1KXTB

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
123
Chain Sequence
QVQLVASGGGSVQAGGSLRLSCAASTFSSYPMGWYRQAPGKECELSARIFSDGSANYADSVKGRFTISRDNAANTAYLQMDSLKPEDTAVYYCAAGPGSGKLVVAGRTCYGPNYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 22
structure length 123
sequence length 125
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2002-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kxtB00
3U7WL 5D7LB 1J9CT 4BZ2H 4L5FL 5HSFA 5D1ZD 3MRLA 5JPNA 1XMWA 3UTZA 1NGYA 4GRWB 1Q94B 4L8CA 1X44A 3T08A 4YXKL 2HA1A 4K3JL 4CN4A 4M61A 1CF8L 1FNGB 4E9LA 4UAOC 2EO1A 1Y18A 4U6HA 4MSWB 1TFHA 3TA3C 1Y6NR 3I50L 1JWMB 5DRNB 5KOVC 2VLRD 1OAQH 4RFEA 3MYJB 3H9SA 4Y16C 5JXAL 3GK8L 1OW0A 2VDNL 2F74B 3QNYB 1R3IL 4WI8A 4PRPB 2NY0B 2YC1A 4YBLB 4YDKH 4QRRD 4YUEL 3QQ3B 1D5ZA 3KNBA 1KUMA 3DXAA 3MNWB 1TVBA 4F8QA 4GRMA 4Z95L 1R3KA 3F65A 1P84K 4WVRA 2EE6A 2XYCA 5C0DA 4AENB 3CLEH 1K9TA 5JQ6H 2YA1A 4GBXB 2BVPA 3QNXB 4ORGA 1Z2KA 4KK9D 1OT1A 3Q2CA 4P46D 3V5DB 4K3DH 4BH8A 2B2XH 4D3CL 1IE5A 1LEGB 1JCKA 1NFDE 1FG2A 2QQLH 4H0HB 4MNHA 4MMZC 4KJWC 3X11B 1WIUA 2NY2D 5CP3A 4ONOA 1DN0A 2A74B 3ROLA 5DMIL 2YPVH 4XNMB 4LNRB 2JB6A 1V5JA 3RX8A 3UBXA 1J87A 2RCSH 4L8SA 3HR5A 4NQEA 2LABA 2HTLC 3RZCC 2BOCB 1E4WH 4WDIB 2CIIB 2EXWD 4OJFL 1EFXB 1MCWM 4GLRI 4HC1L 3LQAC 3RAJL 3TBSB 5I1AB 3N1PC 4ZFOB 3WKNA 2IAMC 1RVFH 5FO9A 1QFWM 2AK4D 5I6XC 4AM0B 1N3NB 3QQNA 3DPBA 5TE4L 1MUJA 3MBEB 1MVUB 2GSGA 2UVFA 4QRRB 1GZPB 3ARZA 3HPLB 3JUYA 3MJ8A 4YDIL 3C6LB 4GUPB 5FDWB 3SGKC 2P5WD 3CSYA 1E4XI 1RUPH 2VDKL 2YEZB 1E6OL 3BKML 3DI2B 5B22A 3TYGL 4HS8H 3GMPA 1HQ4A 4TUOA 1OOAA 3WNLA 6FABH 1KTLA 1RD6A 1NCCH 3MRFA 4M6ML 4MNQE 1R3IH 4F7CA 2OTWA 5I8EB 2P46B 5IFJB 3GBLA 2FSEA 4R7DA 4DQOH 3HI5H 3KXFD 3RHWF 3MODL 2HT4D 3GHBH 3MLWH 5C7XL 1BWMA 4S1SH 4UBDC 5SX4H 4R4NC 1EX0A 4ONGH 5E4EC 4NNXB 4TSBL 5CZXD 1PQZB 1U8NB 3RWFB 4KUCD 4LDEB 4LKXA 4R26H 1T0NB 3RGVC 1P4LA 5DGRA 4NYLB 3T2OA 4FQQA 4DN4L 1VFAB 2UYLA 5EOQH 1MF2L 1L7TL 5CBAA 1GRWA 1AD9B 3VFPB 5JW4Q 1NCAL 1N7ML 1MWAH 5I1KL 4F58H 3O11A 4Y19A 3T3PE 4XBEH 4UNUA 1BJ1J 4WHTB 1VCAA 4F7PB 1RUQH 4PJBF 4QGYA 4MNGA 1I85C 2Q6WA 2X70B 4KTEH 5ILTH 1X5IA 4NYLA 4QXGL 4P2YA 4JKPH 3ULVH 2R4RH 5FCSH 3WEXA 2NTSP 4CN1A 3L3IB 1QVOA 4LLVB 3THMH 1G9NC 5JUEL 4OFYA 1RZFH 3CDFA 1LK3H 1QG3A 3P3YA 3C87A 2FNBA 3M07A 5CJ8A 1CFBA 3SKJL 1JGUH 4LSTH 3ZE2E 1GGYA 2F8VA 4N90E 5F96L 3FAXA 5CIPH 2X05A 3QDGA 3P77A 4JFHE 4Z8FH 1OGAA 3O9WA 2VQTA 1YJDH 2HKFL 1OP3K 1A9BA 3S37H 1JFQL 4JVUA 5IMMB 1V3MA 4Y7MA 2ICCA 2VZTA 1FRGH 4HWZA 5GS2D 1NC2A 2ILLA 4QT5B 2FJFA 4KGLA 4OCXH 3FQXB 3SKOB 2ADGA 4KK9C 2E8YA 3H0TA 4JPVH 1U8QB 3TBTA 2H32A 3QNZB 4FFWD 1J18A 5DLMH 5SWSE 2PW1A 3DO7B 5IKCA 1JGEA 4Y4HA 5MEPB 1S9YA 4JZJC 4LMQE 4DGVL 3GHBL 1MLCB 5DD6B 3V9FA 1HILB 5HDOA 3UBXB 2XG5A 4JRXA 4U1LA 2XZZA 1BMGA 4IIQA 2AS5M 2DAVA 4PJ9C 4W70A 5DHVH 1XGYH 1QLFB 3NCEB 3DOSA 5C0AE 3WHXB 3GNML 2ZUXA 2AEPL 4XCNA 5C6TL 5J6HB 1ES0B 5E2VL 4TNVF 1NEUA 4Y1AD 4J6RH 3MLVL 1RHFA 1IL1A 3OB0K 5FKPA 1KJ3H 4D94A 2DQIH 4BK5A 5SX5H 1XGQA 4OCNC 3SDCB 1IM9A 4NIKB 4XTRC 1VB9A 3GM0A 5ADPL 3W9EB 1BHGA 4ZUTB 4OF5A 2NTFA 3VCLB 2DLIA 5D7IA 3ROOA 1QHPA 1AO7B 1JF5A 1HKFA 1U3YA 3MV9B 3L3OB 3G6JA 2WIIA 1WWBX 1CDHA 2VAAB 3PABB 3V2AR 3MOBH 1KEGL 2VXUH 5GRJH 5TFSH 2HRLA 2X7LB 3U9PL 4C56E 1CDGA 3BISA 2IPKB 5I73C 3M17A 3FO1B 3R0MA 2ZNXA 4XNYH 2W1NA 3WIHH 2HT4C 4NC1C 3AS3A 4LP5A 3CFDB 1J8KA 1IM9B 3GSUB 1U58A 4NN5C 3O9WB 5ICXA 3BRFA 4ZPTA 3PHOA 4QTHB 4HCRL 5KG9A 1NBZA 3KHOA 4YHPB 2BVQA 2UWEF 3DIFA 3EJZC 4MJ5A 4Y4KD 4KQ3H 3NA4A 4OLVH 4EI5C 5C1MB 1ZANL 1NC4D 4WU5A 2O61A 1G7HA 2WMPA 5CZVH 5IMOB 3KPOB 4NHCH 2JJVA 4KK8C 1KSRA 3WNNA 2C4FU 4EN3B 5E8EA 4JRXB 4U1LB 1KB9J 5IROA 3LEXA 4NKIH 1I7TB 1ONQA 1MCJA 3TBVB 2GAZB 1JGEB 2IPUK 2XZCH 3EO1A 5T3ZH 3TN0C 2H1PL 3MRHB 4AEIL 5GGRB 5DJAB 3UYRL 1EUUA 3T0AA 1TDQA 1U8HB 3S36H 2FHCA 5JTWA 2FL5A 5DMYA 1OWRM 3ULUH 5IWLC 3KR3H 5CWSA 4UBDD 5F7MC 4HG4J 3HMXH 5SWQA 4M62L 4KUCF 5E6IA 3EYUH 2Q8BL 3WN5B 5L88L 2X89A 5DO2D 1DE4A 4DVRL 3ILPA 3F58H 1X3DA 4WI6A 3D3VB 2OBGA 3WKML 2R0ZH 3S3SA 4C55A 5JDJA 2JJTA 4PGDA 4PJGE 4HFWA 5DR5L 3RY5A 5HYEA 4JM2B 5CGTA 2DQUH 3OZ9L 5IEHB 4IOFC 2L4OA 5J9PA 5CP7A 1JV5B 1TZHA 4OLYH 3RTQA 5D2LF 4JPVL 5MEOB 2X4RB 4OF7A 4XWGH 3TNMB 2V5YA 3OQ3B 1ORSA 4J3UA 1JTOA 5DDHB 2VUYA 4F8TA 1JMZA 1IQDA 4IOIA 1OP5K 4WFHD 5EC1A 1AQDB 4EIGB 2ZP0T 1OGAE 5GGRA 4K3DL 4JM4H 15C8L 4WWID 5ADOL 2NY4D 2BJMH 3MA9H 5GISL 1X4ZA 2GT9B 2MKLC 1A9EB 1HH6B 4WV1B 5F7FA 3MRJA 4UQ3A 1UZ6E 4NO0A 1EGJA 4ENED 3MQIA 4Z18A 1WQVT 5KSBB 1CS6A 3L3HA 4Y4FA 2RCSL 5F1SA 3O6LH 2ARJB 5I1GL 1RAMA 1HXYB 2V5RA 1CT8B 2LV4A 2FB4H 2XWTA 5JZ7D 3KJ4C 5F93C 1WFOA 3QPQD 5DMGD 3R0NA 5CCKH 2V7NA 3C5ZD 3I75A 5D2LB 4XXDA 3BW9A 2VDRH 2R2HB 5I17B 3PWUB 5F3BA 4HUXA 4KK5D 3LZFH 2CKBL 4GRLD 4G5ZH 2PO6D 4P3CL 1MI5E 3QEQB 1RZGA 3PQYD 4YHYC 4HV8A 5DEFA 5EB9A 4Z7OE 5BXFA 5LXGH 1U3HA 2XFXB 4G8IB 4GRWE 4RISL 3ELAT 4N90D 2HMID 4PV8B 2OL3B 1DFBL 2HFEB 4POZD 4K8RC 3V79C 3KYOA 1ZHNB 4PJCE 1NSNL 4JFHD 3BIKA 4OIAA 4K23L 1FQ9C 4YHKL 1TZHB 3DBXA 2VXVH 4JDVA 1T21B 4DQOL 1CN4A 3QBTB 4UOJA 4OGXH 4S0SD 3D25B 1BD2E 3HC0A 2F19H 2Y06L 1QEWA 5EO9A 5E6IC 3WV0A 2VKXA 3BPLB 3SDAD 5I76B 4HKBA 4TNWK 2VZSA 4MNHB 1FNEA 1NGYB 1RZJL 5CJXC 1CD1A 2DKUA 1G7IB 1O5DT 2OR9L 4HS3B 5CEZL 4L9LA 4K2UL 1IGCH 3WD5L 3ZDYE 5IVXB 5BZDA 4WV1A 3CFDA 3SKJH 2G9HB 2XTJE 3OXSA 5HI5D 3T0XA 1W0VA 3OF6D 3GJEA 5FYLH 2QLVB 3IF1A 5DQDH 5GRYA 2C4XA 2FRGP 4HUVA 2B1AH 4M43H 5GSRA 3BGFC 2V9TA 3TO4D 1FP5A 3S5LG 4HULB 4D0CA 3QQ9C 3TIEB 4GQ9L 2XY1A 2QSVA 3PGFH 4BSVB 1EHXA 4ELME 3BW9B 3QUML 1QFWH 2BC4A 1CFTB 5FOBA 5IQ9A 4YWGL 3IT8D 4G8EB 2E27L 1YN6B 4J23A 5JHLL 5DS8A 4GW1B 3NIDE 1J11A 4GO6B 4Q9BA 4WNQA 3U6RA 1NUFA 5C2UB 5D2LA 3H42L 1AGEA 2ADJA 4GS7C 1U8IB 4AEIH 1MNUH 3CCHB 3MCKA 4ZNEA 5HHXH 3LPGA 1UM6L 1JYXA 4OB5H 3EFFA 2YD9A 3OB8A 2JJWA 2QHRL 4ZNEE 4NRZB 4ISVB 1B0WA 3GIVB 2EECA 4XCFL 2ICEA 2CKBB 4HK0B 3DVIA 4R4ND 3KPPA 5DJCA 1HILA 2DB8A 3FCTA 4JQVC 4KKCC 3P0VL 2VDML 3V4VL 5K9OB 1AKJA 1YDPA 5DQJA 5ERWB 5IP4A 4GW4B 4UOW1 4QLRA 5H35B 1ACYH 1RUAH 4F9LC 3G5VA 2XA8L 3LN5B 1AI1L 3PWJA 4O02H 5ITBH 3SOBH 3JZ7A 4K3HA 1H5BC 5ANME 3RKPA 3HZYB 1JV5A 2X4SB 4QHKJ 3GNMH 4LHQB 4DVBB 5EBLA 2R15A 3D39E 2Z8WC 4WW2A 3KPSB 2R2CA 5TFSL 3B8YA 4RZCA 4LBEB 1DTUA 1YPZB 4F33A 5FXCH 4U1HB 4UDTB 1JWSB 1CXLA 3AS0A 3HE6B 2OSLA 5CP7B 1OY3B 1XGUB 1DDHA 3W9DB 4GW5A 4E0RB 1YEKH 4QHLA 3VGAB 1IC4L 5LCVL 2XXMB 1NEZB 1WTGT 2VE6A 4H88L 1G7MA 1GGTA 1T7WA 4WEBL 3UPCA 1DE4B 1W72H 1J7VR 3BZFA 4PJ7E 1EEUA 4P46C 4H5SA 3D3VA 3MGTB 3BZDA 1EERB 2DKMA 2PNDA 2YPLA 1ZTXL 4CN6A 1JTPA 1OAXH 2FJHA 5B3JE 5JW5A 1T03L 2FX9L 2I9TB 4MCYB 1YNLH 3QRGH 4HDIA 2A6IA 2BXYA 4JFOB 2BFVL 1NFDB 1SYSA 3PQYE 4ZO6A 2IMMA 4HW6A 3RJQB 3WLWC 3QEQD 2PXYD 3LQAL 4QOKE 3MV9A 2UZYB 3CK0H 4QT5A 1P1ZA 3DUUB 4O2FA 5EOQL 5JW3H 4CU8A 4U2ZA 5TDOA 4WO4B 4X6DA 2OTUA 3MJ7A 3IETB 5C2BL 1HHGA 1JPFB 2X89D 4LFHG 5HJ3B 1AR1D 3NIGE 4EI6A 1BP3B 2Q3AA 4KI5F 1QTYT 3T0EE 1RIVL 4KV5F 3V6OC 4OF0A 3O6FB 1Y0LB 1NGPL 5C0ND 4BZYA 5LBSL 3ULUF 5HHMD 4WHYG 4WFHE 1QOKA 2C1PA 4FQLH 3RGVB 5HHNA 3S97C 5D1ZC 3RA7L 5IFJA 3U4BH 2YD3A 2A6KB 4F57L 1I1FB 5C07B 5CIPB 1M05B 2XN9D 4QF1A 3L7FA 4GQPH 1E4JA 3PL6C 4PJ5A 5A40E 5F7KC 4ZD3L 4WCYL 5EWIH 3GB7A 1FYTE 4L5FH 1S78C 1UENA 2VDNH 4M1DH 4Y5YA 4LCCB 1VA9A 5SX4I 3BRGC 1M4KA 3BYTA 2PETA 2OTUB 3MJ7B 1H3PH 5BW7A 3SKNB 4GRMB 1U0QA 4QRSA 4PJEA 3ROOB 2ADGB 1F4WH 5FO7A 4LHUA 5TDNA 2PTUA 2Y5TA 5C8JB 4P99A 3WLBB 2WIIB 1W72L 3ZHLA 1VFUA 5HHOB 5FHAL 4PGZA 2RAMA 1XCQB 3DETD 3RVWD 4PGCB 4RIRB 5LCVH 5TE4H 2C1OA 3RWGB 3ZT5A 1JRHI 3SCMD 5EFIB 4MCYA 1LDPL 3HR5B 3LKQA 4JR9L 1QFUL 1FL6A 1YNLL 3HKFA 4UTAL 1ZVSA 2D9QB 5I9QC 2OS7A 1EMTL 3KVQA 1MHCB 1KLUA 1RI8A 4APQB 1P4IH 2WIMA 1FFOB 3GGWA 1FG2B 3O2VL 1FZKB 4FG6C 3HZVA 1FDLH 3LHPH 2GCYB 4L9LC 2ZSVB 1CGWA 5GZOC 1DVFB 2IPTL 4PGCA 5C7XH 4OJFH 5GZND 5JHDE 1N8ZB 3G5ZB 4YO0B 4FHBD 4NWUH 5IB1A 1HNFA 5HYJD 4MYWB 4AQOA 4N0CD 2BVTA 4FXGA 4XBGB 5KS9A 4E5XB 2YPVL 2W0LA 1EHLH 3FZUD 5B3JF 2P7TB 4U1SB 4ZFGH 2CO7B 2ESVA 1UKSA 4R9HA 3BKMH 4QOKB 5J7CC 4O58H 4KJYA 5CEYB 5DO2C 4DGYL 1WZKA 4NUJA 1UADC 1WISA 1M05A 1IZJA 3BP4A 3H42H 4JPWL 5I74B 5FGCB 3QRFM 4LSUH 2EE9A 4RGMB 2ICEB 3BSZH 1KB5L 5IBTH 1ZLUK 4WUUA 2DWDA 2FHBA 4OSUL 3V6ZB 4DK3A 4QNPE 1FVCA 2HN7A 1OAXL 2OTWB 2BSTA 4ZAKC 3TYGH 1A7NL 1TJGL 1EA9C 1NAMH 2WAHA 2ADJB 5DQ9B 4C59B 2WSKA 1YMME 2PXYC 5EBMB 4LBEA 3DX6A 1J0HA 5SX5K 4CU7A 1EAJA 1UEMA 3SGEI 2EE2A 1HHGB 1RULL 2ZZUT 3WFCH 3U7WH 5JPMA 4PRAA 2MKWA 1CR9H 3UBXI 4UTAH 1TCRB 1ZA6A 3EAKA 1F13A 1WVZA 4F7PA 3OXRA 5C0EA 4WWKD 4XHJC 3STLA 5AWNL 4NHUB 1AGBB 1LDPH 1NC2D 4ODXA 4F2MA 4W6WB 1KPRB 2AJXL 3MRDB 4WEMB 1AD9A 4BQCA 2XICA 3GSVA 4MLIA 3O2VH 1YDPB 1JZ3A 5I1AA 4PB9H 3EDKA 1RZJC 4S1RL 2LVCA 4M7LL 2MTPA 1OPGL 4PLJC 3FRPA 4P23C 2PN5A 1G9MH 2CDEB 4UIMB 3VFTB 4JDZA 3QG7H 1JWUB 4Q6IB 4HF5H 4ZSOB 2YK1L 3DX8B 3OAYK 2OJEB 3CX2A 3RVTD 4OZIA 3DROB 4KTDH 4ODTH 3K0WA 3QCUH 5HGHA 4JN2A 3CGTA 5IM7B 5L88H 4JKMA 1H3WM 4HXBL 4NNYA 4U1GC 1R5IB 3UTSD 4HPYL 3VE0A 5KSVA 4Q9QL 2VLJB 2P48B 4PLJD 4JFXA 3DXAE 3IJSA 4D0DB 3NIFE 5DYOB 4CJ0A 4S2SA 1HKLL 2ENSA 1KPVA 2D4DA 3N1FC 4X6CF 4NO3A 4LQFH 3MV8B 2QHLA 3SY0A 4IJ3B 1BPVA 4DKEL 4ZXBA 4FFYL 3RX7A 1TNMA 3CVIL 4JPWH 4G3YH 1QRNA 4K55A 3L5WA 4X7FC 3ZTNL 4XCEA 4K7PX 1D9KB 2A0LD 5AZ2H 1CICA 4KJWD 1UB5A 4EUPH 1WFUA 2KZ1B 5DD3H 3SGDH 4LQ1A 3TO4C 4HF5L 4FFVC 2Y72A 4XH2A 1U8JA 4RAUB 2YD7A 4PRDB 4UV7H 5C2BH 1NGQL 3MV8A 4HQQH 5BV7L 3OPZH 3C8KA 2VXQL 4KRPC 1HIML 3OXSB 4HUXB 1PZ5B 2HT3D 1P2CA 4O9HH 1RY7B 2EDDA 4R96B 4U2YA 3KLHD 1RIUH 1QR4A 3QAZC 1DCLA 4YQXL 3GKWH 5BVJB 3WFBL 5I30L 4WI7A 2FR4A 1HQRB 2AI0L 1S7XB 3MCG1 4XPGL 5DLML 1IKNA 3DX8A 3E2HC 1BLNA 4CUCA 3FB7A 5I74C 3FT2B 3BKCH 3RNKA 4KTYA 2H2SD 4KI1A 1MHPL 1HSBB 5FO8B 3TCXA 4GAYB 2H3NB 4K8RH 3UJJH 4CADB 1Q0XL 5JORB 3MRBA 1KXTB 3LIZH 3RHWK 5C71A 3F7YB 1UG9A 4JZNA 2R0KL 2JCCA 5HYJB 3T3MF 3K80A 1I8MA 4PJIF 4I77H 3B9EA 1AQDA 4G6AD 3U9PH 1FE8H 4QRPB 5KSAD 4N8PA 3C2AH 4NSKB 3EW3B 4YX2L 2AI0H 2CKBA 4HK0A 2NX5D 4EI5B 1QFUH 4ESKA 1FYTD 4U6XA 4APQD 1CFNB 1A4JA 1T66C 4M8QA 1JNHB 1LO5B 1TJGH 4LRNL 1B6DA 5CGMA 4HAGA 4OLEA 3O45B 4Z76A 1RJCA 1E27A 1NMAL 2NY3D 2YXMA 3SJVB 3F7VB 5JXED 1FL6B 1CE1H 3B5TA 3V0VA 1KJVA 3HN3A 2GTWA 5FOBB 3DVGA 4TSCH 3IXTB 2O5XH 4FQIH 1KLFA 1O7VA 5DEGB 3A6BL 2VAJA 3PUCA 4JDTH 2FEDD 2UY7A 3LVEA 3CFEB 5FYKU 4MMXC 1SBSL 4KRMB 3T04D 2QR0B 5FV1L 3HRZA 1AH1A 1VPOL 1WBYA 1OL0A 2FL5B 3ZDXE 2CDFB 3JV6A 4PJ8A 4LGPB 3MLWL 5D5MB 3VWKB 2WM0A 1R0AH 4Z8FL 2CIKA 4LCIH 4ZTPL 3TNMA 1ZA3A 1T3FA 4G6FD 4UUJB 5JA9A 3Q6FA 4XXDB 2XN9B 3CZFA 3MV7A 5F6HI 3HPJB 4Z7UE 3VI4E 3EOAB 2QSQA 3FO9A 3BUYA 2BVUA 2OM5A 1OAUL 5IQ7H 1JNJA 1LEKA 3ZHKA 1CR9L 2BNQB 5FYJL 5L2KE 3HLAA 5JA8B 4KRPB 2VDLL 2AXGB 3QDMB 2H41A 1WK0A 1FBIL 2ICWB 4NNPH 3O6FD 4U1NB 4B5EA 1NAML 2ORBH 4BUGA 5HD8D 1WAAA 3RWGA 1Z9OA 4OQ1A 5HDBF 5T1DH 2YZ8A 5HHQA 4X98A 1QSED 1Z0MA 1YPZE 3TYFA 4Y5XA 3RVUD 4X6EB 5BV7C 3KWWB 3W39A 4F58L 1F97A 3G5YA 3INUH 4HWBL 1JZ5A 1JP5A 4YUEH 1QKZL 4Z7WE 5DZLA 4A2MA 4LCYB 2DQTL 3DX9B 1XF4A 2I07A 4AMKL 3SEPA 4OF8A 4QXGH 3L5WB 4JY5L 3UPRA 4WI5A 2NY3B 5J4MA 1EO7A 4NFDA 1D5XB 2VSCA 3C2SA 1NMCB 4P2QD 4RISH 3MRNB 3P73B 4OM1H 3T3ME 4P49A 1MFBL 2XQBH 3WXWH 1EBAA 4O00A 5TE6H 3QIUB 2A1WH 2HLAB 3CFJA 4J3WA 5FGCE 2VXVL 1VGEH 1A6UL 2AGJL 2I60L 1BFOA 2QHRH 3PHOB 3H6JA 2IANE 1F58H 2E7LA 5HJ3A 4EI6B 1FL3A 3LV3B 1KF9B 4NQCD 3NCFB 2P24A 1OAKL 3MSPA 4AG4L 3MROA 3KPMA 3DNKA 3DHMA 4L3ED 2KH2B 4TUKH 3AXLA 3AY4A 5F44A 4GMTH 4B7IA 4QXUL 7FABL 3BEVA 4GSDL 2HVKB 1NFDA 1QBMH 3EDEA 3NAAH 3QUYC 1U8QA 3I84A 3TBTB 2DQDL 4XNZB 1IC5H 1N0LA 4JPKL 2VDKH 3HI1B 3P4NA 3FQXA 3FN0H 3EDFA 4I1NB 4GAJH 4MA7L 3AREB 4K8RD 2NY6D 5IB1B 1DBBL 5T33H 3SDXE 2NX5E 2CRZA 5JQHC 2RFXA 1KB5B 5FGBA 1KLGB 4OGZA 5IB3B 1T7VA 1P7KB 4GRLB 1CXHA 1UQSB 4LSVL 3S8WA 3NTCH 5E2TH 1MCRA 4LF3A 5LAXB 3VFSB 3PL6A 1I7ZA 2YMXL 3ALXA 1GAFH 3RIFF 4I18B 3HHRB 2YSSB 3CNKA 5IB5B 4XMPH 3QIBA 2KQMA 1KB5A 4EUPA 4RMRA 4Z0XB 2WNGA 4HBCH 2VWEE 1TTGA 4OFVA 5CMAA 1RUMH 4LARL 5JIPA 2BCKA 2P8MB 4XCYA 1NQBA 1JRHL 1S8DA 3B5GA 1S7VA 3UTQB 2VAAA 5MENA 1ZXQA 2X4QA 2Z35B 4YH6A 5D4QA 4CMMA 1XH3A 3W0WD 4A2LA 3NBNA 2B4CH 3AXLB 1GC1L 1G7PA 2R1XA 5DRXA 4P4RB 5IV2A 4D9LH 4RGOL 3LEXB 5TPWH 1JPSH 4PFEA 4J4PC 3G5XA 3P4OA 4TVPD 4ZODA 1T1WA 4KH2A 2DS4A 1G84A 1KENL 3WYRA 1TZGH 2IC2A 1R3JB 1S9XB 3MRQB 1D5BA 3O0RL 4NNXA 4YHPA 2X4OB 1A0QH 5E00B 1NLDL 3SDYH 3S36X 1VFMA 1UQSA 3BT2L 3IFPA 2AV7B 1QFWL 4LCCC 3PGCB 4LVNB 4HMCA 4UT6L 1L6XA 4JM2D 2VERN 2FCBA 4F7CB 1A7PL 3WNMA 5IEKA 1U3ZA 2E7HA 1GGUA 4K3JH 1UVQB 3ILQD 4KDTA 3D3VD 1J5OH 3KPLB 1GOFA 1U8PB 3MC0A 4R2GD 4XPHH 4NDMB 4WWKB 5FHBL 1OP9A 2H32H 2Q6WB 3TFKD 2OP4L 4LEXL 1U3HB 2Y36H 5AAWA 1MHPH 5EH1A 3CSYB 2MOVA 4JFFA 5JOPD 4TNVK 4WHTA 3HC3H 4X5XA 1F11A 2YPLB 5MP6L 2OR8A 1VACA 4OZGE 4Z7QE 5B39G 3CDCA 5EU3B 5A2IH 3GBML 4K2UH 5HVFB 1XF3A 5INCB 4HZAA 3C5ZB 1IGML 1RZJH 1X5FA 3BDYH 1ZVHA 4I3GA 2VDPH 5C09B 1CG9B 4F80A 2WWMC 2XT1B 4J7RA 4JREB 2GHWB 3D85B 3VFUA 3OX8A 1U91A 4H8WL 4MXWL 1F3RB 3LS4H 1BVLB 5L2JB 4BQ9A 4PJAB 1ZSDB 2C1PB 2M8XA 1KLGA 1QLFA 4KXZI 3WHXA 1ORQA 5E8DH 5HI3C 2DWEA 4TN9A 1TQBB 1YYLH 4K23H 5D6DC 3G6DH 4WW2B 3EJYD 5EA0H 2F19L 1ERNA 1A1OB 2Y36L 4ONFL 5I8OH 4PY7B 2NY4B 4K94C 1T89A 2DBLH 3LMJH 4I18C 3GMMB 3NZ8B 2X1WL 3WUZA 1LQSR 2H32B 3RKDD 3DV6A 5TE6L 3ZDYF 5D1QD 1XR9B 1F11B 5EU6E 1DLHB 4AENA 4KZEH 5FM5O 2ED7A 2UZIL 1S7QB 1MWAA 4K9EC 4IDJL 2E7LC 3RWJB 4CL7A 3LV3A 1A0QL 4ZFOA 4HS8L 1KPUA 2I9TA 1FGVH 4PJBE 4HH9A 1K3ZA 4R2GB 3RPKA 4NQSB 1F8TH 3OKOA 1HHHB 4OCSH 2A1WL 5SV4A 3ARRA 1D5MB 4MAYB 4ORZC 1D6VL 1PBYA 1QNZH 5CEZD 4QRRE 1C5CL 2F54A 2LFGA 4X4YA 2VXSL 3VG0L 1HSAB 4UU9B 5D1XA 4HC1H 5B4MD 2IH3A 4GQ9H 1QVOB 1CF8H 2BRQA 4MHHI 43C9A 4I4WA 5C0CB 3D39A 4JHZA 1JHKH 3O3DA 1YPZA 1JNLL 4EXPX 5F9WB 3Q6FB 4F33B 1TTFA 2AXHA 5JR1L 4HKZA 2JB5L 4TQEL 4FN0A 1ZOXA 2XA3A 4X8JA 4Z7UB 3FOMB 2IFFL 2Q3ZA 1BBJB 3BGMB 3OTTA 3QWRD 4QHMB 5D1QB 5ICZA 1CGSL 4LASH 4U6VH 1GZPA 3HPLA 4FP8H 2PTTB 4N0CC 5F88A 2AV1B 3OAZH 3PE9A 1WAAF 3QIWA 1Z9LA 5FM4A 3DI3B 4LCWD 3EYQD 3W0WE 3O3UN 4U1MA 4X6EA 5FFLA 4YHKH 2DLTA 2J8OA 3MJ9A 4FQQB 4LCIL 1S7VB 4M7JH 1I8IA 4M62H 2FEEI 4P4KC 3H9ZA 1KJ2H 3KPNB 2VLRE 4QCIA 1HNGA 4APQC 1D6EA 3G6JF 1J05B 1F6LL 3ARFD 2WBWB 1V3KA 2HT2C 3SKMB 1ZLSH 2WUBH 5DUPH 3WKMH 1CDJA 3V6OE 2EZ0D 2WBJD 5KZCB 4G7YL 2YD8A 5E1AB 1CDUA 4RRPA 3WN5C 5ACMA 1YZZA 1OTSD 1MCPL 5ISZA 3V95A 1CK0L 4U49A 3O9WD 4WUUD 1BREA 4GRLC 2GITB 2CQVA 2IAMB 3BWAA 3D1MC 3QULA 4HCRA 3QZWG 1T7XA 4WO4D 4WTXA 1VGEL 3DURA 4BSJA 3BH8B 1H3TA 4JFDE 5DD5H 4TSAH 1NL0H 4RDQF 1IGIL 5ECJE 5I2IA 3SQOH 1NBYB 3UO1H 3PV7A 4G6ML 3GUTB 2KDGA 4NPYB 4MJ2A 2CJUL 2R1YB 3L3KA 1OLZA 1U8OB 3H9HB 4XZUA 1U42A 4FQ1H 1JN6B 3CSGA 5A2LH 1AR2A 3KLAA 1U8PA 1YMMA 4OLWL 4YJZL 1YEEH 5E2WH 5HVHB 1MRCL 4H25A 3S88L 1IGTA 2NPLX 2XIDA 3BN9C 1G6VK 1GOGA 1HYSC 2X4UB 4FNLL 1W8NA 3RWEB 3I6KB 1BM3H 5E8OA 5F96H 4NQCB 1H3XA 2EKSB 5C0BB 1WFTA 2N1KA 1OB1B 2YXFA 4ZUUB 4MJ5B 3WUWB 1IL1B 3HE6D 4LSRH 3MJ9L 1ZKAA 3LKRB 5EU4A 3OKMA 3DROA 3ZSTA 1OAYL 1ZAGA 5DFVD 3SE8L 3IDYB 1ADQH 3BKCL 5MP6H 3GMQA 3P11H 8FABB 3QIUA 4OCXL 4NZRH 1IGFL 5HHVL 3GSOA 4YGVA 4UDUB 1X5KA 1J88A 5DXWA 4XC1L 3TIDA 1I8IB 4NZDA 5GIRA 4K8RL 1XF2B 3U30B 3ZYIA 4S0TD 5EN2A 32C2A 3A6CL 1E4WL 3O3EB 4PLNC 3E6HA 1OT2A 4OV5B 1NGZB 3FONB 3BAEL 4KAQL 5D7JA 1YNKH 2VXUL 1IC5L 2BCKB 2P8MA 2R0LL 3BPCB 3DUSB 3FQNB 2F8OA 3QXDB 4M9PA 3NA9H 3RIAF 1C5CH 2C4FT 2H8PA 2W9DH 1MCQA 1KPVB 2X9YA 3QI9C 3MLVH 4I18A 2R9HC 4JLRA 4M1DL 5A16B 5I0DA 4HKXB 4BZ1H 1T2JA 2XRAL 1KV3A 5IM7A 3B9KA 3HI6L 3UTZB 5DTFB 4X4ZA 2WLZA 1QQDA 1XIWC 4YDJA 1KULA 4L3AA 5C0JA 4C83A 2X1QA 3QQ4B 4FQCH 1YYLL 5JQ6L 1X5AA 1AQKL 3K4ZA 4H20L 3FB5A 4IRSB 1IGJB 5E9DA 3HZMA 2YD1A 4PJGF 3AREA 5B8CA 1SMOA 1FFNB 3TO4B 4JCMA 3QCTL 2WQRA 3C6LC 2ZSWB 1FVEB 2A9NL 3FTGA 4G3YL 4P46B 1I4FB 5GRVL 4XMLL 4L3EB 1F2QA 4F37F 4Y1AE 4TPRL 1AJ7H 2AXFB 1QYGH 4XP5H 3RWCB 1FZOA 3GI8H 1EO5A 1TJIH 5ACZB 1C5BL 1DBJL 3HRZB 3L6FA 1A9BB 4X7SL 3ARPA 5DDHA 3ARSA 1OQOA 3U0WH 1F2XK 4ZQKA 1H8NA 2GW5A 1KG0B 3LKPB 3DV4B 2Z9TA 2GK2A 1IJ9A 3T4AB 5TGBB 4D2NA 4FABL 3D39B 3O3AA 3AROA 5HVHC 3LEYH 2CDGB 3O8XD 4MDIB 1LO3H 4XNUL 3V5KA 5HHME 3GSWA 3I2CL 2CLZA 1N6QH 4KJPD 2BVEA 5JHDB 2IJ0C 5D7IF 2HLAA 4MS8C 4PRIA 1WV7T 2YRLA 2NCMA 4UIMA 3PV6A 5HPMB 5IJVA 4KVNL 4ZPTB 1Z3GH 4Z0BH 1G7LB 2UVEA 3HC4L 2AJXH 1MCCA 3SKUD 5GXBB 2W0PA 2X4TA 1A6UH 4N5EC 4OSUH 1LDSA 4PJDF 2P5WB 1JPGA 2WQ8A 5C0AD 5EORL 5I16A 1IAOA 3PABA 5LG1A 1AGBA 4ODXB 5T3XE 4YR6A 2R2EB 1MVUA 2GSGB 5D5ME 5CD3B 1YC7A 3DSNA 4FG6D 3LMJL 1NGPH 4RWHA 5J1AA 4PJ8D 1A7NH 2F15A 4Y16D 4WENB 1KCRL 3DX6B 1DVFA 5D96B 5I1KH 1IEAA 3N06B 5F9DC 4NO0D 5IW3A 1MCEA 3MJ6A 4U1IB 4LAQH 1IGYB 1WT5C 4YDIH 2HFGH 4DZ8A 2EDWA 2AJ3A 3CFBB 1H5BB 4XNMA 5CJQL 4ODUA 3FQUA 4MXWH 5D1XD 4V2BA 3KPOA 1MHCA 5DJ6B 1S7RA 5GJTL 5HHNB 1OVZA 1NBZB 4JFPB 1EEYA 4C56D 5C09A 4YXHL 4YX2H 4WTWA 1JIBA 2XNAA 1BZQK 4GRLA 1T5XB 2MPAL 1C7SA 4JFED 1IZKA 3QCUL 1I8KB 4NM4H 2Y07H 3HUJF 5FUOL 2Q76B 1TNNA 5KSUA 1AR1C 1ZHKB 4ZO9A 5C08B 1GC1C 4O2EB 1BZ9A 5KJRL 2GK0B 3FQWA 1OF2B 4LCWA 1X5ZA 1MCSA 4P5KA 1A3LH 3QHTC 5LWYL 2JB5H 2YA0A 1TETL 3CFEA 5JW3L 3UTQA 5DD1L 1RFDH 5CJXA 3SO5A 1OM3H 1I8KA 2H2SC 1CTOA 1OP5H 4XCYB 2R29L 4XGZA 3GKZA 2HKHL 1A47A 3X3FL 2ITCA 1OSPL 2HFFA 3QIWC 4PRHE 5ID1A 5LJYH 1NCWL 2IPUG 2J8UA 3GJFB 3UBXG 1ZLVH 3LPFA 5JW4N 1OGAB 5IQ7L 5IGXH 3MRCB 1EEYB 4GXVH 3FT3B 3RGVA 4P2OC 4Z7UF 1WITA 3BDBA 1IM3A 1RV6X 3EYSH 5ALBL 5DI8B 4U1HA 2ZUVA 2R56L 4MJID 3RNQB 2FYYA 1AD0B 2VC2L 3RVXC 4MD0A 4WI2A 4HD9A 4JPIA 2DQFA 1M7XA 3SDDD 3EOBA 4UAOB 5ITFA 2HYMA 5HYQB 5IFHL 3TN0A 3GZKA 1MPAL 3Q5OA 3ESVF 4N0YH 4HUUA 4HXAH 2X10A 3T65A 2YUZA 1XF4B 2JKXA 1V7MH 4NN5B 1FVEA 1FGNH 3MRGB 5D7KE 2HG5B 1K5NB 1MRDH 5C0EB 3KPMB 4GAGL 1E4XL 4NJ9L 2OTPA 1OLLA 4Y4KB 4JY4A 3FB5B 3VWJD 5D70H 4BFIA 4RX4A 1DEDA 5IFAL 4HUMB 4OD1L 5ALCL 2W91A 3RWFA 4EN3C 3EDDA 1HE7A 1GOHA 5DK0B 2OXGA 2NNAA 3V6OA 3QWOA 3IKKA 1HOCA 3MRCA 2YRPA 4YBQC 3U82B 3Q3GB 4KKAD 2R29H 1QD0A 1N6VA 3C8DA 1ZLVK 1FV1A 1XIWB 2WBJB 3UYOD 4XPAL 5KVGH 1B9ZA 1PG7L 3VXSD 1MHEB 4UINL 1NJ9A 1K8DB 3N0PB 4PRNA 3EBAA 2IQ9L 3MA7B 3EZ8A 4DEPC 4LAJH 5D7SH 2DLGA 4IEFB 2ZUSA 3RTQC 4N8VG 3X3GL 4MB4A 1E4KA 4M7LH 5J6GB 1D9KA 4ONHB 5IW6B 1PG7W 4I0CC 1MAMH 1T20A 4YDLB 4OI8A 4KMLB 5EZOL 5JXEC 3ZYJA 4P46A 2XKUA 2BNQE 3Q5TA 4U3XA 2DQFB 1XGRA 2HJLB 3O4LA 3RNQA 1SBSH 4LGRB 4OFKA 4I2XE 4WW1B 1UWGL 1NEZA 2VE6B 3VA6A 5LXGL 2IGFH 1FNEB 1LO4L 1JGDB 4P3DB 3S6CA 1DN0B 2A74A 4OGAC 1DBAL 4UT9L 3TZVA 1NMBL 3QAZB 3P73A 3EFDL 3G6AB 3OAUL 5FGRA 2BVPB 3QNXA 1ACYL 2IBZY 5KTEL 5FM8A 2EDYA 5DHXB 2YUWA 4RAVA 3IRZA 3ULVC 1PZUB 3SCMB 1YEHL 4PJHA 4CDGC 4NN7B 3WUWG 2AJVH 2J4WH 2D9CA 3HB3C 3NA9L 1X6LA 3MLSH 2W9DL 3DETC 3HUJB 5H8DA 2R0LH 1BZ9B 2FHFA 1RUKH 3MYZA 4NO5B 4PB9L 5FO9B 4CMHB 3QUMA 1RHHB 4L1DA 4PJIA 3HI6H 3AM8A 5IG7B 3O8XA 4F9PC 1HHKA 3FJTA 4BKLA 1U95A 2V2TB 3MRPB 4OZHA 3RL2A 3ALWA 4LSPL 1ZLUH 2W65B 1REIA 5I75C 4HWEL 3MRLB 4BJLA 3DTXA 2AABH 3O6KH 3BH9B 4HGWB 2RQ8A 2A2QT 4R8WL 3GFUA 4NP4H 4G42B 5EUOB 3L7EB 1WSST 3MV9E 1YN6A 5BS0E 4OKVA 3BEWA 2Z31B 2DLFH 1GGBL 4ZPVA 3T4AA 3SDAC 4WTZG 5BS0A 1BIIA 3UAJD 5J57B 3QUMB 3X3FH 1IFHH 1QZ1A 1H3VA 4NC2B 1KEMH 5GGVL 2NXZD 1Z3GL 1SY6H 2X40A 3HUJA 2H2PC 2EC9U 5FB8A 4KU1A 3RZCB 4NPYA 1GCFA 1K4DB 1ZLWH 4OUOA 2AXJA 5DJDA 1DVFD 3WCYA 5E08L 3OJDA 3V5HA 1HK6A 3BH8A 2HTKC 4NUGL 2EEBA 3DX7B 2X1PA 4RRPG 5I2IB 3IXTA 1UWXK 4GSDH 3SY0B 4L3CA 2PF6A 2H2PD 1A14H 3MV11 1FCCA 5HPMA 1OGTB 2FZ3A 1O0VA 2H9GB 4QYOB 5IFHH 3HFML 4JFXB 4JO2L 4D0DA 5D2NC 2ARJA 3ZE1E 4PV9A 5A1AA 4LAQL 1JZ6A 5E24E 4PJHE 1H3GA 4O02L 5EUKB 3LY6A 5ITBL 3ZZ1A 4DKFH 1AC6A 4JN2B 4NQEE 4QHLB 3F5WA 3P4MB 1EH9A 3OKOB 3WS3A 4KVNH 3PDOA 2F53B 2Q86B 2IG2L 3O8XB 1BQUA 5HHXL 3ARGC 5AZ2L 1JWSA 3C6LD 3D39D 5AZEH 3E3QC 3IKCB 1MHHA 3MRRA 5IBLC 3K8KA 4YHNA 4WO4C 1KBGL 2VKWA 3INUL 1CDBA 1X4XA 4Y5XC 1WWAX 5CD5C 1LK2B 3SDCC 2BFVH 3LKOA 2J8UE 3HNSH 1M7IA 3ZL4H 2IPTH 1MY7A 3F7YA 1AHWB 3HE7C 3I85A 1BFTA 4PJHF 5K9JH 1CU4L 2VLME 3FQRB 4GW4A 4EVNA 2DQCL 2VNCA 3V4UH 5CJBA 2PUQT 3ARTA 5GIRB 3BGMA 1BBJA 2EEDA 2WINA 4NKDB 4XX1G 4ZSOE 4XCCH 3QRGL 4MDJB 4ZDHA 4BSWB 3HS0A 43CAB 1I1YB 3X13A 4YAQA 3IDYC 1QSFA 3RGVD 5F6HJ 4D9RE 1KNOA 4HGKC 1ITCA 1CE6B 2HKHH 5EBWB 3QUMH 5HHMB 2GFBA 5DSCB 1WTLA 1AIFB 3FFDB 2FR4B 1MCHA 1IBGH 3KYKH 4R0LB 3UTOA 1TJHH 2Q7NA 4QWWC 3O9WC 1YECH 5FUCE 4B50A 2ZCLH 3VFOA 4NGHL 1TPXC 1A3LL 3T0ED 4NO5A 4WO4A 4X6DB 1KIRB 3ARVA 5F72S 4DZBA 2IANB 4BFBD 1ZEAL 3EYOA 4L3EE 5H37G 3DWTA 4OCWH 4K7PY 2X7LA 1JZ2A 3CVHA 2NY0D 3C60A 4X6CE 3WIIH 4O58L 1QLRB 4K7PL 1FIGL 1EJ6A 3VRJB 2G75B 1P84J 3OB0H 5EN2B 1MCNA 1CL7I 3NVQA 3TN0B 4LKCA 4M3JA 5I9QB 1A02N 3D0LA 4LVOC 2XN9E 3MRIB 3NFSH 4XCFH 4EDWL 5C08A 1T1XA 2B39A 4XNXL 1I85A 5LGKA 4JCLA 5FF6A 3GMMA 3QPXH 1KN4H 3MLUH 2P5ED 4NBXB 5AAMA 2H45A 3ARBA 2YPKB 2NLJB 3C9NA 5JHDD 3AU1A 4JJ5B 3VXNB 2C3GA 3D2UD 2IGFL 5FYLD 5H2BB 4NNYB 5FKPB 4L9LB 2R9HD 4L4TB 1UXSB 4CW1B 2VDRL 3A6OA 3WJJA 3HE6A 2VO5A 2X4PB 4ZFFB 1W2KT 2C26A 3EO9H 3PP3K 4RSVA 1PY9A 1BFVL 1KJ2L 4XC3H 3VXSA 3DGCR 4PJ7A 5IMKA 3D2UB 4PJAE 4MXQC 2X4UA 4NRXA 4ERSH 5I1DA 3FFCA 1H8SA 4Z7OF 3F62A 5FA3B 3NFSL 1PGRB 5I1LA 5HI3D 4L4VB 3Q5YA 2RIKA 3EHBD 3STBA 4KXZH 1EEZB 4UINH 4LHUB 1S7TA 2YD6A 3T1FB 2GAZA 1UA6L 4IRSD 2HJKB 2HAZA 5I16B 3S88H 4WEUD 2LTQC 4XP1L 3V7AE 3T4YB 3NCCB 4XWOD 4LSPH 1MFEL 3MCLL 4KY1L 1CVSC 5BRZA 3MLXL 2PYFA 2XKNA 1QSEB 1XGTA 1SJXA 2NY3C 5I19L 3IAQA 3UDWC 4LF3B 5LAXA 5EOCL 2BSSB 1R3JA 1S9XA 1WWCA 5L9DH 2IALB 1MVFA 4Y4KA 4R4BB 1MSPA 3L3GB 5CINL 3PWLA 5D72L 3ARFB 4XPGH 3RBSA 1XZ0B 3EGSA 3KJ4B 2MCG1 5IKCB 4OZIE 4OGXL 3Q0HA 3QHZH 3SDXA 4IHOA 3QFJD 3DVNB 3C5SB 3ES6A 2YKLH 3MZTA 3QG6A 3D69A 4LCUB 4WY7L 3RY6C 4KI5C 1UACL 5FKAB 1F6FB 5GSRB 4B0MM 3T3PF 3Q1SL 5GSVB 2QL1A 5DJ2A 1AO7A 1IRAY 2WANA 3TM6A 1INEL 2NY5H 4LCWB 3DUUA 1LNUA 2MQ3A 3ULUL 1UCBH 4F57H 3OAZK 1LO2L 5K9QG 3KDMA 1ETZA 2GYSA 4PD4K 4YHYB 5INDB 4KKBC 1GIGL 3RY4A 1IQDB 4RGNB 2OI9C 2R23B 1GZQA 4NRXB 1UM6H 3P9MB 3F58L 1YUHA 3ZE2F 1GGIH 1PSKH 2EDQA 5CIPA 1QFOA 3LN4B 4HKJB 4MWFB 2EDOA 4V1DA 4P57A 3VFMA 2R1WA 5MHSE 3FT4B 5TJWK 3VMOA 5JXEA 3QUZA 3BKYH 4ODUB 1NMAH 3GRWA 2BOBB 5AYUL 5IOPB 1RSFA 2ITCB 3PGFL 4JFYA 1BQHB 2E8ZA 4BYHA 1U41A 2PO6A 3GDBA 4LKCB 4AEEA 1JI1A 3RI5K 1DQJB 3FB6B 1ZLWK 3EO0A 1G6RB 2JK5A 1MRFL 5FF6B 2EKJA 4X5LA 3K8LA 4HIXH 1CLOH 3MXVL 2Z93A 5D6CB 5HXMA 3IJYA 4XP1H 1LILA 4QRSB 1BD2A 1JVKA 1P4IL 4NN6B 3VXOB 1R5VA 2NXYB 4DZBB 4OQTH 1MLBB 4Y5YB 1WBXA 3VXMD 1QA9A 4X9IA 5FKAA 3OR6B 5FA3A 3CVHB 5FAAA 4A6YL 1S5IH 3DYMA 4NM8H 5I19H 5DMGC 3EO0B 3M8OH 1JK8B 2GKIA 3IFNH 2XNAB 3A67H 4OZ4A 5DVKA 4OGAD 2P5EE 4JO1H 4P2OB 3SBWA 4N0UA 4NKMB 4KKNA 2DIBA 3Q6GL 1T5WB 3PWLB 1F02I 1QLEL 3BZFB 4L29B 4M6OL 1J8HA 2Z31D 3PWPB 5DJZB 5IBUB 4NRZA 1E4XH 3LDBC 1OWWA 5KSBA 3S4SB 3TC9A 3VXUE 3LKSA 4R8WH 4QEGA 3GEWB 5BMFL 4GKNA 4XPBH 2OSLB 4X80H 4RMWA 3NPZB 1F5WA 2YPKA 2FGWH 5E2UL 1R3LA 4YNYB 3QUKB 1N59A 3RVUC 4OT1L 4TUJA 3NFPA 5CSGA 3MFFB 4RQQA 5JDSB 4RFOH 4OQTA 3ZKNC 2VIRA 3RPIB 2PR4L 4P3WA 5ICYA 2OR7A 4DJMA 3TJHC 3PWJB 3JV6B 2CDFA 3WNPA 4KWUA 2KUTA 1X5XA 5D9SB 4QY8B 2CGRL 4YHLL 3E6FA 1CQKA 3VRIB 1JI2A 1MCLA 4YHNB 3S7GA 4TTDD 2ZOKB 4Y8DC 1FGNL 3RZWA 1U3HD 4JFOA 1U8MA 2YUVA 2Y6SC 4Z7NE 1O7SA 2R2BB 3QB7C 3ARDA 3W39B 1SJHA 2FO4B 5K33A 1NANH 25C8L 3QEHB 3ZDXF 1UM5L 5E94A 1B0GA 4U1GB 4XBPA 3U2SB 4JFYB 3IJHA 4JRXE 3DECA 4AIZB 5JIHA 2FX7H 4PREA 5GGQH 3U0TA 3MXVH 3IFPB 4RGNC 2XZQH 5HGDA 4HZLB 5EO0A 3LKRA 5ISZB 2DTMH 5C09E 1WCBB 2CUHA 2ZUWA 4Y5VC 4L3CB 3EOAA 2XKNB 3WSQH 4X7EC 3QI9D 4UI2A 4X7SH 1OGTA 5JMRA 4TUOB 4RMVA 1BVKB 1QKZH 3QUXC 4M5YL 1I3RA 2YHGA 5L2KB 4ORGB 5EBGA 3HZKB 2J1KA 2J88L 4RGND 4GUPA 5FDWA 1UB6B 4NOBA 3D9AL 1X4YA 4K9EL 3FL7A 1LO3L 4YPGB 1TVBB 4X7TB 3VWKA 1QSFE 1M7DB 1LE5B 3QIWB 1NLBH 4G8IA 3DVNA 2BNUA 3RZCA 1WBYB 2DD8L 4YE4L 2YS4A 4ZS6D 5K9KA 5B8CB 2DJ4A 2NW2B 4I0PA 4EBQH 2BY1A 4HFUL 4ZUVB 3QYCA 3ZTJH 2EH7H 1V7NL 4N8CL 3SJVA 1NC4B 3EOTL 1IILE 3T8XA 4FS0A 3I75B 4RFOL 1GHFH 4P5TB 5FUCC 4YEEA 1A6WH 3DIFB 4DUWA 4O51B 2H26B 3KPQA 2R4RL 4ZD3H 4KUZL 1P9MC 2X09A 1A7QH 4NCC2 1SJEB 2EKSA 5C0BA 1NAMB 2NY1B 2YR3A 2BNRE 2SEBB 4ONGL 1EUTA 1JPTL 3NCBB 5C0GA 3FO1A 3RJDA 3BVNA 1R6VA 2DDQL 4TULL 1WC7B 2ADIB 1WIOA 3L3IA 3PDDA 1ZGLA 1INDH 4ZTOH 4PRDA 2Q87A 2BSRB 1CYGA 3IB4A 3FN9A 1JZ8A 5E2JA 4YIQB 3C6SA 4QOKD 4NKIL 2LQRA 3ARGA 5A2FA 3H9HA 4XZUB 2O5YH 1I3UA 3V6FA 5FB8B 4JZOB 4S10A 4FFWC 4QHKI 3VXME 3IFLL 4NKOB 2NW3A 3TZVC 4R90H 2HRPH 3QXTA 3ZDZE 3P0YH 1QRNE 1MHHB 1UT9A 4PYGA 4LSQL 1NEZG 3FB7B 5I8KH 5F89B 2V7HB 1S9KC 4K7FA 1BJ1H 4MJIB 2JE8A 3BD3A 2EYTB 1BZ7A 5FEBA 2WP3T 3ECBB 3N9GH 5TQ2L 4QTIL 4OCMC 5I18L 4KGJA 1ADQA 4AMKH 1Q0YL 2B20A 1RULH 5E9DE 3WFCL 2F54B 5D2NE 2OJEA 2K7PA 1UKTA 4OQTL 3SKMA 1MCOH 2OZ4L 1ZT7A 1P69B 4PJ5D 1PLGL 5F70A 3PIQA 4ZUVA 2GJ6E 4LASL 5LGJA 1I9JL 3IFOB 2W60A 4LIQL 4P4KD 5IVOA 1RU9H 2O5ZH 3B9AA 1M6OA 3MLRH 1QPPA 1DQLL 4G8GA 3GSVB 4XPHL 4CRPA 1N6UA 3FB8A 1CGYA 4Z7VA 1S7QA 2D0GA 5E95B 1C5BH 3RPIA 3A6BH 1SJVA 1TXKA 5GGRY 3NZ8A 4PJCF 1XIWA 4YXLH 4RAVB 4E41A 1WZMA 4U0QB 1R3LB 4G8GB 1A7QL 3D0VB 4PRNB 3P77B 3MREA 1RK0A 5DURB 3VFGL 4ZPVB 3QHFH 1EO8H 3O3BA 2PW2A 1R5IA 4FXLA 4Y5YC 5CKGA 5J9PB 4JY6B 5C70A 4LFHD 3C8HA 1QPXA 3OL2A 4LQFL 5D72H 4J2XA 1C5DB 3SQBA 3RUGB 3O6FC 2CGRH 3NIFF 4MNQB 1ULVA 3IDGA 5BOPA 1JHTB 1D6EB 3B9DA 3HS0B 3HC4H 1D5BB 3MO1B 2HLFD 2JJSC 1CL7L 1HH6A 2Y6SD 3LS5H 5JOEA 2OK0H 1NCCL 5I1HH 2DBLL 4NP4L 4G6FB 3NTCL 3KDMB 1U8KA 2EYRB 3EYFA 2LAAA 2NYYC 5T3XD 4Y16B 3VXMA 4PJ8B 3CFKA 2NY7H 3BZEB 1UH4A 4QHUA 4JE4B 1KJ2B 4AH2A 4WJ5B 4LLYA 1N5YL 4LRIC 4H8WH 4X9HA 5T5NF 4W4OC 1Q9OB 5FECA 1QP1A 3EOBB 4O2CA 3D3VE 2VR9A 1J8HD 1TVHA 1UJ3A 2Z31A 1A5FH 5IOPA 2HN7B 2YWZA 3TBYA 1LVEA 4WI4A 1IEBA 5DRNA 1YY8A 2J4WL 4PY8J 5F7YC 5T33L 1UH2A 5L8KB 2HJFB 2D0HA 3O6KL 4LHUG 3VMPA 4DK6A 5KVMC 3ZYZA 1PY4A 4EDXA 2JIXA 3RWDA 2AP2A 2YA2A 1BQLH 4JM2F 4QWWD 4GG6F 1LWRA 1RMFH 2F5AH 2VISB 4XVSH 3ZE1F 3PQYA 4CNIB 1I9RH 2DTSA 4KZEL 3TJEL 3VFVA 4YDVA 1J5OL 2CRYA 1QBBA 5MI0B 5CEYA 4NKQB 2NW2A 4MXVF 4X6BB 2VLKB 3T0EC 1A6PA 3DGGA 4WFGD 1DLHA 4S11A 1MH5A 1XH3B 5AZEL 4J12A 2Z92A 3BIAX 1G0XA 3BT2H 4L4VA 5C0RL 2VQ1B 4E5XA 4KKBD 1DQJA 3WFEL 4I0KA 2CIIA 4TSBH 3FFCB 1T5XA 1A21A 1FFPA 1GPOH 2EIZA 2V9QA 1EZVX 2VITA 3V0WL 2VXTH 4X4XA 4ZFZB 4X9GA 4GG8B 4EN3A 1EK3A 1FZKA 1I9IH 4LU5L 3MNVA 3CDGA 4P9ML 4LK4A 4Z7WA 2AV7A 2NY2B 4JQIL 5FA4B 2BMKA 1UM4L 1BVLA 5L2JA 5DYOA 4HJGB 4J4PD 1QSFD 5HI4C 1RMFL 2O93L 5EU6D 4YFDB 3D85A 3VFUB 2P8PA 5B38B 3GSQA 2O5ZL 5ENWA 5ABDE 1C16A 5JOPE 4F37K 4PY8I 5GS1B 3HG1A 2GUOB 2ATKA 5EZJA 5JOFB 3BHBA 3ZTNH 1T66D 3LQZB 3OMZA 3H3KA 1UJ3B 1AHWC 3HE7B 4L8DB 3TVMC 5F1IB 4H1LA 5FGSA 5E4EB 4XAWH 3T0EA 2C1OB 3C2AL 4GAFB 1OP3H 4KHTH 3NACH 4B7LA 1DL7H 3C5JB 2APTA 5CBEB 3DMMB 4AYFA 5CLTA 2ZCLL 5CSZB 3CJJA 3G6JB 1HEZA 4KI5E 1IMHC 1UB5B 4R2GC 1DQQA 3CC5A 1MFAH 4WWKA 1GAFL 3C60B 4QY8A 3VDAA 3WIFB 3U7AA 4M6AA 2VLRB 1I1AD 1QRNB 3EYFB 1MCOL 4X6FB 5BOZG 3QXWA 5FDYA 3SJVD 1Q38A 4BQBA 4HUWB 4DFIA 4U6HB 1YEEL 5HGAB 1AE6L 3QUKA 2EE3A 5HHOD 2JIXB 1LP9F 3RWDB 1T0NA 1CLCA 4PRIB 1HH9A 2GUOA 3QUXA 1RK1A 2VLJD 5BRZB 1WEJL 3GK8H 3B6SB 4J3OC 1F90L 5IWLA 4N9GB 3FN3A 3DV4A 4WWKC 3HNVL 1AGDA 4XMKH 5GPRA 1JNNL 3JWDH 3PJSA 3NACL 3GMLB 1NGQH 3QDHA 4GG8A 4MDJA 4HIHA 3VXRB 3MNVB 4PGBA 4U1IA 3MOAL 1S9YB 1V7ML 1VFBA 1J0IA 4BFGA 1VGKA 2CUMA 1FFPB 3REVA 4JAMA 4E41B 2WWKT 3NOIA 4PJFF 2VXTL 3MUGA 1DQTA 4UIKH 3VFRA 4KRNA 3KS0J 3KLHC 3CD4A 3PHQA 1BVZA 4OZIF 1A1MB 4ODSL 4F2MB 2R2EA 4WUUE 3SGKA 4DKFL 1DR9A 1RUPL 5DZOA 5MI0C 4JGMA 1FNSH 3W5NA 1DBAH 4UT9H 1VFBB 1N0XH 2YD5A 3CK0L 2Y7QA 1AGFA 5IT2L 4LPVA 4DCQB 2EIBA 2ATPB 5ESVA 4H0GA 2PO6B 5T5FH 1DUZA 1YEJL 3PP4H 3B9KD 3L95A 3V4PH 1CBVH 1D5IH 1UWXH 2P45B 4MAUH 5IGXL 3I3DA 1EFQA 1A6VH 5HHVH 1UXWA 4PJ9B 2NR6C 5DJ6A 2GJ6A 4V1DB 4PJXF 3VFMB 1BF2A 1AGFB 4F7TB 4JRYA 3ULSA 2DQCH 5T1KA 4HUWA 3BN3B 4MA1C 5GZNC 1TVHB 2D7QA 2DQGH 2DQDH 4YLQT 4NN6C 4ETYA 3UJJL 3GSRA 1ZT4B 1E28B 1U3JA 4MD5A 4U1KB 3E6HB 5HYSB 5J1AB 2Y5TB 3REVB 4JZNB 3MROB 5HYQA 2VLKA 3FRUA 3TT1H 3MV7E 5ESQA 1XF2A 4IHOB 1QFHA 5BZDB 5ANMA 3BHBB 4JFDD 2IBBA 2GTWB 1G0DA 3I02A 3ZYOA 1WIPA 3VG9C 3SHSA 2DM7A 1WF5A 2D3VA 4G6JL 1HIMH 3N50A 1KXVC 3CSPA 1N4XL 3ECBA 1G7QA 4XXCA 1XT5A 1DBKL 5GJSH 2CXKA 4M1CD 2AJ3B 3CFBA 1OD9A 5DZNA 4MVBC 3WFEH 4Z0BL 4YXKH 2X6MA 2CLRA 1FIGH 1A7OL 1FO0H 4F9LA 4XVJL 3BKJL 1EVUA 1F8TL 3JV5A 5EWIL 4P59L 4JKWA 5I0ZA 4GLRH 5GRUH 3T2QA 5ELIA 1RJLA 1FSKC 4LEOB 5DJ8A 3IS0X 3RQ3A 5CUSL 3B2UD 1KN4L 3MLUL 3RWCA 2ADFH 3KLAB 4EQ2A 1MIEL 5T3ZD 4GXUM 3ISWA 4X7TA 4PR5A 1CICB 4FABH 5DGQA 4EXKA 1U8OA 1JZ7A 2J6EH 3IKCA 3LH2H 4P2QA 3IAPA 2GQHA 4ZG1A 3TIDB 3HE7D 4DN3H 5IVXA 5D7LE 1WC7A 2EDNA 3MYJA 3QUYB 2V7NB 3RY6A 5EZJB 2B1HH 2RR3A 1IEHA 4Y5VB 3OR7B 3BN9D 4G7VH 4RNRA 1G7QB 3ZMRA 5EOTA 1X5JA 5HPOA 3G04B 3BO8A 3LB6D 2V9RA 2D2OA 3DRTA 4CVXB 1J0KA 4FRWA 3JWOL 4HKBB 2P43B 1QBLH 4HMEA 3R8QA 5M7QA 5DTFA 3TBYB 5HGDB 1T2QH 4WW1A 3WSQL 1K6QL 3PWPD 3HB3D 2IH1B 1CU4H 4YXHH 4QXTB 3IVKA 1V3LA 1Q9OA 5FECB 3BMVA 1A22B 1RZKH 3C9NB 3BIKB 3D0VA 3TV3L 1OD7A 4KK5C 5L7XH 1ZTXH 4Z95H 5AUMB 1T21A 3FQNA 3NCMA 2HH0H 1M71B 4IS6B 1KFAH 5E99L 3S3PA 4ONHA 3P30L 1KCKA 4Z7VB 3C6SB 1NAKL 1JMXA 1FN4A 3STLB 3O2DH 3KPRE 2CLRB 4P9HH 2VZ3A 3BX7C 3TBWA 5DMKB 4NRYB 5D1XC 4WI3A 4F7TA 1C08B 1QRKA 2R2HA 3W2DL 4MSWA 3JBG7 4S2SB 2YN3A 4CDHA 1F3JA 3KPRB 4WY7H 3VW3H 3GIVA 5C0NC 5CILH 4KK6D 3BKJH 5D2LE 5B39A 1NGWB 4FQXA 1FVCB 1NCUA 4RBPH 4TSCL 4H0IA 3ARDC 4XI5C 4JFZH 4BKLB 4OZIB 1RJZA 4J3TA 1VKXB 1DFBH 3QIUC 3BPOC 3VRLE 4YBLC 3AVEA 1LO2H 2DKSA 3LKPA 1NBVH 2BHZA 3HMWH 4OLXL 1G9MC 3AAZA 2Y1VA 3FFCE 4PLKC 4GRWF 3FRUB 4ZDHB 4BSWA 2PYEA 3NCYP 4R0LC 3KPSD 4KROC 4NRYA 3K4AA 5IQ9B 5E5MB 5L8JB 4H25B 4XNQB 4RGOH 2VUOA 3MJ9H 2VLJE 1NKOA 1I3GH 5EU7C 1YA5A 2ZKHH 3AS2A 1RU9L 2DYPA 3V6BR 1AHWA 2WWKO 1EGJL 5F21B 2OMBA 2HMIC 3LEVH 4L1HA 3HZKA 5F7EL 1ZVYA 1UB6A 4LPXA 5TDPA 3NFPB 1I1RA 4DUXA 4LIQE 5LGJB 4GG6A 3FQTA 2IQAB 4I4WB 5C0CA 1U92B 1RJZB 4L4VE 3UTSA 2W0FA 4FOMA 2W59A 2VTFA 1Q9LA 5EU4B 1BOYA 1KLUB 1NFIA 2YN5A 4NNPL 4AL8H 3OKYA 4KJPC 4ZUUA 3LD8C 4M93B 4MAYA 4JY4B 5CS7A 1YEFL 3MUY1 5T5NG 4N0UB 4NKMA 4KHTL 3PWVB 2X9XA 1FL5A 1KTKE 2DICA 3D18B 4PS4H 4XPAH 5KVGL 2VOTA 4V1DE 5EFIA 3ET9F 4RAUA 4KPHL 4BZ1L 12E8H 5EIVA 5I15H 3TIEA 3NIGF 5KAQF 3VW3L 1VACB 3EYUL 5CBEA 4UV4H 3KPLA 3OHXA 3LRGA 4YPGA 2Z93B 2J5LC 4G9FD 1ZGLB 4C4KO 2A77L 2Q76A 5GRXG 1MCFA 4RDQG 5CGYD 4JEGB 2EH8H 1CK0H 5BMFH 1OCWH 4PJ5B 2VDMH 4N9GA 2FEEL 3CLFH 2CLVA 4ZAKB 2ZUTA 1VEPA 4HUNB 3QULB 4X6CB 43C9B 3S4SA 1CDCA 3PF2A 3EDJA 4Y0GA 1LP9B 3QWQB 3WUWA 2VLLA 4RAHA 1BFSA 3VG9B 1G7JA 3PWPE 4X4MA 5I8CA 4LRIA 1R3HB 3M8OL 4ZAKD 4XP4L 1YUHB 4JGJA 4M7ZC 5C3TA 5TQ2H 1U58B 4NQDA 5EUOF 5INCA 4M5ZL 3LEYL 2QADB 4P2QB 4BZ2L 4JO4H 3FKUS 1GL4B 1HHIB 1FCGA 4AJ0A 1JN6A 3E6FB 1TPXB 4I9WE 4PBWD 1I1AC 2JJSA 3D69B 1SYVA 1N5AA 1YY9C 4U1KA 3DYPA 1L9MA 3FO0L 1G6RA 4OZGA 5CEXA 1XZ0A 3EGSB 5IB5A 1RZKC 4PP2A 2X4RA 1J12A 2I27N 3AB0B 2DF3A 1A6AB 2F54E 3SBWC 4PTUA 5I8KL 1LEIA 2Y06H 1E0OB 4RMQA 4G6MH 4N0FA 2VLLB 1JHKL 4WUUB 5EO0B 4GXUN 2VXQH 3QUZB 4U6YA 1YY8B 4OIIL 3LZFL 2VQUA 4X5WA 3GSWB 4N8VA 2WW8A 4LLVA 4HKJA 2KQNA 4XT1C 5EU5B 1UWEH 4PGJA 4N0RA 1OTUD 1KIQB 1VSCA 2BNQD 5IIEB 4WGVB 5DFVC 2ZKHL 2V2WB 4YDLC 1Z5LB 3ARBB 4I8DA 5GJSL 3ARXA 4DW2H 1CWVA 4LLUB 2A6DA 3QO0A 1GHFL 4U1MB 5MEPA 4Q2ZB 4CVUA 4PJAF 5ID0A 5CD3A 1MI5B 3QEQE 4WU7B 3EYVA 3GMNA 1EHNA 4RFNB 4JFFB 2HVKA 4IDLA 3FOMA 1KIPA 3GSRB 4LIQH 1N59B 3EYOB 5GGVY 5SWSB 1XEDA 2Z91A 4DKDC 2WZPD 3PNWA 5MEOA 2GCYA 2ZJSH 1NH6A 3VXSE 1F00I 5I8CB 4H5SB 5IEKB 3ABZA 4LHJB 3GJFH 1L6ZA 2DI8A 35C8H 3H8NA 1KCRH 4P23A 1A3RH 5ISZD 3W11C 1HYSD 3FO2A 2QSCL 1J1XH 4HWUA 4IBLT 1BFOB 4ZS6C 1KYOJ 2R1WB 3LQMA 2N7AA 1UXSA 4ALAL 4DZ8B 5GRZA 4N0FB 3WMSA 2YOCA 4O2CB 4OKDA 3KPRD 2ORBL 4EOWL 3SCMC 1KTRL 1QSEA 5CEXB 1W8OA 4N68A 1EV2E 1JGUL 4LSTL 2IF7A 5D1ZB 3OGCB 3C60C 3UTTD 1R24B 4XAWL 5GHWH 1B90A 5F6IC 4U7KA 4O2FB 3AFLA 5KSAB 3GBMH 3ARFC 1RZKL 1OTTD 4KV5E 5I1IH 1XR9A 2QQNL 2APVA 2ZJSL 3DX9A 4KDVA 1CLYL 4C58B 5I1LB 1IAOB 2EDLA 1EIBA 3MUJA 3DRQA 4LLQA 1OTSC 3C5SA 1NBQA 1P4BH 3CVHH 5JIKA 3UDWA 1M6OB 5I66B 1RUKL 2V2WA 5F9OH 3MXWL 1WICA 2UZIH 3K8MA 1G7JB 1E4KC 4HIHB 3VXRA 5F1IA 5EU5A 2FX7L 1P9MA 1NL0L 4EN3D 2VR5A 1T2XA 4W6YB 3IU3B 1PQZA 4ZFFA 3V0WH 2WP3O 4P57B 4WCYH 2V6HA 4NQXA 4M3KB 4Y88A 1U91B 1XGYL 1RIHH 2IEPA 2VL5B 3IRPX 4K7FB 1HH9B 4OLWH 2FSEB 3D85D 3FQTB 4NQCA 3PNWB 4MS8D 5E2VH 4PJBB 2R23A 3HI5L 2YEZA 3PXJA 2MQ0A 1IGIH 3V52H 4AG4H 4KJQD 2BY0A 2IPKA 2V5TA 3G5VB 4D0CB 4S1QH 5IR1B 5KVEH 4KDWA 4ODSH 3TP4A 4JO3L 4XX1E 2JK5B 1X5GA 1N64H 2AJUL 2OYPA 1KIRA 4YFLI 4ZUTA 3D87B 5GGSB 3GJEB 1F3DJ 1KJVB 4YDVB 3GMQB 3PWUA 5F3BB 2Y4SA 3PGCA 3KYKL 4WDIA 3QDJD 3QQ4A 4XPTL 5EORH 1J1PL 1Q0XH 3EFFB 5HHOA 4M7KL 4K71B 5JLZA 1I7UB 1X6NA 3BOVA 4TTDC 4U1JA 1LE9A 5ETUB 3B4NA 4P5TA 4JLRB 1OARL 3ARWA 3HC0B 3T2NL 3VJ6B 4OZGB 3AU1B 1B0RB 4OCWL 4YK4B 2NQCA 3O81A 1J0JA 4QRPA 2VR4A 4U6VL 1JF6A 1JGLH 3VD3A 4BSVA 1A5FL 5MEND 1RIUL 1NGZA 3I6LD 2VMFA 3N1GC 4TRPH 4YIQA 3QDGE 5KAQG 5I1CL 4PJFA 4TSAL 5ADPH 4JHBA 1M7IB 1ZK9A 1YEIL 2R4SL 3VFNA 1AQKH 1SY6A 4D9LL 5IHBA 3VFVB 4DGIH 2RGSA 5BJTA 5HGBB 1YMHB 1MCPH 3AMKA 3IXAA 3WJLC 5HHQB 3M45A 1JBJA 1G7IA 4Q74A 4TOYH 4ZFOL 1AY1L 1YYML 2MPAH 4QRQA 3VFWB 2O5XL 2NZIA 3S35L 2CUIA 2W0FB 3QDMA 4IMKC 2CLVB 4ZAKA 2N7BA 1DQMH 3IDXL 4P2RA 3ZE0F 3T4YA 4GG6B 3HNVH 4XMKL 5E4IA 2CLZB 3C09B 2GJ6D 2EDBA 2J7LA 4IRZL 2FO4A 4G6KH 2PW2B 3AMLA 1V05A 5I1CH 2XQBL 5T1KD 1SM3L 3OHXB 4P59H 3ARED 4QRPE 1CICC 3UCRA 4EVNB 4HBQA 4IRSC 4LHUD 3TESA 5ACZA 4LCYA 4ZXBC 2BZDA 1OSPH 1DVFC 1SHMA 4Y16A 3UZVB 4IJ3C 4XNQA 1EHLL 1J1OL 1OAUH 2FDBP 5HDLA 5DJYA 3O11B 4Y19B 3SDCD 3SCMA 3W5MA 3MFFA 3ZE0E 3BQUB 1N3NA 2HH0L 3VXTA 3HTLX 4WTZA 2V2XB 3EO1B 3N9GL 4Z9KB 5EIIB 4LSDA 3GSNA 4QNPF 5DMIH 3G6JE 3BDYL 3P40A 3DVGB 3L7EA 2IMNA 4XVTH 3R06B 4IM8A 1HSAA 4UU9A 3GMOA 4NFBA 1AC0A 4YHIB 5DSCA 4XNYL 5GS0H 3F8UB 4RNRB 2Y07L 5FUOH 1PSKL 1NPUA 3Q48A 3FMGH 1ED3B 4RGMC 2AK1L 3UJTH 4OD3H 4PRID 4UNTA 4UQ3B 4KJQC 1K85A 3ALPA 5TDPB 1E6JL 4XPFH 1JWUA 1D5IL 5HI4D 5JO5B 2B2XL 3BFOA 1HDMA 3F6IA 1BD2D 4JKPL 3PHSA 4Q0XL 5FYLE 1HWHB 4POYA 5C0AA 1NUNB 4JG1H 1UZ6F 1U6AH 1RJLB 1T1ZB 1HHJB 4DW2L 1MIML 2ZUYA 4FTVA 1EO8L 1L9NA 3LOWA 2NY0C 1MCDA 3VXUA 9CGTA 3OV6A 1IT9L 5IHZB 1DZBA 5DHYA 1S7UA 3V8CA 3MV8E 2BRRL 5JPMB 1UVQA 4X83A 3WFDL 4P9HC 4ZOCA 3LKNB 1SM3H 1MAJA 4PYHA 1DUYA 1TZGL 3F5WB 1F3DH 1KCLA 2AK4E 2DWDB 5DA4A 1QLEH 3F7VA 4M6OH 3TZVB 3BPNC 5F7UA 2CMRL 3FT2A 3CPLA 2BSTB 5E00A 3L3DA 4JQXC 4OCRH 5EU6B 3KPRA 1QSFB 3RA7H 2ED9A 3SO3C 4KROB 3QXVA 4JY5H 4XPBL 3MA9L 4DCQA 1BBDH 3H7BB 4P48A 1QUNA 5EIIA 4UT7H 4DAGL 1U6AL 1PX3A 3IGAA 3SGJA 3CVIH 4X5XB 5D5MA 5T1LB 3TA3D 3J8F7 2DL9A 3G6DL 3CXHJ 3LKOB 4Q2ZA 3NABL 4ZNCD 5CSZA 2Z92B 1F90H 4NT6A 5KS9E 4JAMB 5D7KD 4JREC 2AK1H 3DGGB 4LNVA 3VGBA 3RTQB 3SN6N 4YBHA 1YC8A 1MEXL 4PGBB 4P2CG 5K59E 3QT2A 3VWJA 4ZXBB 5DJ0B 3ZT6A 1J1XL 4Z0XA 4OLUH 3KXFB 4IRJB 1UZ8B 5DJXB 1A6TB 5E0QA 2BXZA 4G42A 2MJWA 3OWEA 5IMOA 5DRWB 5I30H 1PLGH 4UIKL 1UM5H 1SJEA 4LLMA 1RK1B 1I7ZB 4L8CB 2HJFA 1S7RB 1JJUA 3L95B 1T22B 4FFYH 4OZFH 5AYUH 4LPCA 4LSRL 4IRJA 5TPWL 1PYWB 4ZXBD 1PZ5A 2WBKA 4XB8A 4ZO8A 4LLAA 1Q9KA 3QJFA 4POZC 1T6WA 1NCAH 2OX5A 1MWAL 5SV3A 2KBGA 1MFBH 3WXWL 3BP7B 4GMSH 5I66A 1I8MB 1XCQA 1G6RH 2NMSA 4TOYL 3UTPD 4YK4C 2X5PA 1BFVH 1NBVL 3U4AA 1WZLA 1YN7B 2HTLD 4OTXH 5MHSD 3RZCD 1T0MB 4G8FB 4NQTA 3REWA 1E28A 4I0PD 2Q7YB 2NTFB 1P7QD 1NAKH 4NQDB 2EYRA 2VN7A 3QJFB 1URLA 3VDBA 3JWDL 3RVXD 4PP1D 1ACZA 1N4XH 1R3HA 2D03L 2HLFC 5IJKC 2NY5L 4KMTL 4RCAA 4KAQH 3QIBB 1XGQB 5D1ZA 2D31B 3MOAH 5DI8A 3H7BA 4I48A 1YYMH 5IVZB 5JNYA 3N1QC 5LBSH 5IJVB 1Q8MA 5KN5B 3U46B 6FABL 4PJCA 2Y5EA 1JGDA 4GKZB 2NY5C 5BVPL 3O2WH 5I71C 5E08H 5T1MB 2DIAA 3E1F1 4XI5D 1G6RL 2A73A 4AIZA 4U7MA 1S7SA 1XAUA 4MQ7A 1IC1A 3GO1H 1ZHLB 2R0KH 2YRZA 4P4RA 5IV2B 1MFAL 5IHZA 2ZUQC 5AYQA 2D0FA 3X3GH 5SWZD 3MLXH 1P53A 3ARGD 2OMNA 3LSOB 2ESVB 1CBVL 3IETA 1HCFX 3MRDA 1FZOB 5AG9A 2UUDH 4RBPK 5T3XL 1D9KD 1QBLL 4MX7B 1R0AL 1LGVA 2Z8RA 3HMWL 2XWJB 1JF1A 5AWNH 2Q8AH 1QBAA 2P24B 4HK3N 1SVZA 4RQQB 3VGAC 1MJJB 4TPRH 3MV8D 3QO1B 5J11B 2AGJH 2I60H 4PB0H 2PCPB 3QH3B 2VDQL 5FUZH 3UROR 1CD8A 5EU7E 4CU6A 4JFFE 3U7YH 2COQA 2XY2A 4JZJB 2GY7B 1FH5H 4F7MA 2M26A 4DTGH 5F1KC 4LP4A 5EBWA 1EAPB 1KT2B 1Q72H 1RZIA 4HUKB 1MQKH 3HUJE 3CU7A 4IRJC 5DJXA 3L1OL 5CJOH 1NMBH 3X13B 2FX8H 2ARJQ 4BA8A 5AG8A 5BS0D 1ZVSB 4OCLC 2V7HA 2EIZB 1D5XA 4X9BA 3HPJA 3HZYA 4XVUC 1JF1B 2MHAB 2WK2A 4Z77B 3HI1A 3P4NB 2AK4A 4LGSB 1L7TH 3LAFA 4OV6F 1GGIL 4YHML 5DEZA 1MPAH 3BZEA 2E5EA 3SDXF 2VLKE 1FAIL 4TNWF 3ULUE 1OTUC 4Q9RH 1MH5B 4P5KB 3DXAB 3MNWA 1HI6B 3BE1H 3NCJL 1UFUA 5JO5A 1HINL 4UV4L 1PD6A 4FTVE 2X1XR 4KFZC 3MV7D 4YC2B 3C08L 3GI9H 4HDIB 3WFHA 1NDGA 3S34L 4MB3A 1P4LB 1CLYH 1HOCB 5D7IE 3TH2T 1QFPA 3H9SB 3QDGB 3QHFL 4KPHH 2Z8VC 2G60H 1ZEAH 4D0BB 4JG0H 4PJDA 4HWEH 5DT1H 2IAMD 2XG4A 2AEIT 8CGTA 3PDGA 3T1WA 3X11A 4XWGL 3FQUB 4GW5B 4YE4H 4WW2F 3RVVD 2J12B 4EOWH 5F89A 3L5HA 3LB6C 1A6AA 2FWOA 4QHNB 5DJ0A 2A0LC 2E6JA 2J6EL 4FXKB 4TYUA 5I75B 4UUJA 4EI5A 2Z91B 5TE7L 2IWGA 3VG0H 3MRGA 4MA8L 3RWEA 1EXUB 2G2RA 4XC1H 1T1WB 4TUKL 1UJTA 4X7CC 5K9KB 2V5MA 3CFKB 4E42B 5GRWA 4NOFA 2R0ZL 4MXQD 1U36A 2D03H 4NM4L 5I1HL 4OV5A 2BY2A 5IF0B 3HC3L 4O2EA 4X99A 4WIQA 1WBZB 4PJ7F 4UOW0 4X0KA 4Y2DB 5F71A 3S4SG 2OR9H 3RU8H 2BNRD 7CGTA 5IB4B 5IBUG 1G9NH 3NCYS 4XXCC 2IADB 4WFEE 4M5ZH 1FFNA 5CJOL 4D3CH 1YEJH 1CIDA 1FC1A 4M1GL 2E6PA 2PR4H 1KGCD 2W9EL 4R4BA 2HWZH 1A7PH 4F3FB 1LO4H 3G04A 2W38A 5JMOC 4C56A 2H9GA 4QYOA 5E8PB 1MAKA 1HZHL 4QRQB 4RWYL 5JLZB 1OGAD 1ND0B 2JIXD 5LVEA 3CDGB 2NZ9C 4HPYH 5K9QI 4XRCB 4XP6L 1A8JH 4PP2B 1DANU 2PTVA 4UDTA 2V2XA 4ZMAT 1JGVL 4MD4A 3MODH 4Z7VF 3V5HB 1OCWL 3NIDF 2EYSA 3VXUB 2BC4B 3C60D 3KPNA 4JDVB 3OG6B 1BOGA 5KBNC 2BY3A 3VWJC 3UTTA 1UC6A 3ARGB 4XNXH 2CRMA 1EPFA 3VMNA 5E2UH 5JIIA 5D7JB 2YZ1A 3PWNA 1BX2B 1QLRA 4Y4HD 5C08D 3OJMB 3JTTB 2BJML 1FDLL 2XXCB 3LHPL 3IF1B 2MCPH 1F4YH 1RJYA 1MQ8A 1B4JL 4JFEB 5FIEA 1FJ1B 4OZHE 3MLRL 1F4WL 4WEBH 5IVXE 1S9WA 3VFOB 1IAMA 3KPPB 4Y4FC 2DQHH 4JVPA 2IFFH 4YC2C 1F42A 4GKNB 1BZ7B 4YQXH 3SDDC 5F9OL 1CGUA 5C0JB 4KC3B 4ODVH 5L6YL 4R6UA 4AZ8A 3IU3A 2GFBB 3B2UC 1I75A 3GSNH 2X2YA 4PREB 1QEWB 5DJZA 1KCSL 3V5DA 3KYAA 3A6CH 5KSAC 4HS6A 1S9WB 2K9UA 3FFCD 1P7QB 1WAAE 4NJAH 4E41E 2CK0H 1BM3L 1FJ1A 35C8L 1DN2A 1FYHB 2APBA 3I3EA 2B5IC 4MXVE 4FFZL 4UQ2A 3UC0L 3VXMB 1ADQL 3W0WA 4GH7B 2NXYD 3CDYA 4PJHB 2I07B 5JZ7C 3ZLQC 2BSRA 2Q8BH 2PTTA 5F88B 2YC1B 3W2DH 4LPYA 3SGEH 5F3HA 3UTTB 4PTTA 4JFQB 3TLRA 1B0RA 4F7EA 2BHYA 4JO2H 4W6XB 1S9VA 4HS6B 3D48R 5IEHA 3IDGB 1NLBL 3DURB 5C0IA 1C1EL 2VLJA 5DD5L 5SWZE 4J3VA 2SEBA 4YHMH 3OPZL 4L8BA 2YD4A 5JHDA 2FX9H 1YY9D 3P0GB 5E1AA 2CK0L 4CVXA 2NXZC 4JM2A 2ATPA 1FE8L 3HE6C 4OD2B 1YEFH 4NQDE 5DK2B 1S9VB 4L4JA 5TF1H 3VXTB 5GS0L 4M9OA 3L9RA 5E6YA 4QTIH 4UB0H 3JWDC 5FYKH 1J8HE 1U8JB 4OF6A 4FZ8H 1I9RL 5DA0B 4J3XA 4M43L 4JFFD 4UMGA 2BNUB 4GOSA 5IW6A 4L9DA 3GMNB 1I9JH 1C8PA 4XCCL 4JM4L 1L4IA 1WCQA 5D6DA 1VESA 1BOGB 3QFJB 4EJ1C 4M00A 5HD8C 4G9FE 4GAJL 3ES6B 2R39A 1N8ZA 3G5ZA 4YO0A 5E8EB 3O4LD 3BP6A 1FHGA 1IC4H 5DK2A 4IRSA 3TBVA 5DQ9A 2ZSVA 1RVFL 4V2CB 5EZIL 2A9NH 3WS3B 2FWOB 2R69H 1UKQA 1H0DA 2BOBA 3QUZD 2AJSH 5DUBB 1ZSDA 2LTQB 3GRWH 4PJXA 2DOCA 2WV3A 1F6AA 3P0YL 3GO1L 1IBGL 1RFDL 4OUUA 4ETQB 2CKBH 5HGAA 3CLEL 1NKRA 3SOBL 2P8LA 5ICXB 1A3RL 4K3GA 1HHHA 3GMRB 3WN5A 1LO0L 2XOTA 4UILH 3MRJB 2ZCHH 5HGBA 5FK9B 5IB4A 3G5XB 3P4OB 2FBOJ 2WUCH 4PJFE 4YHZH 2ZOKA 4Z6AT 2CD0A 2EH8L 3G08B 2APFA 3KLDA 4PGEA 5ID0B 1NMCC 1V7NH 4I0PC 3VCLA 3QPXL 4LMQI 1MCIA 1R24A 3VA2C 1KIUA 3OSKA 1HHIA 3MLPA 2R56H 4LCCA 1GC1H 1NUDA 4L8DA 3GSOB 2B0SH 2K3TA 1D6VH 1Z5LA 2GEEA 4N5UA 2C9AA 3SDCA 5E70A 1FH5L 1MF2H 2XV6B 3I3BA 5I17A 5A2KH 3QXAA 3MACH 2QQNH 3O3DB 3I9GL 2VDQH 5FUZL 2F54D 5EDXA 3CXDL 3OKMB 3NN8B 4X80L 1OW0C 1HYRC 1ORQB 5JHLH 4PJ9A 1PDKA 3HA0A 3SDAB 1GH7A 1SEBA 4TQEH 1KT2A 1Z6JT 4HFWB 4PTUB 4U33A 4IIQB 1P4BL 4Y5VA 1T5WA 5HTSA 1NANI 3QXAB 5CGYC 1ZHBB 1PEZA 1X5HA 3ESUF 2P5EB 4WFED 3VXPA 2P7TA 4NZJA 1VDGA 3OZ9H 4JO1L 5DD6A 4HEME 3H9SE 4I13B 1H8OA 5DQDL 4XPTH 5DRXB 3MRIA 2D7TH 5KW9L 1MLBA 1JYVA 5HI5C 3U1SL 3F7RA 4K94L 1QO3B 4HV8B 4HMDA 5DEFB 3L3OA 2VB5A 1CGTA 2XTJB 2EYSB 4Z7NF 1MRCH 5JDSA 3H0TB 2EDXA 4JPKH 3VXPB 1PKQE 2IAND 2LU7A 4IRZH 3AC0A 3GMRA 4LVEA 3WXVL 4U05A 4NQCE 4HGMA 1ONQB 5HVWA 1FV1B 2WBJA 1EFXD 4ZTOL 3SDAA 3NFNA 4FQLL 1NFIB 3UX9B 5FGBC 2DDQH 4PLOB 3IJSB 3P9WB 4YDKL 4P3DA 2NNAB 3PWPA 4X4ME 3H7LA 3QI9A 1H3UA 4L4TA 2ICES 4CW1A 4PJCB 5KVDH 5K93A 1CE6A 4TVSa 3I02B 4KKAC 3RFZC 5IVZA 4BK4A 2EEAA 4HH9B 3TEUA 1NDGB 3X17A 2AQ2A 5T5FL 1KELH 4JQXA 3OR6A