1KXVA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 175
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxvA01
1KWGA 1DHKA 1R34A 1XD1A 3ZSTA 3S2CA 3CO4A 2Y8VA 1CENA 2UY4A 1ZBVA 2VJXA 3VD4A 3WF4A 1AQMA 2D73A 1E6RA 1UR8A 4TTUA 1LLOA 2A3BA 1H2JA 3VIHA 4OIFA 1XCWA 1I75A 3VINA 4D6IA 3TTQA 3SCVA 3HZ3A 3VGBA 1E0WA 2BV9A 2GVYA 1VFFA 3I3BA 2VCAA 4MAVA 3J7HA 1PX4A 2WC3A 3EJUA 3SEPA 1GOKA 1OSEA 1VEOA 4QCFA 1GOOA 3BMVA 1SR0A 3MU7A 3GXDA 5M17A 1LWHA 2X8RA 4PSRA 4X0NA 4DWSA 5CXPA 3OZPA 5AY7A 5FD0A 3LPFA 1V0MA 2WKLA 3K1DA 1Q6EA 2J77A 4BQ3A 4UQ9A 1B3VA 1QPKA 1D2KA 2FH8A 2QMKA 1U2YA 1E1FA 3KZSA 2E8ZA 1UWIA 3OLIA 4TX8A 3RIKA 1KCKA 5I0DA 2EPMX 1HP5A 3M7SA 3SCRA 1HVQA 1JXKA 1BQCA 1CGVA 4PMXA 2JIEA 2F7OA 2GJPA 3WN6A 1VJSA 4JAWA 3OLEA 3AHZA 1TR1A 1V3JA 3CZEA 1W9XA 2ZX9A 4OGZA 1O7AA 1XYZA 2W61A 1VEMA 3L4VA 2GFTA 1M53A 1B0IA 4AW7A 2O9PA 4H2CA 1VB9A 3AFBA 1HXKA 1V3IA 3THCA 6CGTA 1R87A 3MSDA 1E3ZA 1DTUA 4P7NA 2D20A 1CYGA 1QNPA 3ZQ9A 2X0YA 3CZNA 2CKRA 1OGSA 3VMOA 2A3HA 3WUBA 2XG9A 3QHOA 1UASA 4AD0A 2YJQA 4XX6A 3EMZA 2XVPA 3W82A 1B31A 1QNQA 2YBTA 2V38A 4JIEA 3LRKA 1LJYA 1GORA 2XWDA 3AYSA 2D3NA 2VQUA 1HKJA 2EEXA 5D8WA 3EYPA 4ACZB 3F5KA 5A2AA 1VIWA 2BHYA 3OLGA 3ARSA 3GZAA 4RE2A 2FE0A 3UG3A 4IPNB 1A47A 4UQAA 7A3HA 2W63A 2WB5A 4NZJA 4GO8A 4KRTA 4P8UA 3AZSA 3KLKA 2YL8A 2ZUMA 1LL6A 4PMUA 4E2OA 4F8XA 3AISA 5A8OA 3EDFA 3EJSA 1QI0A 4Q22A 3AS1A 3WEOA 2XUCA 1OM0A 1UD2A 2E4TA 3ZJKA 2XFRA 3OBAA 1OWQA 1JDAA 2XYLA 4AXNA 2E8YA 1BYAA 5HOSA 3VDHA 3TONA 3ARQA 1EDTA 3K4DA 4R5EA 1MXDA 3A47A 2V3EA 1CGWA 2XPKA 1KBKA 4LQ1A 3NYDA 1WNOA 2X0HA 2E9BA 3WH7A 2YA2A 4HZ7A 1RH9A 3PTQA 2VRJA 1WB0A 2VTFA 2VZTA 1QI4A 4UFMA 3F4VA 1EQPA 2NSXA 1GQKA 1V0NA 3EBVA 2ZXAA 2UY2A 2VI0A 2HISA 4S3JA 3WSUA 2JF6A 1HT6A 3ZT6A 1DWFM 3QHMA 4NZCA 2D2OA 1JNEA 1D3CA 1UWTA 2ZX7A 4DWSC 4H8VA 3RJXA 4JL2A 1KWKA 9CGTA 3WKZA 3BAYA 2WC4A 1NARA 5E1QA 3L4XA 1PBGA 1QX1A 2VURA 1WO2A 1MQRA 2G8ZA 3AI0A 3WD2A 2OYLA 1XYFA 4E8DA 1UWSA 1E9LA 2F8QA 4H04A 1R47A 2UY5A 1QBAA 4MB5A 1SMDA 2W62A 6TAAA 4UFJA 4LGXA 1J12A 3BMWA 3EDEA 4AEEA 3AHVA 4AD1A 1XCXA 5M03A 2PWDA 1OD8A 4CCDA 4U5IA 2E0PA 1R85A 3WQVA 3WH6A 5BCAA 2EPOA 3MUAA 1JDDA 3SCQA 1YHTA 3II1A 3A21A 4HOWA 2WKGA 1W2PA 1E73M 2VT0A 3VMPA 2EO7A 2QPSA 3CPUA 2VX4A 3ZT5A 4W86A 3K46A 2DSVA 5A8PA 3MMWA 3ALFA 3K8LA 1KGXA 3MSGA 2QPUA 2EQDA 4FMVA 4CU7A 3QGVA 3BAWA 3DX3A 4NXKA 2YBUA 2J47A 2Y5EA 1K9EA 2D1ZA 3GYCA 1V6UA 4PMYA 3AHYA 3W27A 1DWAM 3HMCA 1CXKA 4D6EA 1IV8A 1MW0A 1CDGA 1WPCA 2C7FA 3EDKA 1H0IA 4MNKA 2F1AA 3UETA 2V3GA 4PUDA 3WQ4A 2BVDA 3CHEA 1MW3A 1HJSA 3ZT7A 2YA1A 3GDBA 1JF6A 5JIPA 1E6XM 1UD8A 5ABFA 3LRLA 4DWSB 3UERA 1JFXA 3VU2A 3VIGA 3WY3A 3VO0A 1WAWA 3DDGA 1W3JA 5A6BA 2G3JA 2WMJA 4UOQA 4OBRA 3OGVA 1IT0A 1BHGA 1I1XA 1GPFA 3QOMA 3BC9A 1W9BM 3PTMA 3CBWA 3WF2A 5I6SA 1V3LA 3BLKA 3S5ZA 1C93A 1H11A 3MV01 1BG4A 1H3GA 1R7AA 2J7CA 3G6LA 2CBJA 2UY3A 2ZWZA 3WY4A 3OIHA 3RPMA 4B9ZA 2J8FA 3AXXA 5LA0A 4DO6A 1GNXA 1R75A 2WMFA 3WDQA 1WKYA 1CXEA 4DO5A 4HP5A 5JUVA 4PRWA 3CUIA 3T0BA 1QVBA 4KH2A 3AICA 7TAAA 5E6YA 4PTWA 4H41A 3CZLA 3BH4A 2PWGA 3NSNA 3SCSA 3UR8A 1EO5A 2WYSA 3U57A 3IAPA 1EXPA 4OKDA 3ZJ8A 2BHZA 4AWEA 2C0HA 2OYMA 3VDBA 4C7FA 4QLKA 3AHXA 1B9ZA 1EA9C 2JALA 4NZFA 3M6DA 4HMEA 4V28A 4ATLA 4YN5A 4PMZA 4AY1A 1JAEA 4AD5A 1PX3A 1B90A 5A6BD 2J75A 4W8BA 1FH9A 4FLQA 1E15A 1BSIA 4QDMA 1FFQA 5GPRA 3VSVA 3WFLA 3H53A 2WM0A 1XSIA 4NX0A 4W8AA 3JUGA 3SCNA 1UOKA 1E1EA 3VNYA 3K4AA 2GSJA 1MW2A 2JF7A 3PZTA 4Z2LA 1C7TA 1NWTA 2E9MA 4U3AA 3A4WA 2FHFA 4HA1A 5FL1A 1SMAA 3BAXA 2WZHA 2G41A 3AOFA 3NJ3A 3S5YA 4UQBA 3AMKA 5I78A 4FNPA 3D52A 2CITA 3BAKA 4PCSA 4WSKA 4PCTA 1XRVA 1AVAA 3PZMA 4TOQA 1QWUA 1ZJAA 3AIBA 1WCGA 5JBDA 4UR9A 1GVIA 4DO4A 5HNNA 4D6DA 6A3HA 5A6AA 1HJUA 2G3MA 4MDOA 1GJUA 5IHRA 1X6NA 2YA0A 3KL0A 5I5RA 5CPQA 3T2QA 1UWQA 4ZE4A 1ZS2A 1UKPA 1TMQA 4IUGA 3OA5A 4NRRA 2YOCA 3WDJA 1CECA 4CN4A 2QLYA 4JCMA 1J0IA 1NP0A 2WHLA 3LRMA 4BF7A 5E0FA 1NOFA 4X9YA 3BSHA 4AZCB 2VR5A 3F5JA 2VUYA 2EPLX 1UR4A 2WWCA 3SCOA 4XZWA 2EAEA 3W28A 4URIA 3TOPA 5CG0A 2VRQA 1W3HA 1IZJA 5BRPA 3GTNA 1E4IA 5FL0A 1W2VA 3UESA 1OT2A 2W91A 2WLZA 3KEHA 1GOQA 1E4LA 3HG2A 3A3HA 3FW6A 2X09A 1G01A 3CV5A 4FLSA 1HF6A 3WNPA 3OZOA 1JZ6A 3L4WA 2WW5A 2VX7A 3VX1A 2J7GA 4Y7EA 3RMEA 1UYQA 1V08A 1XC6A 3CC1A 3ARXA 1J9YA 4BS0A 4GINA 1VF8A 1M7XA 3AROA 2A3CA 1DWJM 1TZ7A 4UZUA 4XV0A 3N15A 3AJ7A 3KL3A 2F7RA 3CHCA 1QI3A 4MDPA 1O7DC 2D0HA 2F61A 4P7OA 1UD5A 4U2YA 1WDQA 1C90A 3AMCA 4XB3A 5JBFA 1P6WA 4W84A 1E71M 4PEEA 2OLHA 2ZUSA 2G3IA 2XFFA 1QW9A 1TQVA 5CPSA 1NWUA 4Z2HA 3AXIA 2XSBA 4R27A 3WIJA 2WHMA 1HJVA 3WMSA 2BY1A 2CETA 3T0DA 2D0FA 1BFNA 2CHNA 1JG9A 3T2OA 3DC0A 3WMBA 1S46A 3GNOA 4PMDA 4B9YA 1GONA 3DYOA 4CN6A 2OWCA 1JAKA 1W9UA 1BF2A 2G4FA 4BQ2A 4ZEPA 3G6MA 1IZKA 4Z2GA 2J7BA 5A6SA 4DUWA 3LXBA 1MFUA 3CZSA 3O2LA 1B2YA 1JNDA 2XN2A 2VVSA 5A6LA 4DUXA 4AIOA 1T0OA 1V3HA 2WHJA 4MJ2A 3THDA 3LXCA 4GI6A 2VCBA 4MAZA 1V02E 3B9AA 2WZEA 4FK9A 3MMUA 1MFVA 2FDMA 3RM8A 5HXMA 1E6NA 1E5JA 5CQ1A 3VD7A 3TTYA 4E4PA 2V5CA 3AIWA 3PZNA 4GIAA 3K8MA 3BVXA 1ISZA 2AAAA 3LPOA 3MMDA 3HG5A 1QHPA 4FNQA 4P8VA 2G3NA 3WF3A 2Y4SA 1UWRA 1ECEA 5CJ5A 2OSWA 3BAJA 1C8XA 3HG3A 4M80A 3CUGA 2F1BA 2XIIA 2J7DA 4ACZA 4OOZA 4AYSA 1VENA 3LPPA 2OYKA 3WMCA 4F79A 2WANA 2VVNA 1QW8A 5A8NA 5ABEA 3VGGA 3VD5A 1AQ0A 2BY3A 3VSUA 3CIVA 4A3HA 1J18A 1RP9A 3WDHA 3SCPA 8A3HA 1UR1A 2Y2WA 3M46A 4OOUA 1Q6GA 1HWWA 2FGLA 1EHAA 1ESWA 5KZ6A 5JIWA 2CCRA 2YDSA 4HPGA 1BPLB 3TTSA 3VIKA 2DSUA 2J7FA 4V27A 4GZJA 2IXVA 1DEDA 1ZL1A 2WMKA 4X0VA 1TVPA 3W37A 2CXGA 3VIPA 4D72A 1KQYA 4H8HA 3APGA 5HBFA 4CGTA 5I3DA 3GXNA 4M1RA 5D4YA 1KXVA 3WDIA 1XHGA 3N17A 3PZGA 3VIIA 2ZOXA 2RGLA 1WDPA 1JDCA 2VOTA 1Q6CA 1W9PA 3ZR6A 3VIFA 1WZAA 3EMCA 4D6GA 4PMQA 2YDQA 3D4YA 3VIOA 4TVCA 3GNRA 2TAAA 2WLYA 2F7QA 2XGBA 2CESA 5C70A 3AIEA 1XSJA 4J3SA 3VIMA 4M24A 2ZUWA 1ISVA 4BZYA 3WUGA 3GH7A 1H49A 1U30A 3BLBA 2WNWA 2VO5A 4UQCA 2YL5A 2RGMA 4AMCA 1JZ8A 3ARRA 2X2IA 1QNOA 4N0RA 2PWFA 1BG9A 1JF5A 2QF8A 4M82A 4ACYA 1PEZA 2BS9A 2XVKA 4PMOA 5A6JA 3NSMA 4Q7NA 5CSYA 2XVLA 2FGZA 3AHTA 2WBKA 1GOWA 5HPOA 4H7VA 5TD4A 3VM7A 1C7SA 3L4TA 2O9TA 5D8ZA 2X2JA 3WF1A 3WH8A 4AZ5A 1PIGA 1V3MA 4GZEA 1UZ4A 1XH1A 2EADA 5C8BB 3D51A 3WD3A 2ALWA 1FH8A 3BGAA 5HDRA 3W53A 2JFEX 2Y8KA 3DHUA 4N42A 1PJ9A 5F7UA 3VPLA 4GZIA 4F9JA 4XUYA 4XZBA 3EJPA 2WVUA 1ZB5A 3IJ9A 3ZM8A 1QNSA 1E4NA 2BVYA 1BYBA 2J7HA 4HA3A 4HPHA 4AISA 3OGSA 1MQPA 1R86A 4TUFA 3CMGA 4ZXOA 3WBEA 4HU0A 1KTBA 2VCCA 3AMLA 3WQ8A 2ZUUA 1W3KA 4MADA 4B3LA 5CGTA 4CU6A 4MNMA 2VZUA 1V6VA 2YLLA 3NSXA 1JD9A 5ECUA 4FF5A 2NT0A 1JL8A 4EE9A 1QOXA 3KWXA 5EFFA 4JZ5A 2NT1A 1M03A 2BHUA 4GI8A 4D6JA 3WD0A 2VZSA 5AC4A 4EANA 1ISXA 1H41A 2VQTA 2AOSA 3HG4A 1UA7A 3IJ7A 1GZJA 4EAMA 1WE5A 2VL4A 2WVTA 3N04A 4UFIA 4FNTA 4HOXA 5E09A 1C92A 1QI2A 4A4AA 3PZOA 4NXSA 3I3EA 1EGZA 1MQQA 1US3A 2JEPA 4ZXLA 4FNRA 1WZMA 3OB8A 1E4MM 3WNMA 4WK9A 3DECA 3VDAA 1VFUA 3UG4A 4AZIA 3RO8A 1H09A 5BXTA 3WY1A 3DX1A 2V3FA 1D7FA 4J3WA 5KEZA 5GNYA 4W7UA 4BQ5A 2VRKA 3W38A 3ARZA 2PWHA 3O6AA 4CVWA 1E6ZA 2EBNA 4DWSD 4KWUA 1FH7A 1ZBCA 2BVTA 4QP0A 4YHEA 2WSKA 2J78A 5DEZA 2OSYA 1HKKA 4AD3A 1BLIA 1ISWA 4PTXA 4KGJA 3ZR5A 2W4XA 1UA3A 3LXAA 4NF7A 3VM5A 3U5UA 4QLJA 1J01A 1R33A 3CLWA 1B30A 1VAHA 3VMNA 2DQXA 1FHDA 1Z32X 2BNJA 3UG5A 1UWUA 1CTNA 1E55A 4UFHA 1PPIA 3ARTA 2GJXB 2F2HA 2ZX5A 2YL9A 3AIUA 4D1JA 2Y24A 1M04A 1HJWA 1QBBA 3GXIA 1KGWA 2ZIDA 4AZ7A 5ABFB 5A2CA 5A94A 1UH4A 1W1PA 2IGTA 3TA9A 1NWSA 4CN1A 2E3ZA 2YLAA 4DUVA 2WCGA 3D50A 4J3TA 3ZO9A 5A3HA 3TP4A 3VGEA 3WY2A 4J7RA 1JD7A 3WEMA 3T08A 2ZUNA 4CD4A 4AMWA 1JI1A 1VJZA 1JYVA 5D9MA 1XGZA 2BXZA 2XIBA 1QNRA 2DEPA 1OINA 4JFSA 4LXFA 3AQUA 5I79A 1TQSA 4CD6A 4MTVA 1TA3B 4EK7A 2CBIA 5CLTA 3I3DA 4W7VA 3VILA 3O9NA 4WJXA 3MUZ1 1HXJA 2W92A 1JZ4A 1OCQA 1KR1A 2CIPA 4CD5A 2PB1A 3PZUA 4GXPA 1CNVA 3LMYA 3W6MA 1FP9A 4CCEA 3VTRA 5CZKA 1DWIM 1BTCA 1W91A 3VIJA 1M01A 4MNLA 4MB4A 3NCOA 3GBDA 1KXTA 4AMXA 3BVUA 4PMNA 4FLOA 1UD4A 3GBEA 3T09A 1SYTA 3W25A 4IM4A 4HMCA 3POCA 3WUFA 3MS8A 2DIJA 2FHBA 3CMJA 5CPTA 5EBAA 4UCFA 4AZCA 3KL5A 1V3KA 4ATDA 1JGIA 2ZE0A 3IAQA 4TTGA 3KLLA 1VFMA 4ZE5A 1WDSA 1JYNA 2OW6A 5A8QA 1H5VA 1UH3A 1HTYA 2BY2A 3BCDA 1CEOA 3OG2A 2X1IA 1JYXA 2WC7A 2VMFA 1CXLA 3VKKA 1G0CA 2XVNA 4MJ4A 2FHCA 3CZKA 3IGUA 4M8UA 3N1AA 4Z2IA 1KTCA 3L4ZA 3ZOAA 1JZ5A 2EABA 1HL8A 4ZENA 4LPCA 1R46A 2D0GA 4MB1A 4PTVA 2CBUA 4Z2JA 3WQ6A 4UZSA 1Q4NX 1E70M 3D5HA 1E40A 1BVZA 1AQHA 3LX9A 4OUEA 1RPKA 4HZ6A 2X2YA 2XM1A 1GW1A 4GPNA 4W5ZA 4W5UA 4CD7A 3SUSA 5CSUA 4PBGA 5AC5A 1TQUA 1KQZA 1JZ3A 2CNCA 2EXOA 3U5YA 5M3WA 3DYPA 2W5FA 1FOBA 1OBAA 4JFWA 1ZJBA 2C8NA 5AYBA 2PWEA 4UOZA 2WVSA 4TVUA 1J0HA 1E0XA 2O9RA 4NSBA 3BVWA 1JI2A 3T0AA 4AZGA 1DWGM 3KE0A 4C7DA 1UKTA 1HVXA 1RP8A 2UWFA 1NP2A 4ML4A 1WDRA 3AS3A 1HX0A 3VGDA 3WL1A 2YKKA 1Y7VA 1HN1A 4M81A 2CPUA 4TX6A 1EO7A 3W4RA 3TTOA 3WF0A 5FIPA 2ZWYA 1CGYA 5A8MA 1XSKA 5M5DA 1UQYA 4UFLA 3GH5A 3DHPA 3CZGA 4AEFA 4WIWA 5BXPA 4FNUA 3UR7A 2D23A 1ITCA 3GNPA 3BUQA 4B15A 3VVGA 4PMVA 3A24A 1UKOA 3ARUA 1W1YA 1AMYA 3W6LA 1TG7A 2QHAA 3WQ5A 1QI5A 3CZJA 5E0CA 3GM8A 5AYIA 1C91A 1GQIA 2DT2A 1UH2A 4OJYA 1LL4A 2WZIA 4JHZA 4F66A 1BVNP 3AS2A 4P7LA 4JKMA 1HJQA 2WBGA 3W81A 4LYPA 1US2A 1K9TA 1F4HA 1XH0A 5ABGA 1PS3A 3CHFA 3L4UA 1E5NA 2XHYA 3GXFA 5I2UA 3CZ8A 4E8CA 3MV11 3RM4A 2X05A 4BA0A 3N13A 4D6CA 2Z1SA 3BUIA 1NQ6A 1FA2A 1C8YA 3IANA 4Z2KA 1B1YA 3SCWA 2GJXA 3FXYA 1EOMA 1C8QA 1E6SM 2JE8A 4K68A 4C7GA 4QFUA 3L4YA 5E9AA 2WWDA 3ALGA 5I24A 2BY0A 3QR3A 4TXEA 3RJYA 4U2ZA 4L4PA 1OGBA 3HU7A 4WKAA 2ZX6A 4GQQA 3VNZA 3FAXA 1MWOA 3NIYA 2DT1A 2AMGA 4OBSA 1WZLA 1WZKA 3EDJA 4KGLA 4P8WA 3VGHA 1JIBA 3FN9A 1B3XA 4AZHA 2Q8XA 1W1VA 1EHNA 4P7QA 4W88A 1UKSA 1J0ZA 1TVNA 4H8UA 4MNJA 5BROA 3WNKA 3AMGA 1K9DA 2A3AA 3T2PA 4AYGA 2X2HA 2ZXQA 3TV8A 4JFUA 1NH6A 1H4PA 3CHDA 1E3XA 1K6AA 1GCYA 1V02A 3MUIA 4BCEA 4HOZA 4DM2A 4W85A 1MYRA 2CYGA 5IFPA 1CGUA 3DX0A 1RD6A 2WSPA 3U7VA 3L2MA 4TVDA 1UZ1A 2J7EA 1CGXA 3WQWA 4CVUA 1HL9A 4WF7A 1HIZA 4S3KA 1TA3A 1EDQA 4FNSA 4P8XA 1CXFA 1G9HA 1VBRA 3WD1A 3WFZA 3WUEA 2WMHA 3A22A 1ITXA 4AZBA 1TFVA 4RE3A 3AXHA 3A6OA 1W1TA 2IXUA 3CGTA 1KB3A 1UHVA 3W26A 1X6LA 1Q6DA 2VNCA 3RDKA 3M07A 1YQ2A 3WL0A 1ZBKA 2ZX8A 4GO9A 2OWXA 2XN0A 3BUBA 7CGTA 1DWHM 1UD3A 3FY1A 5FOOA 1UUQA 1B3ZA 2J4GA 3BLPX 5DMYA 1GQLA 1NWRA 1MXGA 3OLDA 2GDUA 3DX2A 1LF1A 3EJTA 2A3EA 1I1WA 3VD3A 1TQTA 1FHLA 4W89A 5DT7A 3PZIA 2JIWA 2WHKA 3WD4A 3GH4A 3PBGA 1V6YA 3SURA 2DSKA 3SUVA 3A4AA 1BGGA 1Q6FA 2VZOA 3W24A 3LPGA 1VEPA 3WNOA 4D71A 4UTFA 5LA1A 3BCFA 5FKYA 3ZMRA 5IXEA 3N12A 2BFGA 4B3KA 1ISYA 3MUY1 4F9DA 4GQRA 1E6PA 3AIQA 4D1IA 2PBOA 2GK1A 5E6ZA 2WMGA 2WMIA 4MPKA 3AZRA 1EOKA 1W32A 1MVYA 4NRSA 1CXHA 1ODZA 2XTKA 2XFYA 2J8GA 3DYMA 2WK2A 3SUTA 2WMIB 3QOKA 1ODUA 2OWWA 1B3WA 1O6IA 4J3VA 5D9NA 2WCAA 4WKHA 3GXPA 2J79A 2NW0A 3AZTA 4YHGA 3UEQA 4NI3A 3WDPP 3SUUA 3MANA 1V6WA 4IPLA 4P7RA 4JKLA 4PN2A 2ZUVA 3B9EA 2O9OA 1GOIA 3CUFA 3N18A 3H55A 1H0GA 4WLCA 2PBGA 3IJ8A 2DT0A 1E0VA 1GVYA 4PTMA 2WVVA 3AIVA 4JKKA 1TQWA 2CHOA 4PMRA 2PI6A 1UR0A 3SIMA 1N82A 1HKIA 4LYRA 5EB8A 3NDYA 5C71A 4IISA 3WELA 3WNLA 4AZ6A 4GI9A 2D3LA 1GJWA 2FH6A 1CLVA 5DF0A 2V3DA 1XD0A 1GHRA 2EPKX 2ZUTA 4AIEA 1B3YA 1VFOA 4W7WA 3FAWA 4JFVA 2Z1KA 4KRUA 3WENA 3HN3A 1NM9A 2V5DA 1VBUA 2XJ7A 1G5AA 2W67A 3WDRA 1FFRA 2DPEA 3PZQA 1OIFA 3DX4A 4UNIA 2GJRA 1G1YA 3BSGA 2PC8A 3DDFA 2DGAA 1PAMA 3PHAA 4RE4A 1OT1A 2W66A 3VSTA 3ARWA 4GKLA 1J10A 2FYVA 1E6QM 2EPNA 4UOJA 1CIUA 3BUPA 3RM9A 5BXSA 3ZJ6A 3F5LA 5D9PA 3WEZA 2BXYA 4HA4A 1E72M 2D24A 1CLXA 3MO4A 4CCCA 3EJRA 1J0YA 1PZ2A 2B31A 2XN1A 1ZBWA 1LG1A 1HNYA 1EDGA 3SUWA 1CXIA 2DH3A 2XM2A 2ZXDA 1PX8A 4AIUA 2ESCA 4RL3A 2CERA 1OIMA 3BVVA 1FP8A 1KCLA 2DT3A 2J25A 3B8SA 4JL1A 3A4XA 4UQDA 4U5KA 5ABHA 3FHQA 1EQCA 1GUVA 4QCEA 4OZOA 5BWFA 3PN8A 3VD9A 1JXJA 1OD0A 3K8KA 1OB0A 1JYWA 3ARYA 3CUHA 4CU8A 1XV8A 3E1F1 3BAIA 3L2LA 1XH2A 3BVTA 5EFDA 2GUYA 2WAGA 3FHAA 1J0JA 1W9VA 1K9FA 1UG6A 4ZFMA 3D4ZA 4WSJA 1CZ1A 2GK1B 4AC1X 5DFAA 1X1NA 3W29A 1E43A 5E70A 1UR9A 4BQ4A 3MI6A 4L4OA 3AS0A 5HPCA 1UD6A 5CLWA 3UCQA 3GXMA 4ATWA 2E9LA 4KMQA 5GNXA 2PF0A 3SCUA 4B16A 2WPGA 3ZJ7A 3S6TA 1H1NA 2VC9A 2OW7A 5GNZA 1OGGA 3SCTA 1NOUA 1PIFA 1LL7A 1A3HA 1GOMA 3W0KA 1KXHA 3AYRA 2GDVA 1HKMA 1LG2A 3ECQA 2VX6A 4J3XA 1J11A 4AD2A 1V0KA 2J62A 3ZSSA 1TUXA 2DDXA 1NOWA 3BUDA 3VX0A 1JZ7A 1E56A 1JZ2A 5JBEA 4LYQA 4EKJA 3H54A 8CGTA 1W9DM 1BYDA 1BAGA 2DSZA 3PZVA 4W8LA 3CUJA 2YL6A 5GQBA 2XSAA 3FNDA 4QLLA 1R8LA 3AMDA 1TCMA 2ZICA 1CPUA 3A23A 5A6MA 1L0PA 1EH9A 1KGUA 5BXRA 1WP6A 3PZ9A 5IDIA 1W3LA 3BXWA 3EJQA 3GXTA 3CH9A 3NDZA 1KR0A 2J74A 5A6KA 1G94A 2F18A 1MW1A 4U3CA 4WKFA 1CWYA 3VGFA 2CKSA 3ZIZA 2QV4A 2OSXA 4YPJA 4CUCA 1CGTA 3MKKA 5EMYA 4M29A 3WBAA 3VDCA 4JHOA 4D6HA 3N11A 1QHOA 4AD4A 4CKQA 2YFNA 2ZXBA 3ARPA 2MANA 4UFKA 4PUEA 3AIRA 1UKQA 1UR2A 4D6FA 5A1AA 4J27A 1QWNA 3NUKA 3WH5A 3CTTA 2DSWA 2IUZA 5I23A 4JFTA 2YDRA 2XGIA 5BYWA 1HJXA 5DT5A 1C3FA 1CBGA 3EDDA 2VR4A 4CD8A 4J3UA 2XVGA 5D9OA 1JFHA 4HU8A 5A69A 1ZU8A 5I77A 5CGMA 4W93A 4HZ8A 2O92A 4PYSA 1GHSA 3U7BA 4UQEA 4V2XA 1HP4A 4U31A 4JCLA 1R7OA 1KXQA 2F7PA 2E40A 4W87A 2XWEA 2WVVB 5FCZA 3VOCA 3D3AA 2DIEA 1EIBA 5LYRA 3B9DA 2CEQA 1V03A 3HJEA 4MB3A 2CBVA 4HMDA 2EJ1A 2QMJA 1TE1A 4M56A 1V0LA 1LQ0A 3A5VA 5A95A 2D22A 1L8NA 3WNNA 1F4AA 3OGRA 4PSPA 1VRXA 2YIHA 1DP0A 1GQJA 3PTKA 2VZVA 4FLRA 1BGAA 1V6XA 1KBBA 4HTYA 4LX4A 1UQZA 5IHSA 2EACA 1QHZA 4DM1A 3QHNA 1KFWA 3IK2A 3RCNA 3RILA 2VX5A 2YFOA 1BYCA 5BRQA 1U33A 1J0KA 4J28A 2JEQA 4QAWA 3N9KA 1LWJA 5A2BA 1SFSA 2HVMA 2DH2A 3WH9A 5IFTA 2WCSA 5DO8A 3POHA 3ARVA 1SZNA 4U33A 5LA2A 3VUPA 2WXDM 1PZ3A 3EMQA 4A3YA
chains in the Genus database with same CATH superfamily
4MLJA 1I7TB 1DHKA 1KJVA 2APFA 2AV7B 2F53E 3IGLA 4CL7A 3V5CA 2NQJA 1R34A 4ZFZA 3ZSTA 1OB1B 3V4UH 3MLTA 4OLZH 3HPJA 2XZAH 2VJXA 1CENA 4V1XA 4FZEL 1FFPA 3I50H 1ZHNB 3FBKA 2VMDA 4YHOL 1HINH 2HMIC 1E6RA 3MFFB 4XNYH 1UR8A 4DN4L 4ATTA 3FOKA 3PV6B 2AGJL 1D8WA 3NPZB 1Y0LA 4PJ7A 5I16B 4E3TA 1AD0A 1JQVA 2PD9A 3BL3A 3C5QA 4OIFA 3QQ1A 1TYJA 4QQUA 1P6AB 1RJLB 1EJWC 1MAML 4LSQL 4D6IA 4MA1B 3IEAA 1XKYA 2L7JA 2QR0B 4XNQA 3ZDYE 4Z7AA 1RPXA 2VZ1A 4FS9A 1A7QL 4Z9KB 1VFFA 1PNDA 2GQ9A 4MX7A 3WBAA 2XZ9A 4KOBA 2CZVA 1FNGB 3J7HA 3TR9A 1NC4A 2NYZA 3QJQB 3ZTDC 3EJUA 2AEPH 1J1OL 3SEPA 2CLVA 1J87A 4YQXH 3V6FB 4PUBH 1T41A 5H91A 3NL6A 3PFQA 1GOKA 1OSEA 1KEML 4AQ1B 4R7JA 1QJWA 5FCUL 5ID1B 5CPMA 1GOOA 4R9OA 2JKTM 4FQHB 3BP6A 2ZYRA 4M3PA 2DQFB 4GW4B 3CXDH 1QZ1A 1X5FA 4CAGA 4JN1H 2X8RA 1KXQE 1O95A 2D8KA 3GU1A 2K0RA 5FOBB 4OQTH 5E4IA 2CBMA 2WUCH 2HKFH 4QRPD 4DWSA 5DUMH 3SQRA 3DI1A 3B8DA 2C9XA 2QKIC 4YVVA 1QRND 2VH5H 1OP4A 4HF5H 6XIAA 2WKLA 2KHAA 5JLZA 2JJUA 4N2DA 4HEPA 1HEZB 3WJMA 4JX0A 3ZDXF 2J77A 1W72A 2WTRA 1Z9SB 3ULVC 2IQDA 5FF4A 1AW1A 1E4XI 2V2WB 1MXSA 1H9DA 2FH8A 4BZ2A 2DIAA 4YHYB 2DY3A 2ICEB 4PYGA 2WZ6A 4KK9D 2IDQA 4XB8A 3N55A 3F8UB 2B5IC 1OCNA 4S38A 3IRPX 2VX5A 4B0MM 3HGJA 1J8RA 3CT7A 5CILL 1E1FA 5CC5A 3QQ9D 3KZSA 3NACH 2FVMA 1UWIA 2HK0A 2X7VA 1ZGLM 3LIZL 3UJFA 1EO8H 1KCKA 3MV9D 1KPRA 4NZRH 5D7IE 2DV0A 1J48A 3B1TA 4M7LH 1W0YT 2OMUA 3MRNB 4Z3FA 1JXKA 3WBDA 1BVWA 5AHEA 5IDZA 3QY6A 3S1XA 4ZYKB 4PBWD 3MACL 3QQ9C 4QRTB 5DJCB 3MFFA 2GJPA 3WN6A 1LT8A 3EXSA 1VJSA 4J5NA 3CBRA 4BI6A 1WS7A 3WI9A 4YSEA 4YYCA 3LQZA 4F2FA 1GTHA 4N9BA 2ADIA 2UXGA 1IM3D 3CZEA 4XP5H 2BS71 3QRBA 5KZMA 1W9XA 2ESVB 4LDCA 5FESA 3N2XA 3CU7A 3MNDA 4DKFH 2FZMA 1B0IA 1BF8A 1N0XH 1OARL 4RIRA 3FO0L 1KYDA 1HXKA 3X1FA 1V3IA 1H3PH 5HGHA 1PDKB 1R87A 3QDJD 3TBWA 1NFIB 1U8KB 2ZCKH 3GNMH 1VESA 3Q5YA 1XRSA 3C56A 1GVOA 3VWKA 1MNZA 3SDDA 4HHWA 1WTLA 4XO5A 4ELKA 3WK0A 4DJFC 2X0YA 3CZNA 4P46A 2IALB 5JW4R 4WGVB 4Y5XB 2R94A 4KERA 3WAJA 3KBVA 3SURA 4XGZB 3G5ZB 4IMEA 1XF5A 4PJDF 4KNSA 4M4PA 3VNIA 4FE9A 4PRNA 1BQLH 1GOFA 1HHKB 4HPXA 5L9FA 3W1TA 4EI6A 2J24A 4W9HC 4LVGA 3ENEA 3IPBA 4XX6A 3EMZA 5BZZA 5D38A 2ICCA 1XBXA 2FVKA 1AR1D 1A5OC 3S35X 3VXGA 5EO0A 3W82A 4D9PA 2AXGA 5TH2A 1K7FA 5IT2H 3MUXA 4JIEA 4IBWA 4K7VA 1B4JL 1IL1A 4N7QA 3V5DA 4K9EH 4WUIA 1M1XA 3UWZA 4HUMB 4TUKL 1TPXB 4S3CA 1C29A 3G8RA 1X5YA 2XWDA 4R2GD 2VQUA 2Z93A 2QVFB 2EEXA 2V67A 3IRDA 4HUUB 1FL6A 2A6DA 5E4EB 2ZZUT 1FKWA 3D33A 3KS0H 1VIWA 2GWNA 4G9FD 2OG9A 2Y61A 4QXUL 3TDFA 4HVBA 5LGKA 1TMCB 2NZLA 5FO2A 3GZAA 1JCXA 1DV7A 3T44A 2ZUYA 1U91A 1TJIL 3QJHA 4JFED 1I3RB 3UG3A 4N86A 3G3MA 5J3HC 4IPNB 4LV9A 3KOXA 4OD3H 1JUKA 1DQQA 3SSGA 2Q0ZX 5INDB 3H1ZA 2FB2A 3KX6A 4G8GB 2K6WA 4H9VA 3LZPA 3O6ML 4I1RA 5C0CA 5J13B 3KNBB 1WFIA 3OJ2C 3ZE1E 3VA6A 2K3TA 2R4SH 3B0YA 4KRTA 5T8GA 4FQJH 1A4JA 1RK1B 1P7QA 4X6DE 2MPAL 2BZCA 3QWRD 2GITB 3E38A 1TEGA 3IYLW 5E99H 3TIEA 4XWOD 3CN1A 4Z3IA 3QV6A 1DO6A 2HFTA 4ELMB 2Z25A 1DDTA 3G5EA 4GQGA 4HSOA 2I7SA 3GYRA 2DMKA 4E2OA 4D71A 4F8XA 3QDGA 4F33A 2RUSA 3EDFA 3EHBB 2VKWA 1FWWA 3D25A 2P10A 3FU7B 4NRXB 2ZTJA 1EGJH 1JF1B 4P57B 4TOYL 2EXYC 3S3PA 2R69A 1QI0A 5FIEA 4HIJA 4KIEA 3FTVA 1LO5B 2YWYA 1GYCA 3HE7B 3SDAC 1JVLA 4FIRA 2E5CA 4KK8C 2E6PA 3WEOA 1VS1A 3MRRB 3EYUL 3KM8A 2JVUA 3ZMNA 4C6BA 4RSVA 1H3XA 4ELKB 1UZ8B 3NIDB 4GUCA 4HD5A 3ZJKA 4MA3A 3D2TA 3BLLA 3OBAA 1KFAL 1P9MC 4M7ZB 1OWQA 3ZZLA 1WX0A 1D5IH 3KXFD 5JR1L 1L6SA 4ZFOA 2CK2A 2E8YA 1ZRUA 4XN7A 3DHDA 1FZOA 4IMLA 3TVAA 3EJYD 5C0CD 3MUCA 3WJWA 5FA4A 1T7LA 1H15A 1EDTA 2XV6B 4NM4L 4FMKA 4M1GL 4KV5F 2EIDA 2YBRB 4H8QA 1AYRA 1EB3A 3LLDA 3PFRA 1CGWA 2AJXH 3CASA 3BYTA 5C2XA 4JGMA 4Z1CA 3TJHC 2AQ3A 5TQ2H 4LQ1A 1M68A 1LO2H 3UTSB 2WWNA 3QZWB 3ARBA 3HA0A 2P8CA 5T91A 1N67A 3QNYA 1NFKA 2E9BA 1FWAC 3Q4DA 4IDJH 1QASA 2X1PA 4OGYH 3ML9A 4AGLA 1RH9A 3S88H 2VRJA 3PTQA 1MWAB 2VTFA 2D03H 1QI4A 4EN2A 3S8WA 2GJ6A 3OA3A 2B1HH 3IDIA 5F3HA 4EN3C 5AECA 4LPVA 3VSQA 5B3SB 1F6PA 1IMHC 4YTQA 3LIZA 1GYUA 2KMWA 3DV4B 5ICUA 4HWBL 1XDJA 1CD9B 1ZFJA 4HK6A 1A7PL 4ESKA 1E9QB 4GD0A 3LHZA 2G60L 3LZQA 4PVNA 2RFXB 1M71B 5EUKB 3RVUD 3UZEC 1JCJA 5A6IA 1VACB 1HT6A 4WHTA 2CCWA 3V0DA 1DWFM 3FXGA 3BQVA 4IFKB 5FX3A 3GJEB 2ISSA 3VOJA 1D3CA 3KNBA 5JIKA 1AGFB 1JGEB 9RUBA 1KLYA 3VW3L 3RJXA 1F3JB 1KBGL 3HBLA 3HS8A 3NK3A 5AW3B 3QJVB 3C0LA 4LUJA 3MLRH 3OZKA 3UTPE 2FIQA 5DYFA 2WMPB 3BAYA 3MDJA 4WUUA 3RVVD 3RVUC 2FWOB 3VXPA 3VXTA 1JZEA 2OXGB 2V7HA 4JFDE 2IBGA 1QSZA 1KIRB 1IIIA 3F58H 2FEEI 1QX1A 3BQUC 4HC1H 4HEPG 3DX7B 2IBZX 2X38A 1A6AB 4XPTH 5AYTA 3V16A 4Q9BA 4PJ9D 2EDQA 2X70A 5IB5A 4C54A 4QF1A 5FM5O 3RVVC 3UX9B 2NW3B 4B5ZA 3ZDWA 1WBXB 1NF7A 1MVUB 3CXOA 1Q1PA 3FFSA 5JBEA 4TULH 5JHDB 2BSCA 4TVPL 3DGGB 2NR6A 1G4RA 1WC7A 1CVSC 3FFCE 4JFFA 4YDMA 4QRFA 1ZLWH 1AOZA 3UL4A 2H4EA 2IVFC 1MCNA 2VN7A 3MMEA 4XBGA 4ZJ9A 3W6YA 1IF2A 5EUOB 4YJ5A 3Q1EA 2X7LB 3PQYA 4XZ4A 3QPEA 2YD9A 1R47A 4EIGB 2UY5A 3SO5A 4H04A 4OF7A 5AOKA 1T7ZA 4RFNC 3T4AC 2ISWA 1OQXA 4F7KA 2R4RH 3A3YB 4HXAH 4OCSL 1NDMB 3CHVA 4YC2B 3C0QA 4DNLA 4Y4FB 3ZDXB 4AH7A 5BUGA 3EDEA 4KIRA 4AEEA 1E28B 1G7QA 3OG6B 5GZNC 2VAAA 2VDMB 1XCXA 4MXVF 1F58H 1GC1C 2QGEA 4XBPB 1TNMA 5D8JL 5F89B 1OD8A 5FAJA 3WQGA 4K2UL 3ZR4A 3WH6A 5JORA 3O07A 5DURB 5BCAA 2OSLA 3TJEH 1EJUC 3BLEA 3MA8A 3WEAA 3NFPB 4MXQD 3MUAA 1JDDA 1ES0A 4IOIB 3KG5A 3RVTD 4EVNA 3FU9A 2PRHA 3L2IA 3MOAL 1CTOA 2BMKA 2MKLC 4M5ZL 1JCKA 2NNXA 1W2PA 3IXAB 1MFBL 1E73M 1GGCL 3VMPA 2AJ3A 1A64A 3KVDD 3CPUA 3SGJC 3ETTA 4QM1A 3DRTA 2FJGB 2WNQA 4W86A 3K46A 1XAUA 4Z42C 5ES4B 4PJEF 5A8PA 3MMWA 1BXVA 1QSFA 4PV9B 3RUGB 5H4ZA 5AUMB 3H2CA 1KGXA 2JKXA 3MSGA 3KH3A 1ZHBA 2APTA 3GJEA 4G43B 3IJIA 2J4WL 3WIFA 1LO3H 3OMZA 4CU7A 4X98A 3VE0A 3PGDA 4IKKA 4B0MB 1RPUA 5JMOC 1K9EA 2J47A 3GYCA 4Y6GA 4AD1A 2LLEA 3FYYA 3O4LB 4JO4L 4HJ1A 4TNGA 4HS6A 3W27A 1E2VA 1IVTA 4OZFB 5G4MA 1YIXA 4AYDC 4YXGA 3JVGA 1DVFC 3NK4A 1WG3A 5L9DL 5HQLA 2DQCH 5KBLA 5E2TL 2WJDA 2HJLB 3H26A 3NIFF 2Y1VA 4XX1G 4B5NA 3BKJH 1R30A 1IV8A 1CDGA 3P8IA 4YWSA 1L0QA 2C7FA 2FWUA 5JXEA 3PWPA 1AHWC 5AFAA 3CJPA 2EDEA 1DYZA 3Q01A 2B20A 2NXHA 5I1AA 3EO9L 2IDFA 4L8BB 1IGMH 2ICWB 1EFXD 1R3HB 2BVDA 3B40A 1A5MC 1R24B 3W07A 2VISB 3KBEA 4GRLA 3DO7A 4JFDD 3NSFA 4PJGA 1HJSA 3V0UA 3CK5A 4NLHA 4EAYA 4PY8J 3FU8A 3NJXA 5I30H 2Y5SA 5I3GA 1NGWB 3UBXB 3X13A 3WQCA 4HC1L 1JF6A 4BGDA 1RK5A 4I2XB 1UD8A 2EDHA 5ABFA 2VE6A 3LRLA 4DWSB 3B9KA 4ICNA 4TMBA 4OV9A 3VU2A 3IDYC 1QBML 3W1AA 2AV1B 3IRCA 3WY3A 2RDUA 4LL1A 1WAWA 1GZPB 2OMWB 2Q5BA 3DDGA 4LLMA 4PGDB 4BFIA 4ZS6C 1EAOA 4MHBA 5HA7A 1AGCA 1CE1H 4L4LA 2VAAB 4XBPA 4QXGL 2Y22A 3K6DA 5JHLH 2QW5A 5FEZA 5EDXA 2MCPL 2QGYA 5C08B 3P9MB 3L0NA 4H6KA 3S96B 1DBJL 2FBOJ 5CEZH 1YEDB 1H9VA 4U1HB 3TF7C 4LUSA 1W9BM 2VWEC 4ZS6D 2EEFA 3TCTA 4JQIA 1KW1A 3L12A 3GSVA 1NCCH 2H8XA 1KC7A 2OTWB 3Q5TA 1CQYA 4AVJA 4YXKH 4C83B 5ALBH 1XBDA 1Q90A 2QCEA 2ZCLL 1H11A 1TNNA 3BESR 5E8PB 1AHWA 1G4SA 1ZA3A 3WKNA 4D0DB 5CU9A 1XS2A 3E12A 2JKNA 1E9OA 1KDJA 3C08H 4HDIA 5IBLC 2MTPA 4POYA 4RNRB 2NR6D 4S1DC 1ZHBB 5LXVA 3PNWB 3ATDA 2UY3A 3E9AA 4XC1H 4GNVA 4L2YA 4BFAA 5GRVL 1A6VL 4K94L 5LA0A 4GBXD 3REQB 4Q8TA 1TR9A 1AZVA 4FHBD 4H26A 5DVLA 4CSSA 5BRZE 4PWIA 5AYUL 3N44B 2WMFA 2YX0A 3BUYB 1WKYA 3KBJA 4DO5A 3KBSA 4HMNA 4HP5A 3LDBC 3SADA 3CHSA 5I17A 3VXSB 2BH0A 3QC5X 4FG0A 5JUVA 4ZUWB 4HSNA 5REQA 1UZDA 1NCOA 4EAEA 1OCCB 2FBRA 1FNSH 1U21A 5K9JH 2QIIA 3L1GA 4ZMTA 4JM4H 4ZS7H 7TAAA 2PDNA 4PTWA 1AACA 5C09A 3ZJAA 3OVQA 1TQBB 3PPSA 3WK3A 1ET7A 1IAKA 1INEL 2XZCL 5GRVK 1LEIA 3FA4A 4IDLA 2B1OA 3O15A 5A6TC 4WK4B 1TZZA 3NSNA 4JY6A 5KVDE 4V15A 3S83A 3GBLA 3QO1B 1JOIA 3W7HA 2OR9L 3U9UB 3I9PA 1U3JA 4Z95L 4OKDA 2VM4A 1JTTA 1I4FA 3BJLA 3U30C 1CDBA 4LVOC 1NCUA 1TU2B 2OR7A 1AGDA 1T21B 3GB7A 5EG6C 5FWQA 4Z1AA 4LLVB 4KPHH 3VDBA 1NIAA 5L4JA 3GX9A 4LKCB 4FOKA 2IAAC 1L9WA 3ULUF 4MAYC 2AL2B 4PS4L 4QLKA 5LO7A 5BS0E 2XIQA 1EA9C 3KPTA 2P80D 2Y07L 2YWZA 4P46D 3VFTB 3ZBMA 5TK2A 4YGVA 4BFGA 2R23B 3OG4B 2EE2A 4AY1A 1NCIA 5F0JB 1DN0A 3LJ3A 5B38B 2WZ5A 3LN9A 5ADOH 3LS4L 2ENYA 1IO4C 4Q8PA 4HAGA 1B90A 3NRFA 35C8H 1KJMA 2D9CA 4FYQA 4EO5A 3GSVB 5GRUH 5T3XH 5T5FL 1R9XA 1SBSH 3N50A 3H70A 2WD0A 4JJHA 3TJHD 1AKJA 2IWEA 4EEEA 1AG6A 4TNEA 3WS3B 2K4AA 2NQ3A 3VSVA 3DUUA 4LEXH 3M0VA 4KWVA 4KHXL 4AL8H 4LLDB 1UZ6E 2LFGA 2WM0A 3H53A 3FDWA 1FRBA 1TPB1 3GDLA 4O8RA 5DN1A 3MTXA 5L8KB 3D4CA 2WNZA 2RAGA 4S39A 3F85A 2AQ2A 2JJTC 2WXHA 3SO3B 4YLQT 2ZP9A 1OTUC 3BZ5A 4XN4A 2VGIA 3LM3A 4XZ9A 3PWVA 1UOZA 1GZQB 1Q6QA 1H8SA 1JNNH 3HC4L 1V7NL 1C7TA 2BX5A 4WO4B 3GKZA 3MRHB 3UP6A 4NOBA 2CO7B 2VJ8A 3KPOB 5J1SC 4RAUB 2VGBA 3BAXA 5ALBL 1OD9A 5JDJA 2WZHA 3AOFA 3NQVA 3GMLA 1Z3NA 5E8DH 3AT9A 3U4EA 5EU6E 4FNPA 2DUAA 4YHKH 1WBJA 1TWWA 2L5HA 4MBOA 5E93A 1F3DH 4CW1A 4OIAA 3KOFA 3OODA 3MBWA 5DS8A 2A4AA 3DBXB 1NZRA 1WCGA 3EOUA 3UYCA 5LNUA 3K72B 3BDYH 3ULUE 1NCWL 2OXNA 5BU9A 3DK0A 1EMTL 5FS5A 4UR9A 1GVIA 4NQCE 4ODHH 5HHOA 4F15B 4DO4A 2GOKA 1URIA 3FH8A 1TETH 2X4PA 2NZIA 3LCIA 4YX2L 8PAZA 1OGAE 4Q9CA 4S3EA 4PV8A 4HIIA 3QGAC 1MAMH 4LSQH 3GLZA 4YSTA 3S3GA 1A6TB 1G0DA 5DJDA 4GSQA 1UKPA 5B7MA 3ZJ8A 1KBWA 3S3CB 3OZMA 3FUDA 4YHZL 3RN6A 1SOXA 1IBGL 2WAQA 2YOCA 3DX8B 1NTHA 5I75C 1HINL 2K7QA 1CD1A 2PZ0A 5EWIL 4YR6A 5CBEB 1L3WA 5DHVA 1EJOH 4W9JC 4CN4A 3S0PA 3TF4A 1CECA 5C92A 2QLYA 3BHBA 4G8IB 4NRZB 4XPBL 1FVEA 3VKDA 4I0CC 3FU5A 2P4AB 1KM6A 1RCYA 5CUSH 4GUPA 2BP0B 3AC0A 4O02H 4RQQA 5E0FA 5AVXB 5CGBA 1L2UA 1E9QA 3TN0D 1JNLH 4AZCB 1QPNA 5B1KA 3RUGF 2YAEA 2VUYA 3KYNB 5ISZE 2EPLX 2F08A 4E9XA 3G3LA 4O58H 4KO5A 2LHAA 3UJSA 1XFCA 3MLPA 2AEWA 4XN5A 5EIIG 3MCMA 2DI9A 2JJVA 1SUJA 3N43F 1JMXA 2BNRD 3TOPA 5K4ZA 3KXQA 4KQ0A 4MG4A 1KJ2A 2VEFA 3N2OA 5G1YA 5CN1A 3CNYA 3RBSA 1YPZF 2W0FB 4WSGA 5IMLA 5ERWB 3T07A 3LNPA 1IZJA 1SQMA 2F5BL 2XDFA 1YA5A 5HNUA 5FL0A 4OT7A 3MP4A 2LW3A 4L4TA 4WJG3 5ESAB 5J57B 1AZRA 3IS1X 5D1QD 5FCUH 2IBBA 1W2VA 2FPVA 4UIMB 3WJLA 2P1YA 3FFOA 4MVAA 3N91A 2V8MA 3NJHA 2RACA 1RMFH 1T7WA 2A73A 4JFOA 4XXDB 3M0XA 1IE4A 3O2VH 6REQA 1E4LA 1NCGA 3ESMA 4DOHE 3T0EE 3QIWB 5K9OA 3BLFA 2A83B 4E9RA 2ZYSA 2C3ZA 2BRRL 2PSNA 2W59A 1UM6H 2GG1A 2IAMB 4DKEH 1LO2L 4F91B 2WBJA 4I9WD 4PFMA 1KJVB 3QIWC 4N8VG 1TVDA 1WFMA 2R1XA 2V9UA 1W1A1 4GEIA 3OZOA 3RU6A 3KYMA 1WA3A 3DETC 4KVCL 3S5NA 2XIJA 1XDTT 2HP4A 2PCPA 3HMWH 2WW5A 3HAEG 3W73A 2AGJH 1Y0LB 2EPHA 1TKWA 3CPLB 2CBTA 4TTDC 3SB0A 3SGGA 5AC7A 3S8GB 1G6RA 3RMEA 1TEFA 4WIQA 1CDCA 4E2VA 4M62H 1V08A 5D2TA 1F3RB 2JIXA 4YSOA 1MJJB 4N9OB 1R5IA 4HJFA 4IOSD 3BZDA 1DQXA 3M41A 4DVRH 2EXWD 4GINA 4QOKB 4Y7MA 5KVFH 4HU2A 1VF8A 1OXYA 3VA8A 2OP4H 1G4TA 5IFAL 3AROA 3SD2A 1F5ZA 2Q3ZA 3OKNA 2H1PL 4LSRL 3NBNA 1N68A 2NCMA 3FSWA 2G2RA 3KL3A 2F7RA 4LCYB 4M8QA 3RCMA 1QI3A 1EGJL 2NY5L 3GFZA 2XJKA 1N2VA 4P2OC 3GHTA 3LGDA 4P7OA 4PJFB 3WLIA 1B3OA 1BZ9A 1WBYB 4XB3A 1P6WA 3STPA 1IM9A 1JS4A 1E71M 2JJSC 4PLKD 4HGWB 1Q6RA 3FX4A 4FZIA 4WSHA 3D18A 3M4HA 1HIML 1Q5MA 3L5AA 1TQVA 4GW4A 3O4LA 5EU3B 5SWSE 3PABA 2I1OA 2VFFA 4L3EA 2CGRL 2DZWA 4OF8A 3VQ1C 4ODTL 1CTMA 4QRQB 3ME0B 4F92B 4PRAB 5B3NA 2DQGL 2Y7NA 4OHQA 4Q8WA 2BY1A 3LOTA 3QI9B 3DX6A 3OSVA 3R43A 4ADJA 5ESAA 5MHSD 4JHUA 1JG9A 3TBSA 3VXNA 1I60A 3FMGL 4F40A 2B59B 3F64A 1KTRL 4GW5B 4R8WL 4WWKB 5DEFA 1GHFL 4E9QA 1IWPA 4PMDA 5J12C 4JPSA 3QFJD 4F5CE 3FQ2A 3HPSA 2BVEA 3UPBA 1IKNC 2GOUA 1MJUH 5IBUG 3UBGA 4BCYA 4CN6A 4M61B 4XHJC 2VDMH 2RJGA 3ETSA 5FXCH 3MRPA 3MT1A 3NP3A 4WV1C 5LN8A 3FFCB 5IHZB 4Z2GA 1JWUB 5A6SA 4HKZB 4K3HA 4N9CA 3LXBA 2KZBA 2OO0A 4K9EL 4LPXA 4KXZH 3LS5H 3CZSA 4KH9A 3EH2A 5J56B 4XPGL 4L18A 1X3DA 2Q87A 3O2LA 5E03A 1JNDA 1XLBA 3T0EC 4S3DA 5KVEE 2AV1A 2KL6A 5A6LA 3MLSH 3ETBJ 3ABXA 2ZOKA 3IGKA 1XR9B 3BEWB 4O9HL 1PKOA 5MP6H 5HATA 4BF9A 4S1QL 1QLFB 2MSPA 5KVDL 3JZ7A 3TO2B 1HUVA 1TJRA 3O2WH 2VITA 4MAZA 3QLLA 5GJMA 2A85A 2WZEA 4FK9A 3IFOB 4I9TA 3Q8BA 3B5HA 5JHBA 2FDMA 2Y25A 4MZIA 3EJJX 3RPDA 4ZX4A 3CS2A 3D05A 2FX7L 4WW2C 5FF7A 5KBDA 2E7LC 1E6NA 2NLJA 2AZUA 3BW3A 3AREA 4LVNB 5H35A 5ESVA 1HOCB 1AD0B 4LVEA 2UZXB 3WFBH 4JTGA 1KUMA 1PHQA 2YD3A 4BKLB 4NILA 1PKLA 4Y9FA 3MYJA 2FDSA 4KTDH 3BVXA 4LY8A 1ISZA 1OX4B 1TZIB 3M0IA 3MMDA 1LEGA 3MRQA 3TEUA 1F4YH 4C56D 1BZ9B 1WBYA 4OZGB 4PJEE 1J4EA 4L9YA 4MLIA 5D2WA 4Q8UA 4XTDA 3GC5A 1QHPA 5AKRA 4XP5L 2CLZB 1MFEL 3VFVB 2OCJA 4NQSA 2OI9C 4A2FA 1JGDB 5AFDA 2HCVA 1S7XB 1G87A 2KQNA 4P8VA 1FJ1A 2G3NA 1WGVA 5FFGA 5KOMC 1U8JB 5HD8C 1ECEA 5IBLD 4YHPA 4ZMOA 1ZP4A 5E9DA 2WO3B 4GRSA 4LKXB 2OSWA 4GBUA 1C8XA 2DL2A 1WT5A 3MKVA 1MIML 5H8DA 5KSAA 4JN8A 4IKIA 4KPHL 3E2HC 2VLME 5GZNA 5JPMC 4IRJD 4OOZA 1V7YA 4IX2A 3BPOB 1I2OA 5FJRA 4RZCA 1ZANL 3LPPA 4WU7A 2GPTA 3KP0A 2XKUA 5EU7E 5CKGA 4F79A 5E0QA 2WANA 3K6IA 4G7YH 1WUFA 2QZ5A 3NWRA 4O10A 4BSJA 4QHLB 4UTBA 4WFGD 1XRFA 3C2FA 3L1OL 3SBWC 2RALA 2C18A 1GY1A 1MFMA 2P5WB 3D39E 2BY3A 4KKCD 3PB0A 3MRKB 3OJGA 3CFUA 3RY6C 1J18A 3U0PA 5EPDA 3FCGA 4A7QA 3DFOA 1KTJA 2WQWA 3R0KA 4WW2F 4GYKA 1TOXA 4NZ4A 4F0MA 2Y2WA 5D2NA 1HDMA 4PWHA 3S2JA 2FIKA 2FKPA 4BH7A 3IDXH 4YGVB 3CQJA 2RCSH 4IEFA 4JHWH 1E8YA 1HWWA 5EEUA 4R4BA 4F2EA 3CUPA 1YMMA 3OMAB 2JJTA 3QUHA 3QNZB 1YKWA 5DEGA 2CCRA 2NXIA 1PXGA 4QTGA 3GK0A 3PAOA 3TTSA 2NNCA 3H7UA 2RKXA 1BQHA 3B34A 3GRWA 3KYKH 4V27A 1A9EA 2J21A 1CLCA 3DLQR 1NLDH 4GMSH 2HT2C 1FHVA 1X6UA 1LO5A 2J3SA 2Z1VA 4GZJA 5G1TA 2WMKA 1FWTA 4R4NC 5HDQH 4NP4H 3QWNA 1REQB 2VM8A 2BWIA 5GS2D 5CEZE 5BMFL 2HS6A 3V0SA 4D72A 1T6WA 4Y1AB 5DT1L 3ZE1F 1XIGA 3QC3A 4B3EA 2OA9A 4QWWC 3IJSB 3JQOB 4JTDA 4CGTA 4Q9RL 4J1UB 8FABB 1XL9A 3O41B 3QWQB 1SQ2N 3VAVA 1Q7ZA 2FQFA 5JYMA 3WN5A 4BQBA 1FHUA 1ECZA 3B1UA 1XHGA 3HJZA 3HZKB 1FYTB 4P9HC 1QWGA 4GS7B 2DQIH 2OS7A 2XC8A 1AKJD 2GJJA 1OAZH 3KLSA 4LKXA 1WDPA 3H2QA 4Q56A 3G24A 1XR8A 2KZHA 3EFOA 3I02B 4JJ5A 3R79A 1WDDA 2OZ4H 4OCWH 1W9PA 3TO4D 1WZAA 3LKNB 3VXSE 4UBDD 5LJYH 1U3YA 3P14A 4ADGA 3MQTA 1KDIA 2ZAGA 4RGMB 4PMQA 3GSUB 2YDQA 1LJMA 3D4YA 3NCMA 3BP5A 3MJMA 1I8IB 3MYPA 5DC9B 2WLYA 5IB4A 1NBVL 4KKZA 2EC9U 4OCSH 3ME3A 1CGSL 2AQOA 2BP8B 1BD0A 3OPZH 1QUNA 4P5TC 5FUOL 2VGGA 2BP1A 3FB7A 4M24A 3LEVH 1IIGA 2E7FA 1BIIB 2G37A 3HMJG 2X0UA 4IFOA 1JHLH 2HKFL 3QEHA 5T1KD 3B3DA 3GKFA 2E6JA 1XISA 2V2DA 3FRPG 1FA4A 3CAQA 3Q8FA 2JQMA 4JD4A 1S9XA 2X9XA 1E65A 1FL6B 2Q6ZA 4G7EA 1NJ9B 2WWOA 3NCEB 4FFVD 2ICSA 4PH8A 4PQXA 2VO5A 4PB3A 5DMMA 5D2NB 4D8LA 3NAAL 1NKOA 4D0BA 1YEFL 2RGMA 1BLNB 1KEMH 3EX6A 2XA3A 1Y07A 2JKEA 1JZ8A 4A3RA 4U1SB 1DVFB 1T3FA 4WQOA 1N64L 4NAEB 3U2CA 2E7BA 2DUXA 5HAOA 2BNUB 4N0FB 1FTXA 2BRRH 1ADQA 1E90A 2PPEA 2IAMD 3U0WL 3AU0A 3WO3B 3ARBD 3II3A 2B77A 2YO3A 1MWAL 4NRYB 4Z7UA 3SYPA 3TYUA 5MEQB 3LBOA 4FZ8L 3NSMA 4GIRA 4Q7NA 3REWB 1FWBC 5CSYA 1PFOA 2V5MA 4JPIB 2YYTA 4F7EB 5KVFE 3QKEA 2NY2C 4R0LC 3D3VE 2EG7A 3W7NA 1IGFL 4GPVA 4XVTH 5DQ9A 3MJ9L 3O2DL 4G8EB 3RWHB 4J2XA 1GOWA 2WKJA 2WPBA 3L4TA 1QMLA 4QQ3A 3FTXA 4HIJB 3UBFA 3GVVA 4ZQOA 2X7LA 4AZ5A 2XCMC 4MFHA 1QQDA 3I50L 4QOKD 5AC8A 5C1MB 2OEMA 3ULVE 4ODTH 3OX8A 4RGNC 4LCIL 2ZVIA 2EADA 3GKWH 5I0ZA 5C8BB 3S3DB 3C2SA 4IL2A 4DBWA 3B43A 4YHNB 1HKWA 4BKNA 3EFOB 3I02A 2AK1L 4H8WL 4JJ5B 4NERA 2TODA 2Z65C 3O16A 2FAUA 4NVTA 2NSMA 2R9HC 1R3IL 3PWPE 1QU4A 4MWAB 3QVAA 5C0QA 2C3VA 2R29H 3DOSB 5AB0A 1MUCA 4S2CA 3JTTB 4ODVL 4N42A 2EP6A 4K5LA 4PJXF 4FHKA 4PJCB 5E24E 1FVPA 1FCCA 5CUSL 1R9ZA 3EWDA 2HVKA 3UGEA 3F03K 4KRZA 1YUKB 4OIIH 1G9ML 4XZBA 3EJPA 1B2WL 1ZB5A 3ULVL 1BXCA 3L3GB 3FJLA 2PPGA 2AJ3B 3X1GA 1OFPA 4QG6A 2VDLB 3FTSA 4GMTL 4ZMGA 1ZA6B 4H0IA 2GJ6B 2V68A 3G5YB 4HVXA 2VC2L 1KPVA 4WVXA 3T1FA 3WBEA 2YAOA 3ZYJA 3PGDB 5JIDA 3L5MA 4QHKI 5HVHB 3EB4A 2GL5A 4B4HA 5DRNA 3AMLA 1TO5A 2P5ED 2ZUUA 2AGTA 1BMWA 2CR6A 4OB5H 4JTKA 4REQA 1HS6A 1IEBB 1WCBB 2ZAHA 3U6XA 6FABL 3TZVA 2HPIA 3EOBB 3BAEL 4NKIH 1EAPA 3V4LA 5HVHC 1FDJA 1VZHA 5AVUB 4MY1A 2F7FA 3MOQA 1JD9A 4OF6A 2DUZA 3TYEA 2GAZB 4QGYA 2NT0A 2VW4A 4NCC2 3QEQD 4EE9A 1YY8B 3S36L 3WNIA 2WV8A 3HLAB 3QA3A 3REWA 2NT1A 1RUML 3JWDC 3QQXA 3CAKA 4WD0A 5PTDA 4GI8A 4UNKA 2VZSA 4QTHB 3RVXD 3NO3A 5AC4A 2PDUA 2Q7YA 2BIIA 4ZTOH 1RQEA 1ISXA 4FR1A 2ZUXA 5ISZB 1P2CB 1LTXA 1G7VA 1GZJA 4QS5A 4UDTB 2QJGA 2NY2B 2PW1B 5G4WA 4QF1B 3APFA 4UFIA 1F4WH 4EN3B 4X9SA 1GG0A 5BRZD 2YMXL 1JNNL 4GG8A 3LQMA 5JHDA 3U0WH 4A4AA 3DPDA 3B9KB 3PZOA 1N8IA 2QUTA 3EO0B 2AK4B 4N8VB 1A3RL 2E56A 1EGZA 1JZHA 3PJSA 3MMEB 4EP8C 4G1MB 1US3A 5I1EL 3BQUB 1QABA 3OB8A 2HVBA 1A6VH 1J5HA 3V5HB 3W7RA 2BSSB 3RDTB 5DEFB 5GGTL 4O58L 1TJXA 3I9GH 2Q02A 2ZG3A 4L05A 2QUVA 4EPKA 2V5JA 5SV3A 1R0AH 1G84A 3MNVA 4UF7C 4FR6A 1BDYA 4IK6A 4GCXA 4XRCB 1X8FA 5AG9A 1IT9L 1S5MA 1UOVA 4UB0L 1G7QB 3E2HB 2Q8AH 3LN3A 1M05A 3TT1L 3QH3A 3WY1A 5JIQA 2RGSA 4FXGC 3UC0H 4EZKA 2Q10A 4MKNA 4DXXA 5KZEA 4NDMA 4W7UA 1GA2A 3ARZA 5ADOL 2OSLB 4CVWA 2EBNA 2W3ZA 4FXFA 3OQ3B 4KWUA 5HYJB 3MRDA 2K9UA 1Y6KR 2IH1B 1F6AB 1AOHA 3SIKA 2VC7A 2BVTA 2NNRA 3ZKNC 3VYNA 2OMBA 2OLAA 2J88A 1JRHL 1WCQA 4MCNA 4X9IA 5H37G 1HKKA 2C9RA 4LBEB 5DA0B 1VRDA 4AD3A 3IF1B 4XNUH 3TPUB 3HG1D 1INDH 1M7IA 4GVGA 1ICQA 1S5HA 2W4XA 1U41A 3AT8A 4GKTA 4LS0A 1OSPH 3A0OA 2ED6A 4R0LA 4QYOB 2J6EH 4Z7WE 3OPUA 5KTEH 4GY7A 5JVLA 4H2HA 4G43A 4OV6F 4QLJA 3I9AA 1PKNA 3TA3A 4XWGL 4H0HB 2A74B 2QAFA 4FEIA 2Q2EB 4NJAL 3X14B 3GHPA 4OLYL 1SHWA 2DLIA 2X1QA 1B30A 3GR7A 4E9LA 5CFHA 4HGXA 5K9JL 3W1LA 5ESQA 1CO1A 2DQXA 1TV8A 1AL8A 1PV8A 2DJXA 4OZHA 4AVHA 2V7NB 1MUMA 2G75B 3IU3B 3QUMA 4P2QE 1KZYA 3NQMA 1FH2A 1OEPA 5TQLA 3AQZA 3E2SA 3V3WA 4UFHA 2VEGA 3LBCA 3A3WA 3KJ4B 2GJXB 1COBA 1BXBA 1SFHA 4ZUVB 5GRJH 2ZSWB 1KENH 5L7XH 4LVAA 2XTJD 4M6UA 3MCLL 3PJSB 3EEZA 3DIDA 1SMOA 3KW3A 5D55A 4IP5A 4X5PA 1KGWA 2WB1A 2ZIDA 2FSEA 2TRHA 3UBHA 1QOQA 5ABFB 4R26L 2V5LA 5A94A 4K8HA 1RUKH 3L48A 3EXLA 1W1PA 1QEWA 3RI5F 4EPBC 3TA9A 1NWSA 3GZ3A 4CN1A 4O2FA 3BEVA 1W3TA 2ZRZA 4I1PA 4DQOH 2NSQA 4JZOA 4AIXA 2E27L 3R4RA 3VVWA 3BCJA 2AW2A 3D50A 1K6QH 5LCVA 3ZO9A 4EUPA 3VD2A 2ODIA 3UT0A 5T3XL 3QH3B 1SY6L 2DYPA 3VGEA 3ENLA 3UGXA 3W1PA 1U6AH 3DH7A 4J7RA 2GGJA 4PTNA 3WEMA 3T08A 3MBEC 4G7YL 2JK5B 4TSBH 2HZHA 5SWZA 2O61A 3UMTA 5AYZA 5J0BA 3GMNB 2ZCKL 4UQ3B 1JI1A 1P4LA 1SDYA 2A6KA 3BH8A 3NJMA 5EDSA 1AD1A 3KW8A 3SRHA 5D9MA 2A6JB 2A5UA 2GK2A 3DHFA 4L1GA 2ICEC 4AQOA 3WMPA 1OINA 5FLUA 4JFSA 1MI5E 4PGBA 2P8PB 3H9HA 1GOXA 1A7QH 3WKYA 3GIVB 4JN6A 4LEOB 4M5YL 4AUYA 3P3TA 5I79A 5FYLE 3WKMH 5IROD 1W0VA 5CFAA 4EK7A 4H20H 3QJAA 4G6KH 4W7VA 5DRWB 4FFZH 5KVEH 3O9NA 3Q2WA 4ZQKB 4ZW3A 4XISA 4QTIH 2ACUA 1ID2A 2Q76B 4NNXB 4PS8A 4Y4HC 2XFWA 3KCOA 4CC4A 2P8MB 4ZQNA 3W84A 3CQKA 1HH9A 4OCXL 4FS0A 2E76C 4JM0A 3C87A 3BOLA 1LK3L 3EOYG 3IJSA 3S3SA 3FSVA 4ORMA 1TTIA 2ED7A 4ZUWA 2W9EH 3AWGA 5EBWB 3WJJA 3ZU8A 1JUEA 1CF1A 2VMEA 3BPOC 3A6CL 4R4ND 5LNGA 4IGMA 3OHXA 2VDNB 4XO8A 4IWWA 1SSGA 2NY7H 5D7IB 3FXIC 3UBPC 3EBAA 1IAKB 5I74C 4QWWD 5JHLA 1LEIB 5EF3A 1XTLA 3T0VA 4WX2A 3VTRA 4P4RA 2J55A 4CCEA 2WBWB 4G7RB 2A7BA 2VLRE 5FHBL 1PY0A 4ODBD 3GS4A 5JHDE 4GVIA 1IQDB 4Z23A 2CLPA 3SSZA 1RZPA 1SW3A 4OTKA 4LCSA 2BVPB 4HUVA 4I18A 3R10A 4MDJA 2HJKA 1DBBH 2A9BA 4AMXA 4H6EA 3L3IB 3K2UL 3O9WA 4H0LC 3EZJB 3N40P 2WXKA 5B1JA 1F05A 1ML1A 3POCA 4DZ5A 2DIJA 4HKJB 4J3OH 2R9HD 4GAJL 4B95C 3L3HA 3PHQB 5GGSB 5CPTA 2ETWA 5EBAA 4UCFA 2R1WA 2KQMA 1W37A 3EOAA 1DN0B 1PD1A 3SE4C 4AZCA 2D4DA 1MFNA 1JGIA 2ZE0A 3IAQA 3PWJB 2NX5B 3CQQA 4OVVA 4JM2A 4UINL 3UH8A 3KRSA 1WDSA 2XYCA 1KJMB 3AU1A 5I09A 1MREL 5HPMB 4M1DL 2GC4C 2GSEA 1D9KD 3KPSE 4WGKA 5A8QA 4JREB 3W76A 4B5EA 7FABL 3WS3A 1UH3A 4C4KT 1L9PA 4OFDA 4U1SA 2E9WA 2ADJA 1WBHA 1J05A 3FB5B 3GS7A 5E5RB 1O1ZA 4P2VA 4Y1TA 4AYBA 3KHOA 2WZPD 3L21A 4NY2A 2JB5L 1G7JA 3FBQA 3NAAH 1ZNNA 3OP2A 1XP3A 5DRWA 4JTJA 2XPYA 2PP7A 3ECBB 5BXFB 2OX1A 1BX2A 2F6XA 5LHEA 2I24N 5KYWB 4Z7WA 2XZAL 2DJSA 3WDQA 1FN4B 1JVKA 3W5NA 2FHCA 2XA8L 3HBQA 4EZLA 1ONEA 3APTA 3N1AA 3ZXWA 1KTCA 2XIMA 3ZKSD 1Q72L 3KR3L 4MSWB 1JZ5A 2EABA 4H13C 2BNQB 2B7OA 1EEZB 4PBXA 4LPCA 4OIIL 4IHOB 2NQ9A 4ZAKA 3TWYA 4AGNA 4Z2JA 1ILSA 3H22A 3OZYA 3CSPA 1YEEL 1OSYA 2WBJB 3I6KB 1Q4NX 4UZSA 3WQ6A 4E41D 3TNNB 4XVUC 1BVZA 4ZUTA 2CA4A 4J3OD 4F57H 2R83A 4HFWB 4I3SL 1U4EA 4KI5D 1AH3A 2LLNA 5EBLB 3TQ0A 3MB9A 9XIMA 2PCYA 4XZLX 2XM1A 3ZO0A 2OKTA 4W5ZA 4W5UA 3PIQA 3FO9A 4QHUA 4WI2A 3BG5A 2F5AL 5CSUA 1JHKH 2OJZH 5AVYB 2P24B 3LN4A 3QDJA 4WU5B 3EWWA 4PBGA 1IWBA 1S8DB 4ZTPL 4KFMA 3E0VA 2AQSA 4XNXH 4WO4D 1HJBC 1I7ZB 2DMBA 4XPFL 2CUHA 1LXMA 5DLML 4GKSB 2AXFA 4ZVJA 3CYJA 1FOBA 1OBAA 1XSOA 1ZJBA 3GUTA 2ADFL 3T6CA 1RK7A 4LOVA 3RB5A 3RWEB 4IH3A 3WK2A 4N1EA 3PWJA 4WO4C 3ZL1A 4YBHA 2DRUA 3L3DA 2E09A 1J0HA 3OHIA 1KEGL 1ONXA 4WWPA 3BVWA 4OCLC 5DFWH 3T0AA 4LCWD 3WTXA 4X63A 1UUMA 1NMCB 4ZQTA 5FHAL 1GVEA 4C7DA 2H2PC 5IB2A 2X1SA 1LLWA 1S5TA 3AS3A 3MODL 2HJPA 1F3TA 4XIAA 3C2VA 3WL1A 1AG0A 2YKKA 3W1UA 3TZVB 2A2IA 5ENWA 4HSAC 3LNMA 4ZMAT 4W6WB 2E6YA 3HN5A 1GZHA 2ORBH 5FIPA 3X17A 1QYGL 1U4FA 4JO3L 5BOOA 1NGPH 3EH3B 3ABRA 1RQBA 3LBMA 5A8MA 1P6BA 1WZ1L 1FE8L 1XSKA 5CR1A 5M5DA 1UC5A 1S7UA 3L1OH 3NDZE 4TULL 3U46A 1QEXA 3QZPA 3V6ZB 2ZBTA 2ZDRA 3D6NA 3Q45A 3ABOA 3I7QA 3QQDB 2EDDA 4H1LG 2DQMA 4JUSA 1JNLL 1UACL 1OG0A 3HBPA 4UFLA 4M3JA 1FNHA 4MNQD 3SKJL 5LDSA 1EEXA 2GIYA 3GH5A 1Q8MA 5L4FA 2IPUG 3I2CL 1F8IA 2V5SA 2D23A 1OY3B 2GTWB 1ITCA 4G71B 3GB6A 5F93C 1AR1C 1N0XL 1OARH 3BUQA 3W9ZA 1IFGA 2D31B 3FQ1A 5C0BB 4PMVA 3ARUA 1L2QA 1W1YA 4LQFH 4E42B 4YFDB 4P4KC 4LLYA 1INQB 1JNHB 2QHAA 4OCWL 3GGWB 3WQ5A 1QI5A 4U7SA 3TLRA 2R59A 2E47A 3TO4B 2AXHA 2RR3A 2IAMA 3IGAB 4ZQPA 3FCTB 2VITB 2H6RA 1JSYA 4QDWA 2OXHB 3TSDA 2ACQA 1D5RA 5CZVH 4AVNA 5I1DB 4UBPC 1UH2A 1VKXB 1LL4A 2WZIA 3ZYOA 5F0MB 1M2VB 3Q2LA 3TTEA 4F66A 1BVNP 4FD0A 1GG1A 2J6EL 4BZ2L 5KTEL 3S34H 2L0DA 2DM2A 4IRSA 1HOCA 4JKMA 5DT1H 2ZZ5A 2C5DC 2EIZB 3D39D 2WBGA 4IP7A 4DPRA 3B2VH 1US2A 1Q66A 1K9TA 1HKLL 1F4HA 5JU6A 3STLA 2VN6A 1Y8BA 4C47A 5T26A 4GEJA 3T8XB 1IC1A 3GVRA 4I9JA 4QOKA 1VFTA 2XHYA 1ADWA 3GXFA 1LEGB 3MRQB 1ETA1 1ADQL 3X12B 5TPWL 1EF2A 1VZIA 1JERA 3MPGA 2CK0L 5E7FA 1YE4A 4HUXB 3QPXH 1RZ7L 2O6PA 1CLYL 1I82A 3S37H 3SE8L 2Z1SA 1D6EA 3SDCA 3ZKND 3CXHJ 4ETYA 1C8YA 1FA2A 1XYBA 3IANA 4Z2KA 3MV7B 4DPAX 1TPWA 1EX0A 3FB8B 3FXYA 4KBXA 1E5ZA 3PJLA 2ZNWA 2EC8A 4X7SL 1M6UA 1X5LA 5LGHL 3NGBB 4UT6H 5LQBL 1EOMA 2I32A 4L1SA 2B81A 3DG3A 3GI8H 3VZXA 1R0AL 2X3AA 4JQVC 1A6ZA 2HMCA 2EDBA 5M94B 1D6VL 1IC7L 3L4YA 5E9AA 3WIHL 1QLEB 4PCYA 1XF4A 4OFPA 5EBMA 5F2FA 2BY0A 1MCCA 2N3JA 2IADB 2YGOA 5H94A 4R7DA 3HHMA 1OGBA 3KPSD 3DX6B 2CLRB 4GQQA 4Q97A 5BW7C 5IOPB 4JNYA 3VNZA 4CSZA 1MWOA 3H6AA 2ACRA 3WFAA 3MZTA 5I3IA 5ACMA 4C59B 3EDJA 3AJXA 3PBYA 2H45A 3UMNA 5CSBA 5D7JB 5CEXB 5SWUA 4AQ8C 2FB3A 2GJZA 1JIBA 3AG3B 4M43L 5DLLA 4AT6B 1X5MA 2YPVL 4XPFH 1AXSB 2Q8XA 5DXYA 2J6WA 4U6XA 4W88A 3MDWA 4UTUA 1UKSA 3V4VL 1UWYA 3ZHKA 3IU4L 1JGUH 3NYKA 4K3EL 1Q9OB 4WEBH 1MAKA 4XO7A 4GZ7A 5D2XA 3DK2A 1KGIA 2XBZA 2XZQH 1BFOB 3F7YA 3NA4A 4KOCA 4K94C 1GPOH 1K9DA 4ZOEA 3T2PA 2A3AA 3CMFA 2C6QA 2PCXA 4MS8D 4Z8FH 3GRGA 2RJHA 4XN1A 4EBQL 1F6KA 4WKXA 3LLXA 4WI9A 3TV8A 3URAA 3NACL 5CBBA 4FI7A 1CG9A 5LXXA 4JFUA 1NEUA 3D8MA 1DLHA 5F7DA 3EOLA 4IRJA 1NH6A 3RURA 2C1PA 3MJ7A 1E3XA 4UT9L 3W75A 3IFOA 4PMEA 1ZY9A 3THAA 3KPNB 1GCYA 1U8NB 2JK5A 5DGRA 5BZDA 5JNYA 1V02A 3MUIA 1T0PB 3ESUF 3TV3L 2CYGA 3GTTA 4IIEA 4AE0A 2VLMD 1NY1A 2BVUA 2A6JA 4Z7QF 1KGCE 1H6FA 2NDFA 2P9RA 4ODWB 2FD6H 2ONEA 2A9DA 4AHPA 1QYGH 4PGBB 1G7PB 3EGXB 3IEBA 2Z27A 4TVDA 1UZ1A 2J7EA 3M1OA 1IT9H 1EXUA 3AXLA 4Q6XA 1HL9A 3AWEA 5HQEA 4I4WB 1H5YA 2H9AB 4FNSA 5AYUH 4OZGA 1CXFA 2Y5TA 5KS9A 1GW9A 1Q6LA 1VBRA 2WJEA 3AYTA 3HHSB 1LOSA 4XSMA 4P3DA 3WD1A 2TRYA 5E00B 1L5GA 2GSIB 1Z1WA 4OGQC 5TJWK 2GJ6D 4LSBA 1QA9B 4GB9A 2MOGA 2X4UB 1LYXA 1AP2B 4MRCA 1FVCB 3AQXA 4DLFA 2H26B 1K8DA 2Z7YA 3W26A 4MNGB 4XC3L 3D48R 5EC2B 4XVDA 1NUNB 3D2UD 4QGTA 3CLFH 1W3NA 2YRZA 2BVQB 3BOFA 4O4YH 5I1GH 1IKFL 2MQCA 5AKVA 2HLFD 2Y7EA 4A29A 4A1RA 3QEHB 1RUQH 2A6LA 1Q9LA 2VM3A 3QUZB 2Q2LA 2GT9A 3F04A 2W60B 3D09A 4JG1L 1AI1H 1SDDA 4HK0A 1E3FA 3G6DH 7CGTA 3FY1A 4C56B 4TSCL 1F76A 2AQTA 3Q1SL 4XMLL 3RDTD 1OWWA 4D0BB 2OV0A 4EQ2A 2DIBA 4FNLH 4XP4L 4FQIH 1EHXA 4FULA 1CBVL 5DRZA 4AKPA 1SVCP 2WXIA 4MHHI 4GVFA 1HIMH 1MMFA 4NHCH 4N02A 4ZYKA 4YK4B 2BNUA 4IQHA 3RAJH 1G1OA 1NEZA 1BFVL 3OLDA 4PR5B 3RDTC 1J1PL 4I8DA 1SFJA 3MSRA 3VKJA 3E3QC 3FQXB 1IEVA 2R4RL 4HXAL 3U79A 1M7OA 4G6CA 3FU3A 1S9VB 3VD3A 4LCCB 1A5CA 3KEDA 3GSMA 4O1BA 4DFHA 4GYPC 3WO8A 2I5GA 1XMWA 3ISRA 3NTCL 1W15A 4POUB 5GGSY 3PZIA 2JIWA 1KIUA 1TUFA 2CIKA 1A1NB 3MV8B 4OLWL 4E5TA 5BZWA 3ROOB 4PUWA 4F5CA 1T7YA 5CPLA 4NN7C 4HF5L 4ZL1A 4B9IA 5E6IA 3UJEA 4Y90A 4HAKA 3V8OA 1V6YA 3QEUA 4QT5A 4X2UA 3VI3F 1OABA 4D8PB 5GXBB 3FEQA 4X3ZA 4WFHD 2YPLE 2DSKA 3CVCA 3SUVA 3HAEA 5E08H 3N2BA 1ETZB 4WKZA 1Q6FA 3HUJE 3W24A 3QEQE 4U1IA 1M5WA 3LSOA 5AKTA 1RI8A 5DHYB 4F58H 5ADPH 5F7EH 4BFNA 3TJLA 2VIRB 4N2IA 5HYQA 1FN4A 4RMRA 5E6SB 1WYJA 4FQ1H 4GKNA 4IIFA 1KV8A 5FKYA 3SZ8A 3N12A 3Q67A 2BFGA 3FTGB 4A67A 2PTDA 2DMGA 3R1GL 3B0PA 1ISYA 3EO1B 5EEZA 5JZ7D 4Q52A 3KP1A 4MOZA 1W16A 2XTLA 3RWIB 4EIZC 1BG1A 3AIQA 4D1IA 3BDYL 2HRPH 1SJXA 2OT1A 4KTGA 2IG2L 4J6RH 1OAYL 2VDQB 1EOKA 3AZRA 5IFHL 1NDVA 2IBZY 1IGSA 5LWYL 4URKA 3PAYA 1T89A 2FO4A 5DLMH 3X3GL 1GYAA 2QJMA 5H6HA 3SZ6A 1OPGL 2J6XA 2E75C 3B9VA 4Q9RH 4NKQB 2R27A 4OJDH 5DRXB 3LEXA 3DYMA 5D2LF 4DGUA 2XFYA 1TPDA 4GVHA 3KPMA 4FHJA 3T4YB 1ELSA 4N26A 1QSED 2VLKD 5E1AB 2VDPB 4PYHA 2C1IA 2MUCA 3L6FA 4A8RA 4QHNA 5ICXA 5KVGL 3QULA 4GAGL 4FG6D 5TE4L 5FB8B 2QSVA 1O6IA 3RXZA 3DSFH 5D9NA 1YXYA 2VSMB 3KYKL 3O6YX 4BM7A 2VLLB 3UCCA 7REQA 5CGYD 3GXPA 4MNQB 4JKPH 4AKOA 2NW0A 5I2IB 3FYEB 5C7VA 4WW2A 2XH7A 2GUUA 2Z0UA 4CNUA 3EOBA 3GUWA 3UEQA 4NI3A 5MENA 5IM7A 4I77L 1YEFH 4P4KD 1FYTE 1WITA 2CBOA 1WWAX 4OVUA 1IEXA 3QXVA 2C16A 5IESH 4LBUA 3ZTEA 3RTQD 3SUUA 4BI5A 1P7QB 1EGJA 4IPLA 1AGEB 3GZPA 5AL8A 2DZXA 4ELMA 1M6OA 3SQBA 1AYOA 3CO8A 3HI5H 5GRUL 2VEKA 3H55A 4GQ9L 3TH4T 3UZVB 3PYCA 3IBOA 4WLCA 2UY6A 1LMIA 3T0EA 1ZHAA 5BOEA 2X5PA 2DWDA 4D9QD 5I1HH 1AGBA 1KIQB 5DDHA 3BIBX 2HWZH 4PRBB 5LB1A 1XI3A 3LTPA 1DQJA 4OM1L 5BPPA 1RZFH 3DFTA 1T20B 2FSDA 2JXMA 4AUUA 4ELDA 2ZTKA 1MNUL 3H7BB 2AAMA 4D7BA 32C2B 1AXTH 2VR7A 4N2YA 2EYSA 3AIVA 1ROCA 1W8NA 4JKKA 1KNOA 1OYCA 4B5WA 3T3PF 2FECL 5AW7B 2CHOA 3DTUB 3KW7A 4P5TB 3V5HA 3VXQA 4I7WA 3WLMA 2HT3C 3Q8AA 2DW5A 4NNPH 3EZ8A 3IBEA 1N82A 1OC5A 4P4KA 1HKIA 1B0WA 4YSPA 2NX1A 2D4FA 3VXOA 1IGJA 2NNFA 3I6LD 4JY5H 1K4DB 2F8OA 4POZC 5D2NE 2ZJSH 5GGUB 1C16B 1DKWA 4AH2B 3K1KC 1XO8A 4Q8MA 1FFOB 1TR7A 2NZ9D 1Z41A 5F97E 2FR4B 4AZ6A 2D3LA 2HUEA 3L1EA 4HIXH 3KH4A 4FA7B 3AT0A 3VRIB 5TFSH 2FH6A 2YD5A 3K6NA 3ARBB 4FQQB 4PLOB 4BXSV 4FJ6A 3LKPA 1S7VB 2FLRT 3M5VA 4MIMA 1ZWIB 4Y5XC 4MX7B 3SPCA 1OPOA 1IXQA 4AIEA 3GBNH 3TAKA 1DE6A 1NC4B 1VFOA 5BO1L 1GTFA 4FAMA 4QRRB 4W7WA 4APQC 1XW8A 1S7RA 1SYVB 4FYTA 3MSPA 4TNVF 5E8OA 1R9YA 5B4MC 2E1DA 2Z7WA 4IOTA 1NM9A 3WLJA 2JCCB 2XJ7A 4O4VA 5B8CA 3F6LA 3WDRA 3C0JA 1JK9B 5K1NA 2CIIA 1FFRA 1FUNA 3PNRB 5DA4A 5T1LD 1P6FA 4KRNA 4G9DB 3FUEA 3E0LA 3MHFA 3AVEA 3TSBA 1SBSL 4PJGE 4XKYB 3RU8X 1F3JA 1LQSR 2EIBA 2UZYA 2CUIA 2YCKX 3BSGA 4JYFA 5INCB 4Z0JA 2ZRUA 4ES4A 4KESA