1KXVA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
total genus 175
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxvA01
2YA2A 1BYAA 1F4AA 1PBGA 2OYKA 1QX1A 5BRPA 3O6AA 5A1AA 3N12A 1TVPA 4XZBA 4OIFA 1UUQA 1JZ8A 4JL2A 2WCSA 4HU8A 3IK2A 1ISWA 3W53A 2A3HA 1B31A 1WNOA 2O9RA 4KGJA 4AISA 4D1IA 2XPKA 1XSKA 4FLSA 3SCNA 3WDQA 3DX4A 1CXIA 4OKDA 1E4IA 3AHVA 2BXZA 1TQTA 2CERA 4MJ2A 4H41A 3CHDA 3T2PA 2QLYA 4D72A 1UR8A 1FP9A 3W81A 4V28A 4U3AA 4YN5A 1HJQA 1QHPA 1FHDA 3CV5A 1HNYA 2PI6A 3WY4A 3MO4A 5CJ5A 1EHAA 2DT2A 3AIRA 1UKQA 3I3DA 3BVXA 3ALFA 1WZAA 4A3YA 4ZXOA 4E8CA 2ZE0A 3WQ8A 3ARUA 1U2YA 3CIVA 3FW6A 4P8XA 1V0MA 2VR4A 1CGTA 1WP6A 1K9EA 2ZXDA 3OBAA 4TVCA 4BS0A 4AZCB 4F79A 3TP4A 1CGYA 3T0BA 1IZKA 2WHJA 5CZKA 1G5AA 4NZFA 3ZR6A 3AXHA 2D3NA 3DYOA 5EBAA 1EQCA 1WDPA 1WKYA 2ZIDA 1GPFA 1PX4A 1CGXA 1RP8A 3RM4A 3RCNA 4W88A 2FDMA 1V6VA 2YDQA 4TOQA 2E8YA 2PC8A 4GIAA 1LL4A 3OIHA 2DSUA 1OT2A 4WSKA 2F2HA 1ISVA 2QMKA 2WC3A 2PB1A 4LX4A 4W7UA 1NOFA 4S3JA 3A6OA 1OIMA 3ARYA 1BG9A 4U33A 2J8FA 2WSPA 3GNRA 2V3DA 3VIKA 1ZS2A 2E9MA 3WD3A 3GXFA 1BTCA 1MFVA 4WSJA 5D8WA 2FHBA 3F5LA 2WMFA 1GOKA 3WENA 1TA3B 1H5VA 1G0CA 3AXIA 1XHGA 4HA1A 1CIUA 1WDQA 3CZEA 4BQ3A 1BYCA 2VTFA 3O9NA 3SUSA 4XZWA 2J47A 2DGAA 4WK9A 3NSNA 2J7HA 1ECEA 1W9BM 4R5EA 1S46A 4DWSC 1E6QM 2G3IA 3BUIA 1HP5A 4PBGA 3A22A 4C7DA 5AC4A 1YHTA 1UWSA 3A21A 2AMGA 2XG9A 1UR9A 3AMDA 3IANA 2J7GA 1TR1A 3OB8A 4ATLA 3CMGA 4TX6A 2Y5EA 2XN2A 3VVGA 4DWSA 1SYTA 3WH7A 3RJXA 4PMNA 2F18A 3OLIA 2XVKA 3PZOA 3ZOAA 5D4YA 1SFSA 2GUYA 2GK1B 1CXHA 4AZGA 2DT3A 1XYZA 3VMOA 2XVPA 1LG2A 1ITCA 2VCCA 1PAMA 3G6LA 5IFTA 5A8MA 1QVBA 1H49A 4DO5A 4FNTA 1JIBA 1R7AA 4W5ZA 5IHRA 5BXSA 3RIKA 1EDGA 2W61A 3NUKA 3CBWA 3WH9A 4KGLA 4GQRA 1PIGA 3AZRA 5A94A 2BVTA 3PHAA 3IJ7A 4U2ZA 5HNNA 3KL3A 4A4AA 1QW8A 4UQCA 3WUFA 5A6JA 1W2VA 2J7FA 3EJQA 4YPJA 2NSXA 4BA0A 4Z2IA 3WEMA 3ZT5A 4TVUA 1KBBA 1H0IA 1HJSA 2WXDM 2V3GA 3FHQA 3AISA 1CGWA 3WF1A 4W89A 4GPNA 3W37A 4WF7A 1XCXA 4B16A 2V5CA 1VJSA 2F7RA 2DSZA 1C8XA 3N1AA 3POHA 3GBEA 3WUGA 4U31A 1WDRA 2VZSA 4WJXA 1E6SM 4U2YA 4GZEA 3CZ8A 4AZCA 3VDAA 1JYVA 4JIEA 1OCQA 3T2QA 4J3TA 1Q6GA 3QHNA 1V3KA 2VC9A 3GM8A 3DX3A 2B31A 3B8SA 4ZFMA 3UR7A 1UQYA 1JD7A 4H7VA 1K9FA 1IZJA 1C7SA 3PN8A 1KXHA 3UG5A 2OW7A 1UZ1A 1CLVA 4MAZA 2J8GA 1FHLA 1VBRA 3ARQA 3BVUA 4PMRA 1E40A 3WBEA 5BXPA 4HOWA 2WYSA 1E3ZA 4IPLA 1E43A 2D1ZA 5GPRA 1WB0A 3TTOA 2F7PA 3RM9A 2HVMA 3AHXA 4MB1A 5ABEA 3CZLA 1B3VA 5DMYA 3WNLA 2ZOXA 3SUTA 2GJRA 1V3LA 1UWUA 2IGTA 2C0HA 1C8QA 1FFQA 1VBUA 1TMQA 4J3XA 3AYRA 3WD2A 4WKFA 1G1YA 3GDBA 3W28A 3PZUA 3UR8A 4ACYA 3MMUA 1B3WA 3QHMA 1QI3A 3BAWA 4HPGA 1UWIA 3VX0A 1EA9C 2VVSA 4H04A 3WQ5A 2DPEA 2XHYA 2EQDA 1NP0A 1JZ3A 4DO4A 2WNWA 1ESWA 3QOKA 3PZVA 2O9PA 1UA7A 2FHFA 1QNRA 3U57A 2DSVA 4M80A 4YHGA 4GI6A 1HKKA 4HA3A 5IXEA 2DIEA 3WNPA 3VIHA 3D52A 1HKMA 2ZXAA 2AOSA 1W1VA 3VIFA 1JYNA 2EAEA 3M07A 1LWHA 4QDMA 3EJUA 2EBNA 3ARZA 3LXBA 1B1YA 3AIWA 3SCQA 3W25A 2XSAA 4FMVA 3NCOA 4UQBA 2VI0A 2GK1A 3A4XA 1CXFA 3DX0A 2CPUA 3W38A 3WF2A 3DECA 1AMYA 1ZBWA 2WBGA 4JFSA 3ZMRA 3EBVA 2Y24A 4W5UA 1XRVA 5E0CA 4FNUA 2WM0A 1B9ZA 4LPCA 4IM4A 1EH9A 3II1A 3BUDA 1JGIA 1CXEA 1NOWA 2G4FA 2J25A 2OYLA 4DO6A 1CECA 3CC1A 3SEPA 3WDPP 1JDCA 1UH2A 5HPCA 5HPOA 1KQYA 1H4PA 1JXKA 5DEZA 1O6IA 2WCAA 5DF0A 2UY3A 1Z32X 5FL0A 3OZOA 5E6YA 4EAMA 2ZX8A 1LLOA 1J01A 3BAKA 3SCUA 1SMAA 1CZ1A 3FXYA 3AICA 3AS1A 4GI8A 1MXDA 2ZUVA 4AZ6A 2DIJA 3OGRA 3A24A 1KFWA 5BRQA 4AZ5A 3L4XA 5GQBA 3A47A 4XUYA 5AY7A 1W3JA 3HN3A 3SCSA 4FLRA 1R86A 4MDOA 2JIWA 5D9NA 1R8LA 2W66A 3H54A 5A69A 4EK7A 1MW3A 1E15A 1V0NA 2WPGA 2WMIA 4GXPA 4DUXA 2WZIA 4DWSD 1YQ2A 1E1EA 4HMDA 3CO4A 3FAWA 3QHOA 4CVUA 1HP4A 3DYMA 3WF4A 2F8QA 2DEPA 4AD5A 5JUVA 2YJQA 2YL6A 1GQIA 3CGTA 5DT7A 3EMCA 4OOUA 2WVUA 2WZEA 1AQ0A 3CTTA 4X0VA 4V27A 3BLPX 1BGAA 4GI9A 2Q8XA 1KR0A 3CUGA 3KL0A 2PWGA 4M24A 3SCOA 4CCDA 3HMCA 2YL8A 2BVYA 3TA9A 3U5UA 3VPLA 1BQCA 1BFNA 4PTXA 4D6GA 4JFVA 4AEEA 1HL8A 2FH8A 3VIJA 4WLCA 2WLZA 7TAAA 1KBKA 3WFZA 4PMOA 4E2OA 3BAXA 1GHRA 3SUUA 2C8NA 3W4RA 2D3LA 1EGZA 5KEZA 2WZHA 4M56A 3K8MA 1HJWA 3EMQA 3OGVA 4W8AA 1UH3A 1R75A 4DM1A 2EPMX 1KXVA 3WDHA 1TFVA 1Y7VA 3WKZA 3T0AA 3A5VA 5TD4A 4KRUA 3W29A 1EXPA 2XM1A 4PCSA 1JYWA 4CN4A 1HVQA 4AIUA 3RILA 4AEFA 4QLJA 4CU7A 4H8HA 1LJYA 1B2YA 1K9DA 1GCYA 1MW0A 4HP5A 5E09A 3K46A 2XFRA 3N17A 1JZ5A 4MNLA 4Z2JA 1GUVA 2W62A 4PTMA 3VDBA 4D6FA 4JCMA 3VNZA 1RH9A 3WY1A 1JDAA 2D0FA 2WW5A 4Q7NA 3BVVA 5I5RA 3WF3A 3N15A 1PIFA 4FNPA 2JEPA 4FK9A 2BY2A 3AS0A 2VUYA 1CLXA 3BVTA 3MANA 1Q6EA 3BAIA 1L8NA 1FFRA 1UKOA 1OM0A 1KQZA 5M5DA 3MUIA 4CU6A 2GVYA 4M1RA 4MAVA 5CLTA 1JAKA 1NM9A 1KB3A 3UETA 5BXTA 3MSGA 2ALWA 3HG2A 2A3CA 1J0IA 4LYQA 1VFFA 1ZBCA 1E1FA 3T0DA 2WVTA 2YBUA 2VURA 2WMGA 4KRTA 3MU7A 4N42A 3CHEA 1C7TA 2J7BA 4JHZA 4CCCA 5HBFA 2UY4A 3JUGA 2J7CA 2XWDA 6CGTA 3BLKA 2FYVA 1GONA 1TVNA 2JEQA 1QI5A 2OWCA 4AZHA 1XC6A 4K68A 4JKLA 1W9UA 4OZOA 1CBGA 1EIBA 1NOUA 4D6EA 3TTQA 1MXGA 4HOXA 3DX2A 1C90A 3AQUA 3EDEA 4NXKA 4RL3A 4FLOA 3B9EA 2VX7A 3BMVA 2GDUA 3MUY1 1VEMA 3WN6A 2CETA 1A47A 3PTKA 4JAWA 4GO9A 4QAWA 2J79A 3D3AA 4JL1A 2VRKA 4PCTA 1CGUA 4B3LA 5LA2A 5M03A 1W9XA 4NZJA 4EKJA 3NDYA 3KE0A 1OWQA 4UCFA 2VQTA 4HZ7A 1M01A 3TV8A 3AI0A 4MB4A 2ZWYA 2ZX5A 1E6ZA 1QI4A 4PTVA 3HJEA 1UR4A 2VT0A 2VNCA 3MMDA 1GHSA 4B15A 3AZTA 2Z1SA 2OYMA 2ZXQA 2QPSA 2EO7A 1JL8A 3M7SA 2VRJA 1KXTA 3WMBA 3CUFA 5GNZA 3L4ZA 2ZUSA 1NWRA 3UEQA 5JBEA 3WY3A 1BG4A 4NRRA 5EFFA 3EJTA 1M7XA 1J12A 1V6UA 1KCKA 2VO5A 3BCDA 3D5HA 3AMLA 3NSXA 1ZJBA 2VX5A 3VMNA 1JNEA 2A3BA 2J7EA 2ZUNA 4ZXLA 2RGLA 3BXWA 3LRKA 2PWEA 2EPLX 1DHKA 4UFLA 1EO7A 4NZCA 3GYCA 4P7NA 4C7GA 1W91A 1KCLA 4H8VA 3AZSA 5CPTA 1JI1A 4PSRA 3ARTA 4CVWA 1FP8A 1PZ3A 4D6IA 1W3KA 3WQ4A 1R7OA 3APGA 1MVYA 1KR1A 1UQZA 1GJWA 4M29A 3PTMA 2G8ZA 1C8YA 5GNXA 4UOQA 3VU2A 2WVVA 4AYSA 1VB9A 5FL1A 3OZPA 1D2KA 2W5FA 1J18A 1E73M 1W2PA 3O2LA 4QFUA 1V3MA 1HXKA 1AQMA 3U7VA 5C8BB 4OJYA 1ZB5A 2EPKX 4JFTA 5A3HA 5EMYA 2D2OA 4HZ6A 3ARSA 2VZOA 3ARRA 1DWFM 4X9YA 4AIEA 2W63A 2OSXA 4MJ4A 2VZTA 4JZ5A 3CLWA 1HVXA 1VIWA 5FD0A 1UD4A 2BVDA 4W93A 3H55A 4HZ8A 1CPUA 3DHPA 1CXKA 4F9DA 3K8LA 1XCWA 2VJXA 4P7LA 3BLBA 2WLYA 3MUZ1 4PMYA 2WC7A 4OOZA 4AXNA 1ZJAA 2ESCA 2NT1A 3ZT7A 1B90A 3L2LA 3N9KA 3VM5A 3GNPA 2WWDA 2X0HA 1E72M 1XSIA 2CIPA 4WIWA 1Q4NX 4GINA 1QHZA 3DDFA 2WAGA 1GNXA 1X6LA 3WNMA 4DM2A 1HXJA 4MNJA 3VD7A 5FKYA 1E71M 5ECUA 1HWWA 4CGTA 2PBGA 3WD0A 1D7FA 3S2CA 1J11A 4RE4A 2XGBA 2WANA 4MDPA 4Q22A 2IXVA 3HG4A 1C91A 1J0ZA 2F1BA 4JFUA 2D20A 2BHUA 4CD8A 3VGFA 4W84A 4ZE5A 1UOKA 5A6LA 4AMCA 4NRSA 3BUBA 2XN0A 4Z2LA 2JFEX 2MANA 4JHOA 1F4HA 3FN9A 1BPLB 2UY2A 4AC1X 3BUQA 3I3EA 2ZWZA 4PEEA 3ZJ6A 4LGXA 3GZAA 3W6MA 1QNPA 3GTNA 1TQVA 4B9ZA 3VGEA 3GH4A 1GVYA 5AYBA 1K9TA 1QBBA 3UERA 4F66A 1TCMA 4CD4A 1E6PA 1CGVA 3L4TA 2Y2WA 4KMQA 4RE3A 1OSEA 1HX0A 1C92A 3SCVA 4AY1A 1GQJA 2ZUUA 3PZMA 3GXDA 2XN1A 3CZNA 4PUEA 3VDCA 3W24A 4U3CA 3ARWA 4P7QA 3WD1A 1V0KA 1CENA 3DDGA 1ZBKA 1QI0A 3L2MA 1RPKA 4MTVA 2GJXB 4TVDA 1E5NA 4PMXA 4GKLA 8A3HA 1HF6A 4ATDA 3WDJA 2V38A 4QLKA 3T08A 3VSUA 1TA3A 4ZE4A 1BF2A 3SUWA 2DSKA 2YA1A 5BCAA 1ISXA 1JG9A 3CZGA 4H8UA 2FH6A 1CEOA 1KWGA 4GZIA 3WH6A 3WNOA 1W1TA 3POCA 2XUCA 4AD0A 1A3HA 1XD0A 2F1AA 4NI3A 1J0YA 2IXUA 3W6LA 2D0GA 2F61A 4TTGA 2FGZA 3HG5A 1W9PA 3EDFA 3IJ8A 4DUWA 5I0DA 2YOCA 1JAEA 3VM7A 3AHTA 2D0HA 3ZM8A 2WHMA 2YDSA 3ZR5A 2EXOA 3KZSA 1WE5A 4D6CA 4FNSA 2W4XA 4FNRA 1ZL1A 4FNQA 5C71A 1QWNA 1V6YA 4QCFA 1WCGA 3ARPA 1ISZA 3KWXA 4EANA 3OLGA 4E4PA 3OG2A 3S5YA 3M6DA 1QNOA 2XWEA 2BS9A 2DH3A 2VRQA 1QNQA 2BNJA 3EJRA 1NWSA 2X05A 1PS3A 4URIA 3WQ6A 4AD1A 4Z2GA 2CCRA 2XFYA 3OLEA 1QHOA 1M53A 1WZKA 3AIVA 1BYDA 2XIIA 3G6MA 5FIPA 5A8QA 1HJVA 2YLLA 4GZJA 1UD2A 3AJ7A 3VGHA 1W9VA 2XVLA 2XFFA 1LL7A 4DUVA 5JBDA 2BHYA 1GOWA 3BUPA 1E0XA 5CLWA 2NW0A 3MSDA 2WKLA 4PYSA 1GOMA 3EYPA 1J0HA 5CGTA 2CKRA 2G3MA 2XSBA 4P7OA 1MW1A 3FY1A 2G41A 3F4VA 4TXEA 3BAYA 1HIZA 3WFLA 1CDGA 1D3CA 3VO0A 2BV9A 2WK2A 3WY2A 1MQRA 3BH4A 5CQ1A 1VENA 1ITXA 2X8RA 1J0JA 4P7RA 1TQUA 4D6HA 4AZIA 3VD5A 2V3EA 4CUCA 2ZX9A 3VOCA 5D8ZA 2JIEA 2OW6A 5LYRA 5ABHA 3AS3A 4W8BA 3MI6A 1XH0A 1UR0A 1DWGM 1CYGA 1HKJA 2YBTA 3MV01 2FE0A 4PUDA 3L4YA 3SUVA 2YIHA 4UQEA 3SCWA 1PPIA 3AMCA 3WUBA 3WELA 4R27A 2WHKA 5DT5A 2CYGA 4B3KA 6A3HA 5KZ6A 5FOOA 3MV11 4F9JA 1W1PA 4PMVA 3VD4A 2EPNA 3W82A 2BY0A 2A3EA 1FOBA 3AIBA 2VL4A 1QBAA 1E4NA 1I1XA 1FH8A 4UNIA 1OD8A 5I78A 2PWDA 5I2UA 3AIUA 3N11A 4U5KA 4CCEA 1GQLA 2G3NA 5D9MA 1MW2A 3ECQA 3HG3A 2G3JA 3VNYA 2E9BA 1IT0A 3F5JA 4ZEPA 3AIQA 2UY5A 2XGIA 3THCA 1AQHA 5FCZA 2VCBA 4MNKA 1V02A 4W8LA 5A6SA 3EDDA 4PMQA 5I79A 5EFDA 2JE8A 4LYRA 3OGSA 1CWYA 3PZTA 2F7QA 2D24A 3THDA 4BQ2A 1VJZA 2VOTA 3MKKA 1KTBA 1HJUA 3GBDA 3N04A 1CNVA 3WDIA 1MFUA 3MUAA 4HTYA 3BSGA 3BC9A 4JKKA 1PJ9A 5BYWA 2J75A 2OSYA 1VFMA 3BAJA 3VILA 1XH1A 3WL1A 3EDJA 1R87A 2PBOA 1KWKA 2E9LA 4MB5A 5A2BA 2QV4A 1NARA 8CGTA 3GXPA 4L4PA 1WPCA 2WKGA 2J74A 4UFJA 4UQDA 2EACA 4HU0A 1SMDA 1EOKA 4ZENA 2X2IA 5CSUA 1UH4A 5I23A 1UZ4A 2VVNA 5ABGA 3WQVA 3LMYA 4LXFA 3WDRA 4NSBA 4JCLA 1V3JA 1NP2A 2X2YA 2OWWA 2E40A 3EMZA 3ZJ8A 3ZQ9A 5DFAA 5JIPA 1V0LA 2ZUMA 3VIPA 2ZX6A 4HPHA 3WBAA 4CU8A 1OINA 1G01A 3EJPA 4Z2KA 2TAAA 4PN2A 3IJ9A 3W0KA 4J28A 4DWSB 1B3YA 3DHUA 1KTCA 1BLIA 1KGUA 3VD9A 2QHAA 3WH5A 4CD7A 3LPGA 2YFNA 1I75A 2FGLA 2VX4A 4MNMA 1JZ2A 4PSPA 3PBGA 2E0PA 4CD5A 1XH2A 2X0YA 4ML4A 1BHGA 3BGAA 3ZSTA 3KEHA 4M81A 3RJYA 5GNYA 1OT1A 1MQPA 1WZLA 4WKHA 3EJSA 3NYDA 1ODZA 1QWUA 3M46A 2E4TA 5A95A 1M03A 1DEDA 3W27A 2X2HA 4UQ9A 3BVWA 3GH5A 1W3LA 2XVGA 4CN1A 2PWHA 2CHOA 3RPMA 1WO2A 5CGMA 4MB3A 4AMWA 1U33A 2YL9A 3SCTA 4PRWA 1OGBA 4UR9A 1G9HA 3LPPA 2CEQA 4L4OA 2W92A 3EDKA 2J7DA 5E6ZA 3WQWA 1Q6CA 5AYIA 5F7UA 1US3A 4LYPA 2YDRA 1JF5A 3WSUA 4UTFA 4WKAA 2BHZA 2FHCA 1FH7A 5BROA 3S5ZA 2OSWA 1XSJA 2DT0A 3SURA 2GSJA 2QF8A 3LRLA 5HDRA 3NSMA 1R85A 3RMEA 2RGMA 4IPNB 2ZX7A 2OWXA 7A3HA 1QI2A 3VIIA 1JNDA 4B9YA 2WBKA 1DWAM 3VGGA 4OBSA 3AHYA 1VFUA 5A8PA 2J62A 4D71A 5I77A 1JZ7A 5A6AA 3WNKA 3PZ9A 4IISA 1WZMA 2Y4SA 4J7RA 3GXMA 2VX6A 4UOZA 3H53A 1GVIA 2CESA 4J27A 2OLHA 2D73A 2JF7A 3VSTA 3OLDA 5JBFA 4UFIA 1E70M 3ALGA 3LPFA 1VRXA 4CD6A 4A3HA 1DTUA 3WMCA 2DSWA 1RP9A 3ZT6A 1UD3A 1UWQA 2Y8VA 5IDIA 1PEZA 2ZUTA 2XIBA 3AMKA 4AD4A 1E4LA 2CKSA 3WEOA 4TX8A 3U7BA 1GOQA 2X09A 1XYFA 1K6AA 4UFKA 4JKMA 1V6WA 5LA0A 3VGBA 5A6MA 5E1QA 4AYGA 4EE9A 1HKIA 1MQQA 1J10A 4YHEA 1J0KA 2DQXA 2XYLA 4QLLA 3WUEA 3CHFA 3AS2A 5CG0A 4V2XA 5ABFB 1XGZA 3PTQA 3VSVA 1EQPA 1U30A 2CXGA 5E70A 1VF8A 4ACZB 2WC4A 1VEOA 4AD3A 3A3HA 1E6RA 1E3XA 4Z2HA 1R34A 4E8DA 2JALA 3B9DA 2Z1KA 4S3KA 1R47A 1Q6DA 1XD1A 5IHSA 4KH2A 2E3ZA 1FH9A 1OGGA 1O7DC 1GJUA 1DP0A 2JF6A 4GQQA 2WHLA 3WF0A 4UOJA 1JF6A 5A6BD 1VAHA 2J4GA 1MWOA 2X1IA 4D6DA 3I3BA 1B3ZA 4X0NA 1OB0A 1V3IA 3SCPA 1OD0A 2V5DA 5E9AA 1GZJA 4UFMA 2WMKA 1LF1A 2WWCA 1HJXA 3VUPA 2WSKA 4GO8A 3OA5A 4FF5A 5CSYA 6TAAA 3LPOA 3E1F1 1BSIA 3LX9A 3T2OA 1NQ6A 1O7AA 1AVAA 3VX1A 2DT1A 3ZIZA 1E5JA 1HT6A 4PTWA 1H11A 2EPOA 4BQ4A 4H2CA 3PZNA 4TTUA 4AMXA 1IV8A 4KWUA 4OGZA 3UESA 1UKPA 2NT0A 2E8ZA 1CTNA 2WMJA 3LRMA 5I6SA 3A4AA 3GH7A 4W87A 3CUHA 3VIMA 2IUZA 2Y8KA 3D4YA 2QPUA 2EABA 3J7HA 4N0RA 1H3GA 2F7OA 1W9DM 1UD6A 2XVNA 2CBVA 1VFOA 1PX8A 3D4ZA 3TOPA 3CMJA 4LQ1A 2O9TA 2WMIB 3BMWA 1W3HA 2BY3A 4XX6A 3VDHA 2AAAA 3QOMA 4CKQA 3AMGA 1EHNA 1EDTA 3ZO9A 2V3FA 2VZVA 1V3HA 5M3WA 3ARXA 3LXAA 3GXIA 3UCQA 1UR2A 3PZGA 3N18A 5A6KA 5HXMA 2J78A 5DO8A 3AOFA 4TUFA 2YLAA 2VCAA 2VQUA 3RO8A 4UQAA 3CH9A 2XTKA 5BWFA 1WAWA 1TUXA 4UZSA 4U5IA 1HTYA 4J3SA 2PF0A 2VZUA 2D22A 2WVSA 3W26A 1E0VA 4BZYA 5CPSA 1JXJA 2O92A 2CNCA 4OBRA 2VR5A 4D6JA 2EADA 1JFXA 3MMWA 4RE2A 5I3DA 2ZXBA 2EJ1A 2GFTA 3WMSA 1UR1A 5AC5A 1NWUA 3SIMA 3FNDA 3HU7A 4AZ7A 4F8XA 3UG4A 2WB5A 1PX3A 2BFGA 2GDVA 3WIJA 3PZQA 1UKTA 3AXXA 1X1NA 1R33A 1RD6A 3ZJ7A 3QGVA 4PMDA 3IGUA 2XJ7A 7CGTA 1HN1A 1X6NA 3AFBA 4XV0A 1KXQA 3WD4A 3RDKA 5ABFA 1J9YA 1UWRA 3HZ3A 1V03A 4ACZA 1UKSA 4CN6A 4AIOA 5IFPA 1TQWA 3L4WA 3K8KA 4JFWA 1EDQA 3ARVA 3IAPA 3LXCA 3B9AA 3CZKA 4IUGA 1NWTA 5CPQA 2YFOA 1QNSA 3CPUA 4BF7A 1BVNP 1I1WA 1UD5A 1XV8A 3D50A 4M82A 1NH6A 1QW9A 1BYBA 2VMFA 1ZU8A 5A2CA 4ATWA 4UZUA 2XM2A 1E6XM 3NIYA 1H09A 3TONA 1W1YA 1JZ4A 5LA1A 1E4MM 3IAQA 2YL5A 1JFHA 3GNOA 4AD2A 2GJPA 3QR3A 1FA2A 1GOIA 5BXRA 1QPKA 1B3XA 1V02E 2DDXA 3K4AA 2YKKA 3TTSA 4FLQA 2CBIA 3KLKA 1UHVA 1M04A 1G94A 5HOSA 2DH2A 1BVZA 5A8NA 4C7FA 2C7FA 3AHZA 4HOZA 4Y7EA 1V08A 2QMJA 2CHNA 4M8UA 1VEPA 1B30A 4PMZA 5A2AA 3GXNA 4AW7A 3DC0A 4NXSA 4BCEA 4NF7A 4P8VA 1TG7A 4D1JA 3AYSA 5D9OA 4OUEA 1PZ2A 4P8WA 1H41A 4AWEA 1TE1A 4PMUA 3D51A 1QOXA 2ZICA 3TTYA 3NJ3A 1KGWA 3ZJKA 3VD3A 2CBJA 5M17A 5I24A 3CHCA 3KLLA 1W32A 3K4DA 1EO5A 3VMPA 3K1DA 1CXLA 1E6NA 3GXTA 2WCGA 1LG1A 1TZ7A 1L0PA 1WDSA 1JZ6A 4W86A 3AIEA 1GQKA 2WMHA 3VIOA 3BCFA 1BGGA 9CGTA 2CITA 3CZJA 1R46A 1V6XA 3FHAA 1US2A 2GJXA 3WEZA 1UWTA 1UG6A 4J3VA 1C3FA 4AZBA 3A23A 1BAGA 1JI2A 1JD9A 5JIWA 2A3AA 2D23A 1ZBVA 1E0WA 1C93A 1N82A 1OBAA 1E9LA 1Q6FA 1UASA 5EB8A 4MPKA 3VTRA 3CZSA 1H1NA 1HL9A 1T0OA 3VKKA 4UFHA 1GW1A 2PWFA 3F5KA 3U5YA 4J3WA 3KL5A 2O9OA 3T09A 1JDDA 4MADA 4BQ5A 2ZUWA 3L4VA 1E56A 4W85A 4W7WA 1B0IA 1LQ0A 1ODUA 3MS8A 3VINA 2BXYA 1ISYA 3N13A 3L4UA 5C70A 1KGXA 4P8UA 1UYQA 5E0FA 5A6BA 3CUIA 3WL0A 2UWFA 1UA3A 4W7VA 3VGDA 3VIGA 2W67A 4XB3A 1JYXA 1DWHM 1LL6A 5D9PA 4QP0A 1LWJA 1H0GA 1OIFA 4NX0A 1E55A 1P6WA 3BSHA 3WNNA 3DYPA 1GOOA 3SCRA 4HMCA 4HMEA 1DWJM 1MYRA 4HA4A 3S6TA 2YA0A 2BY1A 1DWIM 3ZSSA 3FAXA 2HISA 3NDZA 5A8OA 3WH8A 1EOMA 2EEXA 3AROA 3RM8A 1UD8A 3PZIA 2W91A 1SZNA 3DX1A 2X2JA 1SR0A 3CUJA 3UG3A 2WVVB 2J77A 4QCEA 3A4WA 1OGSA 1TQSA 4J3UA 1H2JA 2CBUA 5CXPA 1GORA
chains in the Genus database with same CATH superfamily
4QE5A 4Y89A 3QWRD 4XXCC 5HYJD 3GNDA 1RPXA 5DHVH 3TW7A 5HMFA 3SCMC 3CUXA 5IB1B 1PKNA 2WQXA 5CPNA 5GGVY 4PWJA 1U3HD 5MKGB 2QPEB 4ROPA 3SCMA 2FLRT 3ALXA 2ZPKL 1A6PA 3VH8A 2XH0A 3UBXB 4GX8A 2Z6FA 2F54D 1WFOA 1HJQA 1XQ4A 2J9XA 3FSUA 3QUYB 4S1DC 4PMEA 4UUIA 3EXJA 3S4SB 5FYJL 5AEAA 4BS0A 3MNMA 1L6YA 4CBZA 2QKIB 4HWBH 2E7HA 3QDGE 4ZYKB 5L8KB 3DI0A 3AXHA 4PGZA 2GSIB 4I89A 4HVBA 5IW6A 5CINL 4PLNC 4GAGL 5JPNB 4TOQA 2E8YA 1WK0A 3OVUB 3U83A 3NZHH 2QEJA 4OW6A 4PI0A 4M3PA 1KN4L 4N90D 1JK8B 3ZL2A 2PMZA 1EX0A 1G87A 1P4IL 1TENA 3FQWB 2XINA 5TQ2H 4ODVL 3VA8A 1U8HA 2VFIA 4I3RH 1TJPA 4JM4H 4MLJA 3CZEA 2FECI 1G7UA 2AJVL 5GS1B 4Z23A 2B0MA 1LO5B 1UA6L 1OCZB 4K3GA 3C5QA 2ESVB 1YHTA 4OIBA 3D4GA 3P73A 1N7ML 3CXFA 4ZO6A 4ZPVA 5DS1A 4M93C 2F0CA 5AVZB 1NMAL 3MCLH 3S8FB 5DXWA 3WH7A 5HJYA 2NY6B 4REQB 3TXVA 4AZGA 2Z1WA 4ESKA 1ZIAA 1BAWA 1Q9OA 1M7UA 5IHRA 3N06B 1P2CA 3DHDA 3PBVA 5F21B 3GIPA 5BXFA 4YWGH 4O11A 4KO7A 5C09B 4Z2IA 1SF3A 5JORA 1JPST 3IETA 1HJSA 4QXTB 1WD9A 5HDLA 4INFA 1OSYA 5L2JA 1JWUB 4XOEA 4U31A 4WJXA 3AQDA 3CZ8A 4LPTA 4JIEA 3I7SA 3TLLA 2YQBA 1Q6GA 3AU1B 3KYMB 2VC9A 4I7WA 3V79C 2ODOA 4NJJA 1B3OA 5J13B 5JMUA 4DF2A 5KMYA 4HJUA 2ZRWA 1E1CB 4EKXA 1E3ZA 4EI0A 1WKEA 1XBDA 4C6FA 5IM7A 5CUSL 2VDQH 4HUKB 5FGRA 4JFEB 3EYUL 3HUJA 5FB8B 1XEUA 1IHIA 4J3XA 4XP1H 2YMTA 5I6XC 1DE4B 2PP3A 4OM1L 4DJED 4H04A 3WQ5A 1MCSA 3FC8A 1ESWA 4PJBE 1HKKA 1AY1H 3LIZA 3PFQA 3ABOA 3W2KA 3B6SA 4RFEA 3TT3H 2IKGA 4DHGA 5ALCL 4RPPA 4LOVA 1ZK5A 4QDMA 5J5EA 3EJUA 2EBNA 5EMJA 3N2TA 4JDVA 4PRBA 4UQBA 3SY0B 3U6RB 1ZBWA 1GKPA 1GGYA 3OGOE 4EQ3A 2Q7YA 4ES8A 5EEXA 3ZE0F 4HJJL 1MRFL 1JDCA 4TUKL 4YZFE 1U3YA 2UY3A 3TYGH 1OOWA 2E47A 4XZ4A 1GOFA 4GX9A 1JRHI 2ALAA 4NIRA 2IOIA 1T6VN 5JW4M 3ERPA 2YGQA 5TQ0L 2GOKA 4PR5B 1H6TA 5ID1B 1UZ6E 4DGVH 1TTUA 4CVUA 3GSRA 1NOLA 3TZNA 1SJHA 5INDB 4YHMH 4LFYA 3ERXA 3KRSA 2OKTA 1MIML 3CHOA 4R5XA 4RAUA 1CFTA 3Q94A 1BGAA 2WQUA 4Z7UB 4JO8A 2X9XA 4NZUL 1HIML 1TKWB 5FF0A 1JNHA 4ZO7A 3P11L 4BH7B 2FO4B 3L08A 4WFGD 4LDCA 1TR9A 3SIKA 1NWOA 2QV2A 2VLME 2OV0A 4JD4A 2F74B 3KNBA 1TFVA 3SRHA 5FLVA 2ZCZA 3B37A 2IANB 3ZW3A 5CJOL 1IQWH 1DL7L 5DFTA 3BWWA 1T03L 4GUPA 3C5SB 5CS7A 2ZUYA 4Y16D 1K9DA 5CO1A 1S2TA 1YQVH 2VR3A 4LHQB 3VFCA 2L8AA 1U8QA 4F3FB 1RH9A 3TEZA 4S0SD 2ZF8A 1NAL1 2Z93A 3X2QB 3F7YA 4HF5L 2VUYA 3NDOA 3GMLB 2HLAA 3I02B 3BT2H 2DQIL 5M5DA 2AL1A 4J3OD 2IQDA 3SO3B 1CLOL 2GFBA 2EXWD 2A4EA 5I16B 1FNEA 4HV8B 1CFNB 1R5VA 3QF0A 4LKXB 2EINB 3K13A 4ZAKB 3CHEA 4TNWF 5HI3C 3URAA 3B0VC 2ZAGA 4F5CE 1ACZA 5I9QB 4WR3A 1GONA 2NUYA 4O4WA 2Q6WB 5LGHH 1ENUA 4G6FB 3V4PH 3WHXB 3IN2A 5HHME 1Q8AA 4N3TA 4OZHB 1IM3A 1MCDA 4DP2X 3LHVA 4IOIB 1USQA 2KQMA 1XLHA 2FB3A 4OWGA 2P47B 1NKGA 2M26A 4D7PA 2N1TE 1E6ZA 5IVNA 1M71B 4Y7MA 3SJVD 3R7QA 4B15A 2FTWA 4GKSB 5CZTA 2PDIA 2KZ1B 4LF3B 4LARH 1QACA 4DCQA 1HCYA 3UEQA 4XZUB 4QSHA 4HWEH 4IBSA 2EEDA 2J1YA 4D9LH 5EFFA 4FB7A 3QZOA 3JV4B 4B50A 5D5ME 2A3BA 2ZUNA 4NKMA 2VLKD 4HZMA 2LOEA 3EF4A 1DO6A 3E6HB 1Y18A 4CVWA 1IMHC 4HCDA 2Z31D 3O07A 4P2QE 3BLOA 5I1IL 1QLRB 1E73M 4E41E 3T4WA 4RDBA 1CLCA 3QSKB 3INPA 5A3ID 5C8BB 4MY1A 2BMKB 4P2OD 2PR4H 1NOAA 1MI5B 3ARRA 3FL7A 5DRIA 3VTMA 1LQAA 3CFTA 5GHWL 4AG4L 4MUZA 5J7CC 1BYNA 3GHSA 5DTFB 2DJSA 3SI9A 4U6HB 5TK4A 3IJ6A 3T1GA 3EJZC 2HFTA 5JUEL 4MHHI 4GBXB 4Q32A 3H9HB 2GT9B 3GSOB 3L17A 3EHBC 2XPZA 2XG5B 1D5ZB 1DDHB 3H7VA 4P49A 4PGBA 3K2GA 1AGBB 4IKKA 1G6RL 3VGFA 4KUZL 4QRPB 4ORGB 1DQIA 1OYCA 3IJQA 1EKOA 1BWLA 3ZJ6A 4LGXA 3W6MA 2EZ0C 3B9NA 1U8LA 4ELMA 3HIJA 2DL9A 4NZ3A 3GH4A 2CPCA 3GHBH 4K3DL 4F80A 4Q4RA 4HIPA 3V4UL 1JS4A 4LAUA 1HX0A 4U3SB 2JKEA 2H2PD 3CH8A 1AODA 5E99H 4QRQA 2VLJD 3MODL 3BEVA 3VWKB 1AKPA 1S7RA 5IHZA 4YLWA 3VXOA 5IBTL 2TODA 3MRLB 3GF8A 2JKAA 2O93L 2ZG2A 3STBA 1CG9B 1Q1PA 4MNQB 1W1TA 1CD1B 5BQ7B 3WTWA 4J8RB 4M1DL 1U58A 3FQ1A 4O28A 4IQDA 3QQNA 5IMOB 3C5ZD 2D0HA 2HS8A 2AXFA 2WHMA 2VERA 4EUPH 2YPLD 5CZVL 5DJZA 4K23L 4O58L 4L8DB 3UTTA 5FX3A 1ML1A 3BFOA 1ZAJA 2W4XA 5I1AA 5C71A 1AO7A 3SE3C 3D7PA 3U4FA 3E0FA 1YDVA 3LNDA 1X1OA 2BS9A 3EJRA 3WQ6A 2J6WA 1U95B 2CCRA 3CFIC 1G7QB 5D4JA 4XZNX 2QF7A 3CX2A 1MCPL 2X40A 2XZQL 4L61A 1OGTB 2AJXH 5ISZE 1DEEB 3JVFC 1REQB 4PUMA 4HFUL 1HQ4B 1OCCB 4O1AA 3FY1A 4O13A 1A6UL 3WKQA 3BAYA 4FS9A 2BV9A 2DEYX 5ANME 3RDTB 1QW7A 3RX7A 1Z7AA 1WZ1L 2ZX9A 1XISA 4XNQA 1T22A 1AOHA 3AS3A 1D5MB 5HDBB 4FG2A 3DX7A 2YBTA 5J04A 4LCYA 5C0EA 3BZ4A 4N4QA 1IAIL 1NDGA 3WUBA 4R27A 4Q6IC 2I60L 2R2EB 3RWIA 2CYGA 6A3HA 5DCDA 3AIBA 2BVQB 2DU2A 4Q6IA 2EXYC 2UX7A 5K33A 1WBZB 4H88H 4ZX4A 4CCEA 4ERSL 2G3NA 1LO0L 2I7OA 3HG3A 5FEWA 4EOWL 4W9IC 3M0VA 2Z1BA 1UGNA 3B8IA 1H5BC 1IL1B 3WLIA 1UCBL 2D9QB 3QEUB 4HUXA 2AZAA 1JF1B 3DUUA 1NGXA 3QY8A 4PJFA 1H5BA 5BOPA 1PVHA 3S8GB 6FABH 2GQ8A 2CDFB 4YSDA 4IRJC 4JX6A 2PBOA 1E2ZA 2J55A 3FH7A 5E4IA 1NARA 3GRWH 1GGCL 2PLMA 4Z1YA 5J3HC 4KZEL 4IRJA 5J6GA 2WLIA 1NP2A 2NY1C 3VG9C 4WFHE 3EH4B 2Y3NA 5GS2H 4TV3A 4PMFA 3C2EA 3ORWA 1XX9C 4UAHA 2ZSVB 4JN1H 1M7DA 5IQMA 1K5WA 1K3UA 1MCFA 2NZIA 1KGUA 5DJ6A 2ZZ4A 4MASA 1XH2A 3QZNA 3GW0A 3R4RA 3KFTA 3QW9A 3KBHE 1X4XA 5GNYA 4HJSA 1OAYL 1IE5A 1FNAA 4IP5A 5K9JH 3EO0B 4QPEA 2E4TA 1MWAB 5F7WC 1WXZA 3TXZA 2X2HA 1RUPH 4UQ9A 4FP8H 4MJMA 4A2FA 1C12B 3RI5F 1OX5A 3FSTA 2VZ3A 3S6DA 4UAOB 4WNQB 2BFVH 4F7EA 1DIDA 1JF5A 4JGMA 5BS0E 1D5XA 2BHZA 4JKPL 1FH7A 2R4SH 3SDXB 2LR4A 2K9FB 5L6YL 1XSJA 3BW9A 2H90A 4LALA 5GRWA 2Y7NA 1G6RA 4KWOA 3LD8C 4P5KB 1KN2H 3IGHX 3EX4A 2OWXA 4JRXD 3VIIA 1X5FA 3UP1A 3HC3L 4PJXE 4TS6A 3GLDA 3MLZH 3VGGA 2RCSH 2A7NA 2BW4A 3EBAA 2BWIA 1TCDA 1KC5H 5FM5M 4CQCA 1QR1B 5B3JE 1BKSA 5FW8A 2OTUB 4KROD 3F12A 5GGSA 3I4KA 2JB5L 4M6AA 4F7MB 3WMCA 4IKIA 1UD3A 4P23C 1E4WH 4OZGB 2PP8A 1NY1A 4PJIA 1P5BA 5A2KH 1ZJIA 2IALA 2P3EA 4P23A 2DZPA 3QQ0A 1FYHB 1LEKB 2DQEH 5L9DL 5CHNA 1P7BA 4IG2A 2DICA 4JFQA 5IB4B 3PTQA 5LKYA 1U30A 1VF8A 3D0CA 1A1NA 3BSMA 1R34A 1TVLA 1MSPA 3B9DA 2R39A 3LDBC 2BASA 3MLSL 3S5LB 1EX1A 4GUGA 4GY7A 3UP6A 2IPUK 2ORBL 4NASA 1RV8A 2O61A 3TAKA 1XL9A 3DUSA 5AZ2H 2EDKA 3S88H 1J9TA 3E6FB 3W1XA 4LLAA 2ZFAA 4QXIA 3GSWB 2QGBA 3QPZA 1IIKA 4TTUA 4PWIA 3QYMA 2Z0UA 1I0DA 4N26A 1T21A 4OGZA 2HN7B 2E8ZA 3JV5A 3M86A 4KEUA 5I6SA 4S2BA 4JTIA 4JY9A 3EFFA 4TULL 3QHTC 2V8ZA 5J57B 2HT3C 4TV6A 1P4BH 4JY4A 3PWPA 1VFOA 3LH9A 4MWAC 2X3CA 4P2RE 4EX4A 5T1DL 1JP5A 4YHOL 3QKZA 1ZD6A 4PJ8D 2CE6A 1PTZA 3GFXA 4KKBD 5D1QD 4MWAA 4MAUH 2EVJA 1ETJA 2G5UA 4H6EA 2HJLA 4XO5A 3AOFA 3WKML 4LVGA 5CR1A 2OKOA 4P61A 4GXMA 4URKA 2EVFA 1U36A 3B9KD 3GHEH 4GAYB 2JGYA 2DLEA 2XYCA 3B2PA 5E24E 5AB2A 3IUHA 4AGOA 3LQLA 2E9JA 1DVZA 3VFWB 3MO1A 4JFFB 4YFLF 3V6FA 5G1YA 3QDJA 1SDAB 3E8VA 1N0XH 3JV0A 4NFDA 2BOCB 1JE6A 1MRDH 3LPWA 1RCOB 1WGVA 2P8BA 4RRPG 1U91B 4H9MA 3BGFB 4OU3A 5TDNB 3MNWB 4Y9NA 3F6IA 2G5BB 4RZCA 1UKSA 3BISA 5IQ9B 4WI6A 2NY2C 4MD0B 4JTRA 3O4LB 4LCWE 2IH1A 5LGXA 4BF7A 2GI7A 3A6CH 3NCBB 4KJQD 3AT8A 3GINA 1ZLUK 3UDWC 4ZUSB 5D7SL 3GNXA 3QR3A 3D33A 1GOIA 5DCCA 4ILDA 3D25A 3LN4A 2J5LB 4FLQA 3O0LA 4AIZB 3UDWA 1GG1A 4RDWA 4JN2A 4Y1AA 4YO0A 5B38B 2GI0A 3BPCA 1E9IA 4FTVD 4P8VA 4LASL 5F9OH 5BRZE 1D8CA 4I13B 3VXME 4ZUUB 3BGMA 5LKNA 3PSWA 1ACXA 1W32A 5IGXL 3KEDA 1CXLA 3GXTA 4K1WA 2GY7B 3GC4A 1ETZA 4LBUA 1D6EB 1R46A 1J1XH 4QXGH 3ZKXC 3UZWA 4A35A 2YQ3A 2F84A 4FXGB 4AZBA 1TFPA 4LLWA 3AYVA 5JIWA 4WCYH 4AQ8C 1MXSA 3NJVA 3IJDA 4OU1A 1K2DA 3PGDA 3FTWA 3CSBA 1GW1A 2GWNA 3DNKA 3P9LB 2AVGA 1TZ9A 4DVOA 2P8PA 3T09A 2JK5B 4B5TA 3N2XA 4AQ8A 2BXYA 5EBWB 4U1JA 5ICXA 3C61A 4AC2A 1LLZA 3FFCA 4Y5XB 3RLHA 3D69B 4LLMA 1RCQA 3JBG7 3GSXA 4DK3A 4MMXA 5CBJA 3UTZA 3BJ91 1ET5A 3KBVA 5D7HA 4LCSA 3DENA 5D2YA 4NX0A 12E8L 4RDYA 1IJNA 4HMEA 4O17A 2PTDA 3WKYA 3ZSSA 5IF0A 1Z3GH 3TFKD 5E2VL 2WHVA 2AEOA 1VS1A 1A1OB 3UG3A 5BPPA 3NA9L 2OK0L 1VACB 3UPMA 4PUWA 5CSBA 3BV7A 4UIMB 2EEBA 4HU8A 3QXUA 3C3NA 3ZKMC 3BZEA 1T1ZB 1WNOA 1RZFL 4QY8B 4D1IA 3RZCD 3CLFH 2XPKA 1KFLA 4YZWA 1ZA6A 4PPTA 1M7JA 5KSBB 3T2PA 1NAMH 2FJHA 3MRRB 1N64L 2A77L 3LKNA 4Z18A 1HNYA 3IFLL 3L81A 5U7SA 3VFGH 3VRIA 4F58L 1BZ7B 4K7FA 4IK7A 1S5IL 5A16A 1A6VH 1WP6A 2GJ6B 4EIGB 2VEFA 1SJEA 4AY7A 2QQNL 1P7QB 4HCRH 4B92A 1B4KA 4H9VA 4DI8A 3LN5B 4KKQA 4IFOA 2JTYA 4NZFA 3MRBA 4ERAA 2OMZA 2VYOA 4P5SA 1Z2KA 3ZGHA 1V7YA 4S23A 4QCIB 1ZFJA 3A6OA 4YDKH 1U8NB 3WD3A 4EDWH 2ZJSH 3G08A 3MLTA 3AT0A 2BSTB 2WMFA 3LCXA 4X80L 1ET7A 1J96A 4K2UH 4KFNA 1TRDA 1IGML 1KG0A 4N0FA 4FA6A 1P4UA 3FQUB 4WJ5A 1GGBL 5LXEA 1YBQB 3QZAA 1JV5A 5IQOA 2A7RA 4I85A 1MHCB 3I50L 1S7VA 4WWKD 4Y4KC 3MBEC 3EWZA 3SKMB 3GSMA 4OCXL 1F6PA 1RZKL 2F53D 5D4YA 2X4UB 4O0ZA 2B7PA 2CQVA 3ZZSA 5C2BH 5GGRY 3U7YH 4Q7IA 1PAMA 1YN6B 4Y4KA 3MBEA 1NQKA 4R2GC 1H49A 3UPCA 4F1SA 1BWWA 5DRNB 5D37A 3TU6A 3CBWA 1JWMB 4A1RA 4FZEH 2LLEA 1XH3B 2C3WA 4FQ2H 4YVVA 1UT2A 3GZKA 1KFCA 3IJSA 1QRNE 1F2XK 1KGYE 2VDLL 4AQ1B 3S97C 4FIQA 1X4ZA 1F76A 2AGKA 2R1LA 3STFA 1JYVA 4H8PA 4RGOL 4KI5D 3QHNA 2FFIA 3BH8B 3V5KB 4NKOA 1ETB1 3ULVD 2BP0A 4JZOA 1ERNA 4JAMA 5HGGS 1QTWA 3MV8D 3NIGB 3L54A 1OB1A 3NJXA 2EKCA 5DQDH 4PJIF 1RBAA 4M1CC 4HG4J 3GK8H 2X7VA 3QFJB 5F3HB 1CE1L 3Q9QA 1UWYA 1LXMA 5HYJA 1UWUA 2VGBA 2AJZA 4F91B 1S9KC 2PO6B 4JPIA 5E9DB 3MNZA 1LQ2A 3KJ6H 1QI3A 1J8HB 4RMUA 5CFAA 5L7XL 3LCHA 3FO2A 4MCYB 1MG2C 1OZTG 5F88B 1K4CA 2F54A 2EAEA 1LWHA 1ICTA 5FO2A 4HAFA 4UWMA 4HU2A 4K9JA 4XBSA 3EAKA 4N24A 4NKIL 1F7BA 1CTMA 1EJOH 1WUEA 3LLDA 1YY9D 1X7FA 2CO4A 3QAZB 4OE7A 4X2UA 1H7WA 4W5UA 3FH8A 4OJAA 5E0CA 5T8IA 3ETBJ 2PD9A 1C8PA 2OYLA 1NGZB 2A5HA 4AQZA 1KNWA 2HRGA 2PYEE 4PP1C 1DVJA 4C5ZA 2VXUH 5FKPB 1YEDA 4XUYA 4XCCL 5HJBA 3TV3H 1NTDA 4PC8A 1RK7A 3LOWA 2YD8A 3NZ8B 4Q9RL 2QAPA 2YL6A 1F3JA 1GQIA 2K6YA 4UV7L 1H8NA 2OMBA 3SY8A 2K9UA 4PEKA 2XY1A 3US1A 2B7NA 4ZMZA 1G7PB 5FPIA 1ZSDB 2IG2H 4YQXH 3F7JA 3U5UA 4MKNA 4PTXA 3TQ0A 3IDIA 3P40A 1SUJA 1W3TA 1E5AA 1R5WB 7TAAA 3WFZA 1NM4A 2MNJB 5DQ9B 2HG0A 1NMCC 1PD1A 3TNNB 1VCFA 5B1JC 4CDHA 4MGGA 3U30C 2JB6A 3BG3A 2EF9A 3UTSE 5AC8A 5C9RA 1FHGA 3HPJA 4AL8L 3PL6B 4O50A 5KYUA 5SWQA 2XM1A 4APQD 3SBFA 4RDZA 1JYWA 4CN4A 5BVJB 3VZYA 3DU0A 4HK7A 3HCVB 1RZMA 5E09A 3LTPA 2XFRA 3N17A 4MNLA 2WQDA 2BPBA 4N2DA 1UPPA 5CD5D 5EPMA 3QYSA 1A5FL 5TE4H 3KHJA 2JEPA 3Q7JA 1FUNA 4NZTH 1MEIA 3MANA 4AQAA 4Y6GA 2VR9A 4NC1E 4XXWC 2AK1L 3FNKA 1YDNA 1NIAA 1KM6A 4N4YB 1CGSL 3WFBL 3S36L 3HG2A 3LY0A 2A3CA 5C9JA 4XXWA 1ZV5A 3S35X 3RX9A 2XZCH 1GRWA 3RUGE 3WFDL 4KV5E 1AGDA 4Z08A 3MBXL 3UGUA 1RZKC 1Z66A 4RFNC 4I3SH 4NZRH 1W9UA 4BI7A 2JELL 3TVMB 4FNLH 3R0NA 4HOXA 3AQUA 4NXKA 1YY8A 1UQSB 3A67L 4ZBCA 1E51A 1S2WA 3MUY1 2OJEB 2CNZA 3I84A 2ADIA 4LVDA 4UT9H 1TLMA 4HZ7A 3X1EA 2I5GA 2OL3B 4YUEL 2Z91A 3EO1A 3LRSB 4FEMA 2I9UA 1AE6L 4MAYC 4QTIH 1H51A 2ZXQA 1FCVA 2DYPD 2G4GA 1XS2A 3S42A 2CRZA 4DAGH 3PUUA 2B1AH 5KVFH 2JKIS 2B59B 3EJTA 4MAYA 2NZLA 4GRWB 1ZJBA 1GS7A 2WWMD 2I24N 4ZXLA 4LGSB 3KM2A 1GGUA 1FZKB 1KCLA 4GUOA 1P7TA 3AZSA 3NJNA 1IGJB 4HS6B 4XP6L 2Q8BH 4HHPA 4O52A 2A9ML 4M29A 1FV1A 1A14L 2G8ZA 3LI0A 3PTMA 5GNXA 2NZ1A 4PFMA 3DIPA 5BZWA 2J1WA 3K2UH 1V3MA 1FL6B 2BMBA 1TTIA 1EJRC 4B95C 5D93B 4JFTA 4CQAA 4KKAD 3KXFE 3ZDXB 1KIPB 2VZOA 1JVOA 3IN0A 1JPKA 3VWJB 3D3VB 3CLWA 1QFWI 3EUDA 3VW3H 1AQDA 5F2MA 4LPWA 3CG8A 3H2FA 4UDUB 4NQCD 5G2IA 4OCSH 1NGQL 4ODUB 5FKYA 4F9PA 3GMNB 4DUOA 4QXVA 1KIUA 3D39A 3E9UA 1AH4A 4Q22A 1WWCA 3TBSA 3CHQA 5KS9B 5MEOB 3N25A 1GMEA 2NLJB 4XN8A 3KBJA 3KLDA 4HA0A 2NQJA 3VXRB 4J3BA 1RVFH 3QPKA 3UO1L 2ADGB 3GYRA 3ATYA 4ENLA 3ABSA 3M6YA 1FZJA 2YARA 3NIDE 1MNSA 3FPXA 2UXGA 4PUEA 1JN6A 2QIIA 2YGNA 2Z34A 4QLWA 3I6GB 1ADQA 3HE7C 1QI0A 5SWUA 5K9CA 4CVZA 2V7NA 1MF2H 3VSUA 1BAFH 3RPIA 5CP7B 3HE7A 1KTDB 2FVNA 1FGNH 4JRLA 4TQTA 4XMXA 1L9SA 4IGBD 2YCLA 4OCWL 1FN4A 3H6OA 3M88A 1A3HA 3SJNA 1RLDA 3N43B 4U7MA 3TMQA 1W9PA 4DQOL 3OPSA 4DRSA 1N4XH 2BHFA 3TC6A 4XC1H 3HI1A 4XD4A 1JRHH 1TF4A 4AL8C 3X13B 4LSSL 1C29A 3ESOA 3MJGX 1QBLL 3C8DA 4EPSA 1R3JB 1EZLA 2FJFA 4JZJB 2SODB 3ABKB 3HG1B 4O4YH 2MTAA 3PDDA 1M7IB 4JM2B 4AD1A 3KTXA 1JGUL 2O6FA 2OZ0A 2C71A 1THFD 4NAJA 1UURA 2HRWA 3MUCA 4OVUA 3N5AA 1YNLH 3DI1A 1G84A 2XSBA 3MHFA 4TUJA 3V6BR 2WZMA 1ZHNB 2KKQA 3DUHA 2OXGA 1J79A 3JTSA 2O5YH 3C0QA 4ZFZA 1SFDA 1OLLA 1A0EA 5D8ZA 1PYWB 3ML9A 2APTA 4W8BA 2WBJB 4LVFA 2WJEA 4KHXL 4MJ5A 1J5CA 1R3IL 1LE9A 5LWYL 4MZ3A 3GR4A 3W82A 5KOVC 4GRLD 5DD1L 4HPOL 5I78A 3ATAA 3NSJA 4P2OA 4U5KA 1IBGH 1W2KT 4UILH 3V6OA 3W1ZA 5CGQA 3EJCA 4TSAL 5E2UL 4RBPK 5E8DL 3LH2L 2NZ9C 2XX0A 4LYRA 3PIQA 1MRCL 3Q45A 4HFWA 3RNKB 2VGIA 4N1HB 4X7TA 4NLAA 2CC0A 1A6WH 1CDIA 3DFYA 1PJ9A 4NQEA 3CSYA 1FL5A 4G6JL 4MQTB 3ORJA 2FWLB 4YHIA 4ADIA 3UG8A 2WXLA 4KK8C 4UFJA 3BV4A 2QGDA 1DKWA 1P4LA 3U0HA 5CSUA 1DHPA 1P1MA 4KO5A 2GCYA 4L3CB 2PDJA 3LMYA 1T7VA 4NSBA 3ZJ8A 3H85A 4JB9L 2E77A 1SSDA 3IUIA 3MJ9L 4Z2KA 1KFKA 4PN2A 3GG7A 1ELSA 3M1CA 3OQRA 5DZ9A 1B3YA 2VLJA 5CCGE 1F1AA 1FLRL 2WO5A 3AG2B 1NLBH 5C0CE 4OD2A 43C9B 1L3WA 3E6EA 2NY4B 4FFVD 4CILA 1B3JA 1CLZH 2VUKA 1D7CA 3VQ1C 2KDYA 5D55A 2B14A 1W3LA 5KSUB 1R3YA 5DHEA 4ZXBB 2Q6ZA 1N68A 1A4AA 2J7DA 2BNRD 4FA7B 2UV8G 1OSPH 3M17A 2OR9H 3BJTA 4CLMA 4KDWA 2DT0A 5K1NA 3RPKA 1GT8A 4P4RB 1RU9L 1HU8A 3BQUB 1CT8B 1VH7A 1E9ZB 4RQQB 5FV1L 1JNDA 4ANWA 5AKVA 5IB5A 5EOQL 2V2WB 1N59B 4TNVF 3WNKA 4BI6A 1XYMA 3TH6A 2CDEB 2VX6A 3TW9A 2EYSA 2KPNA 4KZDH 3U0PB 1HO4A 2Z8SA 2WJ5A 3P2VA 5D72L 3DSFH 3M0JA 3EX6A 1Q0EA 3I9PA 2NRDA 1PEZA 2E1WA 5I8OL 3N1FC 1MFDL 1N5YL 3U7BA 4XBKA 2JSFA 3LJ3A 1C5DB 1FQ0A 1NKRA 2WWKT 1EQPA 3CM4A 4KNTA 4XN7A 3DKLA 3STZB 4N6FA 1E3XA 5F4XA 4S3KA 2QYGA 1SOXA 1KLGB 1GKEA 1XIDA 2OTWA 5D70H 3RVUC 1GJUA 5CC6A 3BHBA 2E6YA 3RIAF 1V3IA 1XLKA 5E9AA 4P57A 1LF1A 5BOOA 3QQWA 2B9AA 4XMPL 4TPRH 3UWYA 1RQBA 4A38A 4WEMB 5IMMB 4O5LL 1HKWA 1EJWC 2EPOA 4LBRA 1KFAH 4H2CA 3PZNA 2IPTH 2WAQA 1RUKL 2K8MA 5CZ0A 4OD1L 5I15L 4LSVL 5BV7L 4BQ9A 4FQJH 3RHWK 1W72B 1W9DM 3ATDA 1RALA 1W17A 1YKWA 2DLFH 4MXWL 4WFFD 3QOMA 2QCGA 4NUGL 4JPGA 2V3FA 1X8FA 5CZXD 1YEIL 1I2PA 3UA4A 4FXTA 5CMAB 2WJDA 1C9SA 1ZLSL 4HX1A 1WA2X 2OMXA 2TYSA 3GTHA 3U6XA 1J2WA 2MCAA 5E6SB 2OQYA 1ROCA 1JCKA 4DETA 2K4WA 5I1GH 3AUVA 2HRPL 3GT6A 3F01A 1TQXA 1EUAA 2VR5A 2EADA 1U8OB 1UR1A 1QR4A 1SFJA 2JJVA 2XTJE 4L4TB 3RPDA 3UG4A 1F6KA 5F6HJ 2IMNA 1X5HA 1BM7A 2R23B 3ZJ7A 4DBWA 2UYLB 2OYPA 3IGUA 4XX5A 4OGXL 4YIQB 4GBUA 1EGMA 5ABFA 3QXAB 3VUSA 4PV9A 2ZAHA 1OE2A 5CPQA 1YMHB 5IHWA 4L4LA 3U9PL 4C4KT 2VUNA 4AH2A 1HNFA 4RUBA 3UIZA 1Q38A 3NIYA 3K5SA 1W1YA 5E51A 4AD2A 3G5XB 4RBPH 1OQOA 4W6XB 3IGFA 3ARDB 3APDA 4JKNA 2DQHL 1GL4B 4ONVA 3A6BL 1IBBA 5KSVA 4H9UA 1JZHA 2QADD 5EO1A 2WGXA 4UM8A 2ZICA 4G5AA 3V0JA 4V1XA 2LVEA 3W2DL 3MJ9A 5HHPA 3PHQB 1HJCA 1A7OH 1A80A 4XTRC 1FBAA 4POUB 1KRBC 3VOGA 4JKWA 3CHPA 3VDGA 2E74C 1D3HA 4X5XA 2H3XC 2CUMA 4L1GA 1POKA 2ZZ1A 2VXQL 5KSAB 1RQ5A 4A2GA 1IJ9A 5ICYA 1T0OA 1GTNA 3U5YA 1Z5YD 3QR2A 4PJCA 4N8CH 4FKKA 3T0ED 2WBXA 4PCYA 4FX6M 3ID7A 3VI3A 1KXTB 3VD2A 5D1XC 3NXLA 1NF0A 1NJJA 3ZE2B 4R7DA 4PODA 3HTWA 4O1FA 2Z25A 2V81A 4I2XE 1TMLA 5E5RB 5D1XA 2OB3A 2FJUB 1B2WH 5C6PB 3B43A 4NZ4A 3BURA 4XBEH 4G8FA 1LUCB 3CX5K 3FUMA 2CGRL 3WTUA 4PYHA 4LCRA 4O15A 2CJSA 3GDLA 1EOMA 4W9HC 2EEXA 3HB3D 5FYJU 2AK4E 3PJSA 4ZFQA 2W91A 1SZNA 3DX1A 1PYMA 2J77A 1M6OA 2CRYA 5DK0B 4J3UA 4X8JA 2CBUA 1GORA 2P9RA 5HVWA 1YLVA 1YEFL 3MVTA 4QOKB 4U4MA 3UPBA 3KGUA 3DHJA 1KM4A 1IEIA 3MFFA 4L05A 4PJ8A 1F41A 5H91A 1THCA 2MFNA 2I9LA 5D1QA 1NBZB 1QBMH 3H9SE 1T5AA 1Z9LA 2CCVA 4G9DB 2JI1A 3AHVA 32C2B 2ZXEB 3B9KA 1SJMA 5H37G 2KLSA 3ZL4L 3CHDA 3ANYA 5BVPH 3BP5A 5LHEA 4G71B 3MBDA 4Z8FH 1QHPA 4JEQA 1FHDA 3CBKB 1ASPA 5SWZE 5F1OB 4LBEA 1T89C 1N6VA 3OXSB 4NQDE 2X88A 4XNYH 2HJKA 4XVSL 5C08D 1V0MA 3EJYD 2NX1A 2ZWLT 3KPPB 1MCKA 2W0FA 3LSOA 1A1MB 5I30L 4J6RH 3I6LD 1T89A 1PD6A 1XC4A 4MZRA 3ZYJA 5IQNA 5BV7C 5EZPA 1RIHH 2A6NA 3QUXC 5L0QB 3NPVA 2C1HA 3GS6A 1OT2A 1NCDL 3H3PL 2QMKA 4KCTA 4LX4A 4JX5A 4WRHA 1I31A 3QUXA 2AQTA 4BQ6A 2WSPA 3WIFB 4XNUL 1BP3B 1BTCA 2PDKA 3IWUA 3IVUA 4K39A 4GPVA 3DDMA 3VZXA 4NZ8A 4MMYB 1JK9B 4FTVA 1QVOA 1G6VK 4MNHA 3WD5L 2OODA 3EB4A 3QRBA 2PGWA 3BYYA 3MUHL 1H3VA 4AVHA 1S46A 5EEZA 1XIWC 2LLLA 4XNZB 2WXHA 4O9HL 4PS4H 1NCWL 1T0NA 4GSDH 4NO0D 4E9SA 4E9QA 4Y5VC 2EH8H 1J48A 1I7TB 2ICWI 4ZMVA 3KYAA 3G18A 4E9TA 1XIWA 1GVOA 4PMNA 4RGNE 3T8MA 2NQ9A 4Y5VA 3VMOA 2FUQA 1QASA 2VCCA 4KVPA 5MENA 1LCOA 2AANA 3CFUA 1CF8H 5IVXA 4U2ZA 3ZE1B 2DQFB 3X1BA 1JHKL 1IAIM 4M7LH 2UZXB 4LIQH 4BA0A 2XFXB 1H0IA 5IT2L 3HC0A 5T5NG 4P5TD 5JR1L 5KYXB 4FFWD 4WF7A 1F5ZA 2OMTA 2DSZA 1T1XA 4GIPD 1ED3A 3KBPA 2ZA3A 2ED7A 5IHBA 4GKOA 1H15A 4Q8QA 1UQYA 2TSBA 5G4EA 4KMTH 2ZADA 2G2RB 2WXFA 4PMRA 2Z92A 3H8NA 1VCBC 2PE4A 3EWXA 2P88A 2QFPA 1W5QA 4YGVA 4KVCH 4FIRA 2ZOXA 3DJTA 4U1NB 5C0IB 3MACL 3OKKB 2C0HA 5G2NA 3HMXL 4YU1A 3WD2A 4X4MA 2EVIA 2RHGA 3RZCA 2VXQA 4HPGA 5IIEA 3CPLB 3UTPD 3TEWA 3WHE1 2XPGA 1IXQA 2DSVA 2FSDA 4HA3A 2BCMA 2H3NA 3EYQC 5FHBL 3RY5A 2MPVA 3EOOA 1HKMA 4MNGE 3SDDD 3VIFA 2JIXA 1E90A 3TQKA 4MA3B 3NWRA 1O9VA 1CXFA 1AG6A 3DX0A 3WF2A 4GG6B 1NF7A 4M7JH 4EVNB 4W4NA 2G4FA 5I03A 3NJLA 1N3NB 4NILA 3G1XA 1FF5A 1U2HA 4AGNA 4JO2H 4X4YA 4X9GA 3HR5B 4G70B 4PULA 1PF3A 1PHQA 2ZX8A 4JDEB 1L0YA 1IXPA 3RX3A 4I5BB 1IQDB 1URLA 3AICA 3V0WL 1KFWA 3QPXH 3OF6D 3IKCB 5GSVA 2R1YA 3V5HB 3ASOB 4BWUA 1QFOA 2ITDA 4QHLA 4KIEA 3WLLA 3NDZE 5GGQL 5EIIB 5IY5B 1RK1B 3W9EA 3TEYA 3IXTA 1ORQA 4HNOA 2PKDA 2HKHL 3HUJF 3FYYA 1THAA 1CU4H 4Z5RA 1YEHL 1G9NH 3UCDA 1EHXA 2YL8A 5AOJA 3P2BA 1ZLWK 3TA9A 3FKRA 1BF5A 4HYWA 2P24B 3VIJA 3QK0A 1PLCA 4NN6B 4PMOA 4TTDD 3PWAA 4KAQL 3TYDA 1EGZA 1BMGA 2R1PA 3B5GA 5A8GA 4AV0A 1JV2B 1AUSL 5I09A 4M7ZB 8PAZA 2OCZA 4KRUA 1VRDA 2Y61A 4EDXB 3ABQA 4LAOA 4H8HA 4NCC1 5HHOB 1FYTB 1RD5A 4N2GA 4QNEA 4LSRL 3IMUA 3ALWA 1KB5H 1S9XB 4Z2JA 4D6FA 4JCMA 4B0MM 4WJG3 2WW5A 4PREB 4IIQB 3TZFA 5I1CL 2Q76A 1GTEA 1XX1A 4FK9A 2VDKH 4IJ3B 4NO2B 1E2WA 3RGBA 1KLUB 1WVZA 2HE8A 3OIXA 4JFZL 1HXYB 3ES7A 1F11B 5L2KE 3MSGA 4P2AA 2VXTL 1SFTA 2WQPA 1VFFA 3H9YA 4DN1A 1GH7A 1EYWA 3AVEA 5I1LB 2VURA 3MU7A 1HCVA 4GW4B 1C7TA 4Q6XA 3JUGA 4ODWA 4Y4HD 4GY1A 1L9NA 3UJJL 4JKLA 4NC2B 1EIBA 2NYYD 4MXVE 1YDYA 5ESVB 4JREC 5HP5A 3ISWA 4HW6A 4PJCF 2ATMA 4JR9L 3GNML 2PTXA 1CGUA 2IQ9L 5KWYC 2A7BA 4JS7A 1TJHL 1OWQA 1YUKB 1EQWA 4PJDA 2ED8A 4MB4A 1P84K 4JN8A 1J5DA 1JCVA 2YUZA 4XGZB 3QRFM 4U6YB 3UBXG 1P5VA 2QPSA 3WFCL 2NUTB 1S9VA 3DOPA 3A4FA 1QO2A 4G7YH 3D6NA 1KV8A 3UJTH 4PGEA 4F8LA 1O12A 3UVAA 4WEVX 3TNBA 1TO5A 4M43H 3FXIC 2OX5A 3GVGA 2QSTA 3S4SG 2HJFB 2RGLA 1OCBA 3T55A 4UFLA 4D0DB 1LT8A 2VWEE 1W91A 2OLDA 2Y6SD 3GDTA 1ZRUA 3HRPA 4HETA 4H3DA 3IDXH 4XWUA 1AXSB 2FEDD 4OJCA 4JMNA 4CMHB 1UQZA 3W7KA 1TNNA 4YBLC 3P4NB 1XXXA 3ES8A 3N6YA 3O41B 3BWAA 3HMXA 1KJ2B 1Z69A 1SDDA 4MIMA 1XB6A 2CIKA 1KKRA 4O51A 1JPGA 3W7HA 1HEZA 1A5SA 4NL1A 3U48A 4MJ4A 4DN4H 1QPXA 4NU7A 3FB7B 1JZEA 3D30A 4XPHL 1SUHA 3F8UB 3MLYL 4A3RA 3QIWB 1FJ1A 2VKXA 3GKWH 4WCJA 1VA9A 3CQIA 3WS3B 5EYWA 1NC2A 3DESA 4DJDC 2DIKA 4WIWA 4NG3A 3QJXA 4F15C 4F0LA 4M3KB 1TVHA 1RVKA 2W95A 4DJDA 3ZQXA 2ZZ7A 4MD5A 4N68A 3PHOB 3U9IA 3HG4A 1N26A 4KF1A 2IQAA 4DJFD 4XB8A 3BPOC 5D2XA 4AC1X 1FWWA 2HUHA 3GZAA 5ENWB 3ICJA 2H2SC 3SD2A 1NFIB 3DMMD 2Q3RA 4NWTL 2P8MB 1E6PA 3IS4A 1BZ8A 4LLUB 4I9TA 5EZIL 2Y2WA 1EEUA 4FQXB 4GQ9L 3I9AA 5FO8A 2XJLA 1RUQL 3UMNA 4PWHA 2EP6A 4AG0A 3JU2A 1F90L 3DDGA 3QDMB 3L9RA 3NPZB 3K72A 3C6LB 4DNLA 3HNTH 4RXFA 4NGHL 4KEVA 3GRIA 2VL5A 3L7FB 3QQ3A 2NXYC 4PJEA 1QSFB 4F1ZA 4KJWD 4FABL 3TBBA 1ZT4B 3T3ME 1EC9A 1SBSL 1HINL 3MUXA 1KYDA 8FABA 3JZYA 1VPYA 3SGGA 1BIHA 2J27A 4YFEA 1OCWH 1FGVL 1UUNA 3W87A 1JAEA 3IFPB 3AHTA 5C0AE 1ZTVA 2MNRA 1YNKL 3WEAA 4JFDB 4FNQA 3TZVC 3QORD 1QWNA 5IVXF 3WNIA 3CHSA 4WUUA 2XRAL 4ORZC 4KBPA 3USBA 5AVXB 2FTYA 2XWEA 2VRQA 4YGAB 2EEFA 3TZVA 1UXWA 3RPBA 2DN7A 2XFYA 3V8OA 1F42A 4JHWL 4B9KC 1S38A 2XIIA 2VLLB 1HJVA 2DI7A 5EUOA 4EI5C 3VGHA 4ELMF 3ZYZA 5FF7A 4NIYE 5KVFE 3JTTB 4NJIA 2Y6TE 4EI5A 5D7EA 2DV6A 5E23A 3MRNB 1ITXA 4XCYB 4HSHA 1LDPL 1PWMA 3GR7A 1XKYA 4D9QD 4JO3H 3VOCA 4NNCA 7XIMA 2G3XA 3KWWA 1NMBH 1PTAA 5B80A 3RA7L 1TTBA 4WY7L 4NJ9H 3MV11 2VMEA 1YC7A 3LV6A 5TDPA 4XNBA 2VL4A 5D7LD 3G1YA 5LO7A 1QSZA 3QFGA 4MA8L 3Q58A 2G2PA 5D9MA 3KCPB 1MW2A 3CWHA 4UTWA 3SQBB 4RE0A 2BZCA 3O9WB 1MY5A 1V02A 5IVZA 1MEXH 3VG0H 4NAFA 1DL3A 4MMXC 3O6KL 4BM7A 1T1WA 3Q1EA 2VOTA 4L4VA 5HGAA 2CLHA 4X5QA 4RNHA 4V2BA 5JHDA 2ATPB 2OPJA 1XH1A 4N2FA 1Q5MA 3QEQB 1Z5LB 1AIFA 2FBJH 3HA0A 5CCZA 5IV2B 3MGAA 5F7NC 1I9CB 3V0UA 4JTFA 1GTHA 5GGRB 4CVXA 4X99A 3QI9D 2X2YA 4L1HA 3GGWB 4JHMA 3HLAB 3VIPA 1U8JA 2G9HB 3EJPA 3QY6A 3RDJA 1OGAE 2X5PA 1A6ZB 3KDPB 1DOSA 2IVFC 4UTAA 3LZFL 1HYSD 2NQZA 4YTUA 3VD9A 1I9JH 1UP3A 3L3JA 2NX9A 2GG1A 3BUYA 1BHGA 3QMRA 1X39A 2E7CA 3GFZA 1OT1A 4I4WB 3O7UA 1QWUA 4J1UA 1T4KA 2HH0L 1VPOH 1TO3A 3BVWA 5T91A 2CHOA 2L7JA 1AD4A 2HWZH 3OC8A 3GR8A 6ALDA 4J4PC 5DK2B 4BFEA 5LNGA 4DY1A 3DI3B 5LAPA 1G7JA 2OQHA 4E36A 4JQ4A 4WKAA 4NRZB 2OSWA 4J4PA 4LSDA 5BZAA 5LXVA 4PJFF 4B91A 4D0BB 5D7KE 1YNTA 3KD4A 4IPNB 1UM6H 4ZBJA 3KPLB 3MDJA 1PG7X 2ZXGA 4R7XA 5A8PA 4Y9PA 1A7QL 4AGPA 3N1QC 4WI8A 1FX6A 1MH5B 5HI4C 3QJTB 3WLHA 3C2AL 4R5VA 1XDLA 1G9EA 2YUVA 2FEEI 1YUHA 3LSBA 5G1TA 4O2CA 1UXSA 5IDIA 1N2RB 2JXMB 1BRLA 3AMKA 1CYWA 1TT6A 3W7OA 2EUVA 2VWTA 3OKNB 4AYGA 3Q5YA 3UL4A 1KBIA 4ZPTA 5FUZH 4Q4SA 3MRHA 1DVFC 4NN7C 1M6JA 4WK0B 4Q74A 4HCLA 2QDWA 2P80A 2O55A 2Z1KA 4BHUI 2R56H 2E3ZA 1AGEB 1DVFA 4JW3A 5KANI 4QRRA 2VXSL 1CYXA 3FYIB 3PPSA 5HYQB 3LS4L 4PJDF 3IFOB 3ZK0A 2PRLA 1DVXA 1IC5L 4Y9GA 4KK9D 2D3JA 1YECH 1U41A 2Z9TA 2XN9E 3UY7A 3QNXB 1MELA 3VCCA 3F5WA 1IV8A 5B7ZA 1ONRA 1PO9A 1TTGA 4KXZI 1H7OA 4Z7NB 3SD5A 2VDPL 1MZRA 3BPLC 2OCCB 2EDNA 5D38A 3L3OC 3N50A 3GIQA 4GB9A 3EYVB 5I17A 5J5RA 3TOPA 2XWTA 4LT7A 5IG7B 2X3BA 4JG1H 3L3OA 4XPFL 4QYOB 3QJFA 2YR3A 1ZLUH 4X8CA 1EJUC 1WFTA 4FR1A 2VC2B 4P3WA 1KCUH 4LF2A 1UOVA 5JW4R 3K2MC 1SVCP 3SZ6A 4FQ1L 4Z3IA 4OV9A 5BWFA 4QTGA 1XUUA 1I53A 3V0AC 4CQ8A 1AD1A 2D22A 2VC5A 3KYOA 4LGPB 3QWRA 3PWGA 3CFDB 4MA1B 1MFEL 1U3HC 4HH9A 3VFSA 3NESA 3BRDA 2FSEA 2XIDA 2E27L 1PX3A 3PZQA 2CKBH 4U0RB 1XZWA 3CFJA 4H8WL 1U3HA 2ZF9A 4ROQA 5FKAA 4LRIC 4B9FA 3NFPA 5DEJA 3IJLA 2JJUA 3IVSA 1WFUA 4GS7B 4PJ5E 4HUVA 3CL6A 1FVEB 1BD2B 3AG4B 4LRIA 4AJYV 4BRJA 1NH6A 1AXTL 1AD0B 3W76A 3U2EA 3VFMB 3HPZA 1CQKA 4BH8A 5IR1B 1BXBA 4B9GA 5HHVH 2DDXA 1A22B 2M8XA 3JS3A 1U42A 1SGJA 2PCXA 3EGXB 3NACH 1KTRL 2WIIA 3KH3A 1CL7L 2CUHA 1JGMA 1P53A 5KANG 1B30A 4K15A 1FFTB 5IEKB 4NF7A 5C6MA 4LVBA 2MH4A 4N7QA 1JFQH 3LS5L 5CJ8A 4PMUA 1M05A 1EXGA 2GGIA 4O1DA 3MRGA 1ADQL 3DH7A 4XPBH 1E6NA 2R1WA 5FJTA 1TZ7A 4JPKH 2GC7C 4Z1CA 4AMKL 4XMUA 3SIZA 2QVMA 5EBMB 4PJEF 5GS3A 5T3ZH 2J5WA 3QQ1A 5E6IB 1S7SA 3X14A 4BEIA 2E4FA 4G42A 5E1IA 2P26A 1UG6A 4P59L 4TM9A 3B8VA 3WIAA 1Q6FA 3A9IA 1HHIA 4GLRI 3FGCA 3UXLA 3VKAA 3BKCH 3QPYA 4PJGE 4NBZB 4UANA 1ZUAX 4JRYE 1E56A 4JFYB 1MCCA 2Z2UA 4BWWA 3N13A 4NUPA 4NNXB 4FL4B 4DXKA 2BODX 4P8UA 1AGCA 1CLYH 2VISB 1NCIA 5DUBB 1FAKT 3G6AB 1FSKB 1INDL 1CI3M 1G7HB 2B7OA 2W67A 2IMRA 4IOSD 1F4YL 1Q94B 2MWCA 1PSKH 1LWJA 3QV7A 5EUOF 1B4RA 2WXOA 1QPOA 1ZS8A 3BSHA 1DWJM 4G6CA 3P4OA 3TYFB 3O3AB 1B5TA 4IHOA 3AWFA 2OMVB 3U4KA 4WWPA 3M8OH 2YAMA 3QUMB 2IAAC 3S4TA 3REQA 3WSQH 3RLGA 4LL1A 3FT3B 4ZMTA 1KFGA 4FGMA 5G5IA 4W4QA 2WOQA 3GI9H 1MPAL 2XISA 4AGQA 3O8AA 2VDML 1OEPA 3CC5A 4XO9A 2QHRL 2KZWA 4CSZA 3L2IA 4FLSA 1EZWA 2XSXA 4Z77A 3OZ9H 2A6KA 4HS3A 2N7AA 3O2VH 3FS9A 4X60A 3CDCA 3FA4A 4RMTA 2ICWJ 2QLYA 4WGVB 2R69A 4V28A 1TOXA 2K45A 2AJUL 4DJEC 3O6CA 2W94A 1OAKL 4G8IB 1MUMA 1E9PB 2DT2A 2BJML 3I3DA 2C9PA 3GSNB 3Q5OA 4DJEA 3EFOA 1B4JH 3HMWL 4E0CA 4DYEA 1K9EA 2ZXDA 1F00I 1D5BA 3O6LL 3TR9A 4K71C 4G6AD 3ZR6A 1YJDH 1WGOA 2D3NA 1EQCA 3FMGH 1WKYA 4B41A 1E4JA 3ES6B 1U93A 1ECQA 3S2AA 3RM4A 1K3IA 1A02N 3IGXA 4RPQA 4HNUA 1XLCA 1DANT 2AXWA 1YPFA 3BFWA 1XF3B 3HN8A 2WC3A 4KU1A 3S3BB 4D9PA 5C9XA 4XI5D 3BXNB 4DFHA 2Z64C 4MWFB 3NJGA 3MV7D 3MLWH 5DWUL 4HA1A 2D7NA 3QJHB 2NX3A 2VTFA 4XN4A 3SUSA 3AM8C 1BM3L 1SPQA 3QJSB 5JO5A 2BSDA 3MRJB 1OAUL 2QQLH 4IIGA 4H8WC 1XR8A 4F37K 2ICSA 3AM8A 1TMHA 2FIKB 3ZOAA 2JQZA 2GUYA 4X5PA 2GK1B 4A7TA 4GJ1A 2B2XH 5IFTA 2HUEA 4ZMNA 4FEIA 1JIBA 3MW7A 4A7GA 4I7VA 2VDHA 3NG5A 2X42A 4F9PC 5AQ0A 1O66A 4YAQB 2PUZA 3V95A 5F4SA 4AYDC 4A2LA 2G97A 4AWTA 2NTFB 4PY8I 1Y8BA 5B1CA 4OLZL 4B5XA 4XP5H 1C8XA 4Y16C 3U0WH 3WUGA 5AZEH 1QATA 3S5LG 3ZVVA 4IDJH 2A99A 3NIFE 3TQVA 4WI2A 4E9VA 5GRXG 4Y16A 1AGFA 4IBTA 4MVAA 4H7VA 1X44A 5DQPA 4DBEA 4RH4A 4N2MA 1FHLA 3ARQA 1TIWA 4CSPA 4IBWA 3W0WB 1C5BH 2MQCA 2MOVA 5FDWA 2VFHA 4J3OC 4GW1B 2EXWC 2LU4A 5DMKA 3KPNB 2OJPA 4KRMB 5FO9A 1Z1WA 5AHIA 3V52L 1OZUA 2VDNH 4LEOA 4APXA 3P54A 3UR8A 3RGTA 1TIMA 1I2NA 1JZ3A 2VR2A 3PZVA 3HNVL 5JXAH 4M80A 5IXEA 3LIUA 3MXWL 1ZPTA 4PUJA 3DX9B 3A5FA 3EJYC 3KYKL 1GHFL 2ADJB 3NCOA 3VXUB 4UR8A 3ZS4A 3APMA 3WX7A 2A2QT 4ZTPH 4OLYH 5GRUH 3O11A 5D6CA 3GMOB 5CN2A 5HPCA 1JULA 2WXIA 1KQYA 4PJHB 3SJVA 3B8YA 2NXHA 3TTEA 3C6EA 5BW7C 3V0VA 1EXUB 4MJID 2ZA2A 1J1PH 1OG0A 4AF0B 5C8JB 1Q4WA 5ID0A 3HGSA 2A0LD 1HQRA 3DGRA 3PU7A 5BW7A 4YXGA 4K7VA 3CDYA 3KPOA 2X2GA 2VLKA 2IWGA 2Z31C 3CQKA 1MJJB 3GVWA 2W38A 4L5ZA 5A3IC 3CUGA 5B38G 2Z31A 4P2OC 2PNDA 1BQLL 4F7PA 5IUSA 5TDOA 2BVYA 3WEXA 3WIIL 1SO3A 5EU6B 3V6OC 2VDOL 5FK9B 3NSYA 4XN9A 4UQ2A 4X9BA 1P9MC 1DUZA 5AKSA 3B7SA 1M2VB 1FIGL 1R2SA 2EDMA 1FIEA 4BFNA 2WZHA 1RUAH 2GZXA 5D9SA 3PUOA 4TN9A 1FNGA 1P9MA 3INOA 3X12A 15C8L 2VKZG 1CFSB 4AIUA 3SRDA 4V1YA 4LIQE 1NFKA 1UB5B 2CBQA 4NSKB 4LRNH 1IFRA 2Q09A 1SHMA 4RX4D 4WDIA 5FV2A 4Q52A 5ITFB 5E08L 3AZUA 3WF3A 4UXDA 3ITXA 1HGYA 2EVGA 2EC9T 1UKOA 3IXAA 1EP1A 4OH2A 3NJKA 4MAVA 3GO1L 2WP3O 1XI3A 1E28A 2H2PC 1GSKA 3RG1C 2R2BA 1KM0A 2I07B 2GK0A 3B5TA 4FG6D 3QZBA 4LYQA 2YOAA 2LU5A 4YEFA 4FE9A 1Q7QA 2A0NA 4CCCA 5A2JH 1UZ8A 3HHRB 2FYVA 1TVNA 4WRLA 5DRXA 5T1KD 3HOJA 3BE1H 1GOXA 4XWOD 3CLMA 4Z78A 3HURA 5A2FA 3C5ZC 4Q33A 2E09A 2VRKA 4KITB 3BK0A 3SDDC 5M03A 4PZVA 2NY7H 4EKJA 3IPWA 4UCFA 3C5ZA 2YPLA 1QI4A 3OX8A 5EC1A 3SDDA 2VNCA 4N0YL 3DX8B 1LP9B 1H7NA 4WKXA 5E6UB 1N70A 3G04A 4Y5YB 3D12B 5IFJB 1C08A 4CMMA 4K37A 4UZGA 3ZXWA 5F7DA 1M6UA 3D85D 2H6OA 1TWWA 3VNLA 3RLSA 3PP4L 1T2XA 3MRMB 1Q2RA 3GWJA 4KTGA 1MVYA 4JEJA 5EIQA 4YXHH 2VW6A 1MCQA 4N22A 2LAGB 4L3EE 1RAMA 3TMLA 4KY1L 4EIUA 4QF1B 3CAVA 2WCPA 2D2OA 5KITA 4YDLC 2QKSA 5FYKD 1RUML 2W63A 1BXNA 4JX0A 3OG6B 3PQYE 3FCUB 2YK1H 2ALRA 2C3VA 1TJGL 2B4CH 1CPUA 3A4DA 3TS8A 4OOZA 4BHYA 4EXQA 4HJ0D 5B21A 1Q4NX 2PDMA 2OJ1A 1BMZA 2J9ZA 3LVEA 2XHNA 3UJIL 3W7NA 4Y19D 5BZDB 3SPIA 1N6QL 2VN5A 1LOLA 1F97A 3HFML 3S1WA 5I26A 3LEVH 2XWCA 3QG7H 4JFUA 3BDKA 4YL4A 3ARGD 1F8MA 2QL1A 1CQYA 5C0RL 4RAHA 1HK6A 4MSWA 4I48A 3DOIA 4QNPE 4H4NA 1S2VA 4ETQB 4AEHH 3L4TA 2QQKL 4X61A 2GUOA 2Z8RA 2OZ8A 1UOWA 4XH2A 3GXDA 4M3HA 4WY0A 1F8TL 4F3HA 4UUJB 3K80A 2SFPA 1EAPA 3QXDB 2JKXA 2I26N 4D0CB 3UWZA 3O6FD 4QHNA 1J1OL 4NQTA 1TTPA 4ATDA 3MJ8B 3CVHH 1HH6B 3REWA 1Z9SA 3S1VA 2RUSA 4JTHA 1A4LA 4X6DE 3TXAA 1GEQA 5AFDA 2FX7H 4EEEA 3QEHA 1U2CA 2ZCKL 3QCUL 2C1OB 4LEXH 4HIIA 1U8KB 2Y7SA 1YXYA 2Z4QA 3O3RA 1EA0A 3IFNH 5JQHC 4D6CA 1XGPA 4FNSA 5B8CC 1R0AL 5C7XH 4CQDA 5CSZB 1WCGA 4WFHD 4KJYB 4E4PA