1KXVA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 175
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxvA01
5IHRA 5AC5A 1TA3B 1EHAA 4PTVA 3ALFA 1LWJA 1UKOA 1V3HA 5E09A 4E2OA 1E4IA 3N12A 2ZXBA 3K8MA 3WEMA 4BS0A 1V03A 3WH6A 4JKMA 2EACA 4UOQA 2ZIDA 3SCQA 3AZRA 4BQ2A 3I3EA 4AZBA 3AXIA 4UR9A 4AEFA 2X0HA 2W63A 3N04A 3K4AA 1OD8A 1JI1A 3BH4A 3UESA 4GZEA 3E1F1 1NARA 3RPMA 1CXFA 2JE8A 3GTNA 3AYRA 2Y4SA 3AISA 1OT1A 3UG5A 4MAZA 2QPSA 3MMUA 3VMPA 3WNKA 2WMJA 2DDXA 2CERA 5ABFA 4V28A 1E40A 3VIHA 4PCSA 3SCNA 2WWCA 1E6ZA 3OLGA 5IXEA 4FLSA 3KLLA 1BLIA 2WMKA 1OB0A 1ZBCA 3W26A 2VVNA 4IISA 4CVUA 1QHOA 3CZEA 4TX6A 3H55A 1KWGA 1UQYA 1UA3A 3RIKA 5D9PA 1QWNA 3W29A 3VX0A 4Z2LA 2PWEA 1NP2A 1ZBVA 2D3LA 2BVDA 4IUGA 1UH4A 4WKAA 2AMGA 1WNOA 4AZ5A 3LPFA 2VQTA 3HG4A 4D1IA 2C0HA 4CD6A 3DC0A 3D52A 1B3XA 2EADA 5A6JA 4J3UA 3EBVA 4N0RA 5A8PA 3BVVA 3ZT5A 1KBBA 1P6WA 1QI3A 1E4MM 1NP0A 4QFUA 5C8BB 4CGTA 4XUYA 4UQ9A 1UH2A 1BHGA 1V02A 2WC7A 4DWSC 3AQUA 4B3LA 1CGWA 3MMDA 3SCOA 3MMWA 2WC4A 1KBKA 4ATLA 2O9OA 2D1ZA 4PSRA 1UYQA 2XWEA 3WNLA 4CCCA 2YL9A 2PWDA 3A5VA 2J77A 2CBUA 1E0XA 4NXKA 2X8RA 3KWXA 1FHLA 1OGGA 4C7DA 2W5FA 3OG2A 2BV9A 4OZOA 4Z2JA 5AC4A 4Q7NA 3OB8A 2CETA 2J8FA 2XWDA 4PMQA 4YN5A 2CKRA 4UFIA 2J7FA 4EANA 3WELA 3ZMRA 2EBNA 4MB4A 4PMVA 3S2CA 5A95A 4W84A 2C8NA 5CLWA 1J0YA 4W5ZA 1A3HA 1ZU8A 1G9HA 3EDEA 1TQWA 2GVYA 1DEDA 3WN6A 3PBGA 2E9MA 2VZTA 2D24A 4RE3A 1N82A 3MV11 4M81A 2YA0A 4LPCA 2G3IA 4FLOA 3L4UA 3AIWA 3BAIA 2BY2A 3AMDA 4NXSA 4C7FA 1FFRA 2XN1A 2F7OA 1QPKA 3VM7A 1X1NA 2OYMA 2OWXA 4FK9A 2WW5A 4IPLA 3WF1A 3L4YA 2F1BA 4PMOA 3WQ5A 3RJXA 1SZNA 3AZTA 3ARYA 4QDMA 4WK9A 4AY1A 1CYGA 3VO0A 2OW6A 3FY1A 4WKHA 3ZOAA 1HP4A 3O6AA 2X1IA 1C8QA 3RO8A 1W91A 3ARUA 1WPCA 4AMCA 2YLAA 1TQSA 1UUQA 2G3MA 1GNXA 2CIPA 3T0DA 3VGBA 3BSHA 5A2CA 1AQHA 3EJRA 5TD4A 1R75A 5LA1A 4RL3A 1KGWA 3WEOA 3BGAA 2YA2A 1EA9C 2EEXA 4LXFA 1E4LA 4PMZA 2PB1A 1MQPA 3WQ4A 3IAQA 1KXHA 3WBAA 2NSXA 3CV5A 1J10A 1GOMA 3PZUA 1C91A 4U5IA 1W1YA 3VKKA 4BF7A 4M80A 2VI0A 3ZSSA 3BLKA 1W1PA 4CU6A 1LLOA 4AZ6A 2A3CA 1C93A 2WVVB 3ARVA 1FH8A 2DSVA 4JCLA 1EDQA 1MQRA 3BUBA 3QOMA 3BSGA 3ZSTA 2JEQA 5A6BA 1E6XM 3WDJA 4PCTA 5ABFB 1C7SA 3MV01 1GONA 1JIBA 3WNOA 4H2CA 4D1JA 1RPKA 1E6NA 1NWRA 1BGAA 2WZHA 3OA5A 4AD5A 2OYLA 5CPTA 4HZ6A 1LG2A 1OINA 8CGTA 2PWGA 2VZUA 3AI0A 3CIVA 1KB3A 1TMQA 4CN6A 3VD4A 1FA2A 4DUXA 3W81A 1HXJA 4U5KA 1RP8A 1H09A 3CZGA 1UWSA 4A4AA 4WLCA 3U57A 1KQYA 1GQJA 3EMCA 3GXFA 2EJ1A 1E3XA 1BSIA 5A6BD 3BAJA 3CBWA 2E0PA 4E8DA 4ZE5A 2YL6A 4MPKA 1ODUA 1H11A 5A1AA 3AFBA 3WY3A 4PTWA 4NRRA 1W3HA 4TUFA 1UKQA 3WY4A 3SCVA 1V6XA 3BLPX 1QBAA 1JL8A 2XGIA 2J47A 5BRQA 1QNPA 5M17A 1H49A 1E55A 2Z1KA 3ZT7A 4AD0A 4WSKA 2VZSA 3S6TA 1KTCA 4AEEA 1J01A 1B3YA 4UFJA 5BYWA 3OBAA 4M82A 1HKMA 1E56A 2WMGA 2QF8A 5GNYA 3PZOA 2J75A 5LA2A 5CLTA 1W9UA 1UOKA 2ZOXA 3DDGA 1UWIA 1HVQA 2EPLX 5BXRA 1LL4A 1HT6A 4J3VA 3CUFA 2GJXB 2JALA 2E9LA 1WZKA 1JG9A 3PZTA 1JFXA 5A6LA 3CH9A 4Z2IA 3WD0A 3M7SA 3AZSA 5EBAA 1KGUA 4AYGA 3IK2A 1X6LA 4W88A 1W9PA 1JAKA 1CDGA 4LQ1A 4ACZB 4BA0A 2WANA 3W53A 4HTYA 2BVTA 2E9BA 3CUJA 2WBKA 5HOSA 3ARRA 4JAWA 3EJQA 3DHUA 5A6MA 4M1RA 4JFVA 4HMCA 1TVPA 1QI5A 2B31A 4U2ZA 3VILA 4GXPA 3WNMA 2VX5A 3GNRA 1QHZA 1NWSA 1X6NA 4GPNA 4KGLA 3AHZA 2FDMA 2HVMA 1V6YA 4UOJA 3LXBA 4W8LA 3VNYA 4UQCA 2YBUA 3K1DA 3MANA 4MNMA 2YFNA 2RGMA 4AZIA 3N9KA 3FN9A 3A23A 4Z2GA 4NRSA 4B16A 3AIEA 3MSDA 1XHGA 1FHDA 2DIEA 2YDRA 4D6HA 1H0IA 2ZX7A 3VNZA 4JHZA 2E8ZA 3DX0A 4NZCA 2CCRA 1HWWA 2IUZA 1UH3A 4B3KA 3UEQA 4LYRA 1U2YA 3BUIA 1SYTA 1NH6A 2F7RA 3LXAA 1LJYA 2UY5A 2DIJA 1Q6CA 4M8UA 3VMOA 2CEQA 2DQXA 2WB5A 1M7XA 1CNVA 4BCEA 5HXMA 3GM8A 1TQUA 1KWKA 3AHTA 2V38A 3WBEA 4QAWA 1F4HA 4NZFA 1TUXA 3GBDA 1QNQA 1B3VA 1BGGA 1B1YA 3GXDA 1PX8A 3BMWA 1RH9A 3S5ZA 3HN3A 3KE0A 2VTFA 3N1AA 1Y7VA 1V0MA 2XG9A 1WZLA 3TTQA 1J0JA 5CPQA 4ZXOA 4YPJA 4TXEA 2OSYA 3WD4A 5HNNA 4TVDA 4RE2A 2J7EA 3W4RA 1XC6A 6A3HA 2Z1SA 1HIZA 1QNOA 1TFVA 4U3AA 3IJ7A 3MKKA 5I24A 4W86A 5A6KA 3NSXA 3ARTA 1JZ6A 3RCNA 5CSUA 3ZQ9A 4D71A 4XB3A 2VRJA 1JYVA 4JL2A 4GIAA 2WHJA 5DMYA 3GDBA 1B2YA 2ZUSA 3TOPA 2JIEA 1E6RA 3AIVA 4W87A 4CCDA 3ZO9A 1SFSA 1B9ZA 4P7NA 4W8AA 5D4YA 3ZR5A 3VVGA 1LL6A 4GI6A 3WF0A 2WCGA 2VRKA 2GFTA 2XJ7A 1UKSA 2XVPA 3GH7A 2W62A 4F9JA 2ZUNA 2XTKA 1W9BM 2UY2A 4QLJA 1EH9A 1G01A 4PTXA 3CUHA 4PYSA 1MW2A 1VEMA 2WHMA 4U3CA 4PMYA 4MNJA 3WFLA 4DO6A 1GUVA 2WHLA 4GQQA 2WSPA 7TAAA 1J0ZA 2VOTA 1CBGA 1QI2A 2JFEX 5C71A 4R5EA 4OBRA 2YA1A 5KZ6A 2G41A 2FGZA 3PN8A 1HKKA 3GNPA 3BC9A 3L2MA 1UHVA 3GXNA 4P7LA 4DM1A 1XSKA 3AS3A 1JXJA 4MDPA 3RMEA 3W6MA 1PEZA 1WDSA 3KL5A 3L4VA 5I79A 2XIBA 3LPPA 4Y7EA 1UQZA 4JHOA 5C70A 3DX1A 3CZKA 1GVYA 1EOMA 4OBSA 3CZLA 4AYSA 2ZUUA 1H1NA 7CGTA 4UFLA 3ARXA 3VDHA 3UETA 3GZAA 4KWUA 2NT1A 3D4ZA 2Y8KA 4W8BA 2DH2A 5A6AA 1HP5A 2O9PA 4W7UA 1BYCA 4JFWA 3POHA 2FE0A 3BAWA 2YLLA 2OYKA 5GQBA 2OWCA 1JDCA 3PZVA 4D72A 1UR4A 5I6SA 2YDQA 2F8QA 1JDDA 1UWRA 3K8LA 3WD3A 2O9TA 1MFUA 3EDKA 2F61A 1V3MA 1HVXA 3VSVA 2VJXA 5DO8A 3DX3A 2BFGA 1M01A 5CQ1A 2X05A 4JKLA 4NZJA 1ITXA 1VFMA 2ZXQA 3SCRA 3AMCA 2DPEA 1UR0A 1HJQA 3ARWA 4AZGA 3WQWA 1FH9A 3B9EA 4JKKA 1CXHA 2V5DA 1R7AA 4FLQA 3ARSA 1HNYA 2JF6A 3AIUA 3CC1A 3W37A 1TR1A 2Y2WA 4AIOA 3WF3A 4P8XA 2YL5A 3HJEA 2WZEA 2UY4A 3BVXA 3M46A 4LYPA 4AMWA 2VZVA 2GJPA 1K9FA 1UWTA 1CZ1A 5GNZA 5BROA 3U5UA 5A2BA 4HA1A 1XYFA 3WDPP 2FHBA 3WQ6A 1E71M 3WUBA 2DSWA 3NDZA 3RDKA 1J18A 1R7OA 5D9NA 3MI6A 2WYSA 1I1XA 3CMGA 3ARQA 5ABEA 4B9ZA 1KXVA 1BQCA 1JF6A 5EMYA 3N18A 1W9DM 5GPRA 4FNQA 2XPKA 1E1FA 1OSEA 1QWUA 1CPUA 1US3A 1J11A 3OGVA 2OWWA 5ECUA 1QW9A 1UZ4A 3LXCA 5EB8A 3BAKA 2RGLA 3T0AA 3EMQA 2D0HA 5CSYA 2DSUA 1TQVA 1V0NA 2WMFA 4AD1A 4MJ4A 2YBTA 3CZSA 1ITCA 2J79A 2VR5A 3B9AA 7A3HA 3NIYA 3S5YA 2GK1A 1GHRA 3BAYA 5ABGA 2BY1A 1CECA 4FNPA 2ZXDA 4QLKA 3WD1A 5A3HA 3SCTA 3CLWA 4UQBA 1D2KA 1DTUA 2X2IA 1JGIA 4CUCA 3VSUA 1CGVA 4L4PA 4QLLA 4HZ7A 1PPIA 3ZJ8A 2F7PA 1G94A 3RJYA 3AIQA 3WUGA 2V3EA 1W3KA 2XGBA 1CIUA 2GJXA 2D73A 4P8UA 1VFOA 3NCOA 3EYPA 1GW1A 2ZWZA 1PAMA 4GI8A 3LRLA 3OIHA 1AVAA 1LQ0A 4S3KA 1UA7A 2WC3A 2D23A 4CD8A 4UQEA 3SUTA 3WMCA 1VBUA 2DSZA 4LYQA 3WDQA 3EJTA 1GJUA 5EFDA 2NW0A 5M5DA 2WWDA 3EJPA 4RE4A 1LG1A 4TTUA 3MUIA 1EHNA 2VURA 3II1A 3EJUA 2IGTA 2BXZA 3VIPA 3VUPA 3W38A 4AW7A 4CN1A 4M56A 1VJSA 3BVWA 4Z2HA 1I1WA 2WVVA 4CD4A 4HPHA 3MUAA 3PTKA 4EK7A 2V5CA 1C7TA 1BG4A 3MSGA 1E70M 9CGTA 3WL1A 4GO9A 2BHYA 3AYSA 2J7GA 4N42A 2D22A 1KGXA 1DWGM 4GZJA 4GQRA 3WSUA 4AZ7A 4PN2A 1E3ZA 3W6LA 5A2AA 3OZPA 1JZ8A 3BUDA 4R27A 5DT5A 1EGZA 1E0VA 2VQUA 3PZMA 1US2A 5JBDA 3ZIZA 1JD7A 3L4WA 3T08A 2BVYA 1UR9A 2ZX6A 5LYRA 1ESWA 1J0IA 2EPMX 4JFUA 5FL1A 3DX4A 3ALGA 3M6DA 3POCA 3AOFA 2EABA 2ZUMA 1HL8A 2G8ZA 3K4DA 3VD5A 4HOWA 1L8NA 5FOOA 3T0BA 3FAWA 2X09A 4D6IA 2YIHA 1EDGA 2D0FA 2ALWA 2QHAA 1C8YA 2E40A 4URIA 5IHSA 2YKKA 3WUFA 4J27A 4AD3A 1XV8A 1CXIA 1G1YA 4CD5A 1OT2A 1H2JA 1PBGA 1U33A 3AJ7A 3UR8A 1CWYA 4AXNA 1WDRA 2XUCA 3MU7A 2DGAA 1GQIA 5E1QA 3PZNA 1Q6DA 3L4TA 5M03A 1HN1A 5I3DA 3JUGA 4GI9A 2VC9A 3TONA 2CBJA 1QHPA 3RILA 5E9AA 1E0WA 1BAGA 1R87A 3FHQA 3RM8A 1W2PA 3EDDA 3MO4A 3ZJ6A 1EIBA 1FP8A 2GDUA 3UERA 5A69A 2WKGA 2PWHA 1H4PA 1O6IA 1W1VA 2BY3A 4HPGA 1D7FA 1UKPA 1JAEA 3DYOA 3N11A 1VEPA 2XFYA 1Q4NX 4MNKA 1NOFA 2VCCA 4ZENA 3ARPA 1JZ3A 4FNUA 1TQTA 3UR7A 2PBGA 2D0GA 3WF4A 3ZT6A 1V0LA 1WB0A 3BAXA 5D8ZA 1GOQA 1CXEA 1Q6GA 2VT0A 1E6SM 2E8YA 1SMDA 4D6JA 4DWSB 1AMYA 1GQLA 3OGRA 1UWUA 4JFTA 3FW6A 1V3KA 3WFZA 1BYAA 4S3JA 3A22A 1WDPA 3A3HA 4UNIA 1A47A 1E43A 3W82A 4L4OA 2G4FA 3VINA 2EPKX 3UG4A 4H7VA 1KTBA 2IXVA 2UY3A 3PZIA 2WCAA 3VD3A 3SCSA 1H5VA 1GZJA 3WNPA 2DT1A 1JZ5A 3BUPA 4DWSA 3HMCA 3HG2A 3AMLA 1H0GA 3B9DA 4B9YA 3AROA 3KLKA 3ARZA 2WPGA 2QLYA 3AS0A 1EOKA 2EO7A 1CGYA 2BNJA 3AS1A 3ECQA 4LGXA 1GOIA 1W2VA 5AYBA 3L4XA 1IZJA 3CUIA 3W24A 1UASA 1GPFA 1V0KA 3VIJA 4PMDA 3QHOA 1BG9A 4PSPA 3DYMA 3VIKA 3AHXA 5E70A 5I77A 1B3ZA 5ABHA 1OIMA 6CGTA 1PIGA 1W9XA 1MYRA 4EKJA 1V3LA 3MUY1 4MB3A 4IM4A 5CXPA 5FCZA 1MVYA 4JIEA 4YHGA 3SUVA 1WP6A 3APGA 1JI2A 4HP5A 5HPOA 1KR1A 3F4VA 2VL4A 5E0CA 2J74A 2WMHA 4J28A 3LPOA 1DWHM 3BCDA 4UTFA 2ZE0A 2A3BA 1CEOA 1C90A 4PMRA 2MANA 4ML4A 3VPLA 1WCGA 3PTMA 3D4YA 4OJYA 1E4NA 3A4WA 1MXDA 3SEPA 4ATDA 1VAHA 3PZQA 4AZHA 4PUDA 5DF0A 4ZFMA 3TA9A 2ZUTA 1E5JA 5I2UA 2OW7A 3DECA 3AMKA 1YHTA 5D9MA 5I23A 1J12A 3DDFA 2XFRA 3CZNA 4W7WA 3F5KA 4X0NA 3KL3A 2XSBA 1V02E 3RM4A 1GQKA 1JDAA 3OLEA 3TTYA 2PWFA 1TA3A 1JNDA 2X0YA 1PIFA 3H53A 5CGTA 1VJZA 2VCAA 1BVZA 4GO8A 1W3JA 4HU8A 4B15A 2YFOA 1OIFA 2EPOA 4NSBA 3QR3A 5EFFA 2WCSA 3WL0A 4HMEA 3SCWA 2JEPA 1ISYA 1QNSA 1JZ4A 2JIWA 4W85A 3OGSA 1JNEA 1HXKA 3ZR6A 3UCQA 5DEZA 3IJ8A 3VIMA 1HJXA 4JFSA 4PTMA 2E3ZA 4PUEA 1T0OA 3FNDA 5E6ZA 2J7BA 2F7QA 2BY0A 2W4XA 3SURA 4BZYA 2V3DA 3GXIA 4WIWA 1QX1A 3F5JA 2J7CA 4CKQA 1OWQA 3U5YA 2YL8A 1E73M 4C7GA 3FAXA 1HJVA 1XH0A 2ZX5A 4OIFA 2PI6A 1UD4A 4M29A 1GCYA 2ESCA 4MB5A 1BPLB 1XH2A 3VD7A 2GSJA 1UR1A 1B90A 4AZCB 2VMFA 4V2XA 3EDJA 5HDRA 1OCQA 2PBOA 4UOZA 1M04A 1ZL1A 2FH8A 4JL1A 1FH7A 4UFMA 2G3JA 4AIEA 3NUKA 4OOZA 1C92A 3VX1A 1ZS2A 1DWJM 2CITA 1UD3A 5A8OA 4PMUA 2D20A 3OLIA 1Q6FA 4AC1X 4YHEA 2HISA 2OLHA 1GOKA 3W25A 1PX4A 4GZIA 4QCFA 1ECEA 2BHZA 1D3CA 1WO2A 1TG7A 1O7AA 2V3GA 4UZUA 1PZ2A 1C8XA 3VM5A 2W92A 3KEHA 1EO5A 3A4XA 2DH3A 2ZWYA 1MWOA 4GKLA 1S46A 1B31A 1WZMA 4OKDA 1NM9A 2XVGA 1OBAA 3K46A 3PZ9A 4ZXLA 2CKSA 3HU7A 2Q8XA 3NDYA 1BVNP 3NYDA 4KRTA 5FD0A 3AXHA 3W0KA 4NF7A 2ZUVA 1UG6A 2G3NA 1I75A 1BTCA 3A4AA 3IGUA 4FNTA 2PC8A 1UKTA 1ZBWA 4NI3A 4ACYA 1TCMA 3WQVA 3LX9A 3L4ZA 1ODZA 1SR0A 2WHKA 1TE1A 4X9YA 2BHUA 1R33A 1LF1A 1EQCA 1DWIM 1Q6EA 3MS8A 3PTQA 4WSJA 2ZICA 1XH1A 1G5AA 2ZUWA 4H8UA 4J3WA 4HMDA 4AD4A 3SCUA 1J9YA 3WH8A 1ISZA 1W9VA 4KRUA 4ZEPA 1CGTA 4X0VA 4TTGA 3U7VA 1VENA 1VRXA 4F66A 3VDBA 3D51A 3WD2A 2CPUA 2XM2A 4HA3A 4MJ2A 2DT2A 5M3WA 2A3EA 2BS9A 4MB1A 2XSAA 3GH4A 1FP9A 4W93A 3CHEA 4HU0A 1HJWA 1HKIA 2F18A 2WNWA 2XHYA 2GK1B 4H8HA 3BXWA 3RM9A 1B3WA 3WY1A 2X2YA 2Y8VA 1CXKA 3IAPA 1J0HA 2FYVA 2BXYA 4W5UA 4IPNB 1FFQA 4A3YA 3VD9A 3WENA 3W27A 5CG0A 4PEEA 1M53A 1UD8A 1GORA 3SUSA 1K9TA 1J0KA 1DHKA 2D3NA 3CHFA 4CCEA 1JYNA 2VNCA 2PF0A 1R8LA 4EE9A 1GOWA 1H3GA 4J7RA 5JIPA 2ZX9A 4KH2A 3SCPA 1MFVA 2E4TA 1WE5A 1CLVA 4GINA 2C7FA 1G0CA 3VGHA 5IFTA 3EDFA 1GJWA 4CU8A 1W3LA 1YQ2A 4CN4A 3K8KA 3PZGA 5JUVA 3WMBA 1QW8A 5A8MA 3BUQA 1RP9A 1UR8A 3SUUA 1QI0A 4P8WA 4W7VA 1VIWA 1NOUA 1NOWA 4H04A 3A47A 2WLYA 1IV8A 4QP0A 1R85A 2O9RA 1V3JA 3VIFA 4E4PA 1KXQA 1NWUA 3J7HA 4K68A 4JCMA 3TTOA 3QGVA 5JIWA 5KEZA 1CTNA 3VMNA 2W67A 5BWFA 3ZM8A 2DSKA 3AICA 1VB9A 2XVLA 2YJQA 4D6GA 1E15A 2DEPA 1XD1A 1B30A 8A3HA 3ZJ7A 2GJRA 3VOCA 2EPNA 1XD0A 1OGBA 1UWQA 2AOSA 4H8VA 2J25A 4UZSA 1NQ6A 1E6QM 2WXDM 3WH9A 2WVTA 3ZJKA 4OOUA 4HOZA 4TOQA 3WDIA 2GUYA 3A6OA 3WIJA 1EDTA 1DP0A 4M24A 2YOCA 3A21A 1QVBA 4PMXA 4NX0A 1HJUA 5CGMA 3DX2A 4P7QA 1JD9A 1UD6A 1E5NA 3VDCA 1JYXA 3LPGA 1LL7A 4MTVA 1CXLA 1JZ7A 5LA0A 2WSKA 3T2OA 5I78A 5JBFA 2QPUA 2GDVA 1JYWA 3WKZA 2WBGA 3QOKA 2CHOA 4UFKA 3WMSA 4WF7A 2J7DA 2QV4A 1F4AA 5IFPA 3MUZ1 3SIMA 4CVWA 3VIIA 2WK2A 2WMIB 2XYLA 4KGJA 4F79A 2XFFA 3TTSA 2DT3A 4TVCA 1VEOA 2AAAA 5FL0A 3LRKA 1PX3A 1DWAM 2FH6A 4HA4A 1QNRA 3WDHA 2CNCA 1ZB5A 4LX4A 2VO5A 5FKYA 3CHCA 1KCLA 3WF2A 3D5HA 3O9NA 3VSTA 2VCBA 4MDOA 1K9EA 4XZWA 5BXPA 2VVSA 1HL9A 2X2HA 1R47A 3AIRA 2CYGA 3CZ8A 4PMNA 1KFWA 4MAVA 5A8QA 4AIUA 5A6SA 2WAGA 4UQAA 3GYCA 4JZ5A 2VR4A 1PZ3A 1K9DA 3A24A 3EJSA 1MW3A 3OLDA 1BF2A 1R34A 1UD5A 3N15A 4AD2A 1HTYA 1JXKA 2J78A 1O7DC 5IDIA 3M07A 1VBRA 1VFFA 4AWEA 1V6VA 1MW0A 1UD2A 3I3DA 4P7OA 4FMVA 1ISWA 1OM0A 1HF6A 3VTRA 2IXUA 4E8CA 4UFHA 4EAMA 1KXTA 3U7BA 5I5RA 1XSIA 1GVIA 3AIBA 2UWFA 5HBFA 3F5LA 4W89A 3GXMA 3BVTA 3THCA 2FGLA 1WKYA 3O2LA 3VDAA 2VUYA 2VZOA 1XRVA 3CUGA 2F2HA 3WH5A 1BYBA 3GBEA 3DHPA 3D3AA 3LMYA 4PRWA 4Q22A 1UZ1A 3HG5A 1V6UA 3W28A 2WVSA 2Y24A 1R46A 1QBBA 2J7HA 3BCFA 4J3TA 1LWHA 2OSWA 1ZBKA 4BQ4A 4HOXA 1GOOA 1VF8A 1MW1A 3G6LA 3WUEA 2WVUA 1W32A 4XZBA 2J8GA 5BXSA 1HJSA 3N13A 3WH7A 2CBIA 4XX6A 4XV0A 2WMIA 3AS2A 4FNRA 3HG3A 3GH5A 1Z32X 1TZ7A 3UG3A 3AHVA 2XN0A 1GHSA 1E9LA 1EQPA 1K6AA 3QHNA 2V3FA 4TVUA 3L2LA 5E6YA 4F8XA 3VIGA 5AY7A 4CD7A 3CZJA 3BLBA 2WLZA 3WQ8A 3THDA 1CGXA 1PJ9A 4D6DA 1ZJBA 2DT0A 2FHFA 5DT7A 3WNNA 2XVNA 1HX0A 1XYZA 2OSXA 4QCEA 1IT0A 1JF5A 5CPSA 4BQ5A 5CJ5A 4DO5A 4ACZA 3NSNA 1M03A 5AYIA 3T2QA 1DWFM 1E6PA 3SUWA 1ISXA 2Y5EA 1FOBA 1B0IA 1IZKA 4J3SA 1V6WA 6TAAA 1E72M 1XCWA 1AQ0A 3TP4A 4AMXA 1PS3A 3OZOA 1CLXA 3NJ3A 2CXGA 4H41A 1L0PA 1VFUA 2EAEA 3I3BA 2ZXAA 1C3FA 1OD0A 4HZ8A 2D2OA 4OGZA 2CESA 3T09A 4DM2A 3LRMA 3B8SA 2EQDA 4KMQA 3FHAA 1XCXA 1NWTA 3KZSA 2VX6A 4U31A 4D6EA 1BFNA 1AQMA 3GNOA 1SMAA 2F1AA 5GNXA 1ZJAA 3VGEA 3D50A 1ISVA 5A94A 3NSMA 1KCKA 4D6FA 5HPCA 2FHCA 3GXPA 2YDSA 5BCAA 5D8WA 2X2JA 4J3XA 2EXOA 3N17A 1CENA 3EMZA 4ATWA 5A8NA 3AXXA 1RD6A 5I0DA 4U33A 1EXPA 2VX7A 3PHAA 3VIOA 1EO7A 1OGSA 5D9OA 3G6MA 1CGUA 1HKJA 2W61A 2QMKA 4UCFA 3WY2A 1WDQA 3CPUA 5BXTA 3VGGA 1BYDA 2TAAA 2VX4A 1JZ2A 2XVKA 4FLRA 2ZX8A 2W91A 3DYPA 1WAWA 4TX8A 3IJ9A 1U30A 3AHYA 2J4GA 4CU7A 4DUWA 4BQ3A 2XIIA 1MQQA 4P7RA 3T2PA 4DO4A 2QMJA 4V27A 1TVNA 5BRPA 5DFAA 2A3AA 3CTTA 3HZ3A 3VGFA 3VGDA 3VU2A 4FF5A 1W1TA 3GXTA 4UQDA 1XSJA 1V3IA 1V08A 4AZCA 5JBEA 1KR0A 2WM0A 2W66A 1XGZA 2CHNA 3CGTA 4ZE4A 4Z2KA 4OUEA 2WZIA 4MNLA 4FNSA 5F7UA 2XN2A 4PBGA 3WDRA 3WEZA 4A3HA 2VRQA 1H41A 4U2YA 2NT0A 4P8VA 3CHDA 3TV8A 2J62A 3AMGA 2A3HA 1QI4A 3BMVA 4WKFA 3CMJA 1R86A 5FIPA 1WZAA 3BVUA 4DWSD 3FXYA 3H54A 5E0FA 1JFHA 2O92A 4AISA 1MXGA 2WKLA 4D6CA 2JF7A 3IANA 4WJXA 4MADA 5CZKA 2XM1A 3CO4A 1QOXA 3KL0A 4F9DA 1KQZA 2CBVA 4DUVA 1UR2A 1E1EA 3QHMA
chains in the Genus database with same CATH superfamily
3GB7B 3DO4A 3M47A 4YXKL 4GUFA 6ALDA 4S1RH 1JPMA 5IHRA 1KB5A 3MRCB 3TBYB 2QSTA 3GO2A 3VFUB 1G67A 3ALFA 1LWJA 3BP5B 3KCPB 1KFKA 1ZKAA 3QF0A 1UKOA 4JDTH 3U4KA 4M6UA 5E09A 1IFHH 4PD4K 4TYUA 1TPVA 3DMMB 2VMDA 1JXGA 5T5FA 3MNWA 1HQ4A 4QRRB 5DC2A 3D0VA 3WEMA 3P8JA 3QGKC 4F15B 3TNNA 9XIAA 4HHGA 1A5CA 1V03A 4JKMA 2EACA 4KOBA 4GAGL 3GIVB 5LQBH 3NJLA 4DVOA 5EU6E 3LQZA 5C6TH 4RX0A 1TYEB 3C8HA 5AYTA 3GFYA 3KAAA 3I3EA 3B2PA 2AJZB 3M1OA 4PRDA 3C75A 2EUXA 4AZBA 5C0IB 1G7JB 1I7TB 4JN1L 2GIMA 4IRJB 5F1SA 2OJZL 1Z0NA 3BH4A 4PWHA 1QYGH 5HGAB 4G43A 1YEGL 1CXFA 4XCNB 2WZPA 2K3HA 4FFYL 5I8OH 1FFNA 5I09A 5JXQA 2B4CC 2DMGA 4PJBA 2A74A 3D4CA 4I48B 1ETZB 2BWGA 3AISA 2ZF8A 5IBUB 3SZKC 3OKYA 1DQMH 4MAZA 4NHUA 1VFSA 3K6IA 1SEQL 3EH2A 3H3PH 4JM2A 4NZRL 3BMXA 2AXGB 3LGGA 3LQLA 4LTSA 4F8PA 2DDXA 3STGA 3S5LG 4MZ8A 4LVGA 1T80A 1O95A 3TA3B 3SCNA 1AZ1A 1YEGH 3BP4B 2NX5D 2Q2EB 5IBTH 4AC4A 1E6ZA 4NAJA 3GRBA 3QWOA 2EDMA 4Q8OA 4FFZH 1LRTA 4IIBA 4OGXL 1U5HA 2O6EA 2JCCB 2NNCA 1ZENA 3QC0A 4OV5A 2DY2A 2V5MA 3DFOA 1X7SA 5FUZL 4JO4L 5DA0B 1BOGB 1RZGB 3GDMA 2IQAB 1EJXC 2PO6A 5HYJA 1OB0A 3KS0J 1I85C 1G87A 1KFCA 1DJIA 3EOUA 5G1MA 4G8TA 3CN4A 3T55A 1KNOB 2J8UF 5C9JA 2NR6A 4IISA 4DXVA 1OCCB 1SBSL 5SWQA 4TX6A 1RHHB 2Y1YA 1KWGA 2R0KH 1I8UA 1A8ZA 2BM3A 2KZKA 5LBSL 1I2RA 3SY6A 3RWJB 3TU9A 1MQKL 1XR8A 2P5WE 3CXDL 4G7VL 3RWIB 1SR9A 2YBVA 5CC5A 2EINB 4A2EA 4FG6C 5DJZA 4EX4A 2VELA 2NSOA 1REQA 5C0NC 1UB3A 1ZBVA 1S7TB 4HU3A 2D3LA 4ZI8A 5KVDH 4F7TB 1Q2SA 2FIKA 2RFXB 5JW4Q 2DQWA 3NJFA 3O9WC 5KVDE 3Q01A 5K3VA 5CBBA 1WDWA 3FQ1A 3RL1A 1A22B 2YD3A 3MBEA 3V7AG 4BJLA 1A6PA 2MSPA 1W5NA 3WV0A 3ABGA 3S88H 4OVXA 4B5WA 1MELA 2C1OB 5GSRB 1ZSXA 4N0RA 2GTQA 2AL2B 4G2DA 4FN0A 2ZRUA 5IHUH 3UO8B 1U4EA 2EPHA 4ZXBA 2A6LA 2WSQA 2YCLB 5EO0A 4TVPD 2CHDA 1P6WA 3I6GB 4O02H 4Y2DD 2NRDA 2VR9A 3F6JA 4KKLC 4LBAA 2MCG1 2WJZA 3GC5A 2WKOF 1NP0A 1N4XL 4DN1A 4KNTA 4X8JB 5PAZA 1FWIC 3FEMA 2YCIX 4CGTA 4XUYA 5E8NB 5DGQA 3EJYD 3H56A 3BDXA 4KU1A 2ZYIA 3AQUA 3KS5A 2DYRB 1CGWA 3MWAA 5HANA 2YEZA 3SCOA 2Y07H 2QV5A 1JZJA 2OV0A 2P1YA 3BDBA 3QW4B 3VNLA 3WUWG 1H9VA 3BSZA 4JPVL 4DZBB 2I9TB 4ATLA 4B92A 2ZXWB 1UWGH 3UPRB 5D4JA 3JUYA 3G1VA 2BSED 3GTXA 2NY5H 2YRPA 4ODTH 5FHAL 1IIIA 3E2HB 4ZYKB 3KRBA 4HCRA 3QRBA 3UZWA 2MOGA 4KK9C 4QYOB 4GRWH 4MBRA 4QYOA 3GC2A 4QJ1A 2CBUA 4Z0SA 3U82B 1Q9OB 4AH2A 4L4JA 5KVEE 3QFDA 5B38G 2GGIA 3EWDA 2K45A 4NXKA 1JCXA 1OVDA 1QAWA 1TU2A 4JNYA 1XP3A 4N2GA 3LSCA 3TXZA 3LS4H 3VFGL 3FUKA 1G9MC 1F56A 2ZOTA 3S98A 4OZHE 1HGWA 3AAMA 4F20A 1TZIB 2L7QA 5A40E 4Z2JA 1X4XA 4YYFA 4ZGYA 4Q7NA 2IH3B 4D3CH 3MRJB 2NW3A 3QQ1A 4F8TA 4QRBA 3NMEA 4PMQA 1G1CA 4AY0A 4UFIA 1QR4A 2KMWA 2DUAA 3MLRL 4LBEB 1NBVH 5L9DL 3WELA 5C0CE 1BQLL 4JYDA 2L0DA 3VFGH 5MEND 2V2HA 4DI8A 3FQYA 4ZW6A 1XLBA 1LT7A 3S2CA 3C2RA 3DUUA 4R7OA 5A95A 1QVOA 2J56A 4O8AA 3JWNE 3KWSA 1A3HA 3RFZB 1FH2A 3FA5A 4H6RA 1TT6A 4YMPA 1UC4A 3RGVB 1XBVA 1DYZA 1GZGA 4DZ5A 5AB3A 2GVYA 2BBFA 3Q6FB 4HPYL 3BV4A 3MUCA 1TO4A 2VZTA 3CDYA 3RGVA 3C2EA 4WCJA 2IPJA 3TPUB 3ARDD 1IB5A 5GGUB 4PP2B 3GSOA 3NT0A 3MHFA 1T0NA 3D46A 4AAJA 3WXVL 4M81A 2DIAA 4BDVB 4JVPA 2WNQA 3DUSB 3ULSB 2WIIA 1GKOA 4XBEH 4PC8A 3CLFL 3EGSB 4DXXA 4QJ3B 5CBEA 4XVJL 1GTFA 3A3XA 3RWJA 3TAKA 3KNBB 4LBEA 1BXUA 2MQ3A 4IKKA 2BY2A 2F38A 5SWQB 2CXEA 5T3XE 1O5DT 2YAOA 3RVUD 4GQPH 2WZPD 3UTTB 1OYCA 5GS2D 1TJMA 3MLYL 4BSJA 2WQXA 4LRIC 4XP1H 4EN2A 1SN2A 3IIVA 1LLAA 1PZCA 3H6AA 1QPKA 4AYDC 2H32B 1FDZA 2IQAA 1N19A 4LLQA 2FJHA 3BN3B 4XNXH 2EDHA 4Z7WE 2BOLA 3OAWA 4OFQA 1RA5A 2D7MA 2EAWA 4O54A 3BARA 1NDVA 4PRNB 4P3CH 2WW5A 4QISA 3DHJA 2VUOA 4HYVA 3L4YA 2FECI 1X4ZA 1NEYA 2I7GA 4TN9A 3Q2VA 2JK5A 3Q1SH 5KYWA 4PJ8D 4OCYH 3RJXA 2RA1A 3STBA 4FX8A 5ACLA 3ZDZF 4JFDD 4JFYB 4PJBF 2ICCA 2Z1XA 2XIDA 2CFFA 1AQ8A 2ISVA 2A74B 1MNNA 4P49A 1N64L 4ODHH 4DZBA 1WTGT 4IBZA 3ZVIA 5HGAA 1C8QA 1XXXA 1CJYA 4KPHH 3UWWA 2DWSA 5HVGB 3FO1B 3W2UA 2RB8A 1CDIA 1PZAA 4JB9H 1R3SA 3N2BA 4MGGA 5E8NA 5KINA 1JJUA 4XAZA 1Q2RA 4AMCA 2A79A 1GHFL 3LQZB 1UUQA 4PRID 5FA3A 1GNXA 1PB0A 3DSFL 5ID0A 3JWOL 4NQCB 2X1TA 4LAQH 3I6GA 1MNZA 2CIPA 3IVKB 3RURA 1A5AA 1UMYA 3BSHA 4UIKL 3VWKA 5E2TH 3D0VB 2WQSA 1OAZL 3EJRA 1A14L 4XNMA 4JB9L 5B1CA 2CZVA 5GSRA 5TQ2H 1TV5A 2OTDA 2WSYA 3FT1A 1DSWA 4MNHA 3LRGA 3WEOA 2PD9A 1TXKA 3VFUA 2YA2A 3NA4A 4MNQE 1V8EA 43CAA 3RL1B 1EA9C 4TSAL 4LXFA 1W16A 5GRUH 4PMZA 2JJTA 2DYPA 2ALAA 1ESOA 4P4KC 1TPDA 1XIJA 2QFRA 1MZYA 4JHBA 5LG6A 2CLMA 3WQ4A 4F7TA 2IDCA 5IVXB 3TR2A 4DBSA 1J10A 3CV5A 3GBML 4ZO9A 2OZ3A 4NN7B 4OCWL 4BH8A 4MMXC 2HE5A 1MAKA 4GBUA 2HYMA 2HNEA 1ML0A 2PF6A 5F1OB 2IV9A 2ZYSA 2R2HB 3BEWB 3SKNA 2V5KA 1PF3A 5B38A 3OIHA 4M80A 3BZ5A 4JFPA 4LCWD 4MX7A 4U1HB 3BLKA 5DD6B 5ADOL 5EF0A 3ZRSA 3EHBB 3BPCB 3EAKA 3L3GA 4PVMA 2AZUA 2VM9A 1RHHA 1LJMA 3WLQA 3RXZA 3OZ9H 1U8QB 2GUBA 3NAVA 2WXKA 2ZKWA 2R2BA 4YZWA 3OKEA 1C93A 4AZ6A 3UAEA 4DO7A 4QAIA 1D9KB 5JUEL 3RB7A 4N2NA 3VYNA 5HGHB 1X7IA 3AWNA 3TO2B 4RDQG 3QUXD 2PO6B 3O6FC 4MAUL 4FA7B 1XLJA 3P9LA 1QBML 3D39A 3MJYA 1DQML 1FFPA 2FR4B 2DSVA 1KLUB 3NCFB 4OSUH 3IDGB 2RHEA 3G5XA 3DSNB 4HWEL 4XP4L 1EDQA 3PWVA 1ZLUH 1JGMA 1MQRA 1MAJA 1L8PA 2WJEA 4L4VE 4RBPK 3WFEL 3UAJC 5ELIA 1JSYA 4QWWC 3QARA 1MCOL 4FI7A 3IGKA 4HJJL 4E68A 4R7XA 3BPWA 4L64A 7TIMA 2FIRT 2YD1A 5IOBA 4PCTA 3BPOC 2K9UA 5AL8A 2OR7A 1CFVH 4L5FH 5B7FA 3NEVA 4BE6A 4TNGA 3MV01 5HPMB 2O5XH 4HIHA 4NHUB 1NWOA 2XJLA 1BYPA 4I48A 3SKMB 3N3TA 3BO8B 5AUMA 3WTVA 4GG6B 1OHZA 5CPTA 3WK2A 1NGXB 5IB1A 3HE7A 2FGWL 3UQNA 5I1DA 1MCFA 2PWGA 3CK0L 4LFHG 4UUJB 4Y2OA 4YJZL 5IFJA 2HMCA 3CIVA 4JTRA 1I7TA 3ILEA 2AW2A 3OJ2C 1PO9A 1FA2A 1R3LA 4KXAA 4UNVA 3BJSA 4JFHE 4XMXA 4YEEA 4I9WE 3CXDH 5CCHE 1HXJA 5BZDB 3KYNA 2DZPA 1S2AA 2B59A 3FT2A 3DBSA 4U5KA 1LCOA 1RP8A 4QNPF 5KG9B 2K70A 1H09A 4K3ZA 5LGJB 2PDUA 1K4DB 3HVNA 3BW9B 1FWXA 1GVRA 3QSKB 2PW2B 4HH8A 2R0WL 2GC7C 3BWUC 1EJUC 1TENA 2O0TA 1TPH1 4Q8TA 1XIWC 4RA3A 1U3HA 4XPFL 3FL7A 3WO8A 3S3JA 5TBOA 1HH9A 3GXFA 1F58H 1S9WA 3ZTCC 1SW3A 1NCTA 4FXKB 1IEHA 3PWPA 3RGBA 5A6BD 4HSAC 4JFXA 4BZ2H 3KUMA 4ZSTA 1NUGA 2CKBL 1LEGA 2EEBA 4L9LC 2YL6A 3OC8A 4X7EC 4MPKA 4OM1H 3MRBA 1ODUA 5JIKA 1IILE 3FQUA 2CLVB 1KELL 4JX5A 4PJIB 5EG6C 3Q5TA 4X99B 3ZDYB 4PTWA 4F27A 3H2OA 1R24A 3BEVB 1FRBA 1OF8A 3IJHA 3T77B 3IDMB 3FPYA 2DLTA 4RGMC 2O6PA 4HQVA 2OR8A 2K78A 4MAYC 2PDBA 1V6XA 1YDOA 3FU7B 3GBLA 3O45A 3NOEA 4L4VA 4FQXD 3DARA 2N3JA 4Y2LA 1OX4A 4B7LA 2XGIA 4RW3A 2VDLH 2JB5L 1AHWC 4PQXA 2Y70A 2IPTL 3NZ8A 3VH8B 2DQGH 4P2OC 4KAQH 4BSWA 3AXKA 3LYEA 3ZO0A 5DS1A 2DI8A 4N90D 4U6YA 3ZT7A 1D8CA 2WXFA 2WAHA 1AYRA 3ELAT 5CD5C 1KTCA 4H9TA 4Q4QA 1E42A 1LLZA 4JPWH 1NUFA 2UZYB 3K6NA 4WTZG 4ESKA 4K8EA 3KGRA 2FD6H 2H0PA 4AEEA 1J01A 4WU7B 1RBLA 3Q44A 2BVOA 5BYWA 4QRUB 1NFAA 4EDXB 3TAOA 5BWAA 4PJCE 1CI1A 3DX5A 4S3EA 3H7BA 4KAQL 3H3BC 1JCNA 4X4YB 4JPIB 4I5BA 3CE1A 1POJA 1W9UA 1DE5A 4LZKA 2VGLM 3W9DA 1FKXA 1PKQB 2HV5A 1LP6A 3PWIA 1UM5H 3TSMA 3UJJH 5BXRA 4Z7QE 4AH7A 3WJMB 1OCJA 1KIPA 1XWVA 3KX6A 2AANA 1FWGC 2WJ5A 3M45A 1LL4A 3P0GB 4C90A 4IU3B 4P57A 5BXFB 1GY1A 3WJYA 2ZZ6A 1AMXA 1MCPH 3CUFA 4POYA 1S2TA 3WX7A 5JA8B 1FL3A 2JALA 3CYJA 3AQDA 3UNDA 4FR1A 2VQ4A 4J8RA 4CAGA 2EH8L 3UZJA 2VC2H 3L5XH 3BVDB 3GSNA 1S7UB 1YPZA 4KX7A 5I16B 1E5YA 4KT2A 3V5OA 1QMUA 1IGFH 2C79A 3W7CA 1QPOA 4D8LA 2W88A 4GHRA 1UM4L 3I2CL 4R4BA 2KS0A 2C9VA 4ZMYA 1JWUB 2DEXX 4AKOA 4UM8A 1DFXA 2OXNA 3FSVA 2HKAA 4JW3A 5EU5B 1WK0A 5IGXL 3DHMA 3TEWA 4GB9A 1CL7I 2Q09A 3AZSA 3THQA 3IFPB 1SZEA 2Y06H 1FUNA 4W9HC 3QV7A 4EZJA 1PY0A 4RUBA 2FQEA 5AHEA 3RTQD 3TYDA 3FQWA 2VDNH 3UBGA 4KCTA 1BZ9A 3I6SA 4XVJH 4W88A 5GSVA 2VGIA 5KW9L 2VR6A 2XZCL 2FRGP 4HKBA 1UZ6F 1HL5A 4P5TD 3LDVA 1O1HA 1A21A 5D7HA 4OZHF 1IBDA 4Z5RA 4EN3D 1W9PA 4XVEA 4QTGA 4DPRA 1WS7A 3BRGC 4IWWA 1HXMB 4PJXF 2H3BA 4JQ1A 2WANA 4LNRA 4YBLB 5DJ2A 5EZJB 4P5KB 3IJEB 5L7XL 3KJ4B 4HCHA 4N90E 2E9BA 1DE4A 3UZQB 5CINL 2B81A 3PG9A 2WBKA 4OZ4B 1MG2C 3ARRA 4JAWA 2WLLB 2JNZA 3BGFC 3EJQA 4JKPL 4L8DB 2E7HA 3GC4A 2KYIA 1FZOB 2XZCH 4GMTH 3CXHK 1RJYB 5EEWA 1ZCOA 4U2ZA 4GXPA 4QOKB 3CFTA 2VX5A 3GNRA 1A25A 2GAZA 2E3VA 3DVGB 4HUCA 5CZVH 1H60A 3CWNA 1QACA 1VFBA 4PTDA 1NL0L 2I5QA 4JY8A 2C7UA 1K8DA 1QHQA 5I73B 4Q4IA 3ALWA 3XINA 4UOJA 4B9GA 2QVKA 3GHUA 1YMMB 3VNYA 1RLWA 3NJJA 3GAYA 4D9RD 4FXRA 4UTWC 4UQCA 1JN6A 1Z5YD 4M6NH 3AT9A 3K1DA 4ZUUB 3VE0A 1M3IA 4HUXA 3MANA 1U93A 3VXNA 1P7TA 4TQEH 2RGMA 4Z77A 3L7RA 3APCA 2D9CA 3B7UX 2OZTA 2XNAB 4AZIA 3PP4H 1BXNA 3LKPB 3N9KA 2W0PA 5CIPB 3BPNB 1TV2A 3QUXB 4KJWD 1EAPB 6PCYA 3SE9L 3AIEA 2E7CA 2FSEB 2XY1A 1BVKA 4LCYA 3L0NA 4I9TA 4NNXA 1FHDA 2DIEA 2TSAA 5IFHL 3SQLA 4D6HA 4AVIA 1T1ZB 5LXGH 2Y69B 4MKNA 2XTSA 4IZGA 4Q4MA 2ZX7A 3VNZA 3KPRE 5L2JB 5LAXB 1CFQA 4X5WB 5T8GA 3RVWC 2HKFH 1SGKA 4CEXC 1XLHA 3STLB 4LVDA 2OP4H 2XWCA 4F0MA 5HQMA 1G4SA 4TVPE 5DEFA 4B3KA 5IVOA 1YYAA 4PRIA 4L8CA 4LYRA 4PS7A 4RZ4A 4KXBA 5HHOA 3WJXA 4GJTB 2JCWA 3C6LA 3RTQB 3BZ4A 3REVB 4ANVA 3MRKB 4H2HA 3EGDB 5FHBL 1WIOA 2Q5BA 5LBSA 1Q6CA 1QDSA 3NQFA 4M8UA 3MRGB 3VMOA 1SO6A 2NXIA 2SODB 2WB5A 3GG8A 1M7XA 3EYOA 4EI5A 4KBXA 2DQHH 4YXLH 2W60B 3SE3C 1CNVA 3ML8A 2VDOB 1FZKB 1MFCL 5DZNA 1TQUA 4EZMA 5HXMA 1KWKA 3AHTA 3CNYA 2VWEE 1Z89A 4BHUA 2V38A 4O1EA 4OU1A 1MUJA 2KDGA 2O6DA 3FQ4A 3WBEA 3QQ0A 1PVHA 2GFBB 4K55A 4OZFB 1ROCA 4OGAD 1Q8MA 1TUXA 4GW1B 3TNMB 4EVZA 4ERIA 3TBSA 4BKNA 1B4LA 3ANVA 4WI4A 3N9SA 4PB9H 4DX3A 1QBMH 1RH9A 3HN3A 3MI3A 2VTFA 1JV5A 2OMUB 4XP4H 1KN2H 3QEUB 3L2NA 4S3AA 4OQTA 2DM7A 4P5RA 3PAJA 4CQAA 1I1AC 3RZCA 4DGYH 1Y7VA 1Y6KR 1TSRA 3GJEA 3SO3C 3LV6A 3Q4DA 3TTQA 1J0JA 4YPJA 2JLLA 2ADGB 2QJDA 5CPQA 3TFCA 4NNPH 1BWVA 1AR1D 1AJZA 1P6AB 3QIUA 3H9HA 3CIAA 2ISFA 3NNTA 2QEZA 2LU5A 5EBLA 1SQ7A 1KGIA 4RE2A 4JQVC 3MV8E 4AHOA 5CBAA 6A3HA 2WXPA 2HH0H 1SM3L 4IKNA 1KN2L 4B7IA 1P7HL 1HIZA 2VAJA 2NV1A 1TOXA 1GS8A 5DVLA 4DSYA 1MFEL 3BH8A 3IJ7A 3U0PA 4W9GC 2MHAA 1NANH 3S9ZA 3CM4A 2PPEA 4WI3A 4PTTB 4UB9A 3HVDA 4YZFF 3KWVA 1B0RA 1VYPX 2BOGX 3ARGA 1L0XA 4J4KA 2V82A 1BXCA 2DQJL 2YRLA 5K9OA 4GFXA 2IAND 5EC1A 5H4YA 3ZQ9A 3WUWA 2VRJA 4QEEA 5GISL 2WN2A 2QFPA 2CC0A 4D71A 1AXIB 4IH3A 5F1IB 4P2OA 5DMYA 3CSYB 5KUKA 3ETBJ 2WHJA 1U8OA 3EOAB 1B2YA 2ZUSA 3O8XD 2CQVA 5I73C 2ANUA 4X2RA 1UXSB 1E6RA 2D7PA 4J4PA 1WICA 4MGXA 5TF1L 1S5NA 4W87A 1ACYL 4E4UA 2EE2A 3GSMA 3S5SA 1FVDB 5F2FA 3EYSH 5ITFB 4CNTA 4Z7WA 1XGQB 4KK5C 1OC7A 3NO1A 5T91A 1QNZL 3B43A 2C4FT 2RJGA 3MKGA 3G5VA 2AGJL 4KNSA 1NPJA 4EUPA 1QWGA 1AW5A 4PRAB 2W62A 4A67A 4PREB 1KYFA 2FLIA 4ODBD 4FR6A 1K72A 4NAFA 1WFUA 1A49A 1G6VK 5F2IA 3D6NA 4HPOH 1QVBA 4IGBB 2CKBB 3C0LA 1HO1A 2XSXA 3QEZA 2EDEA 4OF3A 2NLYA 3MREB 2Q8LA 3RRQA 5I15H 3I6TA 4JFDE 2E7FA 1AZCA 3BQUD 4IFKA 4MKTA 3QYNA 4Y88A 5AB1A 3FOKA 3E6FA 2OLDA 3DA0A 3CN3A 3V4PA 4RJEA 1RERA 1VEMA 4X0KA 5GS1C 5TDPB 5GGQH 1OFRA 3NEHA 2WHMA 4U3CA 5EGRA 3K0YA 4KOCA 4NRXA 3S5OA 3V0UA 1M7PA 4PMYA 1X5LA 4MNJA 4JYEA 4O14A 1YMHB 1PYWB 4DO6A 1WFTA 5IF0B 1GUVA 2VB5A 3V6OE 4HAGA 3F8UB 3V6FA 1K5WA 4J3ZA 3EUUA 2VOTA 5H35B 5E1HB 1O7VA 1QI2A 1RSCA 2JFEX 4YNGA 1MCKA 1MPAH 3TMLA 3TF4A 2OX4A 2Q8BL 3MVSA 3ETSA 4JPWL 4EZLA 1E51A 3H9ZA 1HEZB 2NY0B 4I7WA 3D33A 3V6FB 4Z3HA 3UAFA 2XZZA 4IYKA 1ZLVK 3ME0B 4K5PA 4X6EB 3VXUA 4HV8A 4W4QA 2B1AH 3HTLX 5BRZA 4Y90A 1QRQA 3QYQA 2CLRA 4JFDB 2J9XA 3V5CA 4B5EA 1QQDB 4OE7A 4J1UB 3ZS4A 2PP9A 4Z95H 1GEQA 3MYJA 5BQ7A 3JS3A 1WUNT 3GXNA 2DLFL 2RJMA 3ZE1B 3HZMA 3WFCL 3MLZL 3S37X 4MD5A 5C07B 1CE6A 1OK8A 1R4XA 2A4EA 2VSMB 4MASA 3VXSD 1AS6A 3V4PH 2FJFA 1O68A 1E6JL 4R34A 4RGOL 1ZANL 4LSVH 3HBLA 3M7FB 5CJBA 1XF1A 3VXMB 3IIZA 2CCWA 4BIKA 5KBNC 4A6GA 4JFFD 3RKDC 2ERJC 2VLKD 1JNHB 4Z95L 1UQZA 4Y7EA 3TYGL 4KROC 3RDTD 3IJIA 2AF2A 1EOMA 2FQGA 5E56A 3PFMA 4E0RA 1PG7L 2ZOKB 4FCAA 4AYSA 5J0BA 2Q02A 1P5UB 5CEYA 2ZSVB 4ENZA 7CGTA 5F7HA 2FVLA 2Z7WA 4Y19B 1X7QB 5AC7A 3PL6C 2HA1A 3ARXA 1BRLA 3UETA 4CBPA 4ZSOB 3QJZA 4Z0JA 5EO1A 5LGYA 5HP5A 4Q6YA 3DOSA 2AQTA 3NZHL 4DKEL 1RAMA 1KENH 4QCIB 3HB3C 4OFYA 2KUTA 3R1ZA 1M6UA 1M1XA 3POHA 3QCTL 4JG1L 2BNRE 4FXGC 5CN3A 3BI9X 1CDYA 2OYKA 4E3VA 2QKIB 3VFMB 3LTSA 1WITA 1RVFL 3PNRB 4LASL 4MA1C 4GQ9H 3BANA 2LU7A 2OWCA 4GIPD 1EGMA 3CL8A 4LPYA 4D72A 5I6SA 5HDQL 4L3EE 4FHKA 3NEOA 4GLRI 4NBZB 1O1ZA 2YB1A 4BFFA 1J5DA 3IMTA 5EU4A 5DJ6B 2O9TA 3NQ6A 4XG1A 3ZE0B 3EDKA 5B80A 2F61A 3EX2A 3CFKA 1IGIL 3I4KA 4ONOA 3PF2A 1JNLL 2CKNA 3QR2A 5DO8A 3CVHA 1NTHA 1HKLH 5FB8A 4HK6A 4Q8QA 4ZQRA 4U1LB 3H12A 2C3VA 4GXFA 3S2AA 1QFHA 4FQIL 5EOTB 5JW4M 1OCNA 1NCUA 3LKNA 5CP3A 4GRLC 4FQ1L 4JKLA 2HFEB 4NZJA 1N2VA 4IJBA 5JPMA 1ZTMA 3QEUA 2OMUA 2PYEB 3SCRA 3OR6B 5BMFL 4XBSA 1UR0A 1C5BH 5D9SA 4R7NA 3X11A 5MP6H 1HJQA 4JG0L 4GW1A 4J6IA 4OLZH 1EJSC 5D4IA 4ZX5A 1FH9A 2XGZA 2PGFA 1IGCH 1ZPLA 2IS7A 2WUBH 4ZOCA 1NICA 5FJTA 3UD6A 1P0EA 5E7FA 4FQ1H 2G75A 4FLQA 4L3AA 4IOSA 1FZKA 5EA0H 4G7YH 2JF6A 4G8GA 3HLAA 3HNSL 1H62A 2P45B 1EXUB 2Y2WA 3M0LA 4KRZA 1N6QL 3HJEA 2F5BH 2D2HA 3NXFA 3BZ4B 3EXSA 2G37A 4G6MH 4AMWA 2PPFA 1UWAA 2FLRT 5HHOB 3B3IA 3QNXB 4GAJH 1O9ZA 2PZ0A 2GJPA 4KKQA 4DEPC 1K9FA 1F02I 1VFLA 4A8RA 3TGXA 3CV1A 4FQ2H 3A67H 3VWJB 5JW4N 2X7VA 5FGCB 2EKSA 2NY4B 1LO0L 2BOFX 5EEVA 2BVUA 2VDIA 2XA8L 4OLWL 4RMVA 5D5MA 3UGEA 5A2BA 1X39A 4KO9A 3B8DA 3G0XA 4JREB 4NNXB 3ZTNH 3QO1B 2REQA 1FZJB 3P60A 1Z7JA 1MRAA 3FOLB 3C8DA 5KJ7E 1Z9AA 3NO5A 1L9SA 1OSZA 3M41A 3O0FA 4YAQA 1AHWB 3SBRA 1KULA 5CIPA 3BN9D 3LKPA 3U2ZA 1YEHL 5CM1A 2BSTA 4ZFZB 2Q7AA 1URLA 2JXMA 3GTTA 3MI6A 4Z77B 4Z2IA 3WJSA 3SE4A 2D8KA 1OP3K 4IIHA 4N0CC 3FKKA 3TWAA 1V51A 4Y4FA 4B9ZA 1KLYA 1THAA 2OG9A 3PVFA 1CG9B 1J7VR 3H42L 3WHXA 4IQLA 3WD0A 5EMYA 1OPGH 4U3XA 3N18A 5CC6A 2R1XB 3O2WL 4ZW3A 1OT4A 5GPRA 2NNXA 5EA9A 4AG4H 1N2RA 1QWUA 5D70H 5FO9B 1HXYB 2ATPA 4MXQC 5HYIA 1US3A 1OG6A 4P2VA 4Y7OC 1RFDH 1J11A 2GAZB 2JWYA 3DVGA 1R3QA 1MEWA 1YX1A 2PCPB 1Q7QA 3TJHC 5IV2B 1E28A 3V4UH 1YPFA 1RJYA 3GUFA 3LXCA 1ED3B 3L7FA 4GG6E 3KPLA 5C3TA 2CRIA 1TQVA 3V1HA 1MXSA 5D72L 1U8PB 5FK9A 4BHYA 1O9VA 1F58L 4M7LL 3IJEA 4JTAA 3FQTB 2JQXA 3KXFD 4MJ4A 2DUZA 2YBTA 1X98A 1ITCA 4L1BA 3DTDA 1D9KD 3MJ9H 4G80A 3U7YH 4EIZC 2ZQKA 5KVDL 3S5YA 5EDSA 2JKNA 7A3HA 1E2ZA 3PLYA 4HXAH 1SVCP 3KM2A 4IBTA 4LLYB 4WUUA 1AKJB 1NMCB 1DYSA 1W5MA 4JZNB 3AXLB 3TYBA 3HPLB 4PGLA 1U8CA 3OSVA 3QEGH 4I18C 3ZVVA 3P11H 3TESA 4CCDA 5TPWH 1IGTA 3S88L 1CWVA 2ZXDA 3WD1A 3VE9A 5A3HA 2XH2A 3PYCA 5HYQA 1ZUAX 1SYVB 1UZ8A 4XZ9A 1HESA 1OM3H 1T6VN 3BP7A 3NPXA 1KFGA 3EX1A 3DHFA 1JGIA 1QG3A 3CPLA 3E80A 3EOBB 4ZJ9A 5KBLA 4CUCA 2AEQL 3VSUA 3M6YA 2WMPA 1RIUH 1SO3A 1A3QA 1RUSA 1PPIA 4M93B 3I4EA 3EIFA 5I6PA 5D1XC 4J2XA 4GGHA 4MHBA 2F7PA 3QQNA 5GS3A 5ENWA 1GKPA 1TTCA 4BM7A 1RLDA 4WY0A 1NIUA 3RTLA 1VFOA 3DLQR 4ZFOL 2JJSA 4PBXA 4LKXA 3EYPA 2ZWZA 3EO1B 5ESAB 1FUYA 1JVLA 2FX9H 3CIQA 1XLEA 4Y5XA 2ADIB 1NLBL 3A4DA 1LQ0A 2QPEB 4MLJA 2WC3A 2Q9OA 4G3YH 3WO4B 5FECB 4JQAA 2JELL 5A3IC 2BVQA 3MCOA 1BVLB 5CBJA 3WMCA 1VBUA 3VVWA 4N8VA 2PABA 2DSZA 3ROOB 3RI5K 4LYQA 3FTYA 2BSDA 4U7SA 4QRUA 4X7CC 5LHEA 5M5DA 1B3OA 2ARJQ 3GBNL 1MHPL 1OY3B 1SQ2N 4HYTB 5ILTL 3N1FC 4FLHA 4BQ9A 2VABB 2XWXA 2H6PA 1AA1B 1LG1A 1JZFA 4FDWA 3M17B 4YDIH 1K6QH 3FFDA 5HVHB 4KQ0A 3MUIA 2OZNA 3II1A 2VURA 1HH6A 5FLUA 3T6ZA 4YWIA 4ANUA 1ZT4A 3B3DA 4XNYL 3IN2A 4Y6GA 4H7ZA 3W38A 3QKZA 2HTLD 2EDNA 4APQC 1R0AL 3MJ7B 3RYMA 5KSVA 1TPEA 1IGFL 3PJTA 3SDDD 3B2MA 1XFCA 2K6YA 3MUAA 1P4IL 3HB3B 5D1XB 1NFBA 1TTPA 1K4CA 3GBNH 3EXRA 3FXIC 1I3UA 3IMSA 3KPNB 5IJCC 4QG9A 1BG4A 2VM3A 3PIQA 1SXNA 4N2MA 4P9HL 5GJNA 3TIDB 3VRIB 1J8RA 3UC0L 5EORL 5JTWA 3WL1A 4Q9RL 2X3BA 3D07A 4E9XA 3HPSA 2FZBA 3IJLA 2CM6A 4LU5L 4MNQB 4YSAA 1P5UC 1DWGM 3G6JE 5CLZA 5I75C 4PJIA 1X97A 3JZEA 1KCUL 4G56A 2FT6A 2MOQA 2ZRVA 4PN2A 2C13A 2P44B 3WLBB 5A2AA 4NNCA 4I13B 4EPBC 4MS8D 3BUDA 1T1XB 3FU5A 4L9DA 2ZKMX 4BSVB 2ZUYA 4UTCA 2A74C 3WS3A 4FOUA 1S9KC 3DIFA 2F7IA 2WXOA 3N42B 5GIRA 1LDPL 4FXKA 1EGZA 1S9WB 2OB3A 3DFTA 3IGSA 6ENLA 4QXGL 4OJAA 5CINH 4S1RL 1BCIA 4QRQA 3TZFA 3X3GH 1KB5H 2EYSA 2X42A 2GVGA 3ZIZA 2ERJB 4WGHA 3WQOA 4J1OA 2NQLA 2KLTA 2VSKB 4G9FA 5ESQA 4OCXL 4FQCL 1AH0A 3VK5A 1UR9A 4GUQA 3T44A 1G9MH 3D05A 2PXYD 3Q2DA 2HAZA 1EO8H 3H9SA 4JFUA 4OFKA 5KG9A 3DX4A 3TBTA 3E2RA 5FL1A 3KYNB 2G3ZA 2W9DH 5BZDA 2QSCH 3LKSB 4KQ4H 1EX5A 3CT2A 3ATZA 1AXSA 2AKRB 1FO0A 1FPTL 1I1FB 4XNXL 2HMIC 2WQPA 3OQEA 1OV8A 3P7YA 4XP6L 4EXBA 3MV7E 4ZMLA 4YJ5A 2G5UA 5I1DB 5I71C 2R9HD 4OTXH 4NCC2 4OLEA 4JZJB 4AF0B 1MFNA 3ITTA 1EO8L 3BJLA 5FOOA 3MNDA 5DHVB 2CRYA 2JTDA 2X09A 4NIKB 4XCFH 4WHCA 3U30B 3EXJA 2JI2A 1O5QA 2YR1A 2D0FA 2E40A 4RKAA 4JRXD 5IHSA 3EBIA 3PFUA 4Y2DA 3VA6A 3HPJA 4I7VA 4M7ZC 4OTKA 3WUFA 3ZVHB 2PDNA 5EBMA 2Q3XA 3P14A 3PK7A 4CD5A 2TSYA 1H2JA 3B0XA 1T6MA 1WC7B 3LZFH 4C4KT 4I0CC 4NO2B 1PBGA 1KTLA 2BDQA 3BFOA 2MQGA 3REQB 4M1CC 1RI8A 4QHMA 1YRKA 4FQIH 1SXAA 5HMSA 2X1RA 5DD5L 5C0AE 4NRZA 1HOCB 3ZW3A 5CJXA 3WLOA 4B5XA 3DSNA 4AXNA 3G5XB 3IDGA 5BV7B 3MRLA 2VKZG 4UQ2B 5BZWA 1KC5H 5E1QA 3RWEB 2GQAA 4YNYA 1DBAH 5AZ1A 1SQMA 1WBZB 2YPLE 3M1BA 2A9NH 4NWUL 4QRPD 3GI8H 5AW3B 4IGBC 4Q97A 1GHFH 5FO2A 1K8ZA 4YQXL 3H7VA 5M03A 1ES0A 1OD9A 4GI9A 4JO4H 5B4MC 5EBGA 3IFNL 3MV7B 2AJSL 3TONA 3V0FA 5CU5A 3B9KC 1XS2A 3IUIA 1O4UA 1FNFA 5EA0L 4U1HA 4NSKB 5CEZE 3RKPA 3T0ED 4MZ2A 4EN3C 3FHQA 1E0WA 1R87A 3RM8A 1J9TA 3M0ZA 1R5VB 3MO4A 3CVCA 3HHSA 2VC2B 4ZAKC 3RBSA 3ZZ1A 5ES4B 5IVXA 3G08A 1A3ZA 3HURA 3ZJ6A 4ANXA 3IFNH 4PWJA 2QQKH 4PUNA 1ZVHA 2BIOA 2IANB 1FP8A 5HQLA 5KSWA 2DYPB 4GAJL 2PTXA 3Q3GB 2L7UA 4UQIM 2WKGA 3IGLA 1O6IA 4TRPL 5FF6A 1NMBL 2V5LA 1EEQA 4CNIB 4EF9A 1VEPA 4Z7UB 2CR3A 1XF4B 5E9DD 4MM1A 1A7RH 5C9ZA 1OQFA 4NNYB 1U3JA 1Z3RA 3RVUC 3L95A 3SCMB 4IGSA 4ZENA 2XINA 2MKLC 3ARPA 4XNMB 3AITA 4I8DA 3AYTA 2WSDA 2H0FA 4FNUA 1L9QA 4J3OH 3FTGA 5K4XA 2IKIA 1SJVA 2DMHA 4MMZC 3PY2A 3MCMA 5C8JB 4X9BA 1J8HB 4PJ9A 4M5TA 5ICYA 1V54B 5DJXA 4O02L 2VT0A 4JN6A 4DF2A 4JHVA 1T99A 5AOZA 4OJEH 1KCWA 3ONCA 1PGRB 4LLVB 4D6JA 2V81A 2FO1A 2YBRA 1X5ZA 5CD3A 1R3RA 3WO3B 1TVLA 3OGRA 4TTDC 3E49A 4JEJA 4CC4C 1MF2L 4N0FA 3KYOB 2ZXGA 3CSFA 5I76A 2P50A 2O5NA 3BCJA 3NZPA 4YSDA 3S0PA 3GMPB 4R0LA 5C0AA 1NBYB 2OMVA 3A22A 2Y7DA 3FYEB 1A47A 5JIDA 3AXMA 4XWGH 3O0LA 2W38A 3D3VA 1ULVA 3G1HA 5F7WC 1OD7A 3CDZB 5KYWB 1XYBA 3EH3B 4H7VA 4RRPM 5I17B 1OTTD 1AO7A 3PZIA 3TC7A 5IBXA 1FNHA 5C2BL 1F90H 1QO2A 3VD3A 3QJFB 3G1YA 3WNPA 4DHLA 4Z7VB 1ZLEA 1URIA 1E1CA 1F4XH 4GY7A 4A04A 2FJHB 2I5YL 4P07A 3M16A 3OJDA 2OX5B 1T7LA 2A1YA 4I89A 3CAWA 3AMLA 1KGCD 3A6BL 3O6CA 3GHEH 1VZHA 1E6OH 1KJVA 2XY2A 5BJTA 1SEBA 2IF7A 3KM8A 1Q9KA 1UP0A 3AS0A 3PHSA 4JK0D 3S5LB 1EOKA 3DG6A 4E0CA 2CO3A 2BNJA 1F00I 2WHVA 4PBWD 3FGCB 1MSSA 4B4HA 3EGSA 1REIA 5I66B 4EF8A 1AK5A 4DPCX 4S1FA 1GOIA 3P6LA 1T22B 2RQ8A 3P11L 4YO0A 2R27A 1MI5A 2DICA 4PP2A 1YNKH 3R25A 1LL1A 5GGUA 3W24A 4WQOA 1MCSA 1YXYA 3KHOA 1HHHB 1BG9A 1LNUA 3HEIB 2VLJB 3DYMA 4ISVB 1FAIL 3UYPB 1HJCA 2DF3A 3GHTA 2XG5B 4Z7VE 3CXFA 1KELH 4FTDA 1W6WA 5CFAA 1KM5A 1VBHA 2ID5A 3QSTA 4F3FB 2P8CA 4DJED 6CGTA 3PGDB 1KTJA 5E6ID 3QNYA 2YUXA 3QC6X 1PFOA 3ISYA 3SSGA 5I1GH 4G1MA 1H8NA 12E8H 1W9XA 4PBVC 4EKJA 1SY6L 3C60B 1KRBC 1SPDA 1Y8BA 4PRBA 4RZBA 1YNTB 5CMAA 4QNEA 2WJDA 1HDMA 2WLMA 3SPGA 2Z2UA 4K3EH 3PHOB 1Q0YL 2CXKA 4Y0GA 5E9XA 3S4SG 1YE6A 4GH3A 4O1DA 2A5HA 2B5IB 5DSCA 1H9DA 2A1WL 2H7WA 4GW4B 2VRAA 2YPVA 3ASWA 4G7EA 3D30A 1M2OA 3UMTA 5DLCA 5DHVH 4MCZB 1A5BA 2CLHA 2HQAA 1TZIA 5TFSH 1BKHA 5JMUA 1K3ZA 3SUVA 1ZAIA 35C8L 3APGA 1JI2A 4E9YA 1TKWB 2P88A 1VPOH 4D9PA 4HJ0D 3OTTA 4K3EL 1V8HA 2J74A 5D33A 3CV7A 2M1KA 2H3NA 3WTWA 1DWHM 1WV7T 5LCVA 3C2AL 9PCYA 3CZFA 5T9CE 3VPLA 1Q9OA 1KFLA 4GO6B 1RUKH 4ZB5A 5C6PB 3TQPA 5H2BB 4F93B 3PTMA 4RX4D 3CCHB 5F96H 4A7SA 3EB3A 3QQWA 1SJDA 2B7PA 1KLGB 3FO9A 1FZMA 2F5AH 5FJJA 4GG8B 3ILQC 3MLSL 2TRHA 3QIBA 3C3NA 4NG3A 3GPSA 1BF6A 3RQ3A 4ATDA 1KB9J 3EYQC 2UY7B 3PZQA 4YLCA 4LUJA 4K39A 2WGXA 1KFBA 4ZFMA 1EZWA 1NCGA 2X9WA 1T3FB 1PY4A 1NM4A 3BUYB 3OIXA 3SDXA 4HEPA 3GG1A 3OPSA 4X4ZA 3N9GL 2OW7A 5FUOH 5FV1L 2IXQA 4TQPA 2R15A 3DECA 3NZHH 4N0YL 4NQXA 2Q71A 4NZ5A 3TJ4A 1JPFA 1VBGA 2F5AL 4ICMA 3P77B 5D09A 1GGUA 2RH9A 3GUTB 4PJGE 3X13B 4UIMB 2CG9X 4HJSA 5T5NG 1CF8L 2R1WB 3W9EB 1UM4H 3I2CH 3L3KB 5C3LD 1W0WA 1L9MA 3KDMB 1EBHA 1F1GA 3S34L 1II4E 1KJ3H 4FYRA 3M1ZA 2Y2TA 4M7JL 3KL3A 1H3TA 5E9DE 3Q5OA 4EZKA 4NKMA 4MXQD 2CDGB 2YZ8A 4LCIH 3O3BB 5E2WL 2AL2A 2OO0A 2PTYA 3OLEA 4KRLB 3TTYA 4F5CE 4ZG1A 5AOJA 3MBEB 4NAQA 4F2MB 2PWFA 4UNLA 4XPHL 3AQYA 1TA3A 1JNDA 3Q2CA 1M2VB 3DRTB 4PB0H 5FYJH 5BOFA 1VGKB 3OKNB 1YC8A 4IDJH 4EOUA 3BE1L 1G9ML 1VJZA 4HUUA 1UTDA 1DJNA 4UT9A 3QPQC 2VXQL 2E5CA 4GUHA 3NFPA 3W2MA 4KXZH 4PJFF 3IGAA 3L9BA 5LNSA 4B15A 4HAKA 3ASOB 2YFOA 4PY7B 3PWGA 2FCBA 3CFNA 4XNUL 1OIFA 2B1OA 4NSBA 2XX1A 2HZHA 4RZCA 5I6NA 5EFFA 4HMEA 2HG5A 3NDYE 1SJHB 2D3JA 4XP6H 2Z1PA 3KXFB 3HA1A 2NW2A 1B3IA 1Q1PA 3HLKA 2XXCB 3BIBX 2J3SA 4NZUH 3U9UA 1JXFA 4FERA 2H2PD 4W85A 1LBLA 2MEJB 3L5MA 2R2CA 2YD8A 4OZHA 5F3HB 3ULUL 3CSGA 1UWFA 4XD3A 5EIVA 3W7GA 3ECVA 3ZYIA 1J05B 5AOMA 4PJXA 3BTNA 4ZMPA 4JE0A 4D8PB 3M86A 4I85A 3WLWD 2KT6A 4UC5A 3Q13A 5BXTA 2C91A 2NXZB 2P8MA 3QWOB 5DFWH 3SD5A 5IT2H 4KXCA 3R7MA 4ODWA 5E6ZA 4N02A 4OZIB 5GHWL 4DGVH 1EHLL 2ZZ4A 2QQNH 4BZYA 5DJDB 5H94B 3U1SH 3WFEH 4ZBCA 5IHHA 3D25B 5FJPA 4HJJH 2Y88A 1G6CA 4JM2B 1SZRA 2NMSA 4NB7A 1Z6KA 4Y9MA 4F0SA 4CKQA 2EVIA 4O0QA 5I8EA 4FTVA 1ETZA 2A9NL 5JHDA 1OWQA 2YL8A 4DIAA 1DBBL 4WJ5B 4GS7C 4C7GA 2YPVH 1HJVA 5LNWA 1FFNB 2ZX5A 1HK6A 2NSQA 1FV1A 3RVTC 2PI6A 4WO4C 2O6FA 1S4IA 4NLHA 3THMH 1Q6RA 2I5IA 4YTQA 4IRJA 2XU9A 3ZTNL 1BZOA 2ADJB 4MB5A 5AB0A 3EJJX 1UR1A 2P5EA 4MY8A 4AZCB 2HBVA 3S37L 4WEEA 5SWSA 4S2SB 4ZQCA 1QRNB 2DPKA 4OGXH 3IACA 1BREA 1M04A 2PBOA 2VR3A 4Z7IA 1YEHH 2FAUA 2FH8A 2JFCA 4HF5L 4RFEB 4PW4A 3U2SB 3NRQA 5HHVH 4IIEA 1R3IL 4IHCA 9RUBA 1UC5A 3W7EA 3L5JA 2AMXA 3ZKSD 4YSUA 3IF1A 4D8OA 2ITDB 3W2DH 2OZ4A 1DJXA 1ZS2A 3KCPA 1RVKA 2UZXA 4XXWA 2WOBA 1DORA 4PMEA 5JIMA 1FWSA 1K3UA 2P5NA 3LHVA 5FO8B 3BXNA 3OLIA 5AHLA 2G5BB 1KB5B 3MRCA 5ANMB 4JM2D 4UM9A 4MLSA 5FS5A 5HHNA 4AC1X 4L1TA 3UP1A 1MZZA 4GBDA 2OL3H 1FNAA 3L45A 1FDJA 3VI4A 1I2PA 5E00A 2WQ8A 1J9SA 4Z7OB 1O7AA 2Y7FA 4APQA 4BH7B 4KMLB 3WQPA 5FYJU 1NQKA 4Q9QL 4ZUTB 3SDOA 2EIZA 1H8SA 5D1XD 3B4NA 5I19H 3K5SA 2CZEA 4U0QB 1JPTL 1I4FB 3RLVA 3P3SA 3KEHA 2CLKA 1D6EA 1AE6L 3NG5A 3PGFL 1KJ2A 4WUKH 2VISB 2OL3L 1PTDA 3LENA 1G9NH 1MWOA 3KWWB 2JJWA 1NAL1 1S46A 5F9WC 1OGTB 1NM9A 2XVGA 3D09A 3VTMA 3QV6A 4JOMA 2YXOA 3PZ9A 2Z24A 4C6IA 3AUVA 3QFJB 5DR5L 3UP8A 4XMUA 3VXRD 5I03A 2CBOA 2VLJD 3U2EA 2X41A 3DENA 1CR9H 3PUGA 5IJVB 3TWCH 5BV7C 1N0XH 4NERA 1FWDC 3VDGA 1OC6A 4QX4A 4NO3A 4KRTA 4F3HA 2Q76A 2XRAL 5TH2B 3ILPA 3QVAA 3R4IA 2Z27A 4NF7A 2J1XA 1ASPA 4C6CA 3EHBC 5DJ0A 3NFSH 2G3NA 1W1B1 1VPQA 3AG3B 3GLEA 5JLZB 3A4AA 4PRPE 4G6FD 4AXWB 4L4TE 1XB6A 4FI8A 4R26L 4RLIA 4XZLX 1YEJL 4BFGA 3LM3A 1J9RA 2VMJA 1E5ZA 2OJEA 4XCCL 3HNTL 4HKXB 5I8CB 2P0IA 4XXDA 4LY8A 4HUKB 3CX5J 1XCQA 3LX9A 1V5XA 4B90A 3L4ZA 2YO3A 5ADPL 2QSQA 2YAEA 4X9YA 1OW0A 2XC8A 4M4PA 4MMXB 1E27A 1G0YR 3SJVE 4A7QA 3EYFA 1H7WA 5C0GA 2QDHA 3TW9A 3IDJB 2Y85A 3KYMB 1NAML 3DX6B 1OCRB 3QG7L 3UJJL 1Q6EA 1RK1A 2W0KA 4NGHH 1Y6MR 4UI2A 5DZJA 5J1SC 5CPMA 3PUEA 2CWRA 2GPTA 4Q8MA 4LUTA 4H8UA 3QFJE 3OAZH 1Q72L 5TJWK 2NWSA 1YDPA 1GAFH 3QM3A 3D2TA 4LAJH 1ISZA 1QSFA 3AM8A 4CDGC 1VLIA 3GS6A 2EC9U 4X5PA 4PRHA 3NYZA 4X0VA 4XTDA 4EI6B 4TTGA 4FKEA 5MEOA 3GR8A 4MVBD 3ZKND 2J6XA 3GMQB 1BEYH 2ZSWB 2CPUA 4Q6KA 1TETL 2EZ0C 2XZQL 4FZ8L 5HY9B 2FLBT 3MOBH 3MAWA 2BS9A 1TWZA 2A3EA 3CFBA 5ILTH 1AZNA 1VA9A 2PYFB 1TTJA 5GRXG 4WEUD 5LHDA 1X38A 5IVXE 3QR0A 1XGUA 3D12B 1DZBA 1MJUL 3F7YA 2WLIB 1Q8JA 4UTLA 4X61A 3IXTA 1XGYH 3NJHA 5SV3A 2WNWA 5K39A 2GK1B 2E28A 3KHJA 2CO6B 3RX8A 3PUOA 4KW2A 5KZDA 4OLVH 7REQA 3FFOA 4BD4A 1B3WA 2B4GA 1V10A 5DO2C 5EU6A 4WTZA 4ADGA 2IH9A 5L4FA 1H7XA 2RFGA 4MJ5B 3ZYJA 4IU2A 3UC0H 3KPOA 3V6ZB 3WMLA 2Q8ZA 5DD0H 3MC5A 25C8L 2A9MH 3VD9A 2QGDA 3SPCA 4I7UA 3T07A 4JKPH 5IM51 2JK2A 4NO0D 1T0MA 3CHFA 4HPXA 1TLKA 2XWRA 4A6YL 3AC0A 2VNCA 4I1RA 5I2IB 1JYNA 4B4FA 3PE9A 3R8QA 1CDCA 5T1JA 3ECBB 1R8LA 4K8RC 2VXNA 4J7RA 5F96L 1ZT7A 4H01A 1RBOB 3WFCH 3PREA 4DERA 1U3ZA 4XBGB 4DYKA 4GBXA 1GPOL 3TYFB 2E4TA 3U2IA 1ZXQA 3F7LA 3QH2A 5B1JC 2YSSA 5LIWX 4M8VA 5HVHC 4A3RA 2J1WA 4GINA 5FEPA 4LVNB 3SYQA 5DJCA 3W2LA 2G2RA 2HPIA 1Q1JL 2WBJA 4MA7H 4N1EA 4US5A 4GRLB 4FF7A 1GJWA 5IFTA 4XX1E 4OCMC 3EFOA 4YVVA 4UMCA 3TFXA 4HNLA 1W3LA 3S9YA 4WK2B 4L6DA 3K8KA 4PGBA 4Q4RA 5D7JB 1PSCA 4O1CA 3SDYL 4PJCB 2OXHA 4YFEA 3QORC 3VOHA 4CLMA 2D2GA 4N3UA 2J6EL 4UDTA 5DMKA 5ICXA 2NY0D 3VRLF 5CCGE 5GZOC 2VUNA 1T96A 5KZCD 1J1OH 3C5ZC 1QI0A 1E5CA 3H4FA 4DP2X 1E50A 3G04A 4WFFE 3SGEH 6PAZA 4P8WA 3M8OL 4NM4H 3WLNA 4C6JA 4PJAE 2X9XA 4MQTB 5T3ZL 1WFIA 2OAAA 4K8RD 4MNGA 4DAFA 2FO8A 3LN4B 4QGTA 4QP0A 2Z93B 2YSWA 3QNZB 2ARWA 3C08H 4QKXB 3EOSA 2IALA 4KK8D 4Q4SA 5C08D 3SYOA 4AITA 2VFGA 3J7HA 4RPPA 1IARB 3NGBC 3K6FA 4RNRB 1N8WA 2W67A 2VXQH 2DSKA 3AAZA 5FYJE 4IK6A 1UATA 2CO7B 2X6AA 2YJQA 5IBUG 2QQ6A 1W8EA 4Q8NA 3NQEA 5EH1A 1E15A 4Q14A 4R4NC 4FQLH 3NQGA 4PGEA 1XHHA 5TDNB 4JM0A 3JVAA 8A3HA 5C0JA 5INCA 5IR1A 5FA5A 3FT3B 1XD0A 3CHOA 2GUUA 3W7OA 2OZ4L 1P0SE 4H8VA 4WR3A 1W72L 2CK0H 2PLCA 4GYJA 1O12A 1E6QM 1ZSDA 4KJWC 1GT8A 1Y5VA 3ATBA 1JGLL 2WVTA 4H8PA 4KNUA 2GQ9A 2YXGA 5DCBA 4N0UE 3P1VA 4TSBL 5HDBE 4A29A 4A6YA 4TOQA 3A6OA 2QKSA 1RJLB 2EXYC 1E8YA 4KC3B 4NHCL 1JPGA 4NPJA 4WIQA 1AH3A 3KP0A 4E41A 1NFDE 4PMXA 4A8NA 5G4EA 2G95A 1G6RL 1MVFA 3G5WA 2JQAA 1SXZA 4ZR8A 1JD9A 2PR4L 4ALAL 1OWRM 1U1JA 1UB6B 1HQRA 1N8OE 3ZKXC 5CLXA 3FBKA 3C5JA 1LL7A 4QO1B 5GHWH 4RZ6A 1IAKB 4FP8L 4MTVA 1JZ7A 4N6QA 3I6LE 5AYQA 5I6OA 3UY7A 1KFJA 1PZBA 4YXHH 3VTTA 2GOKA 2YYTA 1NMBH 5I78A 3GU1A 2IJ0C 2IADA 4L3ED 4NHCH 4S23A 1DBKL 2X0WA 1JK8B 2J6VA 3W39A 2OFJA 3GSUA 4HX1A 3QA3B 1LEKA 3DETD 2Y3AA 2A0NA 2EIJB 3PL6A 5GS0D 1T8QA 2DZSA 1F4AA 1M7DB 5K1VA 4G6ML 3IBOA 4WI2A 4CVWA 1NGWA 1TIMA 4AX7A 2WK2A 4LARL 3D9AL 4AUUA 2B0MA 1ICPA 2XYLA 4F2BA 1QSZA 2CZNA 2WO5A 1EAJA 5G2HA 1HHKA 4JJ5B 4NFDA 1I8KB 4C4UA 3L3HA 5B7ZA 2VERA 4CA4A 5AL0A 5K9KA 3PV6A 1KN4L 1BXXA 4OT1H 4TNFA 1Z9LA 3VFTB 4JY6A 4OWGA 5E0KA 3KBWA 3LV3B 1AGDB 2G60H 2HWZH 3FFCB 4LSTL 1DWAM 3KHQA 2A6DA 3MGOB 1R3IH 1XINA 3Q6GL 3MA7A 5GS1B 3LCXA 3UJTH 4AV4A 3DROB 2OMZB 2WQVA 1S7RB 1S7RA 1ZCCA 2CNCA 4EIGB 3MU3A 3TROA 4MG4A 4HEMA 1EBPA 2A6DB 2OA9A 4ZBJA 5FKYA 1IAII 1EBGA 1DN0A 4CW1B 1X5XA 1TV4A 2OJ1A 3IT8D 4RRPG 4YUEH 4AW4A 4YEFA 2BHFA 1G7PB 2ETWA 2ZZ3A 3QDMA 3DJRA 2VVSA 2P46B 1I8KA 2WAQA 3E12A 5KETA 4GMEA 4LSRL 2OR2A 4MCMA 1EJ8A 4Z3FA 1A8JH 1MWAH 1YEFL 4JMNA 3HMXL 4A7VA 5DXWA 1KFWA 2WTRB 3IMBA 2JKPA 2HUEA 5A8QA 3SBWA 1D5MB 3S8WA 3MBFA 4Q0XL 1ORQA 1X7TA 2CO2A 4HX1B 4Z7NE 3GSUB 4BWUA 1IZCA 2C19A 4S3BA 3S3GA 2GJ6D 3O6ML 3ZDYE 3A6BH 4AVOA 3AWFA 1CU4H 4HUVB 4K9EL 1R34A 3N15A 1KPVB 3RL2A 1K02A 4FKHA 5F7AA 2YWZA 2PCXA 2HCVA 2J78A 3M07A 1K2DB 1IEBB 3K2KA 1FHNA 3KRZA 2J88L 2HPOA 2DW5A 3MRRB 1MW0A 4GK8A 5EZPA 4ZX6A 4WTWA 1FGNH 5CEXB 2QT6A 1L6YA 1TELA 2PGRA 4FMVA 3RBGA 2ISWA 4HKJA 1OM0A 4JYFA 1X1OA 4E9VA 3B8IA 1RJLA 2X12A 1TITA