1KXTA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
total genus 170
structure length 496
sequence length 496
chains with identical sequence C, E
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxtA01
1XD1A 4AMXA 5ECUA 4AZ7A 1TQWA 4BQ3A 4PEEA 2FDMA 4UFLA 4KRTA 2XHYA 4ZE4A 4U31A 2PWDA 3IK2A 3N04A 1B3YA 1Z32X 1OIFA 4L4PA 1FP9A 1D2KA 1WDSA 2CHNA 2WZHA 2EJ1A 5HDRA 1FOBA 2J7BA 2ALWA 2XIIA 2G8ZA 2WMFA 3A21A 4X0NA 4GQRA 1FA2A 3VOCA 3N11A 4M82A 1E6RA 4U33A 1CNVA 1JG9A 3GZAA 4PRWA 4JHZA 4CD5A 1JDCA 3KLLA 1R75A 3BXWA 4YHGA 5BWFA 1QWUA 4BF7A 4D6IA 3MSDA 1HL9A 2VRQA 1ISWA 3WN6A 4EAMA 4AY1A 5BXPA 4P7QA 2D0HA 1H2JA 1AVAA 3G6MA 3A5VA 3A24A 1UD6A 1DP0A 1E70M 3TV8A 2D22A 2EQDA 5A6AA 1E6ZA 1BVZA 1AMYA 2EAEA 5AC5A 3FNDA 4OKDA 3HN3A 5A8PA 3NSXA 2DGAA 3WDQA 3GNOA 1QI3A 3MSGA 1H0GA 3BAKA 3HG5A 2XJ7A 1ZBCA 1EXPA 1MQQA 3MANA 1NM9A 5I0DA 3U5UA 1KCLA 2YJQA 3VD5A 5A8MA 1PX8A 1V3JA 2WVUA 4PMVA 3CGTA 2YA1A 2J77A 4FLOA 1A47A 4JCLA 4WSJA 1W9PA 1LLOA 2XM2A 4UFJA 1UZ4A 1UD3A 5AYIA 3CLWA 2PBGA 1DHKA 2VJXA 4HA4A 2GDUA 7CGTA 3WDHA 3LMYA 3DDGA 2ZUTA 4IPLA 5DT5A 3TTYA 4KGJA 4W5ZA 5FL0A 4YPJA 4Z2JA 3HG2A 1B0IA 2JEQA 4DUWA 2PF0A 2CBJA 2CHOA 1MQPA 1K9DA 1RPKA 3ZT5A 2VQUA 1E73M 1BGAA 1TE1A 2DSWA 3VDAA 4ACZB 1HVXA 1GZJA 4W7UA 2WZIA 2V5DA 1UR8A 1MYRA 3GNRA 3HG3A 4ZE5A 2WZEA 5FL1A 1TQUA 4XUYA 3AXHA 4U2ZA 4DWSA 1QNRA 5JUVA 3NSNA 4MDOA 3BSGA 4AD1A 4F79A 3VSUA 1GNXA 1CECA 1PBGA 4TTUA 4MTVA 4GI9A 1JZ2A 3WUFA 1E9LA 4H8HA 1MFVA 4D6CA 1E0XA 2BV9A 2FE0A 1CEOA 4ZXLA 4RE3A 1V0KA 1NQ6A 4JAWA 2CYGA 3LXBA 3VDHA 2DH3A 4MNKA 5I23A 5BRQA 3B9DA 2CESA 3W26A 4B3KA 3WF0A 2OYLA 1V6WA 3RDKA 2BY1A 4B3LA 1OGBA 4H41A 2OSYA 3AIVA 2DT1A 3U5YA 3AIWA 3D4ZA 2XFFA 3WQ4A 4IM4A 2BVTA 3BVUA 3W4RA 1V3LA 2ZUVA 2D2OA 4JFSA 4PCTA 2CITA 3AYRA 3K4DA 2W66A 3WQ5A 1N82A 4DO6A 3BUBA 2RGMA 4PMNA 3OLIA 4MADA 4A4AA 3MV11 5E6ZA 4IISA 3GXPA 3KZSA 4ACYA 4NXKA 1QX1A 4J3XA 1QHOA 1C7TA 1M03A 1TG7A 3POCA 3AMLA 3FW6A 4DUVA 2VX5A 4HMCA 1C8XA 4WKAA 4UCFA 4K68A 4CD7A 1U33A 2C7FA 4CD6A 3ZT7A 1BYBA 4A3YA 3PZIA 2WSKA 2BVYA 1E56A 1NP0A 2FHBA 1ODZA 4U5IA 1TUXA 3BH4A 1UQZA 3GXTA 3VGEA 1B9ZA 1BFNA 1HJUA 5A2AA 1JL8A 5HPOA 1R7AA 2JFEX 1ISXA 3LXCA 4GXPA 2YDRA 2F2HA 1UH3A 4JZ5A 4HA1A 4AW7A 3JUGA 5HNNA 4D71A 2YLLA 3VX1A 3ZMRA 1JZ6A 4D6HA 3W0KA 2WYSA 1W3LA 4AXNA 3WF4A 3ZT6A 2QLYA 3GDBA 1ZL1A 4D6EA 5A6LA 4AYGA 4OOZA 3B9EA 4FMVA 2WK2A 4LGXA 2VC9A 1QI0A 4PMRA 4DM1A 3GTNA 3WNOA 3WNMA 4CN6A 1BLIA 5GNXA 1DTUA 2ZXDA 3BLPX 1O7DC 2OSWA 3IJ8A 2D73A 3M7SA 4NF7A 3WDJA 2QV4A 3D4YA 2NSXA 3PZMA 4PMDA 2YKKA 4XZBA 1UR2A 4NZFA 2Y4SA 5FD0A 3ZJKA 1LJYA 2PWHA 3KE0A 1EQPA 4PTWA 3GYCA 1JGIA 2GK1B 1KFWA 3OA5A 3DHPA 1R46A 1E0VA 4NXSA 3O9NA 1R8LA 3MUZ1 2DSUA 3A22A 3SURA 2MANA 4HMEA 3AYSA 1ZBWA 2E0PA 1E1EA 3UCQA 4MPKA 1EHNA 1WZMA 5JBDA 3HJEA 2GVYA 4JL1A 1OCQA 2XSAA 2EPKX 5D9OA 4PUDA 2E9BA 4E2OA 1E40A 4AIEA 2VR5A 2PI6A 1PIGA 5ABFA 2C0HA 3BMWA 1OBAA 2X8RA 4JHOA 1MVYA 2XN1A 2E3ZA 3L4ZA 2WBKA 1ZS2A 3BUQA 2G3IA 3CBWA 1NOWA 1WPCA 3ZR5A 4QCFA 3AJ7A 2PB1A 2GJXB 1XV8A 7TAAA 2F7QA 4A3HA 4N42A 1CXLA 4TXEA 4U3AA 1CIUA 3PBGA 1EOMA 3VD7A 2WC7A 4M80A 4Z2HA 2GJPA 3EMCA 1WNOA 4AZHA 4M56A 1HN1A 4J3UA 4AWEA 5DFAA 2VO5A 2XWDA 4DWSC 2VR4A 4FLRA 3LRLA 2DT0A 1W9XA 5LYRA 5I5RA 5FKYA 3N1AA 1KCKA 5M03A 2XN2A 5C71A 1GQKA 2DT2A 4UFHA 2ZUNA 1AQ0A 1JD7A 4JFTA 1J0IA 2WPGA 2HVMA 3PZ9A 4B15A 3CZNA 4P7RA 3W82A 1KXHA 2DSVA 3AI0A 3WF1A 2EPNA 8CGTA 4HZ8A 4BZYA 4N0RA 4CUCA 5C8BB 1GJWA 4LYPA 2JF6A 2NT1A 4FLSA 1VFOA 4AD0A 5A94A 4OJYA 1B2YA 1J10A 1V02A 4W8BA 1NWSA 4V2XA 3WMBA 4TVUA 3ALGA 2CPUA 5GPRA 4F8XA 4IPNB 2YL6A 3S5ZA 2J47A 4MB3A 3DC0A 2EEXA 1B3ZA 2D23A 2OWCA 4URIA 3WD2A 1QI4A 3O6AA 2YOCA 1YQ2A 2Z1SA 2VCAA 4J27A 2O92A 2W91A 4HZ7A 5A8NA 3ARPA 1QHZA 1G9HA 2B31A 3OGVA 1LL7A 2XUCA 1JXJA 3CZGA 3BAYA 2D3NA 1BYCA 1G94A 5CQ1A 3WH5A 3MMWA 1RD6A 2J7HA 2BNJA 3WNKA 4QLKA 2J8GA 3WL0A 3WKZA 1GOMA 3BUPA 1HP5A 3VIOA 1W9BM 4UZSA 3BVTA 4B9YA 3ARUA 4AZCA 5M5DA 4PBGA 1MW3A 2AOSA 4AIUA 4PSRA 1M53A 1E55A 1TVNA 2OW6A 1VFMA 4D6JA 1MWOA 3BVVA 1HXJA 2WC3A 1ZB5A 4QLLA 2X1IA 3ZQ9A 3A3HA 3SCPA 2EO7A 3CZJA 2VURA 1GONA 2XM1A 2VRJA 4EK7A 1K9EA 2BXZA 3DX4A 2DSZA 2WCGA 1HJWA 1H41A 1UWUA 3VUPA 5IFPA 1TA3A 4Q7NA 1MXDA 1IV8A 3GXDA 1HT6A 5BXRA 5AYBA 3WMCA 2DQXA 4P7NA 1EDQA 4GO9A 4J7RA 4UQEA 4GI8A 2WW5A 3PTKA 1EIBA 5CLTA 2W61A 4UTFA 1XH0A 2OYMA 3PZOA 2J75A 3ZOAA 3DECA 5GNYA 4AISA 4HA3A 4UQCA 4KRUA 2ZXQA 3N13A 1FFRA 1DEDA 1AQMA 4TUFA 4DWSD 1B90A 2O9RA 3E1F1 1M7XA 2G3MA 5A6BA 2FH8A 3EDDA 3IGUA 1TZ7A 3WQWA 2CBUA 1UD2A 1TCMA 5FIPA 1R33A 2OSXA 4OIFA 1JFXA 1M04A 3WY2A 1XRVA 1BYDA 4W89A 4UQBA 2YIHA 4BA0A 4NZJA 4TVCA 1PEZA 1CLXA 5CPSA 4LXFA 3VD9A 2WMIA 1B3XA 1OT1A 4EKJA 5JIWA 2W92A 4JKKA 3U7VA 4D6DA 5A3HA 4AEFA 3SCUA 4GIAA 2J7GA 3K4AA 3QR3A 1XCXA 1PX3A 4GI6A 1CXHA 3H54A 4F9DA 1Q6EA 2F7OA 3QHMA 1CZ1A 3MV01 2PWFA 2F7RA 1OSEA 3SUUA 2A3EA 1C90A 1XH2A 4GZJA 1CGVA 2BHUA 4PYSA 1TQTA 2X05A 1OWQA 1NWRA 3WQ8A 1KGWA 4UFIA 4NRRA 1BF2A 3FHAA 3LPFA 4FNSA 4P7OA 4W7VA 5D8WA 1UH4A 1V3HA 4EANA 1C8QA 3ZO9A 2WHKA 2YBUA 2WLZA 1XCWA 3W6MA 2WMIB 1UKSA 1OM0A 1BTCA 3W25A 3ECQA 3AS1A 2ZX6A 1VBUA 3ZSTA 1UR9A 2DH2A 3GXFA 5EFFA 1SZNA 6CGTA 3VKKA 1UWRA 1CWYA 1J0YA 2ZUSA 5D9PA 4W8LA 3VX0A 4D72A 2WKGA 1PJ9A 1JD9A 3WMSA 3BUDA 4WK9A 4RE2A 1J0ZA 1MFUA 3M07A 3WIJA 3FY1A 1V6UA 1LG2A 1KXTA 4AZ5A 4Z2GA 1GUVA 3OLEA 1RP8A 4HU8A 1JAKA 5IHSA 1FP8A 1MQRA 3MU7A 3W27A 1E6SM 4CU7A 4XZWA 3OZPA 3DYPA 2XVLA 4KWUA 5IFTA 2XYLA 1P6WA 4ZENA 5JBFA 1EH9A 3UG5A 3CUJA 1WAWA 2FYVA 4ATWA 5EBAA 4J3TA 4J3VA 3NSMA 5ABEA 5A2CA 3GBEA 3VIJA 2J62A 2EBNA 3NYDA 1RH9A 2ZIDA 3CH9A 4HZ6A 3MUIA 2BXYA 2VZUA 1VENA 4GINA 3EBVA 3GXNA 3PZUA 5BYWA 1WZLA 2EABA 1VEPA 1OD8A 1CXEA 3WQVA 3PN8A 4CCCA 1ZU8A 4PTMA 4QCEA 3VIIA 3VINA 3BCDA 2ZX9A 2YA0A 3QHOA 3UEQA 2ZE0A 2DEPA 3W28A 2Q8XA 1HP4A 2WC4A 2W5FA 3ZM8A 3WDIA 2VZSA 1Q6DA 1VAHA 5EMYA 1K6AA 2WMGA 3QHNA 4E8DA 3OB8A 3APGA 4AD4A 2J25A 3PZTA 3WDPP 1C91A 5GNZA 2J7FA 4D1JA 2ZX5A 5FOOA 1UWTA 2WAGA 3OIHA 4S3KA 1V02E 3WH7A 2WLYA 5EFDA 1OB0A 4XX6A 3BUIA 3OLDA 2OW7A 1WKYA 2DDXA 3ARWA 3WH9A 1QW8A 3LXAA 3RCNA 3VMOA 1CXKA 3TTOA 3CMGA 1GQLA 3K46A 1L8NA 3H55A 3EYPA 4DWSB 2ZX8A 2CIPA 2RGLA 3BAXA 4Z2IA 2ZX7A 5AY7A 1EHAA 1H1NA 2QHAA 3WF3A 4UR9A 4KMQA 3WUGA 4NX0A 2XG9A 1UKTA 1GQIA 4QFUA 3LRMA 4CKQA 2F18A 1VFFA 1R85A 2XGIA 5A6MA 4PCSA 1I75A 3MS8A 3QOMA 5A6SA 1SFSA 3GM8A 5I77A 2DIJA 1HIZA 1V0LA 2E8YA 4JFUA 3CZLA 1HJXA 1JF6A 3D50A 3THDA 1Q4NX 3AIRA 4M81A 4H8VA 1G5AA 1CPUA 3AZTA 2VX6A 2XVGA 4F9JA 4W88A 3ARZA 3AIBA 2BHZA 2EPMX 5A1AA 1VJSA 1GORA 2XFYA 3L4VA 1BGGA 1VF8A 6A3HA 1QNQA 3NJ3A 4HOZA 1LG1A 3RO8A 3RPMA 3HU7A 5KZ6A 3OG2A 8A3HA 4LYQA 4TVDA 2HISA 3WFZA 2VNCA 1J18A 1DWJM 4WJXA 5BXSA 3W38A 5AC4A 3T0DA 1KWGA 1BVNP 3CV5A 5E70A 1MXGA 4P8UA 1E3ZA 1L0PA 2PWEA 1SYTA 3AICA 1G0CA 5D9MA 1JZ3A 1J9YA 2O9PA 3HZ3A 1KQZA 1EA9C 3WEMA 2F61A 3ARRA 4GZEA 2Y24A 4AZIA 3AISA 2JF7A 1C92A 2J7DA 3VNZA 5E09A 3CZEA 2YL5A 1TQVA 2FGLA 3AMKA 3VO0A 2ZUMA 4RL3A 2WANA 1W3JA 2XPKA 3AZRA 4JFVA 3LPOA 5I6SA 2CETA 1E72M 4KH2A 1OINA 2WWCA 1XD0A 5I78A 2XTKA 1H09A 4Y7EA 5E9AA 1NARA 4OBRA 1LL4A 4NZCA 3G6LA 5I24A 2E4TA 1JDAA 1GPFA 1UWIA 1QW9A 2G3NA 3EDFA 3J7HA 2VZTA 3AMDA 4UNIA 1QNPA 3WY4A 3UERA 2VX7A 2QPSA 2ESCA 2VUYA 5CGMA 1UKQA 2EPLX 3T2PA 3F5KA 1G01A 3SUVA 4NRSA 5A6BD 3U57A 3VGDA 3RJYA 3VNYA 5IDIA 4WLCA 4NSBA 1CLVA 4H2CA 4HPHA 4CVUA 1US2A 2E9LA 2A3HA 4BS0A 3CTTA 1LF1A 2XVNA 2WVVA 4W8AA 2FGZA 2F7PA 3CHEA 3I3BA 2XSBA 1JF5A 1EDGA 4HP5A 2Y5EA 3AFBA 3OGSA 3T0AA 2X2YA 2BFGA 4ZXOA 1BSIA 1PS3A 4PUEA 1DWIM 1KB3A 1WCGA 3KL0A 1EDTA 4X0VA 3CIVA 4YN5A 2IXUA 1ISYA 2VT0A 3WDRA 2BHYA 3WENA 1V6YA 3VIHA 2QMKA 1Q6GA 1CDGA 2D3LA 1KGUA 3B8SA 2XGBA 1VRXA 3WL1A 4W86A 1WE5A 4D6FA 3WD1A 1Y7VA 1CXFA 2VMFA 1JNEA 3UR7A 4H8UA 5ABFB 1MW1A 4YHEA 4BCEA 1W2VA 1ZBKA 1IZJA 4H7VA 1HNYA 1GOIA 3WY3A 4LQ1A 1OIMA 2GDVA 1QPKA 3AHVA 4UFKA 1ZJAA 1D3CA 1UKPA 1UD4A 5HPCA 2WB5A 3PZVA 3EMQA 1KTBA 2IUZA 2NW0A 3VMNA 1WZAA 1UD5A 3ARQA 2W4XA 4F66A 3GH5A 1Q6FA 1CGXA 2XWEA 3AHZA 1R86A 1HX0A 2Y2WA 1BG4A 1UOKA 3LRKA 3IJ9A 3MMUA 1HKJA 3BMVA 5BXTA 3VMPA 1JXKA 1HL8A 4X9YA 4CD8A 2JEPA 2EACA 1UR4A 1WO2A 3EJRA 5DO8A 1UR0A 4WKHA 3CHDA 2WSPA 4FNPA 1HVQA 3NDYA 3I3EA 4S3JA 1A3HA 3DX0A 1FFQA 2WNWA 4TX6A 2GUYA 1LWHA 3K1DA 3ARTA 4H04A 1E43A 2WMHA 3O2LA 1US3A 3KLKA 3AXIA 2GFTA 2TAAA 1CENA 3F5LA 5D4YA 1SMAA 1QNSA 2BVDA 5D8ZA 3L4TA 3VTRA 1BYAA 1E5NA 1O7AA 2VVNA 3H53A 1GHSA 3GBDA 1I1XA 3A4XA 4GKLA 3NIYA 4PTVA 3VGBA 3TA9A 1ITCA 2V38A 3WUBA 4GO8A 1UKOA 1W1TA 3EDJA 4P8WA 2G41A 2YDSA 3ZR6A 3BCFA 5FCZA 1CGWA 4M8UA 1JI2A 4KGLA 3WBAA 3VIGA 4GQQA 1DWFM 2PBOA 4AMCA 2V3EA 1PZ3A 3T2QA 1R87A 5JBEA 3THCA 3MO4A 3EDKA 1WDPA 1C93A 5A95A 3RIKA 1H4PA 1TQSA 4AZCB 1JDDA 5CJ5A 2BY0A 4AD3A 3AHTA 2QMJA 2VZVA 3OBAA 3WD0A 1X1NA 2V5CA 2OLHA 3ZJ6A 1XH1A 3N15A 2C8NA 2PC8A 1C3FA 1BQCA 1UHVA 1BHGA 3AS2A 4EE9A 1J12A 3ALFA 1E71M 3L2LA 3ZIZA 4E4PA 2CNCA 2VI0A 1O6IA 1CGUA 1C8YA 1TA3B 5I79A 4DUXA 3SEPA 1UYQA 2Y8KA 3WELA 4PMOA 3MKKA 2WKLA 4J3SA 1ODUA 1XC6A 1V6VA 1KTCA 1JI1A 1VIWA 4Z2KA 2J7EA 4MNLA 1F4AA 2WHMA 3PZNA 1VEMA 1GW1A 2E40A 3K8KA 1QVBA 5EB8A 1EO5A 4UOZA 1GCYA 3SCWA 2VCBA 4BQ5A 3RILA 3SUTA 3W29A 3AS0A 1J0JA 4RE4A 3SCVA 3FAXA 4U3CA 4DM2A 1XGZA 4CU6A 3WY1A 4AEEA 1CYGA 4JL2A 3K8LA 3W6LA 3KWXA 3IJ7A 4FF5A 2WHJA 3EDEA 3QGVA 4D6GA 1UQYA 4MJ2A 3VD4A 2DPEA 4CVWA 1MW2A 4M29A 3FXYA 3AOFA 5CLWA 4OGZA 2ZICA 3MI6A 1W32A 3AS3A 4HPGA 1TFVA 3RJXA 3OLGA 2X2IA 2WHLA 1UA7A 2OWWA 1GOOA 1B1YA 1JZ4A 1CTNA 5LA2A 3CUGA 1UWSA 3BLBA 3BGAA 1JYNA 5DMYA 3DX2A 4DO4A 3CUFA 1R34A 3EMZA 3SCTA 2ZUUA 3AHYA 1E6PA 1W3KA 3T09A 2BY2A 4UZUA 5I2UA 4GZIA 2D0GA 1WZKA 3L4UA 3S5YA 5LA0A 3CC1A 4U2YA 4WF7A 4U5KA 3GH4A 4MDPA 4W5UA 3GXIA 2YDQA 2J79A 1FH7A 3AQUA 3A47A 5M17A 3WQ6A 1HXKA 2V3FA 1E4IA 4ZEPA 3BSHA 2JIWA 1Q6CA 2DT3A 2VQTA 3WEZA 2YFOA 4P8VA 1AQHA 2UY2A 5CG0A 4AIOA 1V03A 2O9OA 4MAZA 3M6DA 4PMQA 1XSJA 2Z1KA 4CU8A 1OT2A 3BC9A 4GPNA 3U7BA 3HMCA 4J28A 2CXGA 4P8XA 3MMDA 1V3MA 5CGTA 1JYXA 4CCDA 1OGGA 1OGSA 3WNNA 1F4HA 1FHDA 3PHAA 4R5EA 3UETA 2V3DA 4QAWA 3VIKA 4AZBA 4AZ6A 3AMGA 1V3IA 1EO7A 1E6XM 5BROA 4HOWA 3WBEA 4B9ZA 2JIEA 4ZFMA 1TR1A 3MUY1 2A3BA 1GJUA 5HXMA 2VCCA 4AMWA 2GSJA 4W85A 3VIPA 3VIMA 2GJRA 2OYKA 5LA1A 4ACZA 1MW0A 1T0OA 2XN0A 2VX4A 3CO4A 3VDCA 2FHCA 4B16A 4V28A 3NDZA 1XSKA 1V0NA 4W7WA 1J11A 4CD4A 4TX8A 1LL6A 2WBGA 4QP0A 3WNPA 2D0FA 4HOXA 3DX3A 4PSPA 1NWUA 3B9AA 4CN1A 1SR0A 3TOPA 1R7OA 3BAIA 1GVIA 2D20A 1ISVA 1JZ8A 4JCMA 3AXXA 4FNQA 3IAPA 3OGRA 2X2JA 1PPIA 1HF6A 4OBSA 3VSVA 1HJSA 1NP2A 1YHTA 2WWDA 2A3CA 1UWQA 1QOXA 1B3VA 1CBGA 2ZXBA 3VGHA 1QBAA 2WMKA 2YL9A 2CKSA 1WDQA 1V0MA 3S6TA 1ZBVA 4UQDA 2VTFA 5E1QA 1UD8A 3L4WA 1JNDA 2CEQA 1FH9A 4QDMA 3DHUA 4W84A 3TONA 3L4YA 1E4NA 2G3JA 4XB3A 2WXDM 5DT7A 3AMCA 5CPTA 1H0IA 1S46A 1XHGA 2CCRA 1HWWA 1TVPA 1CGTA 5A8QA 4V27A 3RM9A 5A6JA 5E0CA 4LPCA 4FLQA 3FAWA 3POHA 3L2MA 1W9VA 2CKRA 3ZJ8A 1H49A 1W1PA 7A3HA 3FN9A 3FHQA 4OOUA 4UQAA 5CXPA 4E8CA 2J78A 1VBRA 1G1YA 2XIBA 2CBIA 2UY4A 4AD5A 2ZWYA 5HOSA 4W93A 4R27A 5E0FA 3TP4A 1E15A 2YL8A 3UR8A 4M24A 1RP9A 3AIQA 3CZ8A 3VD3A 3SUSA 4CGTA 1KR1A 3AIUA 1E4MM 2J7CA 1E6NA 1XYZA 5A2BA 2E8ZA 4D1IA 1VJZA 4ATDA 1EQCA 3PZGA 1KQYA 2ZUWA 1GOKA 3LX9A 5JIPA 1HKIA 1DWAM 3RM8A 1QNOA 3D3AA 2O9TA 5DF0A 3CUHA 3LPPA 3WH6A 4AD2A 1JYVA 3SCRA 4UQ9A 2BY3A 1ISZA 4Z2LA 1UA3A 4JKMA 3A6OA 1CGYA 3EJUA 2DSKA 1UZ1A 3AZSA 4MAVA 2QPUA 4CCEA 2UY3A 3QOKA 3EJPA 4MB4A 1HJQA 2ZOXA 2JALA 3VGFA 2GK1A 1BPLB 1QHPA 1ITXA 2W67A 1ZJBA 2UWFA 3OZOA 1K9FA 2VVSA 2NT0A 3DDFA 3D5HA 1W1VA 2WVSA 3DYMA 1WB0A 2XVKA 1HTYA 2VZOA 1NOFA 5KEZA 1B30A 3UG3A 1GOQA 1D7FA 4MJ4A 4JFWA 4PMUA 1PIFA 5ABHA 4IUGA 3L4XA 1PX4A 1W1YA 1QI5A 2VOTA 1GOWA 2X0HA 1CXIA 2ZWZA 1V3KA 4XV0A 1W91A 4MB5A 5F7UA 4FNUA 5TD4A 3BVXA 4UOQA 1XSIA 4BQ2A 5IXEA 3NUKA 3CZSA 2OWXA 9CGTA 1K9TA 2X2HA 5IHRA 5A6KA 5I3DA 3NCOA 1QI2A 1J01A 2F1AA 4DO5A 5D9NA 4PMYA 3M46A 3LPGA 2GJXA 3N18A 2XFRA 2YFNA 1M01A 3BLKA 5GQBA 2WCSA 4WSKA 3W37A 1UH2A 3S2CA 1KBBA 3BAJA 3T08A 2E9MA 4C7FA 4PN2A 2WMJA 4QLJA 1HKMA 1JZ7A 4ML4A 3KEHA 2VL4A 3RM4A 2G4FA 3VU2A 3SIMA 3W53A 1VB9A 2X09A 3WNLA 1KGXA 3ZJ7A 3D52A 2W62A 4LX4A 1JYWA 3WD3A 1E3XA 3VGGA 3UESA 2JE8A 3VDBA 3ARSA 1GVYA 2F8QA 1QWNA 5BCAA 3W24A 1V6XA 3DYOA 1JIBA 3VM5A 2J4GA 1W3HA 1SMDA 2FHFA 2WVVB 3GXMA 1W9DM 1WP6A 3WEOA 1NWTA 3SCQA 1E1FA 1JZ5A 2PWGA 2J8FA 1J0KA 3AROA 2ZXAA 2WVTA 1DWHM 4FNRA 1QBBA 5CPQA 1H3GA 3AIEA 3N17A 3SUWA 3AHXA 3PZQA 2W63A 5ABGA 4NI3A 1UUQA 3A23A 1KXVA 4MB1A 2YA2A 3VILA 3WSUA 3CPUA 1GHRA 2V3GA 4HTYA 2CERA 3WF2A 3ZSSA 3I3DA 3TTSA 1W2PA 3UG4A 3VIFA 4C7GA 4PTXA 1KR0A 3ARXA 1OD0A 1X6NA 5CSUA 3F4VA 3WH8A 4P7LA 1W9UA 2YBTA 3KL5A 4OZOA 5DEZA 2XVPA 3A4AA 4AYSA 3SCSA 3CHCA 5M3WA 3VPLA 2AMGA 5A8OA 1HKKA 1GQJA 1XYFA 3GNPA 4TOQA 5A69A 1X6LA 1U2YA 1C7SA 1U30A 4M1RA 1VFUA 1H11A 1TMQA 3A4WA 4HMDA 3PTQA 4PMZA 5E6YA 4LYRA 3W81A 1UR1A 3II1A 4PMXA 4JIEA 1JAEA 1LQ0A 3SCOA 3D51A 3CUIA 2D24A 2UY5A 1I1WA 2AAAA 2YLAA 2D1ZA 2FH6A 2BS9A 4W87A 1E6QM 4CN4A 4BQ4A 3CMJA 3F5JA 2X0YA 1B31A 3IAQA 4UFMA 2Y8VA 1H5VA 1UASA 2DIEA 3GH7A 4OUEA 5C70A 3N9KA 1KBKA 1KXQA 3HG4A 4FNTA 1IZKA 3VSTA 4TTGA 3ARYA 1EGZA 3K8MA 3T2OA 3BAWA 2F1BA 3EJQA 1E5JA 3WUEA 3T0BA 2IXVA 2J74A 3EJTA 1ESWA 4Q22A 1FHLA 4J3WA 2IGTA 2QF8A 4ATLA 4MNJA 4AZGA 1J0HA 5HBFA 3SCNA 1LWJA 3VVGA 2EADA 4WKFA 3EJSA 1EOKA 3BVWA 4UOJA 3VM7A 1PZ2A 4HU0A 5CZKA 2EPOA 1NH6A 3N12A 1DWGM 2VRKA 1ECEA 1VEOA 1E4LA 3ARVA 4C7DA 3WD4A 2WM0A 4AC1X 1V08A 1PAMA 4WIWA 3WFLA 2EXOA 5BRPA 3DX1A 2CBVA 3CZKA 3RMEA 4MNMA 1NOUA 2WCAA 3MUAA 3KL3A 1BG9A 3PTMA 1R47A 1BAGA 1IT0A 1UG6A 1E0WA 3IANA 5CSYA 4JKLA 3CHFA 2A3AA 1HJVA 1JFHA 4FK9A 4L4OA 3TTQA 1KWKA 6TAAA 1B3WA 1FH8A 1WDRA
chains in the Genus database with same CATH superfamily
5D1QD 3QQNA 4TSBH 3IXAB 3QIUD 2LVEA 1EEQA 3T07A 3TT3H 1NC2D 4GBXA 3TU6A 3RU8L 3O3BA 2UVFA 4UAOB 2Z7UA 5CBAB 4JKPH 2EJ1A 4G6CA 3L9RB 2G8ZA 3EOEA 5HQEA 5KVDE 2EDJA 3DOIA 3N11A 4GUCA 5E5LA 3KLLA 4O4YL 4WOQA 3DJTA 4NM4H 4YHNA 4PI0A 2BMBA 3EOYG 4OFDA 1WBJA 4HWBL 2HN7A 3FK4A 3GNDA 1PLGL 3FF7A 5JIQA 1C12B 1UD6A 1T89A 4O9HL 5BOOA 1XLEA 1SBSH 3L9BA 1JWMB 2JTYA 4NDMB 3W2JA 5G4WA 2IADB 2FCBA 2Y6ZA 3MANA 4S3GA 2FAUA 1JGEA 2WOQA 3F05A 3W71A 5A8MA 2PCYA 1TYGA 1V3JA 3CGTA 4N6QA 1EX1A 3TEUA 4ZUUA 1A7PH 1YTEA 3CLWA 3HNSL 1WWBX 2NXZB 5AALA 1R0AL 1ZY9A 2F8XC 4W5ZA 3MC0A 2FZBA 4DUWA 1JEZA 2RDTA 3LUTA 3WMLA 3KYOB 1AS7A 4OAWA 2V5DA 4MY9A 3MGOB 2P24A 4ZE5A 5ISZB 3I65A 4U2ZA 2N7BA 4MTVA 1JZ2A 4AQ1A 5IM7A 5FLVA 4EXBA 5F96H 3AUVA 1ZV2A 4B0MM 3FC8A 1Q8JA 1MF2L 4TUOB 2ARJB 3W26A 5EU7E 3ARFC 2R83A 4NNAA 3SBQA 1ZT1B 3O11B 2HX7A 1UBPC 1YE6A 2RKXA 2QR0B 4P46A 2GSEA 1HAWA 1IQWL 2J24A 4R4FL 4CSSA 2W66A 4C6DA 3S3BB 4Z17A 2V5SA 4PMNA 2WNZA 4F92B 4EIUA 1AIFA 3UH8A 2GDQA 1K02A 2F53B 4AK1A 3NCFB 4U1IB 2TYSA 4JFFB 1C7TA 3P84A 1THFD 2C1PA 1LT7A 3AMLA 3UROR 3OQEA 4DXXA 1GZHA 4H0GA 4V15A 2X5PA 1RJZB 2YD3A 4FQJH 3PZIA 2BVYA 1MRAA 3TNNA 2VC6A 2VSCA 1D5XB 4OZGA 4NUMA 4I18A 2DBLH 3MTXA 4LGSB 1TPC1 5IHBA 1W3LA 1SY6L 3RHGA 4LVNB 1M6OA 2Z65C 3VAVA 1KCRL 2BSED 4X80H 2OZ4L 3VC6A 2ZXDA 2PP1A 1B9KA 3CXHK 5EYWA 3ET9F 1NBYA 4ZVJA 4G1MB 2R1KA 3OD3A 1IGSA 1HYRC 3MNZB 4ODXA 4PBEA 1BOGB 2XWTA 2Q8LA 1OGAA 4XNZC 1V7AA 1SW0A 3LNFA 2FO1A 2VC7A 4GP8B 4I5XA 2VCOA 5TK4A 4LLUA 1RK6A 1OABA 1FFTB 3MCLH 4HNTA 5FYJD 2PI6A 1PIGA 1HUVA 3N6QA 4IOIA 3EGSA 4ESKA 3T0XA 4WWPA 1WXYA 5DMNA 2BP3A 3H2CA 4QSFA 4WW1B 2DQ6A 3C8KB 4W9CC 3CK0L 1JUFA 8FABA 1EAJA 5DHVB 4ENLA 3ZE1E 1HN1A 3E8UH 5HD8C 4KJQC 4NHVA 1OCZB 2GITA 1ZVSA 1ZNNA 5FKYA 4UTAL 3EHBC 5DD0L 4P04A 1KTLA 4O2FB 5KMYA 1ONRA 4P4RB 1FWFC 3VD1A 2WHVA 4EZKA 1GJWA 1NKOA 4QG6A 1OY3B 2E6DA 3UPMA 1U42A 4OJYA 3WMBA 4LSSL 3HUJF 4MB3A 5T5NF 1JNNH 1SZFA 1GZPA 3KBNA 3CBRA 4HZ7A 4XX1E 1XF4B 1KV8A 3NAVA 2XKNA 4FX5A 1DVQA 4G6KH 3H9SD 1HP5A 5FJIA 4TUKH 2R0LH 1T3FB 2DMGA 3QJZA 3BVVA 5IQ9A 2N7SA 3KLSA 2WC3A 3CDZA 1JV5A 4MASA 4P5TC 2IPKB 3A3HA 4FQIH 3DGBA 3CZJA 1EP3A 1LM8V 1DO6A 3DMMA 3K13A 1BZEA 1MHEB 3EGXA 4NT0A 2GVEA 4NAEA 4Q8UA 4GABA 4L9XA 3BKJL 1DXEA 4IKIA 2E4FA 1EC7A 3V4PB 3D8MA 1NOLA 3C8FA 4K2SA 5T1LB 3RYSA 2EXWD 4HA3A 3U0PB 1S78C 1A7OH 1BMWA 1GR7A 3TR2A 1LUCA 4JPVH 2VDGA 4K5LA 5I76A 1RV8A 3CSBA 2CM6A 4J6IA 1T5WB 2FQEA 3HE7B 1CLCA 4LCUA 5FIPA 1NAMH 1HFUA 2DLHA 1CCWB 1GTHA 3GHTA 5AVHA 2ZYSA 2CLZB 4JPGA 4P23B 3WJMB 4M6UA 3WK2A 3MBEB 1Q0XH 3JZUA 5K7JA 5C08E 3VWKC 3NFPB 4OM0L 5GISH 5HJ3A 4Z7UF 1X97A 2J7GA 3PJSA 4MXQD 2C1GA 3F2BA 4BK5A 3JWDH 3MRKB 3QRGH 3RJOA 3W11C 1GMIA 3TL5A 1CLZH 2A3EA 2LABA 1YEIL 3JTTB 1NFDF 4HEPG 1NJ9B 2OMXB 3FHAA 1I7TA 1X4YA 4WV1B 2LV4A 4EANA 4DKAA 1PDYA 1GPWA 2PPEA 1FQ0A 2AXWA 3U7WH 4IRSB 3B0YA 5GRUL 2X6VA 1AD0A 1YPXA 5HGAB 4JGDA 4XBMA 1X9RA 1Q6LA 3L5WA 5CGYC 1EIXA 3FY1A 1H50A 3OB0K 2YKLL 3QUYD 2QGBA 3SJVD 3B7YA 5IVOA 1PHWA 5D6DA 1KM2A 4QAIA 2FJFB 4HS6A 5C0EB 2N7AA 2ZF9A 4H26A 1SZEA 3VXUA 2C0AA 3KXFB 1FHVA 3K2GA 3NYDA 3DN5A 5E4EC 1VLWA 3NFUA 3KYMB 5EY5A 3PZUA 4ZOBA 3OZ9L 1C8PA 5KETA 3HV8A 1ZU8A 4HKPA 1HQTA 5C7XL 1HKVA 3GSMA 4XO5A 1H3UA 4ZTOL 2Q02A 1SJMA 3PUEA 3W28A 1AR1B 2QPEB 3IGAB 5B21A 4H2AA 2MQ0A 3QHNA 5IZ7A 3E9UA 1C91A 3EOTH 2J7FA 1SF3A 1SJVA 4JM2C 1EZSA 4Y16A 3L16A 3LK6A 3WH7A 3ABZA 1QRNB 4ZDHB 1CF1A 4E4UA 2DDXA 4UM8B 1NEYA 1XXXA 3PAJA 1S2TA 3B4UA 2N0MA 2YD1A 3MLZL 3GHEL 1EGJH 4X6CF 2KBGA 2ZX8A 3BAXA 2WZTA 4GP4B 4KMQA 3ELQA 3KYAA 3WK3A 3MS8A 4NJIA 3LKSB 2CRMA 1K8XA 4ISVA 1MFBL 3CPLA 2GBAA 2E7LC 4S1QH 3LHPH 1BZ7A 4G7YH 1IGIL 3PHSA 1T6VN 5BXFB 3O6KL 2QTVA 3GSNA 3RY5A 2XXGA 2CBPA 1OOWA 1EF2A 2KZHA 1DWJM 3B37A 3QUMH 1KWGA 1DQQB 4YCPA 2A7RA 4UBPC 2A6KA 1L0PA 3SDXB 4MNQB 3GMNA 2QUMA 5KVFL 3MHGA 2F61A 4LHUA 3FB7B 1YTDA 3QPKA 4ZQTA 1BQGA 4O0QA 5J3HC 2A77L 4PJEF 4IKNA 3WQEA 2YWYA 1C92A 2ZDSA 1A4BA 4O4WA 3WEXB 3NJVA 1DQXA 3DOPA 2WANA 1YPZB 4UT6L 5I6SA 2ISDA 5GGRY 4OFKA 4BSJA 3JWOC 2DB8A 2YCIX 4RV3A 1KYOJ 4OBRA 2ZWNA 2VDRB 2V7HB 3V0WH 1TZIB 4MNGA 4KKBC 3LN5A 1N5AB 2O93L 1E51A 4LRTA 2G50A 3VE7A 5LNSA 1KLUB 1Q72H 4R4BB 4GXWA 4Q7BA 2J1ZA 5BOJA 5A6BD 4XHJD 1ZHBA 3VGDA 4H9YA 4B5ZA 1I1YB 1HDMA 3UTTA 4MCMA 3OL2A 3AFBA 1GYUA 4WNJA 2BFGA 2C1OA 1YMME 5DWPA 2VT0A 5IHHA 2X10A 4HYWA 2WXIA 3IEAA 2KS0A 1QPQA 1FNSL 2OMWB 1XGYH 1VRXA 3P67A 3NFSH 1MCWM 5ABAA 4GSRA 5TH2B 3CHRA 2UZ9A 4DN1A 4I13B 5F7WC 3HLAB 1IGFH 3U4FA 3X1BA 2R7EB 4NNCA 5KVEH 3CS2A 3KCPB 1TETL 2GDVA 3MV8E 4BZ1A 4YSOA 3N2CA 4APXA 4X8CA 1B3JA 5CEZL 4XN1A 2XPGA 1NGZB 1WQVT 4C6MA 5LNDA 3UY7A 2CIKB 2RCSH 5FS5A 2YAQA 4DPAX 4XNXL 2G5RA 5A2KH 2QGCA 1ZT4B 4KVCL 2FTPA 4OCYH 3SBFA 1DVZA 4PJBA 4FNPA 4QAMB 4JVPA 2PEVA 4PFEA 3CL8A 3QZ6A 2R23A 3MSRA 3J07A 5JXQA 4MXWH 4IGBC 1HOEA 2NY6D 4I3RH 4WU7A 4LVNC 3S8WA 3WUBA 2YAEA 2W65B 3BCFA 2OMUA 3JS3A 1PZ3A 4PY7B 5IVNA 2DZPA 4KQ3H 1RJLA 1PSKH 1TUPA 1NCTA 1XQLA 2X3BA 4JRLA 2IQ0A 2J1XA 1L5GB 5KYUA 1H9VA 2IVFC 4KKAD 1J88A 3MX0B 2I7GA 2VI0A 1G7IA 4HKBB 1E4HA 3LHZA 3SEPA 1ADOA 1TO4A 5KOVC 3F1QA 3WUWG 4W6WB 1QNVA 2KZ1B 3V5DA 3G9VA 1U8LA 3QTPA 4MNLA 4N85A 1F6AA 1PL3A 5EU9A 2QUUA 5HMSA 3MPGA 1ZSXA 1S4IA 3EH3B 4FXRA 1H0DA 2GBUA 4YO0A 2IAND 4BR1A 3NPUA 5CLWA 2WWKO 3RJXA 1R3HB 3NBNA 4LCCC 1JZ4A 5FHBH 5IVZA 1JYNA 1BX2B 2QGYA 4IMCA 1N6VA 3UP8A 1NLDL 5FF7A 1UB5A 5KVDL 2Q3XA 1CICD 4N0CD 3G6JE 4ML9A 3LKPA 5FYLE 2VQTA 4ODUA 5HGHB 2HMIC 1AQHA 5HNUA 4MAZA 4ZOCA 1ML1A 4V1DE 5I6LA 1DBTA 6PTDA 4MJIA 2DKUA 3HMCA 1FIGL 3QHZH 1Q85A 3IDMB 3E2QA 1FHDA 3PHAA 5EPMB 3R1GH 1KCUH 1X96A 1BVKA 2VCCA 4M6AA 3S8GB 2W07A 3T9WA 1QBMH 1BQUA 2NW3A 4H9TA 4ZS6D 1L9NA 5FO9A 4C47A 2QSVA 3DOSA 4D8OA 2Z25A 5DHMC 2CWNA 4OBSA 4E5XB 3STEA 5JUEH 3W39A 5E56A 4LHQB 4G8GA 3VGHA 3NSJA 1I2RA 3LS5H 3QYMA 1YN7B 3PWPA 4LLAA 3GTFA 1V0MA 2A6NA 2NQ9A 1KTJA 4HUWA 5E1QA 2NNCA 1AP2B 3R0UA 1H6FA 3FU7B 4L4VA 3LRGA 1AZBA 1A7NH 1D7KA 1HHHA 4XPAL 2OVLA 2CCRA 1XHGA 4WIQA 3HE7C 4NKOB 3V4VA 4MM1A 4QS5A 2ACUA 5ANMA 2I16A 3VYLA 2AXHA 3DVNB 3ZJ8A 4RNIA 3FRPG 3UTSD 4GMTH 1W72H 2FB4L 3NDYE 3FN9A 3CX2A 3URQA 4Y1SA 5DJYB 1BBJA 2APFA 1KIQB 5FSDC 3U9PH 4TV3A 4KKZA 3SOTA 3TP4A 5DBTA 1S5MA 4X7DC 1L9WA 3WFCL 2PGEA 5DZPA 3MBWA 3UR2A 5LGYA 3LZ5A 1RLBA 5L7XH 4B5XA 5T3XD 4XAFA 1MWAH 3IRSA 5HHOE 3RRAA 1E6NA 2EH8L 2YQGA 1NFAA 3JV6B 1E27A 3PZGA 1E5YA 4G9FD 3OC8A 5E99L 4Y4KB 3U4BH 3RWCB 5DF0A 4AMKL 1UXSA 3BZEB 4P8QA 3VOGA 4Y2DD 4LPTA 4FXTA 4JFHE 5AW0B 4DAFA 1LEGA 3DK2A 4Z2LA 3PP7A 3N4EA 4C56D 4XNUL 1TDQA 1ULVA 4ODBD 1X5FA 3NRQA 3MWCA 4DW2H 3MNWB 3RA7H 4U1HA 1WB0A 1OCWL 1NOFA 1ZHNA 3ARBB 1MDRA 4B27A 1ZXKA 1PIFA 4LC6A 1OALA 3IBOA 1P7QD 3G8RA 3IV8A 4LFYA 3HM7A 9CGTA 3HE6A 1JERA 1MVUB 4F58H 2XWBB 3N18A 4PP1D 5AD0A 2IH1A 1KIRA 1X9QA 5IV2B 2QPXA 3MFFA 5HHXH 1A64A 3URNA 4IRJD 3SB3A 4DP5X 2DJUA 3RI5F 3EBIA 1OFDA 2X09A 3MRFB 4ZYKB 4JM4L 3F84A 1MIMH 3VFOB 2AQ1A 3H6AA 1NCAH 3WG7B 2X28A 3DUSA 3UZVB 4HJSA 1H7WA 2OMBA 2A73A 2OJPA 2Y2TA 4K1WA 5TQ2L 2DIBA 1M68A 2IH3B 1NAKH 1W9DM 3W01A 2WSDA 3ULUL 3SRDA 4AVFA 1W3TA 1SVDA 4A7QA 1EBGA 1T5KA 4L18A 3IJSA 1GGIH 3N85L 4OF7A 1EF3A 5AOMA 1JDFA 3WO4B 3OKOB 3KHQA 4C1NA 3JR2A 4NZRH 3OKYA 1JMZA 1AC0A 2P7TA 2EILB 2L7UA 2PW2B 4Q6XA 1AQFA 3DX7B 1PZ5B 3P3TA 3VPLA 1GQJA 1I2NA 4HHMA 4X6DA 1MY7A 3FN0L 4YXLL 4X7TB 3GC4A 5EC1B 1IGYB 1UT2A 1YYMH 2YQ3A 2HFEB 1RL1A 2QCCA 3EO0B 1T7LA 4EOWL 1A6TA 4N7QA 2D2JA 3N6JA 1Z41A 3P0YH 9XIMA 3SKNA 4KRPD 3CUIA 2H6PB 4YXHL 3MHUA 3MXWL 5JU6A 2FH6A 5KJRH 2BS9A 1E6QM 5DD6A 2Y8VA 1WZ1H 1ECZA 1S5HB 5GRYA 2K78A 4QRUA 1KBGL 3C2VA 4LOEA 2HRPL 1JWSA 4LVHC 2HT4C 4FCHA 3QUXB 4Q22A 2F9RA 4Y5YB 5DVPA 1KLZA 5KN5B 2QVNA 4K71C 4YSDA 5IT2H 5D4QA 3Q2WA 3U8GA 1ECEA 3E6FA 1I9JL 4XZIA 3GBML 3V95A 1LE5A 3ZTJG 1G7MB 1F58L 2B0SH 4MNMA 5KS9B 4QRRE 4UTHA 2A6LA 1LO0H 2XZAH 1SUHA 5C0IB 1BQ5A 3SGZA 4DBUA 1U3JA 1PVHA 6FABH 1A9EB 2OMNA 3D06A 3CYVA 1B3WA 1GOGA 4AMXA 5DRXB 2EEBA 3ZDYB 4LYKA 4BQ3A 4NGHL 4UR7A 2DQUL 4HBKA 3FT4B 3VUAA 3BLOA 2YMXH 2DP3A 3GO2A 1K5NB 1RIUH 2ALWA 4LSTH 1T1XB 4PJ7A 2QDGA 2IV8A 5F2IA 2QJDA 4MVBC 3GS6A 1WUZA 5DT1H 2VM9A 1KPUB 2PTTB 3L9CA 3A24A 4NENA 5BRZB 2DPKA 1DP0A 1IFRA 4M7KH 1CU4H 1RBLA 2E9GA 4OHQA 1NVMA 3UZEC 1NDTA 3MJ7A 1E1CB 5HMDA 4WNQA 4UNVA 1PX8A 3QY7A 3QSRA 4DZBA 5I1KH 2WO3B 5F1NA 4MFDA 4A7GF 3VXRA 5HGBA 2XA3A 4U6YB 2P47B 4QTIL 2W95A 4GXVL 4M5TA 4I5BA 1YYAA 3C0SA 4NNPH 1X5LA 2OTWB 2EC9T 5GRXG 2WZEA 2VABB 4XKYB 4F79A 4O02H 4JY5H 3ECVA 3QQ9C 3BP7A 2WO5A 3TO4B 4KJWD 1T66C 4K2UH 1TEYA 3AXLA 3UC0H 1CMOA 1B0RA 1NDMB 1S9WA 2J56A 5AB3A 4L9ZA 1KN2L 1JV2B 2CK2A 1X5AA 4HSQA 1K4GA 3VI3F 3APTA 3RGVB 4XXCC 1FCGA 1OP5H 2EXYD 1AD9B 2Z8VC 3SIZA 3A67L 1ZTXE 4JFSA 3RBSA 3GHUA 1HINH 3BGMA 4UZGA 5EZJB 4XCCH 3S5LA 5J5EA 2VN5A 4A4AA 5C3LD 3K6OA 3ILQD 1X5GA 3RWDA 5D5MA 4KEMA 2DQGL 1QLEB 4NT6B 4L6OA 1A5BA 2DWXA 3RLUA 3F58L 4NN6C 3FW6A 5FO7A 5DXYA 4TOYH 4R0LB 3N9GL 5DRIA 2F68X 3ESOA 4BKSC 2ADIA 1RY8A 3A6CL 2Z8RA 4KV5E 2WSKA 3GXTA 3VGEA 2F7FA 1IX2A 4PUBL 5EO9A 1U8PA 4S1DC 4RX4A 1OP5K 3QFWA 4KI5D 3AQYA 3QQXA 3W0KA 1F97A 3I6RA 2O0TA 2R8SH 4FP8L 3ISWA 1XBDA 1K8IB 2QFPA 4C1KA 3CNYA 3LKRA 2WK2A 4YOKA 4PS7A 4LGXA 2LAGB 3LNHA 3WL9A 1XFPA 3SY0B 2PE4A 3OX8B 2EE6A 4IU2A 3IWPA 3O81A 2Q8BL 2GFBB 3GSRB 1UR2A 4I0KA 1AHWB 1T0PB 3T0TA 4RFNC 4OB5L 5L8JB 3FQWA 1R8LA 3WHE0 3WFAA 5AVXB 2X0VA 3H21A 1UWGH 3V6OC 3G1AA 2FEJA 3VW3L 4MPKA 1WZMA 3ZYJA 3L3KB 2AC0A 4KO6A 1AGEA 4HIPA 3DXAA 4NUQA 4U1MB 3L3OA 1KCZA 3PNZA 1ZZMA 2BOCB 4PI2A 1LTXA 2G4EA 4S2BA 4FIQA 3E9AA 2QCDA 2W81C 2ICES 3HW7A 2JIXB 2W60A 4MYXA 3FXGA 3REWA 3LKNB 1OP9A 4M43H 5DFAA 3W7MA 3GJEA 4AG0A 4PRHA 1VGKB 2D31A 1SYVB 1IEQA 5A3IC 4ORZC 3IDNB 4YDKL 1W0YT 4IQJA 4XO9A 3QUZC 2J4WH 1F74A 2Q20A 1D5MB 4LOUC 1FV1B 5KSBF 2C19A 5H37A 4F0SA 5C07D 1A4JA 1WDWA 1DDTA 1A21A 2IV9A 1PTAA 5B7FA 1VQTA 4J27A 4BFGA 3B34A 4YS4A 3IT8D 3UADA 1T04A 3X3FL 2D3NA 1UWYA 2WXMA 4HIJA 2R91A 2G5BA 3TJLA 3UTPD 4L4VE 4KIEA 4PP2A 2YCJA 2HTMA 2HJKB 2VC5A 4DBEA 1AODA 3RFZA 1JGLL 1K9EA 5ANME 2BXZA 1R2TA 3HNTL 1HJWA 1KB9K 1DSFH 1BEYH 3W2UA 3WMCA 1B6DA 1AAJA 4XTRD 4U1KA 2XCMC 1EIBA 4UTFA 1F4WH 4WHTA 5FIEA 4H5SA 1PY9A 3IVSA 3RPTA 4Z78A 4KRUA 1MRFL 2ZXQA 4N0YH 3QIBA 4Q3MA 2O9RA 3PREA 4YVXA 3CDCA 4R90H 4JY4A 3IGUA 4WRHA 2BSSB 1B4KA 4OIFA 5FEXA 1SRDA 3WY2A 1XRVA 4KK6C 1BYDA 4OQTA 1N70A 3JWDC 3BW4A 2EE9A 3D9AH 4QRSA 3WTYA 2W92A 4JKKA 2CW6A 3ZDZF 3GSUA 4HHAA 5L4JA 2AJ3A 2AEIT 2WXLA 3EEZA 5FCUH 4ZK8A 1VA9A 1Q6EA 4MQ7A 4XMWA 3DJZA 3IARA 3DLQR 3F64A 3QRLA 3X13A 4XZUB 1MHPL 5CAHA 4NC1E 3LPFA 4FNSA 2NNRA 3BD5A 4Y88A 3IJ6A 3AY4C 4ABQA 2WZ5A 4WTWA 3RVXC 4BV1A 2ZX6A 2C3ZA 2J8UE 1PMYA 4BBWA 4KUCD 4LDEB 1VS1A 5TGBA 3CZFB 3VKKA 2DQTH 1IIIA 1I85C 2B7PA 4NB7A 4D72A 3WO4C 2QVFB 1OYAA 4N8VB 1UZ6F 2WXPA 5ITFA 4GUGA 3IU3B 4HIQA 2BSTB 3BO8B 1EJRC 1BQHG 1W6TA 1IAOA 1MQKH 1DXIA 3BN3B 2X4NB 3W9DB 1MQRA 4TTDD 4FI4A 1KFAH 3S37X 2JJVA 3NIFF 4YHOL 2OJEB 2WXJA 5C0AE 4Z3FA 2BW4A 4UANA 2UYLB 5TDPB 4OLEA 3QQDB 4AVKA 1P5UA 5EU6B 4J3TA 5DJDB 3S1WA 3CH9A 2GC7C 4XNZB 1T7XA 5EZLA 2IWFA 3FKKA 3GYRA 3VFCA 1ETB1 3Q8BA 2QKIA 1ETZB 4EUPB 5FYKL 5EPDA 3DX9B 2IKHA 1GZQB 1R6WA 5FUCC 1O6SA 4NFCA 4ILDA 3P30L 1KC5H 1E7VA 4AD4A 2J25A 3QUXC 4FI8A 4U6TA 5IJBC 4Y5YC 2KLSA 4OJFL 1VYPX 1G4MA 3OIHA 3GUTB 4Q6YA 2F54A 1CDYA 2ZSWA 4RAVA 5ADOL 1EUUA 2HRGA 3HPLA 4S0TD 3WH9A 1QW8A 2OAAA 4WGVB 4BEUA 4X6DE 1NFIA 5INCA 3KR3H 5HBBA 3PG9A 3EHBB 3ZVIA 4NAFA 4KKXA 1L6XA 3WUGA 3L3GB 1BD0A 3HLKA 2VISB 3REVA 3SE4C 4GT0A 5MEOB 3WFEH 3QQ4B 5DUMH 3CFCH 1CT8A 3IFOB 3QZEA 4UTBA 4M5ZH 4X4MA 3JV4B 5IVXE 2FZ3A 1BGXL 1PG7X 4TMBA 5BW7A 4XPHH 2VX6A 4NJAH 4HAKA 2P28B 4XN5A 4WKZB 3L3DA 3DIDA 1UW9A 4BZ2L 1BGGA 6A3HA 3D3FA 2R2EB 3UG8A 3WTSA 4JNYA 4PJ6A 4FA7B 5KVMC 1E7UA 4UMBA 5FX3A 4LANA 3S37L 4EBQH 4NCC2 4KPLA 3T9PA 4B3VA 4CVZA 2VH5H 1ETJA 4GKTA 2PC4A 3RDJA 2BVOA 4X7SL 3VRJA 1E50A 1K2DB 5AVVB 3EWDA 1AI1H 5M7QA 4PJFB 1BXVA 1HCZA 4P5TB 4MY1A 4IQEA 1W3JA 2KAUC 2ZAHA 25C8L 1N6QL 2Z4QB 2VLKB 3FN3A 1NL0L 3HMWH 5E8PA 1H8OA 3WIFA 2VUYA 3IVKB 1VGEL 5D1ZD 2V63A 2A4EA 1D9EA 4JKNA 3V5HB 4I5UA 4QNPF 4KDVA 3WLBB 5FI8A 3M17B 3OU8A 5LNRA 5CKAA 1VFAA 2A9CA 2GGGA 3GR4A 1DKWA 4C83B 3P6LA 3WDRA 1OYCA 2B3RA 3TO4C 4XBGB 1OE3A 3VIHA 2D3LA 4W4OA 5IFAL 2NXYD 1KTRL 2C9VA 1P9MC 1B0GA 3IGXA 2JTDA 1D6EA 3E38A 3KJ6H 4NNYA 2LLLA 1Q3NA 5LCVH 3RGVC 1HZHH 1PG7L 3VGAB 5LBVA 3EOAA 3SD2A 9PCYA 1UD4A 1QHQA 2BM3A 3EMQA 3IU4L 2YRLA 3U83A 1DUYB 4NHUA 4PLKC 3VXRE 4XBPA 5TFSL 5LXGL 4BWLC 1P6BA 4Y0GA 2VN4A 3TX9A 5ABTA 1HG3A 1HKJA 2P8MB 3VCLB 4N90D 2GIYA 3AG1B 4QIRA 2V2HA 5E8DL 2WTPA 2NYZA 3CHXA 5B1AB 2WIIA 2G2NA 1A7QH 4KHTL 3GMMA 3OKLA 2ZP8A 2WSPA 4QPEA 1HVQA 3I3EA 4Y9EA 1NA8A 1E43A 3MUUA 4CVXA 1IC7L 3QS2A 4LCYA 1T0NA 3V0TA 4GX8A 5BPPA 3V0UA 4GG6F 5E4EB 3LHTA 2F74B 3GTXA 3M0JA 3MLXH 1RFDH 4OCSH 3B5HA 1BRLB 3ONBA 5F2LA 5EDXA 1R87A 4OF6A 1WYJA 1F86A 1WDPA 2JQXA 3MNVB 4AZCB 2VZVA 4TQEH 1DR9A 1I7UB 4ZFGH 1UMYA 3TBVA 5JMUA 3ZDXF 2OMYB 1XH1A 3NG5A 4L8CB 5T1JA 4ES8A 1AHWC 3BQUC 1C3FA 4EE9A 1RUAH 3C60A 2QEZA 4JIRA 3ZIZA 1J86A 3UJTH 4JM2B 4PCKA 1RLCL 1UM4L 4PGLA 1IE5A 2HE5A 1Q45A 3FTXA 3LZFH 2VE6B 2E40A 4A21A 1DQVA 3SUTA 4JFED 2NXGA 1L2QA 1XGZA 5K4XA 3SGDI 1CYGA 4IJTA 1JF1B 4TMCA 4Y1AA 3STLA 4ZTPL 1FWDC 5T33L 3TO2B 4A6YH 2DPEA 3OZMA 5IM51 3A9BA 3B8UA 3UYIA 7PCYA 3NK3A 3O45A 4TMPA 3VVWA 1UA7A 3LI1A 5I6OA 4UTIA 2CIIA 3VFNA 1LDPH 2QADD 4U1JB 2IFFL 3FH8A 4DO4A 3HQPA 5HI3C 3TN0B 4D9RE 1Y0EA 3IRPX 2ACQA 2D0GA 3KNBA 3VVVA 2FUQA 4L3FA 5D7IA 3HAEB 1OWRM 3A4JA 1ZVNA 3ME0A 3B2UD 4KKCC 4N4QA 3ZKQD 2BZDA 1V03A 3V7PA 5IROA 4XXWC 4QKXB 2Z1KA 5IJKA 3QO1A 4WQ6A 3IIOA 4HV8A 3W7DA 2E7HA 1FQ9C 4I1NB 1FRGL 2CLEA 2BP0A 3QYNA 1QUNB 1CFTB 4PS8A 1FC1A 2R29H 4U1NB 3DXAE 3VIPA 2GJRA 1ZPUA 3LPWA 4GACA 2XN0A 1NEZG 3C4UA 4OT7A 2Z29A 1ZAJA 5CJXC 3DBXB 3F7VA 1ZP4A 4CN1A 4M5PA 3DETD 4Z1CA 1HW6A 4OQ1A 2X2JA 3VWJA 1J5OL 4OLWL 1MFEH 3NTYA 1UWQA 5ID1A 3PSWA 3O2WH 4WO4D 2GT9A 2P45B 1OVDA 3TSBA 2EIEA 2XRAL 1ZT7B 2OSLB 3APNA 2I60L 4L1BA 4XBJA 4I1RA 1CL7H 1OW0A 4Q0XH 3CJPA 5SWQA 4J8QA 4WSGA 3T0EB 3Q3GA 3MCKB 1YNKH 3EXSA 4OLZH 1XGRA 1GW9A 2MOVA 4V27A 2JQZA 3U9UA 3RM9A 1AXSA 1PKNA 3T81A 1S9YA 1A3LL 3UAFA 2GQ3A 5AB0A 1E4WL 1K6WA 4MCZB 3T8VA 1ACXA 1FFNB 2R1LA 2XJLA 3RCMA 4QXGL 1VFTA 2FTWA 1V79A 4YWSA 5HOSA 5CIPH 3HTWA 3WQOA 2RH0A 2C9QA 5E0FA 1OARH 1ZWIA 1NGPL 4H4NA 4AKPA 4BFIB 1TTRA 3SUSA 3LNGA 3RVVC 2CZDA 3NZ8B 5FF2A 2P8PA 4N2CA 1VF5C 2ZKHL 4MSWA 1XVSA 4HUKB 3RDTA 3QLDA 3PAYA 2YPVA 4IKJA 1E30A 1S6NA 2H1PL 3ENLA 3QY8A 4EPEC 2IDCA 1J5IA 3E5BA 3TUUA 4IGBB 4Z0XB 3S88H 3HVNA 5C2UB 4ZI8A 1QHPA 4M4PA 5DD3L 3CUZA 3OZOA 3FT1A 2AAMA 2VD8A 5KSAA 1B30A 4ZD3H 2GYIA 5F7BA 5FGRA 4N86A 4WTZG 2A0LD 4O51B 2J2ZB 4Q4PA 3D6NA 5DK2A 5I3DA 3NCOA 4H44C 2B9BA 2GGIA 1LP6A 4JO5A 1IEAB 3BCJA 4G42B 3OJ2C 3W37A 2EAWA 4KZDL 1D6VL 4YQXL 1WS8A 3BPWA 2GPTA 4LX4A 4Z7QB 2PO6A 1E3XA 4HJGA 1L7IL 1Z0MA 2JSFA 5SWSE 5BVJB 2DJLA 1TCDA 4HJUA 3NJNA 3FCGA 3LAFA 1SMDA 5FK9A 4LCCB 5EU4B 3EYOB 4KTDH 4G72B 3I6SA 8PAZA 2NY4C 1F3RB 2DIAA 3TBTB 2C9AA 5K59F 1F00I 3L7EB 3DKHA 2MKLC 4IDJL 3STPA 2G9HB 4HUXB 3MLWH 1MJJA 1JE6A 1RK1B 1IBFA 4YX2H 4Z7NB 4JYEA 1CB2A 3VIFA 4C7GA 3VXNA 1OD0A 4AEOA 5FR3A 4HHHA 4BM7A 5F7DA 4GI4A 3SCSA 2X44D 3NZQA 1QSFD 1P43A 4DPQA 2W0PA 5A8OA 3T8MA 3MXVL 2OTUA 4K3DL 3KBJA 4S2SB 2GUUA 1J5SA 2OEJA 4M1RA 4GXUM 2IPJA 3K1KC 2BOFX 1UFGA 1UC4A 4HAFA 4PMXA 1LQ0A 3RWFB 5EUOF 3UWWA 1G7HB 4DN4H 4XVTL 4D0DA 3BE7A 2H3BA 1SBBA 1U8KA 4QWWD 4X6BA 1ET7A 3QA3A 2Y9RT 3ETTA 5F0JB 2DIEA 4DIXA 3ARDC 4K1GA 4C4BA 1T8XA 1H15A 4GMSL 1Q90A 2Z93A 2F6XA 4AQOA 1X5KA 4ZFFA 3T2OA 3U79A 4G2DA 4P5RA 3U1PA 2IXVA 3D0CA 2P52A 4I7ZC 4QX4A 5HYJB 5HHMD 5FEWA 4IU3A 4I5RA 3GMQB 1QSVA 1BQKA 1LEIA 1E5AA 3CM4A 3VVGA 3PXJA 4ODSH 5HDOA 2XA8L 1PZ2A 2YMTA 1MFNA 1PBYA 2QHRH 5DEFA 3BQVA 3C2RA 1ZLDA 1BG1A 3MBXL 4AE1A 4PGEA 3ARVA 4I2XE 1GTFA 3EYSL 1FVEA 2O26U 3S42A 5ACMA 3ZZSA 1Z89A 3I9PA 5HHQB 4H0IA 4R85A 4J4KA 3OVQA 3MJMA 1DQTA 4KRNA 4OGYH 3OB0H 5E6SB 3UVIA 2H7WA 2PTYA 3CHFA 3W5MA 1Z3NA 1M5WA 3FUDA 1M4KA 3HN8A 4WR3A 1HI6A 3MYPA 2DIKA 1NCNA 2ITDB 3PB0A 3GIZH 4PR4A 3VFRA 3U7YL 5IOPA 4ADJA 3VGAC 5KBPA 1FP9A 3ULSA 1KRMA 2KI6A 2V2CA 3MJ9H 3A21A 1IL1B 4FABL 3ZLHA 3HC3H 1RVFL 1R75A 3CFQA 4YHGA 4V1XA 3HS9A 4D6IA 1G1OA 3MSDA 4P4KC 2XIOA 3QZWA 4CQ9A 1IC5H 2J12B 1XI3A 4GGHA 3HC0A 1N10A 2WXFA 1N3NB 1BEXA 3FA3A 5IB2B 3BE1L 3QNYB 4IHBA 1KXVC 2GTZB 2F7IA 1YNLH 3MRMB 2I14A 3NSXA 3DX8B 3H9HB 2F19H 4FG6C 1R3WA 4NAMA 2PP7A 1FH5H 4DN3L 3PPSA 1RQHA 3W22A 4XZ4A 2PRMA 1U8OA 3I02A 4L48A 1UJ3A 1EXBA 1AG1O 5E6IC 4R4ND 2PBGA 1DHKA 3RJQB 3MA7A 3DDGA 2GJNA 2NTFA 4S1RH 5AAWC 3GEWB 3TJEL 1YEFL 1XAKA 1AD4A 4DBDA 4TVSa 1AXTH 1TE1A 1BGAA 1C16B 1GZJA 1EX0A 1LO2L 1RA0A 1KJ2A 3W1XA 5I30L 5FUOH 1NF7A 2X70A 4XAPA 1K6QL 2O5ZH 1ETA1 3O4LD 3ATFA 3S3CB 4X50A 4DBWA 2KT6A 3PUCA 2IPTL 3TIDA 1S2EA 1FHUA 4JFFA 3B9DA 3GSVA 1KB5L 1PDZA 5FJPA 4GS7C 3N73A 4FO4A 1EJVC 4LB3A 1XB8A 4GIRA 1RJZA 1E2VA 1V3LA 5AFDA 1E9OB 3K4DA 4B5UA 3M7WA 4RA3A 2OMZB 3UFYA 3M86A 1TG7A 4NNBA 5EBWB 4TNVF 3WQGA 2R1WB 4OIIH 2VX5A 4P2OD 4IBZA 4YNYA 1XUUA 3TN0C 3SJNA 3DTXB 3N42B 3HPXA 5A2LH 4U6XA 1H3TA 4WK0B 1JL8A 4ZQRA 4N9GA 4GAJH 4LNYA 1DL3A 4OLUL 3ZTJH 5J1SC 1WF5A 2KL6A 3VNDA 3ZT6A 1Q7ZA 5IK3B 4MUPA 4RNRA 3MA8A 4KAQL 1KGCE 3EXLA 1R3RA 1JFQL 1WK0A 5C0NC 1MJ8L 4FMVA 4DCQA 3HHSA 3GTNA 1G4PA 4PRPD 1BZ9B 3BXNB 1NKRA 5JOPE 4QGCA 4OFIA 4J2MA 2QDEA 4LVHB 2Y4SA 4NLHA 4AAJA 1CL7I 4Y1AE 2B3IA 1JPST 1TU2B 1QU4A 1JGIA 4PJ8B 3CSPA 1KENL 1R46A 4YGVA 3TBWB 2CQVA 3NR0A 1N0LB 4K71B 3NABL 3RFRA 1IFGA 3DJSA 4NWTH 2DJXA 2V2WA 1UXWB 2XIQA 1P0NA 1H62A 5CJBA 3KVJA 3P73B 3MV7A 1ORSA 3NIDF 2YGYA 4OZFA 1JRCA 2OULB 4NQDD 4PRAB 1SHXA 3O3AA 3AJ7A 2PDNA 1Z9AA 5GGUB 2AXFA 1DLFH 2ZKXA 2VDPL 3T0EC 3UY8A 4AVNA 1R5YA 2F6AA 1TG8A 2DV0A 5E7FA 2VR4A 2CJUH 4S3CA 1IQ8A 3LRLA 2NOYA 2X4RA 4CA4A 5B7MA 1KCKA 4M3KB 2XN2A 2X1UA 5GJPA 4G7EA 5H2BA 3SE8L 3N2JA 2DQCL 2ZYHA 3AI0A 5IBXC 3PFUA 1MXSA 2B9AA 3FQXA 4UMCA 3AABA 1VFOA 1HL2A 5A94A 4TSCH 2NQZA 1S5IH 3G08B 1XZWA 2YL6A 3DHJA 3VYOA 2EEXA 3PRZA 1I4FB 3EZ8A 3WD2A 4X6FB 3T77B 2Z1SA 1U2CA 4H1LG 2VLME 1T83A 1G9HA 5FYJU 2B31A 4KQ4H 5EEZA 3BAYA 3KHOA 2L7EA 4GB9A 3ROLB 2ATKA 1XYCA 1O7VA 4OU3A 3WH5A 4UT9A 5C9KA 4QLKA 3EGDB 3WKZA 43CAB 3V0VA 4PW9A 4FLHA 3V4PA 2CRYA 2PWUA 3U0PA 1E4KC 2FJHB 5CN3A 5BZZA 3DVIA 4ONFL 5DQPA 1JPGB 3WGUB 1S38A 4C57C 1K1DA 4XI5D 1EAOA 3VG0H 1XF5B 4K3JH 4DEPC 3NGBC 4I9MA 4E9VA 4YS1A 2PGRA 5E08H 2J5LC 3T5WA 3WJMA 3BVJA 4XSMA 1QR1A 3DECA 4UILH 1LQ2A 3N13A 2YD6A 4LEOB 2PDBA 1A5CA 3EYUH 4LHJB 4BI7A 3IYLW 3KW8A 3STGA 1KCSL 2KDYA 3NCJL 2P4AB 3UDWA 1J79A 2Y6SD 3VD9A 5BS0D 1NC4D 1JHTB 5D71H 4OZGE 1T4KB 4OZ4B 1MLBB 1PNDA 4FQ2L 4NWUH 4PULA 3VNKA 5D70H 3UTOA 2FSDA 4QG9A 3RVUD 2DTMH 1Z9OA 3SZ8A 4NN6B 2WZ0A 5LVEA 5AZUA 4MJMA 2EUVA 5DD5L 4U0QB 4NQCD 4NPJA 1OM0A 3E6EA 3SD5A 4AJYV 4BE5A 1EZWA 4JFYA 2VJ0A 1L2UA 3B8IA 1ZDQA 3O0KA 3D4CA 1FZOB 1J0ZA 1OGAE 3KXFA 2ZKWA 3BUTA 43C9B 1MCPL 5RUBA 4C6EA 2QTEA 2Y7FA 2ZOWA 3KYMA 1IM3B 3TJPA 3S1GA 4Z2GA 5SWZB 4PGDA 2IH9A 2WQDA 5A16B 1JAKA 2IEPA 3N50A 5E9DB 1OWWA 1DQJB 2KZWA 1OF2B 2ZPKL 3RITA 3F01A 4K7PH 4L1LA 3NSMA 1RZJH 2AKRA 3RX4A 4RFNB 3AWFA 3MV9A 3Q67A 4HK0A 1DBMH 3R79A 3V16A 1EHLH 1DYZA 3KLHD 1VENA 4I9WE 4O18A 3EYVB 4PJHF 5ADPL 3PN8A 4BCZA 4QCEA 1MI5D 4GG9A 5E2UH 1OC7A 3FLUA 7PTDA 5DUPL 3UGXA 1DFXA 4HXAL 4PLJC 2ZXWB 5C9WA 3NO3A 3II3A 3BTNA 3APGA 4OCWH 2B77A 1TVDA 1U91B 2GY5A 4QQUA 3VCNA 3BZ5A 5AEAA 4TLUA 2X42A 4Q2ZA 3KPRD 4L3EB 3BN9D 3HGSA 3KPNA 5KVGH 1D2OA 4LF3A 3S83A 3H55A 5IMMB 4R8WH 2Z3FA 3SY8A 2VSMB 1G9NL 1PWLA 4JG0H 3S3DB 3PUGA 3QUZB 2XG9A 1UKTA 4TKWA 1Q6RA 4FXLA 1IM9D 5A6MA 1EX5A 1IGML 1JPEA 2PLMA 3ABXA 4LSQH 4GBUA 4NKIH 1RR2A 2GVJA 2EPMX 3C3UA 2EH7L 2GBTA 3BSZH 2XDHA 5EU5A 3IXTB 1AHKA 5GS1C 1I31A 2P3ZA 5AC4A 3T0DA 1MFAH 2EUXA 3ULVH 5FUZL 2A74A 5CEXA 1F4XL 4IPIA 4JBRA 1EA9C 3S4SG 1KLUA 5B1BB 5I8EA 3AMKA 5TE4L 1DVFD 4GIYA 4RL3A 3E3QC 2O6DA 4JDEB 4JTJA 2DLFH 3SGKA 1I1YA 1KJVB 2BIHA 3UJSA 1LL4A 1N5YL 5I24A 1FC2D 3FOMA 4GEJA 3VABA 4ZNEA 5CC3A 1NAMB 3BDXA 3GKFA 4F9LA 1NUGA 3RVTC 1E8YA 3C5ZA 3KPSA 1S1RA 3QAZC 3VNYA 3L1EA 1OPOA 4HWEH 1S7XA 1INDL 4AG4L 1SLUA 1P84J 2F7PA 3I3BA 3N5AA 4ZPTA 2HFTA 2V17L 1FWWA 4YXKH 3AM8A 3HGRA 3R89A 4RWHA 4LEBA 4IIDA 2J88A 1F61A 1C5DB 3CSYB 3GLDA 4DO7A 3H7RA 4KXZH 2CIKA 3EYQC 4PB4A 5HJLA 1M1XB 4F57H 3GMPB 5D2LB 2HJLB 3WFBH 4FC3E 2X87A 2VC2L 4LLDB 4J4PC 4RGND 1IZJA 4WWOA 4UFKA 3BOVA 1N8WA 1N4XL 2VELA 3M0YA 1NUNB 3IJEB 3UBHA 1TJPA 4WK4B 3VXUE 2O7SA 4F66A 1CGXA 5JOFA 4TNWF 1BIIB 3PWUB 1TJHH 2PPDA 4AM0Q 1BQRA 1XTLA 3BEVA 5F9OL 1DJSA 5HATA 3BZ4B 5AYQA 3UPRA 3KXQA 3DROA 4K7FB 2R1XB 2WXNA 1I8JA 4H04A 3O6FA 3W1NA 1E67A 4GSDH 4WFHE 3JYBA 1GHFL 1BWMA 1L5GA 5FKAB 3RB5A 4FFYA 1OAYH 1I9EA 4PJ5B 1OTTC 5I1HH 3PV6A 3VIGA 4NI6A 2G5WA 1W16A 3FT3A 3LY0A 1IJNA 3GJFA 1JR1A 4HGMA 2WOBA 3L9YA 4UWMA 3N15A 3GWJA 1YO4A 4KKRA 4PJ8C 2ISWA 3ALFA 2ZP9A 2P44B 3TVMD 1AH0A 3I74A 5MEQB 4DUXA 4ERAA 4PVMA 1OAUH 1ZMYA 4B5TA 1EZVY 2Q0ZX 2ZYIA 4LBEA 1U1HA 3CWHA 5F88B 5CKGA 5LAXA 3ZE1F 3VFTA 3WQDA 3IDGB 4F48A 3SCVA 4E9RA 4Z77A 1FCBA 3VXMD 4FOMA 3ULUF 3K8LA 5FEZA 3BW9B 4TQPA 1YXDA 3B2XA 4OGZA 5GRJH 3VXSD 3OLGA 2AEPH 3P61A 3E96A 3QDMA 3USBA 3OVPA 2LLEA 3QUMB 5AW6B 3UXDA 1OLLA 1Y5WA 1L0XA 4EX4A 4DPRA 3IFNL 2L8AA 1HEZB 1J9TA 4RETB 4OUUA 4MNGE 1HFBA 1E4IA 2IMNA 4PUWA 5LLIC 1JHKL 4OIBA 1WWCA 2OQYA 2LFGA 4JW3A 3VK5A 4RNJA 3NEOA 3MMDA 4GXFA 1SQ7A 3KRSA 3CAKA 2CLFA 4HC1L 3DVGA 5BZWA 2IAMA 1ERNA 2NSQA 3QIWD 3MV7E 1DVJA 3UWVA 3UTTE 3W3OA 3GMRA 3OWEA 5F8RC 2EZ0C 4MA7L 4B16A 3K91A 3FOKA 4V28A 2F38A 4L1DA 1GVRA 1J11A 2X9XA 4CD4A 3ANUA 4QP0A 1A2YB 4EVNA 3UBGA 4LWWA 1IQDB 2OZ8A 3VE0B 2VDQL 1HJSA 1VKXB 3WIHA 4N8UA 2CU9A 3FFDB 1XBYA 1M7PA 4QO1B 2EINB 1VESA 5KYNA 4ZMYA 2BOGX 4QRAA 1OQXA 1JCXA 2AP2A 2VKWA 4EO5A 4UM9D 2FIQA 3LQZB 5E5UB 3ETSA 3MREA 3ZHDA 5E9NA 4L80A 3MDUA 4YLBA 3TONA 5EBUA 2O6FA 4GCAA 1A4KA 1AMKA 4PJ9D 5L2KB 4IGNA 3CXFA 4MS8D 1QWHA 4FXKC 1IEBB 2BWDA 2O30A 4N1EA 3D33A 5AOLA 3HMXA 4YHLH 4BFEA 1W1PA 4PJBE 3BT2L 3LCWA 2ODIA 4LUIA 4PTNA 3TK7A 1RALA 3PNRB 3W87A 2AABH 3U36A 4ATTA 3KW3A 4R27A 5AB2A 3MUHL 4HCGA 3AIQA 4XP4L 5AYUL 5D7JC 3DPDA 4YE4L 3NXFA 2FTYA 5I1LB 3H23A 1VSCA 3QNXA 2E8ZA 4JFXB 4QXVA 1GOKA 4BEQA 4YIQB 5HHVH 4EDWH 4GKSB 4LGRB 3FJTA 4Y4HA 3LPPA 4Y1TA 3DRTA 4N6RA 2J7LA 2BNRB 2DQDL 1BV8A 1M7DA 1P1XA 4MAVA 3SRFA 1B6UA 3CPRA 2JK2A 4WJ5A 4RFEA 3IKCB 5CSZB 2GK1A 1ADQL 3QCTL 2XWBA 4LP8A 3D5HA 5CILH 3DYMA 3W00A 4DHGA 2XVKA 2R24A 4HMNA 4JS3A 1IHIA 1GOQA 1D7FA 4MJ4A 5HGGS 2AJUL 4IUGA 1PX4A 1WT5A 1I8IA 3LS9A 1NM4A 2QCLA 3FSOA 1MRDH 5IXEA 5L9DL 2QS8A 3S2NA 2X2HA 3TQVA 1YVLA 3EFFA 3BQUB 3C2AH 5L6YL 2Y07H 2C6QA 3SKOB 3JUZA 4Y4FB 1S7QB 2EVFA 2Q6WA 2XFXA 2WN2A 4Z95L 1K5WA 4ZTYA 3GE7A 3RY6C 3Q2VA 2KMWA 4NKMB 4GG8A 3TMLA 3VU2A 1D8WA 2OM5A 4QDWA 4GUQA 1XF0A 3M1BA 3IJHA 1Z9LA 2VLRB 3MOAL 3GMLB 2CGRL 4IQLA 3MRJA 5I82A 4AZ8A 1UCBH 2SEBB 4BFNA 4DPCX 4C6IA 5L0QB 3QDJB 3PSVA 3DYOA 4MJIE 5IESH 5E4IA 3NDOA 3BJTA 5HUOA 1YY8B 3VACA 4ZQPA 4WCYL 4H7ZA 5E8OA 1GHRA 5C0DA 4LB8A 4XAYA 1X6NA 5CO1A 4KNSA 3F12A 3ZKMD 5G4MA 2H6PA 2ZYRA 2J6EA 2C26A 4MJ5A 1J5DA 3CHCA 1BFOB 4G8GE 3NP3A 5H94A 4KDTA 5CUSL 5IBLC 3ZQWA 1TJXA 4FOKA 3UBXI 2EXTA 3PWPE 4K5NA 3X1NA 5CBEA 2EKSB 3W81A 1AGFA 4OZIB 3FO2A 5SV4A 2QXWA 1GY1A 4WFFD 2P8LB 1REIA 5T5NG 2D24A 5AOUA 1SSGA 4W87A 3IAQA 2ARJQ 4UFMA 4ZMNA 2FFCA 2E7DA 4U3HA 3L0KA 4L1SA 4GRWE 3GHPA 3VSTA 2Z31A 4JYDA 1QPXA 4Q89A 4BQBA 1EGZA 3CVIH 3G77A 4KMLB 3EBGA 2VDHA 4TM9A 1XL6A 1ESWA 1R9FA 3LBOA 3D08A 1N2VA 5IIEB 3N14A 4LP5A 1J0HA 4FOJA 5HBFA 2GWGA 3FFCB 4RXFA 3K4ZA 4WKFA 5I03A 3WLRA 4GAYA 1W72B 2YSSA 4HPOL 1HXMA 2VMDA 1BW8A 4ZAKB 2Y5TB 3TU9A 4XP1L 5H1WA 2OR8A 3LNMA 2EXOA 3CVHH 1TTGA 4ONGH 3BW3A 1MPAH 2RB8A 1EJ7L 2YUZA 3V7AE 1FAIH 1IT0A 4F20A 4XIAA 1WISA 2LQRA 1MWAB 2A3AA 1PXGA 2DQHL 2PZNA 4F24A 2VWEE 2E6FA 3OR6B 2XH4A 1F3DJ 1NCUA 4I0CC 4UB0H 2WZHA 3L68A 2ZTJA 2J7BA 3ZKXC 3ISYA 2O61A 3D3VA 4U33A 3Q9PA 3ZZQA 2I5QA 4BELD 1FE8L 4YDJA 1BWVA 2VYOA 5FYLL 1XZ0A 2R0KL 2ED9A 4N9OB 2JJUA 1AVAA 1H2JA 1VPQA 3LIZH 1IXQA 4GFIA 2V6AA 5T3ZD 4XMKH 2EAEA 4GW4B 1D3GA 1V7ML 4K36A 5EH1A 1KN4H 3IE9A 3NCMA 3MUJA 2XJ7A 4L05A 4LKCA 4BKNA 1J4EA 5DU7A 1FVCB 3RKDC 2FGWH 2TSBA 2YA1A 2VABA 4UFJA 4GLRH 3WDHA 3WNJA 5K39B 5DT5A 1S7TA 2J71A 4RJEA 3KTXA 1F4YH 1VPOH 2CBJA 3QFJA 1QJWA 3LBMA 3ZIMA 1JV2A 3KS6A 5EL1A 1M41A 4PRID 3OHMB 3C0JA 5E0KA 3X17A 4W9DC 3DG6A 3OTRA 3O41A 3LGGA 2JB6A 1NMCC 4XO6A 1WLHA 3DPBB 1PBGA 3RWHA 4U7KA 2OK0H 1KT2A 1YYLL 1E9LA 1GMEA 1CGSH 1R3LA 5E2WL 2V5LA 1EGVA 3SI9A 3WBYA 4WY7H 3M5XA 5HDQL 1HNGA 5FDWA 2V9DA 5B39G 1OHQA 2GJZB 3I6LE 1XCTA 1R3YA 3V10A 4PJXA 3RDKA 4ADSA 1EXUA 3F7KA 4WW2B 3DV6A 3B8DA 1DANU 2R0ZH 2NY4B 3IS4A 4B9IA 3RG1C 3CFBB 3IDUA 1E9ZB 4FL4C 3HNVL 3QWRA 4YYCA 2WZPD 2HG5A 2C91A 4YBQC 1AKJA 4MADA 3MV11 4IISA 1H61A 4IHOB 2GK0A 2DEXX 4ACYA 4PCFA 3ES6A 3G6AA 3P3SA 4OH2A 3G6JF 4R9HA 3AYTA 1G1KA 1U33A 3HURA 3FB5B 5AVRB 4OI8A 2H32A 2VDMH 2FO4A 2Y3NA 1C08A 1DBKH 2H1XA 2JFEX 4UTCA 4XB8A 3N44B 1KG0B 3M0MA 1PCKA 3UJRA 2ALAA 5DJ2B 1YEWA 4D6EA 2OOFA 3NEVA 3B56A 3GM0A 4F2MB 2LU7A 1MG3C 3SDYL 2P8BA 1V51A 1QI0A 2BC4B 3WNOA 4CN6A 3VDGA 4JG1H 2P5WB 3ARDB 1JBJA 3NEEA 2RDXA 2D73A 3ZS4A 3L3KA 3DGRA 5PCYA 1B2WL 1O5PA 4H88H 1KFWA 1E0VA 2R69A 3NO1A 1E5ZA 4BH7A 3KOZA 5I17B 3QDME 3GTVA 2JIXA 4XMLH 2X1QA 4HPXA 1BVOA 1FLRH 5JBDA 4CADA 4YBLB 4R96B 2QAFA 1PZBA 2PCFB 4JFDB 4JTUA 4AIEA 2V2TA 2Z6JA 3ZR5A 3H3PH 4PJ7E 2D7NA 3ZY7A 2RBLA 3PVFA 2F7QA 32C2B 2B4CL 2YGOA 1EOMA 3R6IA 4JHWH 4NAJA 2W94A 1CFMA 2J57A 4QRTB 4DWSC 2YPLD 4O52A 5D2NA 4ZX5A 3K6IA 4BINA 4TVPD 1MZRA 1ASPA 5FM5M 4LCWD 5DSCA 3MLVL 3RG6A 1PNCA 1H1ZA 4GW5B 1I9RH 4CUCA 3SAZA 4QCIA 2HH0H 4LY8A 3TZNA 4QY8A 4HZ1A 2E25A 3OQRA 1N59A 4JEGB 4W8BA 4V2XA 4F8XA 4Y9GA 3C2SA 1K4DB 3L2NA 4P4KB 4S3EA 1V93A 3QTGA 3LCLA 3KWUA 4KTEH 4D0BB 2YCLA 5C09D 2YAHA 3AQDA 4HIEB 3IDXH 2BNJA 3UBFA 2A83B 2OR7A 2IKJA 1R3VA 2OW6A 3OF6D 4HKZA 2HLAB 5E6IB 3AWOA 1TWDA 2H3DA 2VURA 4MZRA 2XM1A 5E9XA 2UZXB 1SOQA 3NVTA 2WCGA 1B4JH 5KW9H 2WKJA 4O02B 1HT6A 2WBJB 1AJ7L 1Y0LA 3ARFA 3KRBA 1U6AL 4NQEB 3F85A 3H7UA 4DTGH 2MNJB 5EBLA 1O95A 4WD0A 1K3IA 3FVMA 4Y19B 2W9LA 2QSCL 3MLUL 5D5ME 4ZMXA 1MFCL 4CMHC 1P6AB 3UZZA 1QG3A 4WFGD 4PJAA 4Y4FC 3OKNA 4APQD 2PUZA 2VGIA 3U2ZA 1FHGA 2BVEA 4GS7B 4TUJB 3FGCB 3NACL 3HC4H 1EJSC 2Y7QB 5DJZB 1QEXA 2HVJB 3GSNL 4O5LH 3MVSA 1GGCL 3QR3A 1ZJHA 1VDGA 4NRYA 3SQOH 5F0MB 2IG2L 1AFSA 4EZLA 1HO4A 1QYGL 4PJCA 2APXA 4N8VA 1XH2A 4FZEH 4NZ3A 4YHPA 5LXVA 1AGBA 5L0QC 4ES4A 3UPBA 3CDYA 3G1XA 3AG3B 1EUAA 4OM1H 4GPVA 1VR6A 1JNHA 1V3HA 5LHEA 3CAFA 3O1NA 3H2MA 5DMKA 2DICA 3ZE0F 3H8AA 3S3SA 4QHLB 4WU5B 5DJ6B 3TZVC 4W8LA 3US9A 1PZ1A 1SFJA 1JXDA 3CSFA 3EBHA 1U3HC 3GGWA 5EU6A 3HBGA 4OI7A 1MFUA 1ID2A 3USZA 1X5XA 1EEYB 1DBAL 5IR1A 4G43A 4YUEH 4NUJA