5A8OA 5FD0A 1Q6EA 4UTFA 2W91A 1EQCA 4PTXA 3ARSA 4CGTA 1CLVA 2WVVA 4EK7A 1U30A 1VFUA 2OW7A 1AQMA 4U33A 1BGAA 3LPOA 2Q8XA 3AXIA 3CV5A 1JDCA 4JIEA 1G9HA 3HG4A 5E6YA 1QWNA 5KEZA 5BCAA 5ABGA 1D2KA 2JF7A 1W3HA 3PZVA 5HNNA 4AD1A 5IDIA 3DX3A 3WH9A 4JKKA 3ALGA 3W29A 3WUEA 3VDHA 3MANA 4TVUA 1E15A 2QPSA 2HISA 2X2JA 4RE2A 5F7UA 1GOIA 3NSXA 1C8QA 2FHCA 4M1RA 2ZXQA 2V5CA 6TAAA 2WYSA 3GH5A 1EXPA 3MV11 2GJPA 2Y4SA 1BSIA 2QMKA 1HTYA 5A8QA 3PZQA 4IISA 2F1BA 2YOCA 4MNMA 3CIVA 1SYTA 1FA2A 1UD2A 4F79A 1CGUA 4Z2IA 3IANA 3RILA 1G5AA 1WE5A 4FNSA 3WD3A 1G01A 1A3HA 1XH1A 3ARXA 1OT1A 3KL0A 2NT0A 4AD2A 4QAWA 3UR8A 2BNJA 3LX9A 3EMZA 1CXLA 3N12A 5CQ1A 4BF7A 3BGAA 3AROA 3M7SA 3GXFA 1M7XA 1K9TA 5A6KA 3SCRA 5A95A 1DWJM 5JBFA 2V3FA 3BLPX 1DWIM 3GZAA 3WF4A 3SUUA 1E1EA 2BHYA 5DFAA 1QHPA 1EDQA 4ZE5A 1GPFA 4S3JA 4JFTA 2CIPA 3GBDA 2WCSA 1V6XA 4PBGA 5A1AA 2V3GA 4PTWA 3AIRA 2GK1A 2JEPA 3APGA 3TTYA 1E0VA 1GQKA 3GNRA 5DEZA 2CEQA 5EMYA 1Q6DA 1EDGA 3BC9A 2F8QA 3ZO9A 4HZ6A 1WDSA 1V3MA 5CPQA 3BVTA 3WUFA 3WF0A 1XHGA 3PZNA 3F4VA 4HTYA 3GXMA 1CXHA 1JNEA 3FHAA 1Z32X 3AHYA 4W88A 1WPCA 4P7OA 1E0WA 3SIMA 4PCTA 2WK2A 3ARRA 3D5HA 2XFRA 4PMZA 2PWDA 2EPOA 5LA1A 1I1XA 1UUQA 4DM2A 2J7DA 1QI0A 2XPKA 2BY2A 2YDQA 5A2BA 2YBUA 3TOPA 1V3LA 2E9MA 3AFBA 1DWGM 4U5IA 4KRTA 5I79A 2DT1A 2EPMX 4AZ7A 4AYGA 1LF1A 4CD7A 3FHQA 2WMHA 1E6ZA 2GDUA 1RPKA 4AMWA 1UWSA 2O92A 1B0IA 1C7TA 4WIWA 4EAMA 1C93A 3FXYA 1J0IA 4MDPA 4KMQA 3WNNA 3FY1A 3CZGA 4PUEA 1CTNA 4NRRA 4D1JA 2VCBA 3BAJA 3LXBA 4M29A 3W24A 3NUKA 3SURA 5FIPA 2ZWZA 1J0KA 3THDA 4W8BA 4TUFA 1C90A 3RM9A 2XVGA 3WNKA 3CZKA 2C8NA 1E43A 4UFKA 1J12A 4Z2JA 5A6BD 2VX4A 5FL1A 1VAHA 1WDQA 2VVNA 3VGDA 3AISA 2VX7A 3WQ5A 3AXXA 4AISA 3L4ZA 5HPOA 2CESA 4D6GA 4GI6A 3MI6A 3VO0A 1JYNA 3LRLA 2HVMA 5E0FA 1HNYA 4F9JA 1EHAA 1VRXA 1XYZA 5JIWA 2XFYA 3WNLA 2XJ7A 4M81A 3NSMA 5D9MA 1JG9A 3WY4A 2C0HA 2JIEA 4MNJA 4KGLA 5A2CA 1C91A 3WEMA 1CECA 1W1TA 5D9OA 1KWGA 1U33A 4U31A 3WEOA 1V03A 2VVSA 3K8MA 1UH3A 3AIQA 5ABFA 3AHZA 2ZUNA 5I23A 1WAWA 3POHA 4ACZA 2VRJA 1ESWA 2XGBA 1XYFA 1GHSA 2ZUSA 2RGMA 1JD7A 4QLKA 6CGTA 3FN9A 1ITXA 1EO5A 1LLOA 2JALA 3ARUA 3BVUA 4GO8A 5CLTA 1H2JA 1TUXA 4CCCA 3AIBA 1OIFA 1KR0A 5A6AA 5D9PA 5AY7A 4BS0A 5DT5A 4FNRA 3WD4A 1V6WA 1DP0A 1JZ7A 1VBRA 4W8LA 1GUVA 2NW0A 1JF5A 3WFZA 2F7QA 5GNYA 5KZ6A 4OGZA 3DX2A 1AQ0A 2ZE0A 1UWIA 3VD3A 2BY3A 3ZR6A 2EJ1A 3N18A 4PMDA 4URIA 4U2YA 4MAZA 2CKSA 1QVBA 2G8ZA 5HDRA 1PJ9A 4W93A 4NF7A 2J25A 2GJXA 4LYPA 3EMCA 3NYDA 4AD3A 1NWTA 3BUDA 5BRQA 3VD4A 2ZUUA 3N1AA 1I1WA 3VDAA 5HPCA 5A8MA 1E9LA 1HN1A 1PAMA 1W9VA 2CYGA 4HOZA 1TE1A 3VTRA 3W6MA 2EPKX 1GOMA 2XVKA 4CUCA 3RDKA 1NOWA 5BXTA 3FAXA 4AIOA 4DUVA 5IHRA 3CTTA 1WZMA 2EPNA 3VSUA 1V0KA 2A3HA 2W67A 2CKRA 1C8XA 4W8AA 2EEXA 4PMQA 1SZNA 2VRQA 3ZM8A 2WNWA 4GQQA 2C7FA 2VCCA 4TOQA 1ISWA 4ZENA 1VEPA 1ZJAA 1OIMA 3AYRA 4AW7A 4XZWA 3WL1A 1PEZA 1UKQA 3UETA 4CKQA 3AS1A 1R7AA 1EOKA 4X0NA 2YLLA 4FMVA 1TQVA 1KXVA 5EBAA 4HMCA 4CN4A 1UD6A 1JFXA 3VX1A 3LMYA 3CUFA 1LQ0A 4FK9A 2DPEA 3VMNA 4B15A 4DUXA 2ZUVA 2X0HA 2CETA 4D6HA 1PS3A 2DSWA 3EJPA 1NP0A 2QF8A 3VX0A 3MMUA 2BFGA 2A3BA 2VR4A 1VBUA 4J3SA 3PN8A 5D9NA 2X0YA 3A3HA 1BYBA 1JYWA 4HU8A 1CGVA 3BAXA 3WDRA 2MANA 6A3HA 3VM5A 1HIZA 4D6CA 4QCFA 5GQBA 5E6ZA 5ABFB 1JAKA 3BVWA 3CUJA 1OBAA 3T2OA 1QBAA 1D3CA 4WSJA 2EADA 2G3NA 1T0OA 1ECEA 4OOZA 5E70A 1TA3B 2XYLA 4AXNA 2PF0A 1G1YA 3SEPA 4CD6A 3WQWA 5I0DA 4DO6A 1ZBWA 2OW6A 1GOOA 3B9EA 1GVIA 3ZT6A 2X2HA 4CU7A 1QW9A 3GTNA 1VJSA 2E9LA 2YFNA 1UZ4A 5DO8A 4MAVA 4RE4A 2WLYA 2XVLA 3U5YA 4UOQA 4UR9A 4E4PA 1UD5A 3OZPA 4XV0A 3U5UA 3ARYA 3CZ8A 1VEOA 3ZJ8A 4K68A 3AOFA 2FHFA 1J0ZA 1BVZA 4W85A 4UQBA 1OINA 2NT1A 2F18A 3VNYA 3MU7A 4F66A 1DTUA 3GXTA 1BF2A 1JNDA 3BAIA 1UR2A 3BXWA 1NWRA 3WH7A 3BUIA 4J3UA 1CLXA 2UWFA 4WF7A 2GVYA 1G0CA 4AZ6A 2WSKA 1QNOA 4QLJA 2VQTA 3BAYA 3TONA 3EDDA 1OD0A 4H2CA 1BYDA 1CZ1A 1NQ6A 3N9KA 4OOUA 4PMXA 4MDOA 2Y2WA 2A3CA 3G6MA 1WCGA 4MJ4A 3RJYA 3SCVA 1OB0A 3WIJA 2EABA 5CZKA 2GK1B 1RD6A 3ARZA 1E6NA 2CITA 2WMKA 2BHZA 1GONA 2YDSA 3S2CA 4BZYA 3S5YA 1GQIA 2WAGA 2OSWA 3DDFA 1QHZA 3HU7A 2TAAA 4WKHA 1OGBA 2E40A 5AC5A 2CNCA 3AHTA 1HL9A 1JZ6A 1JFHA 4HA1A 1FFQA 2VNCA 4FLQA 4AEEA 3JUGA 2OYLA 4W7UA 4RL3A 7A3HA 1U2YA 2PWGA 1JYXA 3VIMA 3SUSA 5CSUA 1L0PA 4PMRA 1E6SM 1FFRA 4V27A 1WDRA 2J4GA 2XIBA 3CLWA 2WVUA 3E1F1 4PSRA 4XB3A 3A47A 2J8FA 3PBGA 1GOWA 3EJSA 4B3KA 1CBGA 1TMQA 3VKKA 3K8KA 2XWDA 3MV01 4H7VA 4H8UA 2PWHA 4LYQA 1CENA 2O9PA 3MO4A 3ZIZA 4MNKA 2GFTA 1FH8A 1R46A 3PZGA 1H1NA 1W3JA 1WZKA 3PTMA 2OSYA 4AY1A 1MW1A 3WQVA 1AQHA 4U3CA 1DWHM 2JEQA 5I77A 5TD4A 2W92A 3W81A 1V6YA 3SCQA 4QP0A 3NSNA 1J18A 4MB4A 2J8GA 1W9PA 4GI9A 2XN1A 5BRPA 4WJXA 3D4YA 1JIBA 3WDIA 1LG1A 2D0GA 1C92A 2DT0A 4GI8A 5LA0A 3WBEA 3CPUA 4MB5A 2WHLA 3BUQA 4HPHA 1E40A 2DH3A 3VGHA 3VILA 1H49A 4J3TA 1F4AA 4QDMA 5A69A 1FP9A 2F1AA 4D6IA 2V3EA 2VMFA 4BQ3A 1ITCA 1EHNA 3SCWA 2UY4A 5I24A 3BSHA 2VCAA 1KTBA 4UQAA 2W66A 2Z1SA 3W82A 3VPLA 3AIEA 4OKDA 4GZJA 4AZHA 4Z2HA 4AMCA 2X05A 5LYRA 4EE9A 3PZOA 3PZMA 1WP6A 4LYRA 1JZ8A 1EO7A 3OLEA 4GXPA 1NP2A 1HXKA 1UR1A 4MNLA 1UKOA 3AIUA 5JUVA 3CZNA 2XFFA 3L4VA 4HU0A 1HT6A 1EOMA 2VTFA 4BQ4A 3F5JA 4PRWA 3ZJ6A 4WK9A 3H54A 2YA2A 2J7CA 1HJVA 3MUIA 1JZ5A 1MFUA 4J3XA 2WHKA 3QHMA 5A8NA 3PTQA 1H0IA 3ARPA 3MSDA 1W9XA 4LX4A 1TR1A 3VIGA 3GH4A 4MB1A 4FLRA 3N17A 1J9YA 4E8DA 3U7VA 4JFSA 1V02E 1FOBA 3MUAA 1HKJA 4FLOA 1BAGA 3W4RA 5A6LA 3IJ7A 1KR1A 5LA2A 4X9YA 4ATWA 1HJUA 3VNZA 2J7HA 1PIFA 4YN5A 2BVTA 3EJTA 5BXPA 2WANA 1V02A 4WKAA 3D50A 1JZ4A 5M5DA 2GUYA 1JI1A 5FOOA 1MW3A 1CXIA 1J11A 3AHXA 3SUWA 1O7AA 4PUDA 4P7RA 4D6JA 1B3WA 3S5ZA 3WH8A 2QV4A 4HMEA 3AMLA 1GORA 3DECA 4HOWA 1GZJA 2YA0A 1UWQA 4D6EA 1E55A 3RM4A 4NXSA 1ZBVA 3WBAA 4W87A 2X2IA 2DGAA 3MUY1 4QLLA 3WUGA 1R7OA 3GH7A 2VZVA 3CHCA 3MSGA 3ZJKA 1MVYA 2PWFA 3WDQA 2J78A 4F8XA 3L4TA 4LGXA 3AS3A 4RE3A 1NH6A 2WB5A 2VZUA 1XCXA 4UFJA 1H5VA 1US2A 1L8NA 5A6MA 1E6PA 4AYSA 3A6OA 2GJRA 1UD3A 3BLKA 3BVXA 2W4XA 2F7PA 3VGGA 3KLKA 1OM0A 1HL8A 2WWDA 3OB8A 3POCA 4DO5A 2XVPA 3M07A 4AEFA 1MQQA 5D8WA 1VJZA 2VZOA 1K9DA 3AMGA 3UR7A 3AXHA 1M04A 1W9UA 3W6LA 4AZBA 1V0MA 3CZEA 8A3HA 4KH2A 3NJ3A 1J01A 1JDDA 1CXFA 5EFFA 3GBEA 4HA3A 2G41A 1CWYA 2YL5A 1J0YA 5ABHA 3CO4A 3WN6A 3AZSA 3T2PA 2FHBA 1GHRA 3N13A 2EQDA 3D51A 1KQZA 1UR8A 1LJYA 2CERA 3B8SA 1UA7A 1WZLA 2EAEA 3GXPA 1O7DC 3NCOA 1JD9A 3ZSSA 3OGVA 5CXPA 3SCSA 3PZ9A 1LG2A 2BY0A 3A22A 1MXGA 3UEQA 1B3YA 1W91A 1Q4NX 1XRVA 1E5NA 1PX3A 2WMGA 2WMIB 3ARVA 3WL0A 5AC4A 1QNPA 5CJ5A 3AJ7A 1ODZA 3THCA 3AYSA 4S3KA 1JAEA 3SCOA 3MS8A 1P6WA 1FP8A 3TTQA 1LL4A 2J7GA 5JIPA 3DHPA 1R86A 4AZCB 3W25A 2VT0A 1VF8A 4MTVA 4GZIA 1XC6A 3PHAA 3WF3A 3I3EA 2JE8A 4AZCA 4NX0A 2D3LA 1KWKA 4IUGA 1OSEA 1V6VA 3EJQA 2WC4A 3QHNA 4TVDA 3KLLA 4UOJA 3N11A 5E9AA 3K8LA 3T09A 4PMOA 1WDPA 3WENA 2OSXA 2GJXB 1GQLA 4XX6A 3VGEA 1DHKA 7TAAA 1NWUA 2JFEX 3L4XA 3CBWA 1N82A 3GNPA 3CZLA 4P7LA 1UG6A 4BA0A 2ZUMA 1ISVA 5CGMA 4U2ZA 1I75A 5D4YA 2D1ZA 1R47A 5GPRA 2ZX6A 2PBGA 3ZOAA 4W7VA 3QR3A 5ECUA 2J77A 2OYKA 4N42A 2D3NA 2FH6A 3GXDA 1BYAA 3L4UA 4UFIA 4KGJA 1TVPA 4DO4A 3WQ8A 3II1A 4PMUA 1SFSA 2YL8A 2WVTA 4IPLA 2IGTA 4A3YA 1JF6A 2IUZA 1OWQA 4J7RA 3OGSA 4ACZB 4L4OA 4HMDA 3VD7A 5C71A 1EA9C 3MKKA 4JFWA 1RH9A 2PI6A 3WDJA 1GNXA 2J75A 1W1VA 3WUBA 4NZJA 3LPFA 4PMNA 2Y5EA 2VZTA 3CC1A 1JXJA 2VI0A 2VRKA 1OT2A 2YIHA 1E6QM 4OBSA 3ARTA 4NRSA 2VZSA 4WSKA 4CVUA 5CGTA 3AS0A 3WSUA 4W7WA 3DX1A 3OLGA 2J7FA 3BMWA 1V3JA 1HKIA 2BVYA 4CN1A 2J7EA 1Q6CA 1XCWA 2XTKA 1CDGA 1PZ2A 3BH4A 4AIEA 3WMCA 3VD5A 1UKTA 4AD4A 3GYCA 1UASA 1TFVA 3WMBA 3BCFA 2BXZA 1Q6FA 4ATDA 2FDMA 5AYIA 4ZE4A 3SCNA 1QNRA 4ATLA 3U57A 4UNIA 4PMVA 3S6TA 4AZ5A 1E6XM 4Z2LA 5CLWA 2GSJA 1MQRA 3HG3A 3HZ3A 1XSJA 3SUVA 5I2UA 1KB3A 1PX4A 2F7OA 1JZ3A 4M80A 3CHFA 4IPNB 3VMOA 3B9DA 3T2QA 3CMJA 3SCTA 2CHOA 4HPGA 5A3HA 1CPUA 3J7HA 3D4ZA 4AIUA 4H41A 3AI0A 1Y7VA 1V3IA 3T0BA 5BWFA 2D24A 3W26A 1S46A 2B31A 3AICA 4MB3A 8CGTA 2DSKA 3CGTA 4ZFMA 2DIEA 3WNOA 2DT2A 1NOFA 2XSAA 2WHJA 1BG9A 2D20A 2PC8A 1X6LA 1AMYA 2ZX9A 1QI4A 2A3AA 4UZSA 4JHOA 3TA9A 5HBFA 3EMQA 3VIFA 1IV8A 1QI3A 1TG7A 1E3XA 2BS9A 3LXCA 3NIYA 2F61A 1XSKA 2W62A 3VSTA 1CGWA 1M03A 3M46A 4YPJA 3DYPA 4AWEA 1WNOA 3GM8A 3T0AA 4M56A 3VGBA 3BAWA 4U5KA 5IFTA 3RJXA 2OWWA 4GQRA 1W9BM 1ISZA 3TV8A 4GPNA 3U7BA 3GDBA 1KBKA 1EIBA 3OLDA 1UKPA 4HZ8A 2YKKA 3UG4A 2VURA 2XUCA 3EDFA 3VIOA 3LPGA 4V2XA 3VIIA 5GNXA 2ZUWA 3VOCA 2AMGA 3IK2A 5CPSA 3PZIA 4UCFA 2OWXA 4FNPA 4OZOA 1E4MM 4H04A 3OIHA 3RPMA 4ZEPA 5BXSA 1VEMA 4TTUA 4BQ5A 5I6SA 2EO7A 1C7SA 1KTCA 2OWCA 1UR4A 1EDTA 2XM1A 2ZX8A 2DSZA 1KBBA 2W61A 1CEOA 4E8CA 3TP4A 3ZR5A 1TVNA 1W32A 4UQDA 2XG9A 1HVQA 2CBVA 3DC0A 1VB9A 1X6NA 3CMGA 1QOXA 1NOUA 1PPIA 1ZBCA 1RP9A 1H0GA 4HZ7A 1ISYA 2D0FA 4XUYA 2YL9A
chains in the Genus database with same CATH superfamily
3N06B 4APXB 3RMJA 2ATPA 3LN4B 1OQXA 3VFMA 3WFHB 4UR8A 2Y1YA 3DHUA 1UEMA 4V2BA 4ZXBC 1YEFH 3SY0A 3QEHA 3VFGL 1H6EA 1HE7A 2D73A 2FWSA 3MFFA 5AQ0A 5DUML 3RIKA 4EBQH 4HOXA 1I7RA 5GS1A 1XPYA 2DZUA 2BP0B 2ZX7A 4GJ1A 4BM7A 4QXTB 4ZFGH 3IFPA 4LQ1A 2P5EA 2DQJL 1BGGA 3Q2NA 1E9QA 3GC5A 2C4FT 1TZIA 1KTLA 3PAYA 4BWLA 5D8ZA 1NWPA 4W4OA 2WBJB 3WHXB 1PIGA 3T6CA 4JL1A 1HL4A 4WUUB 4JFDB 3FL7A 4NHUA 1RUQH 1O7VA 5F9WB 1O4UA 2O9RA 4XMLH 1KBLA 1WA1X 4UTWC 1KLGB 1UH4A 2J2ZB 3I9GL 4FNUA 2UY3A 5IJDC 3GAYA 1XSOA 3MRBB 1UZ6E 1ZE3H 3H9SE 2QVIA 2CZ5A 2DJXA 1JPSL 2J9ZA 2OQHA 4ZSUA 3S3BB 3O3DA 2CG9X 5I3JA 4UNVA 1HEZA 12E8L 3H3PL 4LIQE 1XYMA 2RJGA 5SWSA 1SSDA 5J6SA 3P82A 5CZ0A 1D7FA 3PJXA 1NC4B 4N1EA 1JPSH 4AKOA 3HJEA 4UQ9A 1QTSA 1EEXA 1Q63A 3NJNA 2V5BA 3KLDA 1GTHA 3VZYA 5D55A 4AGMA 5I3FA 2WCAA 4TXEA 4UQ3A 4HKJA 3RRXA 2YAEA 3FMGH 2HPOA 2QQKH 3L3DB 3U1SL 3X13A 1P9MA 3QHOA 3NZSA 4J3BA 2ICWB 3P6LA 3BUBA 1IZKA 2Z8WC 3VWKD 4GQGA 1UB5B 2HRPL 3MNVB 1XW8A 4MMXC 3M5VA 5CPNA 4BWUA 3N85L 1P4LB 4CCEA 2WWKT 4UQEA 2CLPA 4HYVA 5I3DA 4I0PC 3HFFA 4ZFGL 5GSVA 3COOA 3U9PH 2HTKD 1NCCL 1YN7A 2AJUL 3SDAD 1HJXA 3PF3A 2CBTA 1OVDA 3HN3A 2FLIA 1J8SA 2IIJA 3L4YA 3WJXA 2NY7H 4ZW5A 3USBA 1GPOH 2ICWI 3IU3A 3UWUA 5ALBH 2OCJA 5G2HA 1FNGA 4G9FD 4JIIX 2FATH 1QYGH 1Z0MA 4OB5L 4W5ZA 5B8CA 5DVOA 1US0A 2DQTH 5KAQF 4IWWA 3SDDD 2WMJA 1S2AA 3ETBJ 3MFGB 4KO6A 3QXBA 4BF9A 1QHQA 3ECVA 5AOLA 3TBSB 4ZUTB 1U3HC 3AU0A 3WYRA 3OAYK 3QUZB 3TBCA 1FUYA 1YQ2A 1Q6GA 1BAWA 1QPNA 2DMKA 2Z0BA 3TNOA 3DO4A 4GXVH 3T0EA 1X7FA 5A2JH 4ZOCA 2WYZA 5D2LE 3CQ0A 3RYMA 5FL0A 3MCKB 1CD9B 2DQUH 3ANYA 2XFXA 2ZXAA 4MAYA 4NPJA 4XH2B 3RWEA 3LZQA 4KRUA 4Q7NA 1WA3A 5IMKA 3OJ2C 1I7UB 3FIGA 3GMMA 3S1WA 4OFCA 2V6HA 3S0PA 4AFYA 1LQ2A 2X89A 4WFGE 3OB0H 3E80A 4OCXL 4Y1AD 2GQ9A 3UL4A 4O1DA 2ESVA 3CMOL 3OKDA 5FKYA 2JCCF 1FNSH 3QPXH 4G43A 4RX0A 2EE9A 3I6LE 1NFGA 5IZ7A 1EQPA 4A2EA 3N6JA 1AZZC 2HLFD 3WJMB 3U0TB 3SN4A 5LXXA 4AXWB 3QPEA 2NY3D 4L8SA 2VN7A 5CEZE 4R7NA 3T4YB 1W3IA 5L7XL 1OGGA 1UQZA 3QQDA 1F8IA 4LVGA 1GSMA 3IMRA 3AQYA 4TIMA 3IAQA 1S78D 3MX0B 3H2AA 3TH2T 4Y2DD 1IEIA 2CO1A 2PUZA 1B3VA 4GG8B 2UZYB 2EVHA 4QHKJ 5EOQL 3GRWL 5LIXX 2YCEA 1XIMA 3KVKA 4OFYD 3RVTC 3H6JA 1UPMB 4HLZG 3W75A 2GKIA 2AOSA 3WH6A 4JHUA 4JRYB 4WY0A 2APBA 3OLIA 4AMXA 3IU4H 3KPNA 3ORJA 4Q7DA 4WUUE 2NQHA 1FAKT 2ZOXA 3ILPA 1J86A 2NTFA 1KCZA 4ZTOL 1TSRA 2G2NA 3DV4B 1HX0A 4WVRA 3RCMA 1YIXA 5L8LB 1JGUH 1TVDA 3FOLB 3QCUL 2YPLE 4XMPL 1QJWA 4I7WA 4S3BA 4LDLB 2EYTB 5ADPH 1S5HB 4RLDA 2Q02A 3SE4A 3KWVA 4N8CL 3WY1A 4H1LG 1SXCA 3MJ6A 4BK8A 3D48R 4PJ7B 4UV7H 3T65A 3LM3A 2FTAA 5I1AB 2LHAA 3C2AL 5FO7B 1BEYL 4YHKL 2PCXA 1U8QB 1W15A 3KBFA 3NDYE 2XN2A 5A7BA 5LGJA 5HHOE 4WQ6A 4HIQA 4A7TA 4QBXA 2OP4H 2EXOA 1WFIA 3LKSB 2ZRYA 4UZUA 3B2UC 3VIPA 1T5XB 4KHTH 1N8WA 1BHGA 3QGAC 5IQLA 2IQAB 3CH0A 3MRIA 1F5WA 2IV8A 1KMGA 4YDKL 5D70L 2I25N 2RDTA 4OGAC 4OBRA 4QRPA 5CEXA 3T8XB 3QLLA 3ECBA 2FMOA 3QHTC 3L5WA 5ENWB 3EF4A 1UM5L 2YD8A 4ABUA 4LLVB 2DEXX 1VGKB 3CPLB 4N0YH 3PAJA 3C12A 5C0CB 2OSLA 1QO3B 3MMEA 3A24A 5F7FA 5BQ7A 3IXTB 4FE9A 1ALDA 2XVNA 3A4XA 2NV2A 3G3LA 3BGJA 1TIUA 1E0OB 1T99A 2GC4C 1U8NB 2XG4A 3BSZH 4LEOB 4NKDB 4NPKA 3LBCA 5CSYA 4QRTA 1UWEL 4EP8C 3G6JF 2FJGA 4JW3A 2ZP8A 3QDGE 3W7RA 4DI8A 4TNEA 4OZGF 5E0KA 2F0CA 3UERA 2Y6ZA 3G7TA 4DQOL 4NP9A 1CMOA 3UZEC 3VI3F 3P4MB 3LSOA 4PTTA 3EO0A 1NWSA 1XRTA 2AAMA 3ABGA 4P5TD 1E9YB 3WLRA 2DEYX 1UWTA 1YDYA 1RUSA 3FFSA 3EDKA 3N2CA 3P61A 3UTSE 3EBVA 1GOFA 1X5ZA 3ATDA 5DJXA 5EU3B 2QLYA 5LWYH 2Z93A 5KYXB 1OHLA 3Q06A 2C9XA 2Y7OA 3F7PC 4O1CA 2SFPA 3S96B 5DHVH 4J1OA 4P8WA 5DQPA 4Q2ZA 3VKAA 4A2DA 4WI4A 1XEDA 3UA4A 5H8UA 2P8MA 3HMXA 3OC5A 2Z7GA 2NUXA 4UT6A 2QKIC 4ZK8A 1IHIA 1KSRA 1XV8A 5JQ9A 1SQ7A 3EXTA 1Z9PA 3SFKA 2Y8VA 1YDVA 3LGEA 1ONEA 1FYTE 1UQSB 5J12B 5SWSD 2Y5SA 3SCPA 1AY1H 2HZHA 4AKPA 1BA9A 3BTNA 4M9OA 3SY6A 1R5YA 3VINA 3UCDA 2YBGA 1C1EL 4MZRA 5DA0B 5JMUA 3DVFA 4XNUH 4QM1A 5CCHE 2WB7A 5EC2A 4BH8B 1JCNA 4GRWH 4XP9L 3VIJA 4ES9A 4KRNA 3DLQR 3QQ3B 2W5FA 1CG9A 2ZAHA 3F5LA 3FULA 3BWUC 2WWNA 4MA3A 4EWJA 4Y16C 2QJIA 4TTGA 1AGEA 4C90A 4PJFF 2CRZA 1DWAM 2QGHA 1MVUB 3EOTH 1LE9A 4GRSA 4X6DB 3OKKB 3VQMA 3TZVA 3P69A 1ZT1A 3VFVA 2WZEA 4J40A 3RPKA 4XN8A 4KK6D 4ZOBA 5MERB 4D8ZA 1AHMA 4OSUH 1QLEH 2YJLA 3VTTA 2WBXA 1JZFA 3B2UD 4K5PA 2Z29A 3MT1A 1GIGH 1E4KA 1E4NA 2VXTL 1MRCH 2XH7A 3GMPB 1TQXA 4OJDH 4RPPA 4MUZA 2KUTA 4E68A 4XISA 4DJED 2C6QA 1UD4A 2WZPD 2K1MA 3QAZC 5CPTA 3UWYA 4PUNA 4JVUA 2DM3A 3U0HA 1TTQA 2CDEB 4KQ4L 4PJEF 4XCFL 2CZVA 3M86A 2YWZA 2WW5A 1UQSA 4MVBC 1ZNNA 3U4EB 1G1KA 3QORB 4KVNH 3EDEA 4GAFB 3KJ4C 1BQRA 1FNEB 1N59A 1PFOA 3B9AA 5CUSL 4CNOA 4YHPB 3PL6C 1AVAA 1W80A 2G2PA 3OZLA 1BQCA 4EI6A 2AJZA 4BQ9A 1YTEA 5HHXL 1EGJA 3T8XA 2AJSH 4Q6XA 4LAKA 1ZBKA 5TQ2L 5AW7B 1FCQA 4DCQB 4LU0A 6PTDA 2H1PL 4JREB 5AYZA 2RKXA 1E4WL 2GTWA 2DM2A 5CMAA 4BCEA 4QT5A 4GFXA 2AS5M 2A5HA 1BAFL 3B6SA 1CB7B 1ZSDB 3RIAK 4UR7A 4BWLC 3QH3B 4I77H 2EKCA 4GIPD 4N02A 3MC0A 1CJYA 3RNKA 2DQ6A 1MFAL 3U4BL 1ELSA 2VB5A 4H4IA 3GF8A 3WO4B 2OMZA 1X5KA 4GAGL 1EJVC 4H9XA 3MBXH 1NMCB 2BSTA 3GT6A 2ZUXA 2O5YL 4H0HB 1NICA 2QADC 4W4NA 2ED9A 2JI3A 3M88A 3D1MC 5FAJA 1JWMB 2XPGA 4OZFB 4ZXBA 3H22A 3VQLA 3H4XA 3GSQB 4CNPA 4HIHA 1DBAH 4RNFA 4AQ8A 3AACA 1A6UL 4H0GA 3ZLHA 1QNQA 1ZJBA 1QO3A 3MMEB 5KANG 1W2VA 2ZKWA 4KUZL 4NBZB 4PFEA 4K5LA 1L7IH 2O9OA 2EVIA 3QQ4B 3O6KH 4L4PA 2UVEA 5TAOA 3VCRA 4ZMZA 2IH3B 1WFMA 2B39A 2NSOA 5AW5B 1UYWH 2CDGA 3REVA 3W1LA 4JFQA 2PPEA 1WXZA 2NWRA 1S9WB 2ICCA 3U82B 3UIYA 1Z6JT 1FFTB 2JSFA 4E2VA 1KJ3H 1UXSA 3SD2A 4CCDA 5B3SB 3LKPB 3QC5X 4CU6A 1Q0YH 1PXGA 1NSNH 5SV3A 2G75B 3G6AB 2NY2D 2PDKA 1GTNA 1MWOA 2VMCA 1R3JB 2N0MA 2L7EA 4U0QB 1DOSA 2G4FA 5LIUX 1AKJA 4DWSB 4QFUA 1XMEB 3WU1A 2AV1A 1GL4B 3UG3A 4PS8A 4JS7A 5ID1B 1T0MA 1J5SA 3N6QA 5D32A 4U7KA 5EA9A 5ELIA 2A7BA 3DTXB 2VISA 3QDJE 4PRTA 1V05A 1LP9A 2AC0A 1D9KB 3FQTB 3HHMA 1C8YA 3A9IA 3K13A 4FNTA 3FQWA 3HI6H 4O2EB 3TNMB 3ITXA 3UZJA 3RL2A 4ZFZB 3WMSA 3EH3B 2WWOA 5HVFB 2B1HL 2NSQA 3RVUD 1AQKH 1U8IA 1O6VA 1V7NH 4ZBJA 1CF8L 3D85A 3K0YA 3KPNB 4PR5B 4UAOB 2CLMA 2ZA1A 4JJHA 3SO3B 1TCMA 2BIIA 1XL6A 1X44A 2QMJA 3DO3A 5LAPA 1SJBA 1KM3A 3KEHA 4D6DA 2FE0A 1SMAA 4KCWA 4M5SA 3VG0L 2EO9A 3ZE2E 4MNGE 5KVFH 1PZUB 5M17A 5CJXC 2FX8H 2V9UA 1KJ2L 5C07D 4NJGA 8XIAA 2CLOA 5AYYA 3MGTB 4UMGA 5DJYA 5C70A 1K2DB 1AJ2A 1KTRL 2FH8A 1W3KA 4N2BA 1J5OH 3PWVA 3QYCA 2DSUA 3T8VA 4NO5A 5KSAB 5DBUA 4U6XB 2XN0A 2G3IA 4JTDA 1OK4A 2QQ6A 3IGUA 2D9QB 4WUKH 4UDUA 5FUCC 2C9AA 5CJMA 1JGLH 3OZKA 1PZ3A 5GRUH 4Z1DA 4RAVA 1FHDA 4H9ZA 4PJGE 2X7LB 1QFUL 2D4DA 3GSRA 3CPRA 1GR7A 5T1KD 3HBLA 3HPZA 1PF3A 2LU4A 2C79A 3RDJA 1RZPA 2V5MA 4OF3A 3U8GA 3V0AC 2YR1A 4UMAA 4G43B 4M8UA 4P8VA 4ZW8A 5D71L 1UR9A 4XPHH 1XXXA 2VELA 3IJEA 2XXMB 4F1ZA 5HHOD 4DZ8A 2XM2A 1G94A 4NL1A 2XICA 1XCTA 3TA3C 3NG5A 2ALWA 3Q8CA 5I6OA 3WD0A 2CNZA 3OKNB 4BH7A 2XX0A 4YDNA 4AHPA 3C2AH 4GBXD 5AVZB 3FUNA 4OY9A 4R4BA 1U8JB 3C6EA 4NRZA 1F4YL 3WHE0 3ZYZA 4AD5A 3R43A 4TLTA 5BROA 3WFLA 2APXA 1AQDA 4HCHA 1EWHA 1IYXA 4NUJB 4X7CC 2XIMA 4KWWA 3OJVC 1OM3H 4KI5C 3GUTA 3GRGA 4YSOA 4NI8A 3WJJC 3CX5J 2APTA 3CFEA 4G8AC 3DX9A 2QXWA 2A2QT 2YBTA 4L4MA 2ICSA 5FF4A 4PYSA 3CPLA 3M7OA 2XWJB 4XQ6A 5E5MA 5I76B 3IJ8A 4FN0A 4B41A 1R5IB 5FYKU 5KZCD 1BRLB 1T7XA 3B2VL 2W0PA 4NQSA 2XV6B 5EOQH 2ODOA 3Q9QA 3R0UA 5G4EA 2GUOB 1DN0B 4B9YA 2ADFL 3CIAA 5CBIA 1I85C 3DESA 3UBXB 1FCVA 3O0FA 3EF7A 3QQ0A 2CQVA 4WOZA 1CT8A 2A5UA 1BFOA 2H0EA 5IFPA 3MDUA 2OU4A 3QCVH 2F5BH 1JL8A 2CLKA 3MO1B 1UZ6F 2Q3RA 1YPXA 3WUWA 4MSWA 4HALA 5LGJB 3I84A 4UT9A 2X4RB 1PCSA 1RR2A 4JTUA 2PYEB 4HG4K 4YHGA 2GYSA 2A9NH 2X9WA 4KHTL 3UJJH 1LTDA 2YX0A 4HCGA 1MFBL 1HJQA 1F3JB 1KJ2B 3X13B 1PS9A 2XYBA 4AE0A 2RJMA 2HJKA 4MJID 4Y6GA 3STZA 1AOHA 5KTEL 3KD4A 4Q14A 3CNKA 4JRXD 1MQKL 3E6EA 3NQMA 3O4LA 1U58B 1VADA 1JGLL 2YMTA 2VLJA 4S1QL 5GRUL 3B9KB 3EJYC 1S9VA 1UC6A 2R69L 3GXIA 3ENLA 1M6JA 1ZLVH 2MTAA 2CW6A 4TX6A 3QZWA 2DZVA 1OZQA 3R8HA 1X1NA 1IFHH 1BPLB 1X5FA 2CM5A 3L1OH 4PRBB 3P3TA 4J8QA 5E8DL 4L8CB 1X8CA 3BSMA 2WLZA 2WNKA 3QZ6A 3WN5B 1I7ZB 3G5WA 4G9FB 1UD8A 5MF5A 4LCCA 1SR0A 3VGFA 2X9XA 1I60A 5L9FA 5G4OA 3APDA 3FW6A 3UJTH 5C0FB 2NVAA 1NFDE 1OAKL 4GYPC 1FKWA 4GZEA 4B2DD 3P11L 5CAHA 4IKJA 3REWA 3GRWH 1TB3A 3AREA 1SR9A 2V5LA 3MAWA 4JKMA 3ZHFA 3EYSL 2C4FU 5T5FH 3V4VA 1W3TA 3AY4C 2QDHA 3ABZA 3DI2B 2J8OA 2D3JA 1D8WA 1ICSA 1K7EA 2EPLX 2HT2C 3M0JA 3THAA 2JTDA 1S5IH 3C3NA 2FJHB 4QHNA 3BUVA 4P61A 2A3EA 5HGAB 1SVDA 3EUUA 4M5YL 4ZUUB 3CBJB 2PDHA 1XIWC 4APXA 1MCQA 1E4KC 5DSCB 2QT3A 4LRIA 4TR9A 4CW1B 1JRCA 4KK8D 5JLZA 4PJIB 4ETQB 1S7VB 3LRKA 5IJKA 2ZCHH 4HWBA 4PJAB 4X5XB 4YBQD 1IC5H 1H41A 3ZFHA 4Z2KA 2Y89A 2IPKB 5DF0A 2YXFA 5LLIC 3I85A 3NDYA 1BXAA 2ARJA 1EL3A 3WJWA 3RPTA 1QTYT 3H9HA 3NCYP 3WFDH 5FFLA 5IR1B 3QW3A 5DELA 2P5EE 3NIDE 4L5FH 2W94A 4FHBD 5IROA 5CZVL 1YNQA 1JDAA 5F1NA 1GJPA 2XQYG 3ZT5A 1AIZA 3R10A 1OFOA 2HFFA 3IGXA 3DYOA 5JPNC 3FBQA 3K6FA 1QEWB 1ESOA 3K2MC 2XSKA 5GGSB 4LRNH 1XBRA 3UPBA 1WB0A 3GWQA 3LA4A 1J8RA 1AHWC 2OT1A 3WBDA 3FO9A 4IFKB 5D7KD 1XQLA 2VDLL 5CIPH 4NAMA 4KNQA 5DJZA 2Q86B 2Z6FA 1POJA 5AHEA 4WO4A 4ZG1A 3VXPA 2D2OA 4FLHA 2D03L 2ED6A 3WNPA 1O5DT 5HGBA 4LWWA 3PPHA 1OGAE 3BPLC 4B3LA 1WZAA 4PLNC 3EO1A 2L0DA 5F3BB 3CHDA 4I48A 4JRYE 3QHZL 4LSSL 4UBDD 3S8GB 2WHMA 3B2PA 4IG2B 4JQ2A 2X4UA 3L9YA 3QS2A 1XLKA 1BWMA 3LEPA 4A6YA 5C6MA 4NN6C 1KRBC 4ZRGA 3OM3B 4FL4B 2CLLA 2CWRA 3MNVA 4KHXH 4NRYA 1W0VA 2QPUA 3U9WA 1A0DA 1AZVA 3FSWA 2H32B 5KTEH 1FNAA 3DMMA 4BCYA 1YY8B 2CSPA 3L3IA 3PWPA 2OMBA 4YEFA 3SYOA 1NCBL 4K39A 4YJ5A 4DKFL 5E9DA 3DX4A 5IHUH 5HWNA 4OQTL 1G6RA 2FZNA 2GYIA 4Q8QA 1C5CH 1NANH 2XSBA 2IMNA 1URLA 1SJEB 1XGTB 2D31A 4FG2A 3UO1L 3WFBL 5HVHC 4WI3A 3VWKB 3ONCA 4XZUA 4DJDD 3B7UX 1UUOA 3GTFA 1RHFA 3QM3A 3RM8A 4V11A 2X7VA 1A02N 4OLVL 5BW7C 4LF3A 1IAOB 2X8RA 1F4XH 2H6UA 2UY5A 1HP4A 4C1NB 1RVFH 4N6RA 4JHZA 4YTQA 1V8HA 4ENZA 4L1LA 2YZ1A 4Z3TA 4Q9RH 1UROA 3RLHA 3M1ZA 3K5XA 1IGIL 4NYYA 5AVVB 4HHLA 3I7SA 1IQDA 1HZYA 4IIZA 3XISA 3WNIA 3U0PA 7CGTA 1XLLA 5FB8A 3ERXA 4LOUC 2YZRA 5D7JB 4B96A 1JGVL 4XTIA 4QXTA 3UJRA 2X6VA 1E0XA 2ON3A 1H1ZA 2WBKA 3H0TB 4OJAA 5GGTL 2NUTA 1HF6A 4MWAC 4ZMAT 1F42A 5GS1B 2XGIA 4JDBA 3SY0B 5J7CC 4IK7A 1R3RA 1PZ0A 2JMRA 1EEYB 3G1XA 4XBMA 4J5NA 5B7ZA 3A5VA 3EJRA 3HMXL 4M93C 1QTWA 5E9DB 2HROA 2AF2A 4GBXC 3OKLA 1QUPA 4O9HH 5F9DC 4P46B 2NR6C 8FABA 1JERA 1PHQA 4O18A 3AZTA 3GJFA 4RCXA 4MJ5B 3TIEA 1P4BL 1KIQB 1CWVA 3L16A 4S0SD 5EDXA 6XIAA 1TMCB 3ZMRA 3O2WH 4R5VA 2WLIA 3D2TA 5C0BB 5ITFA 5E6IA 4MHHI 3AGVA 1YE6A 3U6WA 1OD8A 3PTKA 2YJQA 4MWFB 2W07B 1CK0L 2V9TA 3ZDWA 5SWZD 4M3KB 4L6OA 3VI4E 1CZ8L 2B2XL 1A6TA 4MY8A 2AQNA 1E5JA 4QY8A 1NAMB 2EEDA 5BS0A 1Z3RA 4IBVA 1HHGB 4XVJL 4UTBH 1Q9KB 5E6SB 4FI6A 4CILA 2GJNA 4GNVA 5E24E 3TO4A 4S3AA 2AXGB 2GSIA 2X1OA 5DO2C 4IM8A 5FYKE 3TJEH 1FWGC 2NY6C 1PKLA 4C7GA 3MA9L 2ZKHH 1OTSC 2HB0A 2ZWSA 1XWVA 5DJDB 5AW2B 4MPQA 2ISWA 3B0PA 1F6AA 2Y3NA 5I26A 2BRRL 2ARJQ 1RZKH 1CL7H 2VR8A 5J89A 1U8HA 4YL4A 3HAEH 3KPSA 1KBIA 1NFPA 2ZKHL 1W1A1 4KDTC 4PTUA 4KTEL 4WZHA 4N5UA 3NIFB 4RGNB 1L7IL 1JXFA 1R87A 3RDTA 1COBA 3SQOL 2N1TE 4YVXA 3ENEA 3QIWB 3QOMA 5CPOA 4Q22A 3GVQA 3HG1B 2IPGA 4R96B 1DDHA 1AP2B 2ZYHA 3IJHA 4K9EC 3NESA 4QXVA 5DO2D 1F9CA 3H9HB 1GW1A 1UFGA 1U36A 2P3YA 2WUBH 5HDQL 5K9KB 2DQTL 1R0AH 3CN4A 2INEA 4AGOA 1D6EB 5CEZH 3D39E 2VDML 3BXNB 5DHXB 4LVOC 3VKCA 3NJHA 3EA3A 3AMKA 5CH9A 4RX4D 1T5KA 4M6VA 4MLJA 2WKGA 1CFNA 1XLHA 1F00I 3W3OA 4C57C 3VD9A 1Q65A 1NEUA 5KZDA 4AX3A 4B5TA 3DJ9A 3V95A 3KLHC 4I77L 4XZNX 1I3RB 1TJGH 1U4FA 3V7AE 4CMHB 1XF3A 3DGGB 2YO3A 2VGBA 2YXOA 3APTA 3KRZA 1DCEA 5HGBB 1IAIL 4AQEA 3KPSB 1L3NA 2H47C 4JDZB 4HNCA 1GS7A 4I5RA 2PCEA 2Y69B 4XMUA 5GRYA 1VFUA 1ZXQA 2J12B 4U33A 1U92A 4LP4A 3S2JA 1I8KA 3NQCA 2OQYA 3CV5A 3VWJB 2YPKB 2C1OB 4GMTH 4HUXB 4AY0A 3P4OA 1XGPB 2ISSA 4XKMA 3HG4A 4O2CA 2CWNA 3X3GH 1F3WA 5HI4D 3QTGA 1DIKA 5BCAA 1UACH 3CN2A 4Y4KB 4GABA 1ZRUA 1W3HA 5HNNA 4M6UA 4AD1A 1FH5L 1EGMA 1CC3A 1FVDA 1PWMA 3QKEA 3ALGA 4OHQA 1AW1A 3UNTA 2KKQA 2VLRD 4TVUA 1I4FA 1ASQA 1AJ7H 3ZKNC 1BKHA 2QPSA 4O57A 4GVHA 2X2JA 1TYEB 3U79A 4R85A 1X4XA 1VFSA 5HMDA 1S6NA 3KBHE 5A3ID 4TQTA 2JQMA 4PJ8B 5D1XA 3DZ1A 2BOCA 2QTEA 1DSFL 2ZQKA 3AB0B 4HPOL 3DWTA 4QOKB 4RZKA 3JU2A 3I2CH 5IHZA 1H8SA 5HJBA 1KV3A 2V5CA 2WQVA 3V55A 3LH2H 1GXEA 4XPAH 3CLFH 1KNWA 4J4KA 2X4QA 4LCWE 5D7LB 6TAAA 5FB8B 1A2YA 2JQXA 3MV11 5AVXB 4HVBA 1SLXA 5AYXA 3QHZH 1EJOL 4LSPL 3UZQB 3P9WB 2A79A 2H41A 2OMXB 1E30A 8XIMA 4LIQH 2QMKA 2W9DL 1UT1A 4TL4A 4H20L 5T5NF 4N1HB 1E9ZB 3F84A 3F2BA 2TRYA 1OYBA 4KV5F 1H6TA 2AJVL 1WC7B 3WN5A 2YOCA 3BZ5A 3E6FB 2JTYA 4PWFA 4F79A 4POZD 4Q8BA 1CGUA 1FV1B 2BHFA 1XYBA 3CFEB 1ZLUK 3FA3A 4LLMA 1TV4A 5C0BA 3UWQA 4KFMA 1JVKA 1OT1A 2EDXA 2J21A 2QVTA 3KL0A 1NVMA 1U2CA 2WZ6A 15C8H 1AJZA 3STZB 4OCXH 3ELAT 5D2NA 3MJ9A 7PCYA 1OTTD 2L04A 1TTIA 2VDHA 4GXWA 1SOQA 1KCUH 2HFTA 1U93A 2BNJA 2PDBA 3DFNA 3EWZA 5IDZA 3HVDA 1KM2A 3LX9A 15C8L 1TJPA 3MLVL 2VH5L 3HUJF 4LSQH 3UYOD 2B5IB 4RJEA 1FN4B 5I3KA 4ZFOA 1P7KB 3KNBB 3DGCR 1MFCL 4JFDE 4MBRA 5K1JA 3ATAA 4ZS7L 3T8LA 3SN6N 3QO0B 1RY0A 3GXFA 3WLWD 4YFLI 4DZ8B 5EZLB 1Q7ZA 2BSCA 3M7SA 1J88A 2R1WA 3SCRA 3LMZA 5FJPA 3QT2A 3VA2C 4M6MH 3BLOA 4R0LB 4JX5A 3BLPX 2J9YA 1UWEH 1RK1B 1NLDH 4MCZA 5CP3A 2GEEA 2HG5B 4NZ3A 3I02B 4C6PA 1IQDB 1UCBH 3TFCA 1NGQH 3PL6B 4ONFH 3C5ZA 1DKWA 3HI1B 4HBQA 5KS9E 1MZHA 2QCNA 5C07B 4NS0A 3U4FA 1EDQA 5ABZA 3GDCA 1CGSH 3DA0A 5E5MB 5I76A 3A4EA 3HCVA 3DO7B 3DOPA 2V2TB 4PJ5E 3QWRA 4JFTA 4NP4L 2R1XA 1PKQB 1XR8B 3GBDA 2WCSA 4HXAL 1LWIA 2X16A 3IV8A 6TIMA 4GUPB 4C56A 4EUPG 2QDWA 3VKBA 1DSFH 4AEOA 3D12B 1OYAA 1WUFA 1YDPB 1ZS8B 4MYPA 4NIYE 1QFPA 2GK1A 4KOBA 3MKGA 4PI0A 3APGA 2BJML 1XS2A 2X4PA 3NJLA 3II3A 3C2YA 3FV9A 3F83A 4LBSA 1F76A 5AB3A 3PHOB 3AWGA 1CICA 5HDWA 4JX6A 1AUSL 3A67L 2CEQA 3IJQA 1Q6DA 1BEYH 3D9AL 4XXWA 4A6YB 5I73C 2QF7A 5HHME 3L13A 3T55A 3SBFA 3WF0A 3QUMA 1UP2A 3SRKA 4PCPA 3LQGA 1ZCCA 2DYPA 2QCEA 1HC1A 4JEQA 1E1CA 1TTBA 2QKFA 4Y9OA 3TFBA 2DI9A 5ALCH 4Z7OF 1JNEA 3KHQA 2FZ9A 4NQCD 2H3DA 3KOWA 4OJEH 1MFDH 3TX4A 5IHBA 3FO0L 4AEIL 1FORL 4XVDA 5AECA 1B0GA 5G55A 1ZLWK 3GM0A 1D5XB 1S7TB 4GIYA 4GAYA 4R0LC 2NPLX 1IVLA 4K5OA 3VH8A 2F74A 1XGQB 1XDJA 4R3SA 2XFRA 3FSTA 3FYIB 1P5UB 3LRGA 2EPOA 4L8BA 4XRCA 1A1NB 4L65A 5LA1A 1EERB 1M1XB 3APNA 4K5MA 4XCYB 1UUQA 2NQZA 1QI0A 2XPKA 4JFQB 4RMWA 5D7HA 4PBWD 5A2BA 4RMUA 1K03A 1KLUB 3UPRA 3CPGA 5I0WA 4L8CA 3D25A 4BZ2L 3LS4L 3M1OA 3QRFM 2XV3A 5DRWA 2XVBA 2E9MA 5I1KL 3NWRA 4WDTA 3VE9A 1TLMA 2XTJE 4R4FH 3BT0A 4YBHA 1L6YA 5BRBA 1VCFA 3O06A 2JJTA 5I79A 3P0VL 4LCYB 5CC6A 5I82A 1Q0EA 3ARED 1A0QL 1RPQA 3RL2B 4AYGA 4KZ0A 3RFAA 4ODWB 3TNBA 4KXAA 3O8XB 2J3SA 3QZMA 3V4UH 4JDTH 4X4YB 3DTXA 5HGAA 4NJ9H 4K7FA 4E41A 3FN3A 2YEZB 2FJHA 3MLUL 4X5LA 1QMLA 2DMCA 1R3HA 4YHIB 1UWSA 1XR9A 2BC4A 2O92A 3VJ6A 2P53A 1PTZA 3FXYA 5DXXA 1R0MA 1CL7L 1D2PA 3NCEB 3J8F7 3HE6D 4X7TA 4OIIH 3TN0B 1J9SA 4EDWH 1Y5VA 4DSYA 4NRRA 3FCBA 2IKGA 5IT2L 3QR1A 4GG6A 2VCBA 2ZAGA 1JWUB 2AK1L 4M29A 3PPCA 4ODXB 5B7MA 4IJCA 1RZ8A 4KJQC 5D1QD 4LCCB 3NDOA 3WK2A 1KIRB 1W5NA 2I14A 1KJ2H 1TTCA 1UA6H 3DXAA 2QZRA 1UWAA 3M0LA 4ZQNA 3HB3B 2X38A 4D9PA 3LQZB 5F9AC 3NIGF 4Q8OA 2JJSA 2PDJA 2XH4A 2PU0A 5BZDB 1BVNT 4BJLA 3BG3A 3V5DB 5KVGE 5KSVA 3KBWA 1FWHC 1NDTA 4ZQOA 3L3GA 2J55A 4Z1PA 2XBTA 2V63A 4RZ6A 3O2WL 4AQOA 1KBGL 2L4OA 4N0UE 3DJZA 5DR5L 2R2HB 4AIXA 4PIBA 5EU9A 4K3DH 3NEVA 2VX4A 4MY9A 5D1XE 2BSRA 3G24A 4F37K 2VDMH 4HUVA 3MV9E 4L2YA 5EPMA 3B1UA 1HKWA 4LS1A 3DOSA 2VX7A 1FNSL 3QPXL 3ZMNA 5LQBH 2EIEA 2R29A 2DIBA 2QW5A 3APCA 4N6EA 3NAVA 3PAZA 3L4ZA 5JR1H 5KBKA 4R4ND 4WJG3 2BGQA 2OI9B 1QK0A 1L5GB 2MEJB 3UQNA 1ZWIB 3MI6A 1TOXA 4PW3A 4N8PA 4ZPTB 4LRSA 2CBOA 1ZA6B 3HEIB 2BVUA 3H2WA 2WLMA 1AG0A 5DFVD 2VUOA 1UYWL 1FL6A 5ABDE 3ZKQD 5DY3A 2CO7B 3FVMA 3FONB 1F4WL 5FGSA 5LAXA 1XYZA 1AE6L 3HKZA 2XFYA 5JIWA 4M81A 4R53A 1MJUH 4YO0B 3NSMA 1N59B 1PLGH 4KGLA 3GFZA 3I9GH 4QKTA 1YEHL 1E2WA 1YPZA 1CECA 2YQ2A 4JDTL 2ITDB 5PAZA 1B4EA 4P2CG 4OAWA 3ISWA 4DEFA 3UZXA 1PVNA 5K39B 2N4IA 1A9BA 4BE5A 3BW2A 5HI3C 1UH3A 2VWSA 2WKOF 3MRQA 3H2NA 3S6OA 3SKJL 1G87A 3S5SA 3AIQA 3QPQD 4NO2A 4XVSL 3AHZA 2KZWA 2WSRA 3H7VA 3HG0A 4Z7VF 3VE7A 4ACZA 4ZSOA 1MFEL 2QPFA 3CZFB 4F91B 2HBXA 1HXYB 3LEYL 4TXVB 4X8JA 4GAGH 3G1AA 4IIDA 4PR5A 3LH2L 1D8CA 3GHRA 3FQ4A 5A5WA 4HC1L 5EU6A 3ZL4L 3U1PA 3LH9A 4WKZB 4EOWL 5F4SA 5J9PB 4UNUA 3W7QA 2FEJA 3PFQA 4OZGB 1GVEA 3HBQA 2BBFA 2C3ZA 4F1SA 3G6JA 2AJ3B 4QLKA 3VFTB 1KG0B 3FN9A 4P3CH 6CGTA 2PRMA 1ITXA 4IP4A 1D9KA 3FQTA 3MSYA 1NDGA 1T4KB 3P67A 3X2QB 1L9OA 5IVNA 1KGYE 5ID1A 5GGTH 5FDWB 4DPBX 3GUWA 2X7LA 3GSRB 3SKMB 3THML 1XB8A 1OIFA 4DKAA 3IDIA 3OD3A 3SPVA 5D9PA 2YAFA 3ZHNA 4KQ3H 5KSBE 2XXCB 1WFNA 2DI7A 4EN3C 5CN3A 3UJEA 3MRQB 1QU4A 1V6WA 1DP0A 3H56A 5BZAA 4X2UA 1EO8H 4XWOC 5ADOL 1F07A 3HVNA 4FQ2H 4YGAB 1TJMA 4L48A 4TNWF 2CDGB 1FIGH 2F7QA 5GNYA 2O56A 2X0VA 4OGZA 4HEPG 3DX2A 4GK8A 4JN6A 4PUJA 5D7LE 5KBNC 1GTFA 1UWIA 2EUZA 3T0WA 1PBYA 2CO7A 3GSXA 4HJGB 5I74C 1ADDA 4G11A 5L4JA 1P6AB 3CFBB 2PPFA 3EGDA 4PLJD 1T03H 3V7AG 2EJ1A 4HX1B 3TCXA 4EVNB 5I15H 3E2SA 3N18A 4XSLA 3ES8A 2Q3OA 4URIA 3HBPA 4LZKA 4JIPA 3PNWB 4JFED 5IB1B 3GSQA 4C6NA 3BFQG 2VLKA 2XZQH 4Z7UA 2B5IC 1F8TL 3W1NA 3MBEA 5C7XL 4Z8FH 1MREH 2J25A 4L8DA 4U3SB 4ESKA 2QPXA 3ROLB 4M43L 2KYIA 5I9QB 5J6GA 9XIAA 3O81A 2ZE3A 2UV8G 3K2GA 3PJNA 4WI9A 1IIKA 1PZCA 1KLFA 3FFCE 2ZDRA 5CAKA 5DUPL 4H01A 1ZSDA 4J23A 3VDAA 5HPCA 3DV4A 5A8MA 1UXSB 4F5CA 4HIJA 4A7VA 4YX2H 5JHAA 1ADQL 4WD0A 1SJXA 3ISRA 3LCYA 4Q56A 5CZRA 2CYGA 3KR3L 5KSVB 3N0PB 3P3YA 4GS7B 3W6MA 2V0TA 2Z31B 4UQIM 4MVAA 1TCRA 3BZ4A 5SX5H 1MEIA 1NOWA 3EKCA 1XPGA 2J4WL 4QTGA 4YHNA 4MG4A 3EX2A 3FAXA 5BXTA 1Q9OB 4XPFL 4AIOA 2CBQA 3G1SA 2H6RA 5HYJE 5KYNA 4MZ8A 3TYZA 5AFDA 1KEML 2BOBB 5JQ6H 2EECA 3FTGA 5KVGL 1FVEA 1VYSX 3CTTA 3ECWA 1WZMA 2AKMA 2EPNA 2J7LA 1LLWA 3V5FA 4WW2C 3LCLA 1DQDH 1MJJB 2F54B 1GA2A 1UM6H 2AJYL 3NRFA 4WGKA 2V2DA 3D0VB 1KLFB 2A9MH 2W67A 3UU0A 5JHMA 3BPNB 1CS6A 1T2JA 1R3HB 2GB2A 4JNXA 1C8XA 3IGHX 1CD8A 4PMQA 2HV5A 2IBBA 2P10A 2VRQA 4B95C 1TSHA 3QXAA 2C7FA 1UEYA 3DBXA 3NQVA 4QXIA 4IJ3C 3UYIA 4HYWA 4OCWH 4UNTA 4JN2A 5IB3A 2DICA 3BSZL 4J9JA 1ZJAA 1OIMA 4NC2B 4E5XB 3GY1A 1KACB 3R8GA 2F08A 1OX6A 3WL9A 1TR9A 2AL2B 3OKYA 3ZRFC 2R29L 3EO9L 3S88L 5D33A 3RAOA 1R7AA 4PCYA 2ZNWA 2YLLA 4MM1A 4KRPC 1TQVA 1KXVA 1YEWA 2AVGA 4HMCA 5H37H 4YSEA 1NELA 3LHWA 4Q8PA 4ZYKA 2WIIA 1JFXA 1BXUA 1FNEA 4G9DB 5HI3D 3VX1A 2Z7YA 3NQGA 1LQ0A 2UZYA 1O7DE 1PZ1A 3FQYA 3BWWA 1NL0H 4X5WB 4L9DA 4MMZA 4Z7VE 3ZTEA 4EZJA 2AMXA 2C0AA 2D7OA 4CL7A 3J27A 4LDCA 1EFQA 2X0HA 2KZHA 1QP1A 3V7PA 1PS3A 4D6HA 4GBDA 4AVNA 3ML8A 4EX4A 1SGJA 1S3RA 4PREA 1YJDL 3W71A 2ZXWB 3MMUA 4KY1L 5LNSA 2BFGA 3CVHL 2P8MB 3SGDI 2A3BA 3M0YA 3URQA 5D4HA 1VBUA 2WNNA 3BOLA 4FTDA 4J3SA 4QQUA 4LVHB 5HHVL 1HNFA 3PN8A 3W88A 2ZT9C 1TF4A 4NPYA 3A3HA 3LQLA 3H7LA 3LHPH 1T5AA 4RNIA 1EKOA 3LBMA 4L29A 3S3PA 4JTJA 1OCCB 3TVMB 2F54D 3E9TA 1J5DA 3EPNA 1CGVA 5FKPB 3NQIA 1P4LA 1CX9A 3H42H 4IXXA 3E74A 3SKUD 4XK2A 5BU9A 1UXWB 3IE4A 4ACTA 4LCQA 2LAGB 4ONVA 2CGRL 2YUWA 3JUZA 5DMKA 4XH2A 3RWEB 4AQ1C 4GP5B 4OLYH 1S2WA 3ZJ6A 1GGIH 1TQJA 2X4PB 3CVHH 5GQBA 3EIFA 1N7ML 2YGPA 4CVXA 1JGUL 4H5SA 4K36A 5DD3L 1CTMA 3CUJA 1NFDF 1QBAA 1T7VA 4OGYL 3IRSA 4S2BA 1N68A 2ICEA 2Z92B 3D3VE 4WSJA 2HJLA 2IADA 3Q6FA 5IESH 2EADA 5ECVA 2G3NA 3EH4B 1A80A 3U9IA 1CFSA 1RSFA 2BW5A 4YXLH 1M7UA 4JOMA 3RN6A 3K4ZA 4QS5A 4PRHB 4C6KA 1AMKA 2EDOA 5SX5K 3NFPA 3WGVB 2XYLA 1MH5B 1YVLA 1V7MH 2LABA 2WTPA 3C5ZB 3QJRB 2DLGA 2WNQA 4N8VG 1CFQB 1F11B 3CSYB 1DQJB 4Y0GA 5D2WA 1NCHA 3LN5B 4IDJL 3DUGA 3LKSA 1RAMA 3X17A 5I0DA 2FKPA 2FT6A 4NZDA 3PGDA 3G5EA 3ZX1A 1R9XA 2R1YB 4OCWL 1IWBA 2Q0ZX 4Z17A 3AYVA 3I6SA 4HWEL 4M93B 2ZRVA 3FVDA 4KH9A 4QJ4B 2C19A 4RV8A 2VZ3A 3SE9L 3EOEA 2ISDA 2MPAH 4AM0A 4ILSA 4NOBA 3UJIL 1BDYA 4WJEA 1FRGH 4NZ5A 3WTUA 3CMOH 3O16A 2VR6A 2YFNA 4HZLB 5DO8A 1I1AB 3QUML 3SY8A 1ZK9A 2V7NB 2XVLA 4UI2A 1KJ3L 2BDNH 4RZ5A 4ZVJA 2VFEA 2DKUA 3W9ZA 2AQTA 1TPDA 3EGXB 4HV8B 3HRZA 1G43A 2BO0A 5IREA 3OZPA 4B3ZA 1YNKL 5DJCA 3IDXL 3SZKC 1AW5A 1S2VA 2E77A 3CH1B 3E6FA 1Q85A 3MOAL 1NIBA 1W37A 3V4PB 2Q5BA 1Q2RA 4NO3A 4BZ1L 2FHFA 4W85A 3LI1A 1PNCA 2D7NA 4R4NC 4YOKA 2Y62A 4WUUA 3V18A 3VFRB 2AW2A 1P4BH 5EU7C 2JQZA 4I85A 3RDTD 4DHGA 4GYFA 2BNQB 4FNLH 2IANB 4I89A 2F18A 5D1ZC 3V0HA 1CQYA 3UZWA 4OF5A 1A5FH 1BV8A 4RETB 5FYLE 2VLKD 5D6DA 3FRPB 3M0ZA 3ZE2B 4NCDA 3BAIA 3FC8A 3C5QA 1JGEA 3BWUF 3CSBA 4JQIH 1CF8H 4NN7B 1NWRA 1RY7B 3BUIA 3LY0A 3NJXA 3DTUB 3V6OE 5L88H 3RIFF 4Q4KA 1X3DA 2RACA 3W0WA 5FHAH 4QLJA 2VQTA 1ERNA 3S3JA 3SB0A 4E6MA 4FL4C 3BP4B 2GEQA 1OD0A 1TZGL 2Z7UA 4NQEB 5MEPB 1NQ6A 4AYMC 1KFEA 2NW2B 2XFGB 1QSVA 2Y2YA 4MAUH 5CR8A 1ADWA 2HRPH 1PMYA 4JNMA 2P8LA 4OT1L 1JPEA 4K3HA 4MJ4A 3JZUA 1OB0A 1OFEA 4OLVH 3ZKSD 3MCKA 3LB0A 4MJ6A 1WAPA 4HF5L 3HPSA 5M95B 2QCLA 2DBLL 2CKNA 1F18A 1ZS8A 4XPBL 2GK1B 5DD5H 3TH4T 3ARZA 1BZDA 2R8SH 3GNDA 1FH2A 2CITA 5CBAA 2WMKA 2AK4D 4QNWA 5F7DB 3VWJA 2MQ3A 3B97A 1O5KA 3CJPA 5DC0A 1UUNA 1BQLH 3PRZA 1QSFA 5E99H 1GQIA 2WAGA 5JPNB 1HWGB 3N3TA 4H88H 4LL1A 4Y2OB 2OSWA 3GSUA 3UR2A 4RDQF 4XO6A 3EYFA 4G7QB 3VFGH 1WRFA 2NQDA 3LY6A 4R7NB 2TAAA 1QA9A 3R06B 4L8SB 4LL9A 3VXSD 3ISIX 1AZNA 1T7YA 1WDWA 3F12B 4XZMX 4PH8A 4BI5A 4YSUA 4H1ZA 3QIUD 1RK1A 2W8CA 4JE4B 3B2DC 2CNCA 3AHTA 3NPVA 4HA1A 2BSEA 2VDRL 2VNCA 1J1PH 4AEEA 4HWZA 4W7UA 4HS8L 3GG7A 1USZA 3P84A 4B5XA 2X88A 2WXMA 2EYRB 2YR3A 2SEBB 4Q6IB 2GAZB 3RQ3A 1JYXA 4DN3H 2VLRE 3B9KD 3IKKA 4ZFOB 1KXTB 1JTPA 5ANMB 1WCBB 5HY9A 1L0PA 5CSUA 5IBTH 1B9BA 1JZEA 4CRPA 3CVIL 1WT5C 4NWTH 3W7PA 1WDRA 3G5XB 2XQBL 3CLWA 3VXNA 1XLMA 3MWAA 4NN7C 1YDPA 4XPHL 3BV7A 4XB3A 2HMCA 4OM1L 3UAJA 4JANB 4LFYA 2IWKA 3MLZL 3PBGA 4KKLC 4IQDA 1MRFH 4GS7C 2PYED 1OAUL 3SGDH 2BIQA 3TJEL 4XAYA 2PABA 4FQJH 1TMQA 5MHSD 5D04C 3VKKA 1OARL 3DX6A 3DOIA 3MV01 2HK0A 5JUEH 1LO0H 4QITA 4D8OA 1REQA 2PAJA 4YGVB 1JMZA 4LVBA 3LIUA 3FT0A 4Q6YA 1E50A 5GGVY 5A16B 2WP3O 1Z7JA 2EKSB 2Y06L 3LS9A 1NEZA 3DUUB 5JW3L 1QUNB 4YDVB 5KZCB 1PUDA 3QG7L 4Q4RA 5HJLA 1WJ3A 3WO4C 2JB6B 1H1NA 1W3JA 3V0VB 5B39A 2OSYA 3UDWA 2V9QA 4W9CC 5F93C 4F7EA 1XR2A 2Z1BA 4UU9A 3BARA 5L6UA 2XBZA 3QH2A 4KT2A 1FGVH 3FX4A 3WQVA 1T8XA 3RWGA 1W72L 4HU2A 2UWEF 5TD4A 5I5JA 1V6YA 3GMQB 4X6DE 2DQIL 2Y7EA 3P54A 5I8OH 4MB4A 4LVDA 1XLFA 1WHOA 4MAYD 3WS3A 1OIOA 2J8GA 2F19H 3K6DA 5KG9B 4NQDD 3BANA 4UB0H 4IMKA 4K7PX 2CLRA 1V54B 4S1RL 5BRPA 5HHQA 4NM8H 2X1UA 1IM9D 1JTOA 2AJXL 3D4YA 4AAJA 5J06A 1QDSA 1O75A 1YXCA 3QGKC 1JIBA 4IRZL 4HUUA 3W70A 4HK3N 2DT0A 1MELA 4Y5YB 4GG9A 3WBEA 4MF4A 3CPUA 3VRJB 1NAKH 3PHQB 4AYEC 4G80A 2WHLA 4C56D 4IYKA 3BUQA 3EGSB 1EQWA 4HPHA 2ZPKL 1I8KB 1LLAA 3BH9B 3Q3GB 3JYBA 2OEKA 5AAWA 3T6XA 5IOPA 1LYQA 1RCXB 2MPAL 4PZVA 1WIUA 3CXHK 3N9GL 1OX4A 3FQXB 3P3SA 4FTVB 4J3TA 2GWNA 3JS3A 1NCBH 2J27A 3CWNA 5A69A 2I07A 3QV9A 1PD6A 5I1DA 2ZTKA 1FP9A 1A6PA 1DQQA 4TQ8A 2VSKB 4O58H 4G1KA 2ITCB 2V3EA 4BQ3A 4K37A 5MENE 1ZJHA 3IDGA 3TR9A 3F6IA 3GZPA 3HS0C 1KJVB 1LTXA 1YEEH 2F68X 5I18L 1A0EA 5E7FA 1FFPA 2ZVIA 1EHNA 4LCSA 5H37A 3UTSB 3SCWA 3EYOA 5EBWB 4PI2A 4GH3A 1CTOA 1VPOH 3TO2B 4I3GA 5IQMA 3NT0A 3P77A 4LUIA 1OAJA 3VKJA 1Z66A 1HAUA 1IT9L 3MJ7A 3U30B 3FA5A 1AS8A 3OPSA 3RG1C 3KDNA 4C6MA 2EICA 1T22A 4HH9B 4NGHH 3NIFF 4QDGA 2O5YH 2W66A 1UVQA 2FD6H 1Z9AA 3DENA 3VOHA 3VPLA 2O1AA 4POUB 4EOUA 1LO4L 2NQ3A 4RWHA 1E7VA 3LS4H 1EX5A 4DX3A 4AMCA 1DDHB 1AMXA 1RZFH 2HH0H 3IJHB 3L1EA 1K7FA 4P5KB 1QRND 2CD0A 1IQWH 2OLAA 2JELL 1G7PB 2V5TA 2UY6B 3V0UA 4FFVD 3PZMA 5BRZE 3PL6D 1MHCB 3VXPB 2CCLA 2LLNA 3T04D 4YIWA 4NRXB 1SF5A 2FLRT 1HXKA 4FOJA 1UR1A 3R8RA 2NY2B 2QSTA 1PKYA 3CZNA 1QR1A 4HU0A 1KKRA 3BH8A 4U1HA 1THFD 1Q6OA 3DHMA 1P7QD 1MCKA 1SFDA 1ZE3C 1EOMA 4ZMGA 1QEWA 2VTFA 5IK3B 1G4TA 1XF3B 3DGGA 5I17B 4IH3A 1KCRH 4PRWA 2ERJB 1L6GA 4NZUL 1L9NA 3C8FA 2OP4L 4G9FE 4MAUL 2QSCL 3H54A 4WJKB 3SQRA 2QGDA 4EUPA 1K8CA 1WBJA 3F7JA 1DUZA 1JK8B 1QT1A 3ZHLA 2Z31D 5FUOH 4XOCA 5AW9B 5GRVL 1X96A 2BERA 4Y5XC 2JKLA 4BSJA 2YB4A 3SDCA 3QHMA 4C6DA 2WD0A 4ERSH 3BE1L 4A2FA 2GGGA 3A0OA 4MDJB 3PTQA 3MSDA 4PV8B 1W9XA 1KIQA 1XEUA 1VZIA 4G83A 3BQ6A 3W2DL 5DSCA 1KGCD 2YPLB 1ZIBA 3I50H 1IBBA 4YHOH 4B7IA 2F9BT 2KQNA 3N17A 5EEXA 4HQQH 1BJ1H 1P7TB 3QULA 4HAGA 1INEL 3V52H 2QUMA 1L9RA 1V02E 1H7NA 4GBXA 2Q9OA 1OY0A 1FOBA 3LN9A 2VN3A 3ZTDC 4YNGA 3EHBB 5KSUB 1U8HB 2OFJA 1DFBH 4NJKA 3W4RA 1KENH 4LSUL 2QPDB 3IJ7A 1HJUA 3KXFB 1UWXH 4LRNL 3HN5A 4NO0B 5JIQA 1PIFA 2OQJA 3EHBD 2BNQA 1ET8A 5F70A 1C1EH 5B1CA 4JPWL 2A6NA 2JJSC 3S6DA 1BQ5A 1YEDB 3OHXC 32C2A 1G6VK 4K8RH 4S1QH 1OHZA 4LW7A 5M5DA 3BDXA 4M7KH 4PJFA 2GUYA 2ABAA 4N6RB 1OSYA 2NUPB 5AVQB 5TGBB 5KVEE 2EXSA 1JI1A 5EF3A 2N0KA 3MUGA 5FOOA 1MW3A 3O8XC 1DUYB 5CCJA 1CXIA 2B15A 2GK0B 3QDME 2W07A 4TUKH 1V7AA 1LO2L 3AHXA 3ERPA 4WXYA 4JFOA 3B9KA 4AV4A 3BVJA 3T4CA 4JLRB 4FQXA 1DIEA 3RFZB 4XUGA 4RMSA 3T77B 3QWOA 4E42B 2WP3T 4NYLA 3P4NA 4NNYA 3EWUA 2N56A 3MLWL 1XRFA 3OL2A 3DFTA 1NMCC 2BSSA 3OZ9L 1Z3GH 4HCIA 3AMLA 1BOGA 4ZOEA 1YW1A 2X1QA 4UTTA 4XGZA 3DECA 1YG9A 5LWYL 4IP7A 3UZYA 2B14A 2YA0A 3IDGB 4KX9A 1DVYA 3P4LA 1UWQA 3CIXA 3UAJD 4LUYA 3F01A 1ZHNA 4RIRA 4ZS6C 2VEKA 4XN7A 3V6FB 3TW9A 4NXSA 5GZNC 4MZ2A 4W87A 1AH3A 1E4HA 2OAAA 3MUY1 2FMNA 5CJBA 3V0VA 1SFJA 4ENLA 1GVFA 3MZGB 2PWUA 3BW4A 3ZJKA 4JDVB 4BY3A 3CFDB 1E8XA 4JO1H 1H5BC 4YE4L 2Y36L 4IKKA 5DFVC 1CN4A 3MJ9H 1ZT7A 3UBXA 5HP5A 3P8IA 2ZSVB 1C5BH 2XNAB 1JCYA 3BFOA 2WWMC 1QK2A 3LENA 2J78A 4KXZH 4LGXA 3GFUA 4PRDA 2DWSA 5E2VH 1QPPA 4ERAA 3SDAB 3JYCA 4U6YB 4C1NA 2FWOA 1RJYA 1HH6A 4DIAA 4DZAA 1KOAA 3OMIB 1XCXA 2QUVA 3GSVA 1HUVA 1US2A 4QXWA 1FCGA 1TYJA 4DKTA 4KZDH 2W0KA 3GQYA 5IM51 1GAFL 4BRJA 3TURA 2IADB 2Q71A 2YD3A 4C6BA 1DDTA 3HE6C 1UD3A 2ICEB 2Z92A 3ZKXC 3BLKA 2Y7LA 4LMQE 1FH5H 1AJ0A 1J87A 4HTBA 4PN6A 1XGEA 2VDQL 5GGRB 3T4AB 5IWLC 1HL8A 3TF7C 4M9PA 1L0QA 4LCWD 3GJFK 1NAMH 4FAAB 3WIIH 3UJ2A 2XVPA 3QVAA 4JZJA 4P3DA 5IF0B 3VXTB 2J8TA 2XX1A 5DD5L 4NZTL 1MQQA 4GUGA 5D8WA 2VZOA 4LHJB 5AW6B 4UIOA 1LVEA 1NBZA 2EIJB 1N8ZA 5JNYB 1AD4A 1VFBA 3BZFB 3OPUA 4JZOB 1MNNA 3UR7A 1W9UA 4IG2A 4Y2NA 3FO1A 4P2QB 2GQHA 4I48B 4P4KD 3GNML 3G0SA 1CE1H 1V77A 3UPWA 1F2JA 1KDIA 2FTYA 4XZHA 8A3HA 2VFDA 5FO2A 4KH2A 3ASOB 4BSVA 1UADC 4GACA 1ONRA 4TL5A 2PN5A 5EIQA 4HKBA 3IU4L 1AI1L 1NUDA 3ZKMC 2PZNA 3GSUB 2RDXA 4XVUC 4KQ3L 2W60B 2W65A 3QB7C 1DIOA 3TA3A 1HDMB 4GW4B 5KBPA 2I17A 1F8MA 1RUQL 5ABHA 1OOWA 3F8UB 3REWB 3OU8A 5HVGB 2NVCA 3NXFA 1M7IA 3QV6A 4ES4A 1Z0NA 4G71B 4LLDB 2ZOUA 5F21B 4ZTEA 4HAFA 1G4MA 2GIMA 4CJ1A 5C1MB 5EMJA 3L3JB 3TA3D 4EACA 2VDIA 1TYRA 1DQTA 3CU7A 3ZL4H 1MY5A 1SHMA 2YUXA 1E9PA 4EXKA 4AH7A 4XP1L 4K8RD 1DBJL 2WZ5A 4BKLA 4C91A 1VADB 3QDHA 3O41A 2Q3XA 3KBPA 2GAZA 2EHHA 4PJIA 3MBDA 4XO7A 5C7ZA 3SE8H 5HGHB 4LVEA 2B9AA 3D2UD 4NQVA 4ODTH 4PJDE 4Q33A 1I2RA 1A14L 1TR7A 1X9LA 2ZYFA 5H35A 5CXPA 1SFHA 4ZD3L 1RK6A 3NTCL 5HHNB 5JUEL 2DW6A 3DBXB 2ASHA 3JWNH 1BIHA 2F38A 2WUCH 1PLBA 4HWNA 3T3MB 1LG2A