1KXVA

Camelid vhh domains in complex with porcine pancreatic alpha-amylase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase, immune system
total genus 175
structure length 496
sequence length 496
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kxvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kxvA01
2DT0A 1UD3A 3VD4A 2JE8A 3WY3A 4AZHA 2JALA 1CTNA 1BPLB 3BAWA 4LYRA 1FP9A 3AMGA 1SR0A 2WCAA 6A3HA 3LRKA 2XGBA 4GZIA 3QHOA 4AZ7A 2Q8XA 1QX1A 3GXPA 1LG1A 3FHAA 1CGWA 4RL3A 2VZVA 5BXSA 1B3VA 2BY2A 2BVTA 2W91A 1VFUA 3ARWA 1XH1A 1PIGA 1TCMA 3MSGA 2VT0A 4W8BA 1OCQA 2EPKX 2OSXA 4IM4A 5BROA 3ARYA 1TZ7A 1W3HA 3VNZA 1ECEA 1NH6A 4AXNA 1ODUA 1GONA 1B90A 4W88A 1M7XA 3DYMA 1UKTA 1XCXA 4OUEA 1FFQA 3S5YA 1BYCA 4FNRA 1VEOA 3IJ7A 3WF2A 1BG4A 1U30A 2PB1A 3SCVA 1V3IA 4ZXLA 2GDVA 4UQBA 1C93A 3PZOA 3T2QA 1JZ4A 1CLVA 3ZMRA 2YJQA 1W3JA 4CU6A 5I0DA 5GQBA 4Z2HA 1MW2A 3D50A 3APGA 1E3XA 2WAGA 3TOPA 1GQJA 1UG6A 1LWJA 1XH0A 2RGLA 2G8ZA 4PMUA 4OJYA 4YHGA 4AZBA 4P7NA 3QGVA 2D3LA 5FL0A 5A6JA 2E4TA 1WNOA 2WXDM 1QHOA 1VFMA 4KRTA 4TOQA 1OGSA 3AJ7A 1BAGA 4JZ5A 1BVZA 2YBUA 5A2CA 1UZ1A 3WNKA 2X2HA 4HOXA 1JDAA 1RPKA 1EDGA 4BQ2A 2GJRA 3A3HA 1GOOA 4DM2A 3WQVA 3GBDA 1AMYA 1E5NA 5BRPA 3PZIA 2YDSA 1FFRA 2CCRA 1JGIA 1CGYA 1V6WA 1E4MM 3TTOA 1JD9A 3H54A 1XCWA 4U2ZA 4B3KA 4U3CA 3AHTA 1XV8A 3GZAA 1DWJM 1JZ5A 3WL1A 3L2LA 3VUPA 3VGGA 3D4YA 5EBAA 1WDSA 1FH9A 2YDRA 2GK1B 2WKGA 1V0LA 4X9YA 3CO4A 4J3TA 4W93A 3ZR6A 4AW7A 3ARSA 1V02A 2FDMA 5JBFA 1VIWA 3ZT6A 3MMUA 2J75A 2Y8KA 1GOKA 2JEPA 4D1IA 3CZKA 2W67A 3NDYA 4OGZA 1IZKA 2ZICA 4CD7A 1HNYA 3WNOA 4UZUA 1NOFA 1QBBA 3HZ3A 2J79A 4M29A 1E55A 2HVMA 2IUZA 4JKLA 3F5KA 1HJVA 3UETA 4UTFA 5D8WA 1PPIA 1K9TA 2X2JA 2W62A 1NWSA 1HKJA 2VTFA 5LA0A 3BAKA 5CGMA 5A2AA 3TONA 3ARUA 5D9OA 5ABFA 4J3XA 1O7AA 1O6IA 3N9KA 1XD0A 2A3AA 3WUFA 1MW3A 1QWNA 4HOWA 1VBUA 3T0BA 2EADA 1V03A 1TQWA 3BUDA 3VX1A 1ITCA 2QHAA 2W5FA 1SFSA 7TAAA 2XWEA 4MNKA 4W86A 3WUGA 3CLWA 7A3HA 5JBEA 1W9XA 4HPGA 3VDCA 3UG5A 1DEDA 3ZT5A 2VQTA 4JKMA 2WHLA 4FNSA 2JEQA 2OSWA 2XM2A 1C7TA 3GNRA 1H0GA 5HOSA 1V08A 2CERA 4HMCA 1V02E 3DHPA 1RP9A 2F1BA 2VX7A 2BNJA 1HIZA 4Z2GA 3U5UA 2XN0A 1H11A 4HTYA 1KGWA 1UASA 4ZE5A 1AVAA 1GOIA 2VI0A 4B9YA 3HG4A 4IPLA 1KFWA 3VDAA 3KLLA 3L4WA 1HL9A 2YLAA 3II1A 3WNMA 1TFVA 2GSJA 3AS2A 3NYDA 2JF7A 3T2PA 1OBAA 3AIVA 3ARRA 2WC4A 5IXEA 3DDGA 1HJXA 2WMFA 4PMNA 2F61A 3WY2A 2BHYA 5AYIA 4J28A 4RE2A 2WZHA 5C8BB 1R7AA 5A6BA 1JF6A 3HU7A 1RD6A 2VZUA 2CYGA 1QVBA 3L4VA 3WD2A 3AS0A 4MJ2A 1PBGA 4C7GA 2WM0A 1HL8A 1US3A 3PZVA 2VVNA 4QP0A 3SIMA 5LA1A 1VJSA 4RE3A 5EB8A 1WCGA 1HTYA 4W89A 1UH4A 1UH2A 2G3JA 3WD1A 3PN8A 3RPMA 2F7OA 2A3EA 2XWDA 1WKYA 1JZ2A 4F79A 4CN6A 1EA9C 3KZSA 3M7SA 3BSGA 2J78A 1QBAA 3GBEA 2C0HA 3SURA 2CBIA 1KTBA 2NW0A 3F5JA 3TTSA 4AZ5A 3CMGA 3EJRA 3I3DA 4M82A 2O92A 2C7FA 3VM5A 4D6GA 3OLEA 4H8VA 1J18A 5A6MA 4JFSA 3VSTA 1AQMA 2X2IA 3CHDA 1VBRA 2WLYA 1CXKA 2EO7A 4UFLA 3CGTA 3LRMA 1K9DA 1Q6GA 3BUQA 1WDRA 4MJ4A 5E6ZA 1B1YA 1B0IA 1W1TA 4GXPA 4KGLA 5CLWA 5BRQA 3CIVA 4AY1A 4NZCA 4JAWA 1WP6A 2Y4SA 4GI9A 4HPHA 2DT2A 4F9JA 3N12A 1UHVA 4MAZA 3NJ3A 3PZGA 1V0KA 5AY7A 1WB0A 3J7HA 3VD5A 4M80A 3TA9A 1Y7VA 1QI4A 4ZE4A 2J74A 4JL1A 2X09A 4J27A 2CKRA 3WKZA 1AQ0A 2BY1A 3CUIA 1DP0A 3WFLA 2F18A 1KBKA 3NCOA 3CC1A 2CETA 5FL1A 5ABHA 4AD2A 5IHRA 3WDJA 9CGTA 3ALFA 2Y2WA 4M1RA 1MVYA 2HISA 1JF5A 3CUFA 1GUVA 4URIA 5JBDA 3ZT7A 3N18A 4UQDA 2DH2A 2XN2A 3A5VA 1QHPA 3FHQA 2YA0A 1HP5A 4Q7NA 2J62A 1DTUA 3SUUA 5HDRA 1Q4NX 3H53A 3AI0A 2VRQA 2Z1SA 1LJYA 3OZOA 2E9BA 2D23A 3ZSTA 1DWFM 3RDKA 1CWYA 3MS8A 4PTVA 3SCWA 3LX9A 3B9DA 4D6IA 4NSBA 3CBWA 4TVCA 1JI1A 5M03A 2OYKA 3W53A 2TAAA 3WF3A 2X05A 3K8MA 1QI3A 2VZSA 6CGTA 2BV9A 5DMYA 3EMCA 1VF8A 3D52A 2DT1A 1JZ8A 4IPNB 1V6XA 2CESA 1XH2A 4N42A 1E9LA 2F2HA 2BVDA 4WIWA 3GYCA 1C92A 2XIBA 2DT3A 3AZSA 5HBFA 2E8YA 1UZ4A 3L4ZA 2VVSA 3BMVA 4P7OA 5DF0A 2DEPA 2WMJA 1WZAA 3D3AA 1JG9A 3THDA 3OLIA 4EKJA 4DUWA 3OA5A 1UD8A 2WMIB 3FAWA 1BGGA 1C90A 5CLTA 4J3UA 1QI2A 1ISXA 2WVVA 1UKOA 3BGAA 1E1FA 1QHZA 1BF2A 3VD9A 4W7WA 3VX0A 3I3BA 1E6XM 3PZTA 4WKAA 5I5RA 4UFIA 1W9BM 5C71A 1DHKA 5A8NA 1BG9A 3CZ8A 1ESWA 1IZJA 4NX0A 2W66A 4W8AA 4FLOA 1L8NA 3A47A 1TG7A 1OIMA 2J25A 1Q6DA 2WVUA 2ZWYA 4D6CA 5CQ1A 3WY1A 2XYLA 4MDPA 2EEXA 2G3IA 5EFFA 4ACZA 2XUCA 3OBAA 2DSKA 1K9EA 4PBGA 3T09A 1CZ1A 2GDUA 3DHUA 2YL6A 5M5DA 1E6NA 1PX3A 4FLSA 4XB3A 1TVNA 2QLYA 1B3XA 1H4PA 2CNCA 5IFPA 3AMDA 2C8NA 1JYXA 3EJQA 3SCPA 1W9UA 3SCTA 8CGTA 1PZ3A 3CV5A 3OB8A 3OLGA 4V2XA 4TXEA 3IK2A 1R34A 2XFYA 1XD1A 4GIAA 2PWDA 4UQAA 1MFUA 3GNPA 3CHCA 1PZ2A 3RJXA 2VCBA 2WHMA 1KGUA 3BCDA 4CU7A 4W7VA 3T08A 3GXFA 4P7RA 4NRRA 2ZIDA 1B31A 2QMKA 3CZGA 1QI5A 3DX0A 2W4XA 2Y8VA 3ZJ7A 1W1VA 3CUJA 5KZ6A 1B2YA 1OD8A 3VMOA 4AZCA 4N0RA 1HWWA 3QHMA 2EPLX 3RM4A 3CTTA 1TR1A 2WSPA 8A3HA 1J0KA 1GNXA 3UERA 4PYSA 2BVYA 1UR4A 1U2YA 2WCSA 1WAWA 4L4PA 4D6DA 1J0ZA 3AIQA 3VD3A 3LRLA 3SUVA 4J3SA 4AIUA 4AMXA 1OM0A 3W37A 1ISWA 2V3FA 1UWTA 4D6JA 3AYRA 2FH8A 1HP4A 1ZB5A 3VIGA 1XGZA 1WZKA 4U3AA 1MXDA 3EMQA 2D0HA 1BGAA 1X6NA 4P8VA 2YL9A 1E1EA 1MFVA 3EDDA 1OGGA 1HXJA 3NUKA 1JIBA 1UOKA 4NXKA 3E1F1 1R8LA 1QNRA 1IT0A 5HNNA 2ZX9A 5JIPA 1BLIA 2CHOA 4F9DA 2ZOXA 5I77A 1ISZA 5A6AA 1LF1A 3N15A 5GNZA 1VRXA 3W38A 5DT7A 5I23A 2CKSA 2J4GA 2ZUWA 1UR0A 5I79A 1G01A 3WQ6A 2E3ZA 3UG4A 2EXOA 3D4ZA 3L2MA 1KB3A 4PMXA 4NZFA 1XRVA 2G4FA 4UR9A 3MSDA 1ZL1A 4B9ZA 2XVNA 4FF5A 4P8UA 4XUYA 4TX8A 3RO8A 3KWXA 1BVNP 1EDQA 4E8CA 5LYRA 4AZGA 3WNNA 2WYSA 3L4YA 3B9EA 4W84A 1V3KA 3O9NA 3AICA 1PAMA 4DO5A 3GDBA 2ZX7A 4P8XA 3WDIA 3ARZA 1NOUA 1EOMA 4QFUA 3GXNA 1JFHA 1CXEA 1RP8A 1NARA 3IAQA 2CHNA 3MUIA 4HZ8A 2GJXA 3MUAA 1HKIA 1J11A 5D4YA 5JUVA 2XSBA 3GNOA 4X0VA 3UESA 1JNEA 1CXHA 2F7QA 4NXSA 1DWAM 1MYRA 3U57A 2VMFA 4UFMA 3WMCA 3WMBA 3L4TA 4FNUA 2E8ZA 3A4AA 3A6OA 2GUYA 3ZOAA 4MADA 1UUQA 4JCLA 1S46A 2NT1A 1FA2A 4TVUA 3EDEA 4GQQA 1LL7A 4ZENA 5ABGA 4AC1X 2IXVA 1KCKA 3PTKA 3WDPP 1XSIA 2XTKA 4WSKA 3D51A 2JFEX 2A3CA 1TMQA 4B16A 3WD4A 3OLDA 3DX3A 1QNSA 3PHAA 1CGXA 1X6LA 1XSKA 4ZEPA 2NT0A 3VVGA 2OYLA 3WF1A 3A4XA 4BZYA 3EBVA 3MKKA 3EJSA 1HJSA 3DC0A 2AAAA 5CZKA 3HG3A 4B3LA 1GOMA 2VX6A 3BC9A 3IJ9A 4PMQA 4DUVA 1UWIA 2X8RA 2WC3A 1TVPA 4QLJA 3BH4A 3BAXA 1W1YA 4EAMA 1HVQA 2V38A 1VENA 4FNPA 2YFOA 1XC6A 3PTMA 1C91A 4MDOA 1KXTA 3KEHA 1LL6A 4PN2A 2FH6A 4GKLA 3VMPA 4MB4A 2D73A 1ZBKA 1DWHM 3W6MA 1T0OA 1EH9A 5ABFB 3SCOA 3WQ5A 1FOBA 2V3DA 4FK9A 4MNJA 4TUFA 1M01A 4V28A 1BQCA 4P7QA 1EOKA 1QNQA 2EACA 1E70M 1NQ6A 3VIIA 3VKKA 5CGTA 4EE9A 3BAYA 3ZM8A 1C3FA 2VRJA 1E56A 4MPKA 3WEOA 3ZO9A 2J8GA 2DIJA 4UOJA 4GZEA 5CSYA 5JIWA 3GXDA 1E0WA 3AS3A 4AISA 1I75A 1BYBA 1GHSA 3THCA 4ATLA 4AD3A 3N11A 2WB5A 1KR1A 4DWSC 5M17A 5BYWA 4OIFA 1H2JA 4AWEA 2MANA 5KEZA 1JYNA 1SYTA 3WQ8A 2OYMA 3A21A 2J7BA 4AYSA 3SCRA 2XVKA 1GOWA 4LGXA 1JL8A 2FYVA 1ISYA 4MB1A 3MV11 3OZPA 1US2A 2ZXAA 2DGAA 2WWDA 1E43A 2WSKA 3CZNA 1VJZA 4M81A 2XHYA 1W9VA 4CCDA 3OG2A 3VIOA 4CGTA 1I1WA 1OIFA 2XPKA 3AMCA 3F4VA 5A6BD 1GQLA 1WZLA 1V6YA 3WEZA 3K8LA 2WMKA 4JFTA 3WH5A 1CGUA 1CGVA 2GVYA 4CN4A 5EMYA 3CZLA 4FMVA 1PX8A 4M8UA 3WH9A 1H1NA 1UH3A 4AD4A 1HN1A 3D5HA 2XSAA 3BVUA 2XFFA 5FCZA 5GNXA 2ZE0A 1W1PA 2G3MA 1A47A 2OWXA 5M3WA 3UG3A 4XV0A 3HMCA 4YPJA 2ESCA 2GJPA 2YBTA 3OGVA 3EJTA 4NZJA 3CZJA 3LMYA 1YHTA 3GTNA 1ZBCA 1HKMA 3ARQA 5D9PA 3W4RA 3T0DA 3GH7A 4HZ7A 4ACYA 3VU2A 2PWFA 2EBNA 5CPSA 1BYAA 1GQKA 2OW6A 2VUYA 4BA0A 2F7RA 3WUEA 4UFKA 3N04A 4CD6A 4Z2IA 5EFDA 2WBKA 3ZIZA 3AXHA 3FN9A 2WZIA 3BVWA 1H0IA 3UR7A 2CBUA 3PZNA 3WQWA 1W2VA 2DH3A 1KXVA 1B3WA 3AIWA 1EQCA 1UKSA 2DDXA 5AC5A 3S5ZA 4QLLA 4BCEA 2X0HA 1R33A 2V3EA 4GO8A 1GJUA 4JFUA 1BYDA 1NWUA 3VTRA 4R5EA 5HPOA 4A3YA 2ZUMA 2BHUA 2JIEA 3PZMA 2XFRA 4F66A 4JHZA 2PWHA 3GH5A 1B3ZA 1NWRA 3BUPA 2E40A 3BSHA 1WO2A 1V0NA 1KWKA 1MW1A 4OOZA 4W5ZA 3SUWA 1TA3B 4Y7EA 1FH7A 1JNDA 1UWSA 3GXMA 2V5CA 2PI6A 5D9NA 1H09A 1XYZA 3ZR5A 3AHYA 1HXKA 4V27A 3NSMA 1PIFA 3A24A 3VOCA 1J10A 2YFNA 1J0YA 2IXUA 4JIEA 1V3HA 1JZ6A 3LPGA 1E6ZA 4W87A 3N1AA 2D0FA 1UR8A 4UOZA 4PMRA 3FAXA 5BCAA 4GI8A 3WF0A 1JYWA 4S3KA 1W91A 5I78A 2D1ZA 3WBEA 3L4UA 5TD4A 2WBGA 2EQDA 3U5YA 3U7BA 5HXMA 5IFTA 2NSXA 1MWOA 2VJXA 2WANA 1SMAA 1RH9A 3O2LA 3W27A 1O7DC 4UFHA 3WH6A 2VL4A 4X0NA 1UKPA 1UQYA 3PTQA 4CKQA 5I24A 1WZMA 5E6YA 3TP4A 1GZJA 5A8PA 4PTWA 3QHNA 2O9PA 3M07A 1M04A 3VIKA 4CU8A 4C7DA 3S2CA 3W82A 2BY3A 2D24A 2BY0A 4DWSA 3VGHA 3DDFA 4DWSD 3WNPA 4FNTA 3GXIA 3BXWA 1HT6A 1B9ZA 1IV8A 3DX2A 2WMIA 2DSWA 3QOKA 4CD5A 5A8QA 5A69A 5GPRA 3SUTA 3W0KA 3AXIA 4WLCA 4IISA 1TQVA 1NP2A 2W92A 3SCQA 2WVVB 3UEQA 5A6SA 2FHFA 5FIPA 4FNQA 3NDZA 3RM8A 3PZQA 3VSUA 3EMZA 1D2KA 3AZTA 4NRSA 2J7HA 2Y24A 3G6LA 4JFVA 4OKDA 3WUBA 2CBJA 5IHSA 4KMQA 3ALGA 3WD0A 2E9LA 2D2OA 2WNWA 3M46A 2ZUUA 2XVLA 1V3JA 3L4XA 2BXYA 3OGRA 3MV01 4MAVA 4ACZB 4H41A 4AIOA 4AMWA 1E4LA 2D20A 3VIPA 1P6WA 3AISA 3EJUA 2PWEA 2YIHA 3VSVA 1OT2A 3LXBA 4H8HA 3BVXA 4PMZA 5LA2A 1E72M 1N82A 3A4WA 3QR3A 3DYOA 1KCLA 2BXZA 2WWCA 3WQ4A 1CIUA 1J9YA 3QOMA 2GFTA 2O9RA 4IUGA 3ZQ9A 5A8OA 2UWFA 2OWCA 3WH8A 1H5VA 2VURA 1KQYA 3WMSA 3RMEA 3AMKA 4M56A 1E4NA 5BXTA 2BFGA 4RE4A 1EO7A 2J77A 3ZJ6A 1CGTA 2UY2A 4ZFMA 2CXGA 3VIHA 1V3LA 1Z32X 3ARXA 3W6LA 3BUIA 4M24A 1HF6A 3LXAA 2AOSA 2WC7A 4CVWA 2WKLA 1KR0A 1G1YA 1KWGA 4PUDA 5A94A 3WFZA 2VO5A 1WPCA 3TV8A 1NOWA 2FGLA 4U31A 2UY4A 1OSEA 3WY4A 4AD5A 3RILA 3MUZ1 4AZCB 3VGFA 4PMOA 4HA3A 4AIEA 1JZ3A 3ECQA 3N17A 3WDQA 5E0CA 4PTXA 2O9TA 4JHOA 4KGJA 5I6SA 3LPPA 1E6RA 3CMJA 1GW1A 1KBBA 3HN3A 3TTYA 1PEZA 1R46A 3B9AA 1H49A 1D3CA 5E09A 4UZSA 5CSUA 4EANA 1GPFA 1WDPA 4F8XA 1UR1A 3PZUA 2ZX5A 5DO8A 1MXGA 1UA3A 4P8WA 3IJ8A 5D9MA 1GCYA 4XX6A 2ALWA 3CUGA 3IANA 3K4DA 1C8YA 4MB3A 3BMWA 3VGDA 2YKKA 1WE5A 3VDBA 3PZ9A 4UQCA 1YQ2A 3LXCA 1FP8A 3WD3A 1C8QA 3RCNA 2WHKA 1W9PA 3VIMA 1TE1A 4HU0A 1NP0A 3H55A 3AFBA 1J12A 1G94A 1KXQA 1UYQA 5C70A 1W3KA 4Q22A 2EPNA 4DM1A 4KWUA 3WEMA 2WPGA 1XYFA 2F8QA 3POHA 4KH2A 4JFWA 1JXJA 7CGTA 2YL8A 1CPUA 4U5KA 4W8LA 2QPUA 1GJWA 3K4AA 2WCGA 3CHFA 2D0GA 1TQUA 1HVXA 5AC4A 2D3NA 5DT5A 1BTCA 1QPKA 2CIPA 1Q6EA 2WMGA 3HJEA 3VGEA 3WBAA 4WK9A 5A1AA 3WDRA 1F4AA 2GJXB 3UCQA 2AMGA 5BXRA 1SZNA 3WDHA 4UFJA 1R85A 1CXLA 4ATDA 3WN6A 4TX6A 1UWRA 4BF7A 4U33A 2RGMA 2OSYA 4MNLA 4XZWA 2DQXA 1EO5A 4A4AA 1ZJBA 1CXIA 1JZ7A 4FLQA 4PMDA 3MMDA 3MUY1 4AZIA 1ZU8A 1ZJAA 4PMYA 1EXPA 2GK1A 4Z2LA 5BXPA 4CVUA 2QMJA 1EIBA 2FE0A 1M03A 3MI6A 4OBSA 5I3DA 2J47A 1OD0A 5E9AA 1GHRA 4DO6A 3LPOA 1UD6A 2A3BA 5FOOA 1CBGA 2PWGA 4BS0A 3K8KA 4AZ6A 3KLKA 4H04A 1K6AA 2F1AA 4WKFA 2CEQA 2VX4A 1G0CA 2ZXBA 2VX5A 1UWUA 3FW6A 1V0MA 4E4PA 1JDDA 3N13A 2VOTA 1M53A 1PX4A 4NI3A 1JFXA 1X1NA 3AHZA 4PCSA 1VB9A 5E0FA 4W5UA 3WSUA 3SCSA 3AQUA 1E73M 3EDJA 4BQ4A 4PSPA 1LLOA 1CECA 2XG9A 1I1XA 1PS3A 1EDTA 4QCEA 2VR4A 3CPUA 2J7CA 1PJ9A 4HZ6A 1UR2A 4TTGA 4H8UA 1MQQA 2PC8A 4CN1A 1UWQA 4CCCA 2J7EA 2E9MA 1HKKA 2VCAA 1E15A 4Z2JA 1GOQA 1XHGA 3MU7A 2XGIA 3U7VA 3F5LA 2G41A 3GH4A 3DYPA 2YL5A 4ZXOA 4WKHA 3WH7A 4UQEA 3GXTA 1QWUA 3BAJA 4LPCA 2QPSA 1EQPA 1BFNA 3WF4A 1OB0A 3WL0A 1ZS2A 3M6DA 1J0HA 4W7UA 5D8ZA 1H3GA 2D22A 2B31A 4JL2A 1E6QM 4HA4A 4LXFA 4NF7A 2VCCA 2PBOA 4CD8A 2VZTA 2CPUA 1KXHA 3TTQA 4WJXA 1UD4A 3POCA 3I3EA 3K46A 3NSXA 1CNVA 2CBVA 2VR5A 5E70A 1UKQA 2EPOA 3O6AA 1LWHA 3GM8A 3AYSA 1VEMA 1E6SM 2YDQA 1C8XA 1KTCA 5I2UA 1HJQA 2OWWA 3ZJKA 3T2OA 1MQPA 1C7SA 4BQ5A 1W2PA 4PUEA 2WLZA 2Z1KA 1Q6FA 2EAEA 5A6KA 3VMNA 4P7LA 2ZUSA 4HMDA 4D6HA 2E0PA 1KQZA 1ITXA 1J01A 3SUSA 3KL3A 5IDIA 4EK7A 1HJWA 2Y5EA 5HPCA 3VINA 3W25A 3BVVA 2IGTA 1E71M 5CPQA 4U5IA 2OW7A 4AD1A 3AIEA 4PTMA 4AD0A 1QW9A 2YLLA 1CENA 4LYPA 3VIFA 1DWIM 2OLHA 4UQ9A 1L0PA 2QV4A 5AYBA 3LPFA 2YA1A 3G6MA 2A3HA 1W32A 4JCMA 3W81A 5A95A 1Q6CA 1E4IA 1W3LA 3VILA 4D6EA 4ATWA 3EJPA 1HJUA 3KL5A 2UY5A 3B8SA 5A6LA 2EPMX 1LG2A 2XJ7A 3AIUA 5A3HA 1VAHA 3CH9A 4QLKA 2WHJA 2WZEA 3A23A 1LQ0A 1B3YA 4DO4A 3KL0A 5A8MA 2J8FA 5ABEA 1V6VA 2BHZA 2J7GA 1ZBWA 3RM9A 1TUXA 3MMWA 5GNYA 4UNIA 3EYPA 3VGBA 1K9FA 1AQHA 2DSVA 3UR8A 3FY1A 4L4OA 3DX4A 4GQRA 4YHEA 4HU8A 1NM9A 4AEEA 2J7DA 4U2YA 3JUGA 1G9HA 2FHCA 4MB5A 4J7RA 4KRUA 1UR9A 2W61A 4HOZA 1F4HA 4S3JA 3VD7A 1SMDA 1UA7A 4AEFA 2ZX8A 2X2YA 4OZOA 3CZSA 4HMEA 1A3HA 2DSZA 2VNCA 4J3WA 5E1QA 2CITA 3HG2A 2ZX6A 1XSJA 1DWGM 1JYVA 2XN1A 2YOCA 1R87A 2V3GA 5A2BA 4H7VA 3BUBA 4WSJA 2VZOA 4R27A 3VIJA 1EGZA 3SCUA 2VQUA 2UY3A 4PCTA 3ARVA 4TTUA 1GVYA 1ODZA 2FHBA 4K68A 3VNYA 1E6PA 3DECA 1TA3A 3S6TA 1GVIA 3W29A 1CXFA 1JAKA 2DIEA 4OBRA 2VRKA 1CLXA 1U33A 1HX0A 1QI0A 2XM1A 1JDCA 3FNDA 3BLPX 3SEPA 1FHDA 3EDFA 1J0IA 3MO4A 1BHGA 5FD0A 4FLRA 4H2CA 1UQZA 1E3ZA 1ZBVA 2J7FA 1OT1A 1VFOA 1CEOA 4UOQA 4UCFA 5DFAA 3VM7A 2PF0A 4GI6A 3IAPA 4E2OA 5FKYA 3CUHA 1FH8A 3ZSSA 3W24A 4AMCA 2ZUNA 2G3NA 1W9DM 4CD4A 4A3HA 2WVSA 1QOXA 3WELA 1VEPA 1JXKA 1V6UA 3ARPA 4XZBA 3OGSA 2WMHA 4D72A 2JIWA 4D1JA 2WVTA 3AOFA 1CDGA 2JF6A 2QF8A 4AYGA 5DEZA 2V5DA 6TAAA 3AZRA 1CYGA 1NWTA 1G5AA 3AIRA 4JKKA 2X0YA 1V3MA 3SCNA 4B15A 1H41A 1JAEA 1R47A 4OOUA 3BLKA 3CHEA 4GPNA 4QCFA 2DSUA 1TQTA 4GINA 2ZXDA 3VPLA 1JD7A 3K1DA 2ZWZA 4GZJA 2XVGA 1OWQA 1R7OA 3NIYA 4E8DA 4YN5A 3FXYA 4DWSB 1OINA 4QDMA 1D7FA 3CZEA 1E5JA 3NSNA 5CPTA 3PBGA 5ECUA 4CCEA 4CUCA 2WW5A 1EHAA 4Z2KA 3VO0A 3KE0A 4HA1A 2WK2A 4MTVA 3AS1A 3AIBA 1UD2A 4W85A 1R75A 3WENA 4ML4A 3DX1A 1GQIA 2XVPA 1KGXA 2ZUVA 3BCFA 3BAIA 1GORA 1WDQA 4HP5A 1FHLA 5F7UA 3IGUA 1ISVA 1E0VA 1E40A 1EHNA 3RJYA 5CXPA 1VFFA 5CG0A 3AMLA 4BQ3A 4TVDA 4DUXA 2XIIA 1BSIA 2FGZA 1MW0A 2W63A 1J0JA 2VC9A 3RIKA 4C7FA 1E0XA 3AXXA 3ARTA 4J3VA 4WF7A 1QW8A 2ZXQA 2X1IA 2ZUTA 3T0AA 1TQSA 4MNMA 3VDHA 2DPEA 5CJ5A 4PEEA 3WNLA 3BVTA 2F7PA 2EJ1A 4QAWA 4LYQA 2O9OA 5BWFA 3EDKA 4D71A 2EABA 3ZJ8A 1OGBA 1MQRA 4GO9A 3A22A 4LX4A 2YA2A 3W26A 3OIHA 4PSRA 3W28A 3HG5A 1B30A 1LL4A 4LQ1A 4PRWA 3MANA 4D6FA 4PMVA 3AROA 3AHXA 1JI2A 1QNPA 1R86A 3AHVA 1QNOA 2PBGA 1UD5A 3BLBA 3WIJA 2BS9A
chains in the Genus database with same CATH superfamily
4QHKI 3Q5OA 3CDZB 5F6HI 1FP9A 2WD0A 3M0KA 5I76A 3IF1A 4UTCA 5GVJA 5I73C 3Q2LA 1LG1A 4Q32A 1BVKA 5T1KD 3S2LA 2AQRA 4NENA 1JNNH 2GGJA 2HJFB 2VT0A 4GK8A 5HULA 4I18A 3W7OA 4PAZA 1UM5L 1B0GB 1JWMA 1UKTA 3S88L 2XWXA 4K5MA 4MXQC 1ZHAA 1LO0L 2QHLA 1A6ZA 5I1LB 1JUKA 2ZT9C 5EFIA 2NY0C 5GQBA 2RIKA 5BJTB 3APGA 5KZDA 5CSGA 3OGOE 1I8LA 4PRHE 2Z26A 3QTPA 4LUTB 2AQQA 3EO9L 1LD9A 2TPSA 4GRLC 4EN2A 4M7JL 2E4TA 3IJEB 2PPEA 2KQNA 5GS0L 2P76A 4OR1A 4DGIL 3L67A 1R9FA 5H8MA 1J5DA 4HJUA 2XIJA 4PJ7B 4F7PA 5HUOA 4C90A 1KM3A 2XISA 1JBJA 1A7QL 4LCIH 3FQUB 3IJ6A 1EB3A 1ZTVA 1UXSA 1S9XB 4H6KA 2AK1L 3WQGA 5IV2B 5E8OA 1M7IA 3GIZH 3D87B 3NP4A 2GJ6B 1PZ5B 2HT4C 5H6HA 4LAQH 3GPEA 3UTSA 1I1AC 5DT1L 2ZCHH 4M7KL 4Y1TA 4ZOEA 5DURD 3NZHL 1P5BA 3R4IA 4NJGA 2ESVB 3F5KA 3VWKB 3BKML 4IRSA 2VC7A 3H9YA 1EZWA 4ZODA 5TE4H 4J3XA 4XTRD 1J6OA 1NJ9A 1HXMB 2B77A 5SWUA 4IDLA 5CO1A 2APFA 3EYUH 5IDZA 3MUJA 3DPBA 7A3HA 2P5EA 1KFLA 3X3FH 3NJXA 1BIIB 1FNAA 3TA3C 3AU1A 4MDJB 4KIEA 3EOBA 1RUKL 3RX4A 3LEPA 1DQQA 3HPLA 3DHPA 5D1XB 2F1BA 4NSKB 4A8LA 3HCVA 1H11A 2ZA2A 3ERXA 2EEAA 4U3HA 2GITB 3WK3A 2V2XA 4I13B 4JZJA 3MRKB 3WIHH 3VFMB 3RMJA 4HLJA 1XG3A 1FZJB 1X5IA 3TV3L 3T4CA 2D03H 3DG7A 5JW3L 5E8DL 1NWOA 2HMCA 1SF3A 1WAAA 2A4ZA 4OCXL 2NNFA 3OZ9H 1OSPL 4MJ2A 4C7GA 1LWRA 3SO5A 2IDFA 2WQVA 3GDMA 3SO3B 3VE0A 3VKAA 5EB8A 3W2JA 2NV2A 2G3JA 3D30A 3GJEB 4BWLC 4OZHE 2F7OA 3U2SB 3PUOA 3H2CA 1ASOA 2IQAB 1N0XH 3DGBA 4KQ3L 3T4AA 5CWSB 4FFWD 2IOIA 4Y0GA 2BOFX 5A8GA 3FT4A 3KPSE 3OVQA 5F7EL 9XIMA 2DICA 4GVGA 2W9EL 3GJFB 1FC2D 4CC4C 4RISH 3HB3B 4EUPH 1IM9B 3Q8EA 1YE4A 4UFLA 4MCNA 5T5NF 4ML9A 4DVRH 3SGUA 1BD2B 2CXKA 4Q4MA 2DM4A 4AY1A 1HQRA 1PEWA 4HPHA 4JR9H 1IM3A 2V2HA 3UMTA 3MYJA 2J20A 4Z76B 4M80A 2J88H 4IBUA 4ZE4A 2QCEA 2NV1A 2HN7A 3DJ9A 1A4CA 1I85A 4JDTL 1QSZA 3HUJF 1U1HA 4TNWF 2CHZA 3DURB 3K6NA 4N85A 1GVRA 5ECGA 2IO5A 4N4YB 4P4KA 1RUQH 1B5TA 5DMLA 3RNKA 3N85H 1RMFH 3A5VA 1NFBA 2RD0A 4L8BB 1BPVA 4RIRB 1JPHA 4RFOL 4GUIA 4G8GD 3CFBB 3SDYL 2VXQH 4NQVB 3BN3B 5F72S 4LSDA 5KSUA 3SDCB 3ZDYE 4YWGL 1X5HA 4OJDH 5M03A 3W53A 2X05A 3K8MA 1XAKA 5FS5A 3SIKA 4KI5D 3BGFC 3OA3A 4O1EA 1VZWA 1KGYE 5I1HH 4YVXA 4PHZA 1HCVA 4O9HL 1OTUD 4MJIB 4WI3A 5IROC 3GSRA 2XIBA 5JYMA 4XBJA 2NVDA 2C19A 1L0XA 5AYQA 4EJ1C 4EKJA 1Q0XL 3AUOA 3DRQA 2ZNXA 5KSVB 4HW6A 2VOMA 3W01A 3ARDD 1UKOA 1BF2A 1JHKL 3IS0X 3QZEA 4G2AA 4FA7B 3FO0L 5E4IA 2IPTH 4F3FB 3T78A 1OIMA 1DL7H 4FE9A 3LD8C 3FUKA 1I1FB 2VL5A 2XYLA 4KRZA 2XXGA 5DC9B 1YEHL 5I2IA 2G5WA 3UBFA 1WBXB 2CHRA 3SQOH 4XMLH 1BFVL 2P80A 3RVUC 3EJQA 1KYOK 1W9UA 4NT6A 2BOCB 3MLSH 4TQPA 4PJ5E 4TXEA 2M8XA 1S9KC 3VFRB 4NO5B 5IK3A 3MRIA 5L9DH 1AW2A 4BFKA 2K8QA 3PPHA 3GHPA 2VDKB 2XZZA 1YG9A 5BVJA 4AGMA 3CUZA 3T08A 4FQXB 4OLYL 1B31A 3TJIA 3DX0A 3WV0A 2DKUA 4P99A 2ID5A 1W1VA 1ZPLA 1OD8A 3M4HA 1EHXA 1UC4A 3QHMA 3RM4A 4RRPG 3CX5K 1FWAC 3GZKA 2FO4B 4IJRA 4KXZH 2WYHA 3QHZL 5GRWA 4AQ1C 2NQHA 4OM0L 1CFVH 2FJUB 1GC1C 4I5BA 3PY2A 1XDTT 1L6WA 1OGAE 4ACTA 1YQVH 3MJ8A 3RITA 3Q8FA 5D7IB 5AHEA 1HXJA 1HH6A 5B1JC 4KT2A 2REQA 1JIBA 3B5TA 3O3AB 1P7QB 4QHNB 2V9TA 2ZX9A 5JIPA 3KJ6L 3SGEH 3AREC 3UYPA 1RALA 3W38A 5DT7A 3NZQA 3QWQB 3NOEA 2YEQA 4APQC 3QRLA 5IKCA 1UR0A 1FNHA 4E5XG 1J8VA 4Z7WE 4OF3A 1J9QA 1PLGL 2EXOA 1IKFH 2ZP8A 4R0LC 5I09A 2DM2A 4MJZA 5CUSL 3COTA 3NT0A 4R34A 1M05A 3Q2VA 4MOZA 2B4CC 1F3JA 5J12C 3M7FB 4Z7QF 5D03A 1NOUA 1EOMA 2AP2A 3DHJA 1DV7A 1INDH 3EGXA 3IAQA 1WWAX 2A77H 4XZLX 3T0CA 2V33A 3DLQR 3IRDA 4JO1L 5EU3A 1PUDA 3VFUB 5IW6A 2Z0BA 4B95C 2AQVA 3WMBA 5IB4A 5EL1A 3UR5A 1RZGB 2WKOF 5KS9A 4HWZB 1KCKA 4NC1E 3UWUA 1UWXH 2PUQT 5C2BL 3VFWA 4ZD3L 3IDGA 4OT1L 4HK5A 2YD4A 1IZCA 4RMTA 1NGYA 1IEIA 3DC0A 3R2GA 1P4UA 2BPBA 2XTJC 3DVIA 5I7GA 1F3WA 2ZYFA 3ATDA 5FYJE 4QLJA 1QUNA 1EL3A 2V2DA 1R6VA 3BAXA 1KLGA 2YFOA 4HK0A 1E6JL 1KXTA 2DKSA 4JYDA 2DFAA 3QUZC 4ODHL 3F5WA 3S1UA 1EH9A 4KKCD 2XKSA 4K71B 4Z95H 3C08L 1FOBA 3A5FA 5E5MB 1LO5B 2EACA 4ZO7A 4NN6C 3ZM8A 2EKJA 4HJGB 5B8CB 4RLIA 5F1SA 3WEOA 4KXBA 4QYOB 3CQQA 3K4WA 4P59H 3ZIMA 1IGTB 1A5AA 4NYUA 4LVHC 3IV3A 1O5XA 1B9KA 3MVIA 1W37A 5DHVB 5M17A 2R94A 1P0NA 3D0AA 3M0JA 3VCRA 8FABA 3CT2A 2DGAA 4CVZB 1MFDL 2HRPL 3F6JA 3V0IA 3UYRL 1MMFA 2YZRA 3SECA 1OIFA 4H0HB 3NQVA 3HLAB 3RL1A 3S4SA 5FAAA 2Z2BA 4MXQD 4S1SL 2B15A 5D71L 1BYPA 1U92B 4K23L 2X42A 5F7DA 3ZE1F 2P5EE 1UEYA 1R38A 3PJUA 3NO5A 2BJMH 2NY0D 1DSWA 4WNQA 3O3UN 5TF1H 2CO3A 4HSAC 3H9SB 1NPNA 4NOFA 4P2OD 4Q8OA 1XDMA 3ZWTA 3GS0A 3R25A 1U5JA 3GKFA 2EIZA 5HYSG 2X1PA 3H21A 4BSWB 2UYLA 2X6BA 3CCHA 3OR6B 3PS6A 5DSCA 4M0XA 3AIWA 1A9EB 3FBKA 2RB8A 3S5ZA 2R14A 1BYDA 3EJZC 5JHDD 3WE6A 1W72B 3JV6B 3F7LA 2H3DA 2AK4A 4ZZ9A 3GH5A 3F58H 1CS6A 1Q90A 4Y9OA 1TIUA 4GFTB 1WO2A 5I75C 4YSCA 1H09A 3BCJA 3D0VB 4MJHA 1U8NB 4PJ7F 5C3LD 3NSCA 1EZ2A 2R69H 4J9JA 2HKAA 3H4GA 3MI3A 1G7LA 2FLMA 1ME8A 3MV8D 4HGWB 4BSVA 5F9JA 3O2LA 1ZSDA 4DQOH 3VI3B 3QEQD 2P42B 2C9QA 3E0FA 5J1SC 2QJNA 2AJYL 3U30B 3DXAD 1P5UA 1B0RB 1OAUL 1JWUA 4XPBH 3QUXC 5C9ZA 4DWSD 3BXWA 3C2AL 5F7NC 3QOKA 4CD5A 4CBZA 1R30A 3TSDA 3NTCH 2W92A 3MCLL 5FGBA 4NZ3A 3PZQA 3G6AA 3ZHLA 3V7PA 2CBJA 5IHSA 3VFVB 2J43A 3C12A 2YQ2A 4JDVA 5JPNC 2GZXA 3HR5A 4ISVB 5KBPA 3BZDA 2RAGA 1Y8BA 3AISA 3AALA 3QZAA 2YIHA 2MTAA 4PMZA 5I5JA 3WFHB 3NESA 4FIRA 1KTDB 4DSYA 1ND0A 4DI9A 3WEAA 4QX4A 4S3DA 4BKNA 3TWCL 4W9TA 3B05A 1R5IB 3H8NA 5TAOA 3BO9A 1N59B 4GRMB 5DRCA 5L6YL 4PJEE 1PZCA 4K94H 3X1NA 4WI2A 2EIBA 4ODWB 3W6LA 2NUXA 1LO3H 4FFZL 1VGKB 3BLIA 1ACYH 4AD5A 3RILA 3MUZ1 4UANA 5ENLA 4H8WC 2C4FT 2Y6SD 2OJ1A 3GVGA 2PGWA 2EG6A 3RDTC 2DIBA 2ADYA 4LLUA 3CFEA 3T4YA 4M6AA 1U8HA 4UZSA 3IDYB 5EU4A 3HURA 4JLRA 4P9HL 4H26A 4QDPA 1Q0YH 4R6UA 5JIIA 3MJGX 2WUCL 3WE1A 2MPVA 5AVTB 3NPSB 5I16B 4LSPH 1MELA 4M1CC 4EE2A 1KXQA 2YAQA 5GS2H 3DSNA 1TVLA 1U42A 3I6LE 3JWDH 5DYFA 1QMLA 3QLLA 4TUOA 4XVDA 2GIXA 2F8QA 3POHA 1E9QA 1GJWA 3SKJH 5I71B 4XPHH 3X1FA 1JDEA 5DT5A 5D7LB 3WU1A 3LH9A 3CQHA 2WMGA 1TJMA 3NZPA 2JBMA 4G6JL 3HN8A 4P5TA 1OCCB 4EDXB 4KVCL 3WIFA 1DJNA 3FL7A 2JB5L 1UWRA 4ANUA 4N2AA 2MJWA 1XISA 4Z1CA 2Q3OA 5D2NE 2NY5C 4WQOA 3T6CA 3IE9A 2BNUA 1O9WA 1SYSB 4DELA 5HD8C 3L5WA 4N22A 3V5CA 4A21A 1JGEB 2EVGA 4K3HA 1FFOB 3ZTCC 4LASH 1BGXL 5EIIB 2OLAA 3O6MH 5FK9B 3VRJA 3AHZA 3BQ5A 1I82A 5H37G 4OD2A 1LLOA 2XG9A 1JWSB 4A37A 5ISZB 1E3FA 3GVRA 3UC0H 1DORA 2GI0A 1LDPL 3A6BH 2J7EA 7PTDA 3LEYL 5TTRA 2B1OA 3TBWB 4OCWH 1A5KC 4MYAA 1KLFB 1S2EA 1VPOL 3MGTB 3F5LA 4LB4A 1H19A 3J2PA 4TOYL 2X4TA 2YL5A 4NP4L 3TE9A 3SR7A 4QGTA 3WXVH 3DO4A 5BO1L 3P0YH 4X99A 1H5YA 1UZ6F 1NMCC 3CVBA 4IIQA 5AEAA 1DVYA 3D3VB 3V6OA 2BOLA 3DGDA 4GG6B 4JFDD 4P48A 3VFGL 2CLKA 1C08A 1UKQA 2EPOA 1IGJA 5JXAL 1CI5A 3NQDA 3F00A 2ZXWB 4ONHB 1AC0A 1GTHA 2CWNA 5FWRA 4XN4A 4PUEA 1S7WB 4XMWA 4Y4HD 3ZX1A 3T65B 1LM1A 1YDPB 1Q8AA 5DZPA 3KFTA 5HPCA 1E0UA 1UM5H 3G6JB 2OW7A 2D3VA 3SBPA 3S88H 5I6KA 1XF0A 1K70A 4FEZA 4L8SC 1LO0H 2QADB 5GJNA 5AVXB 5ENWB 1M7OA 4WWKD 4HV8B 2OXHB 1V7ML 5A95A 3UJRA 4PBXA 1TJIL 4Y96A 3D85A 3KL5A 2PURA 4IGBB 2VFEA 5T3XE 3EO9H 3BO8B 2EYRA 5AYUL 3DFSA 2XU9A 4O19A 1B54A 1B3YA 1BFTA 4GW1B 4M7JH 1IEVA 1OC7A 3P81A 1XGQA 5GS0H 2FT7A 4UNIA 3IB4A 4DGIH 3FQRB 3ULUL 2H90A 4ZUVA 5KSBE 3N2TA 1RBOB 3VD7A 1ONEA 1A7QH 4AEFA 2GFBA 1WFTA 2HLFD 4UMCA 2AK1H 2GSGB 4J3WA 1JYVA 5PAZA 3HPJA 4BUGA 3V8OA 5IJCC 1JRHL 2VZOA 3L7EB 3W39B 3GMPA 4KRPC 5DT1H 4QF1B 4M7KH 2DQUL 3S6TA 3GYEA 1I0BA 3LCYA 3BPCB 3NZHH 2VRKA 2QR6A 4FD0A 4LCQA 5HY9B 3QE5A 2X40A 3QUZD 2Y2YA 3BKMH 2DVXA 3MO4A 4H9XA 4LUIA 4YUEL 4XWUA 1OARL 3CN2A 1UQZA 3NJFA 1OE1A 5CFHA 5HJLA 5HPMB 4H25A 4Q7DA 2CR6A 4HKJB 2Z64C 4YO0A 4E2OA 1BZ8A 4F7TB 4WOZA 2V6HA 4F57L 3ARPA 4MKVA 4KPHL 1PY0A 5JW4N 3F4WA 1T6VN 2JF6A 4AYGA 3G5ZB 5DEZA 2V5DA 3C2RA 3AIRA 4G9FE 3SCNA 3F6IA 3BLKA 3QFJE 2NRDA 2DSUA 1PWMA 1RUKH 2AXFB 1KYOJ 4GZJA 4E5TA 1ZLUK 1WQVT 3KWSA 1QOKA 3RTLA 5EU7C 5JU6A 5ABAA 3APNA 1ITQA 4JW3A 3F2CA 2W5PA 3TV3H 5D1QA 3C09C 1DN0B 4YSAA 4OZ4B 5JW3H 2DZAA 5E8DH 1Y6MR 3CX5J 1WG3A 3QUKB 4HNOA 4H7CA 1CYXA 1OSPH 3DGGB 4X5XA 1VS1A 2HXTA 3FONB 4WTZA 4M7LL 4F91B 5J11B 2W63A 1HNFA 5D2LB 4X22A 1E5YA 4C7FA 2I1OA 1P4LA 4MNMA 2DPEA 4A6YB 3URAA 4KQ3H 1OSYA 3NPXA 4LYQA 5TH2A 1MFEH 5E8NB 4GOSA 2ZOUA 1AO7D 2W9EH 3TIEB 3GHEL 4RNJA 5C0JA 4GBXC 3MHZA 4PMVA 3AROA 1MCWW 3PQYA 1R86A 5I17A 1CB7B 5D5MF 5C6WH 2X6CA 2JALA 4CDHA 3RIFF 4LYRA 3MY9A 3EFDL 5TGBA 4NQDA 1MG2C 3VXSE 2WCAA 5ITFB 1IC4L 3PWJA 1U8KA 1REQB 3NJGA 3QHOA 1C29A 2OMBA 1QX1A 3VYLA 5L8KB 3LVTA 4WI4A 3MRQA 3L3HB 3CG8A 2FYYA 3VXOB 3NJKA 3VWJC 3BVNA 4PJFE 4YSDA 3IRPX 1RA5A 4JDTH 1WFMA 3PJNA 4IRZA 2H8ZA 5JDSA 3U2IA 2BSRA 4Z7NE 3K2UL 3WF2A 3LOWA 3QUMA 3SCVA 3ML8A 4JUTA 4RFOH 3BWZA 1J8HE 4CU6A 4GRWF 3SDYH 5AHIA 3DRTB 1RJYB 3DUUA 4YWGH 2XZ9A 4U1MB 3KJ4C 4ICWA 5IJVA 2BOGX 3N2BA 4B97A 4JZ5A 4UU9A 4O9HH 1YPZB 3H0TB 2PKDA 2Y63A 3GBDA 4PRAB 3IRZA 5C9KA 1FN4A 3BDXA 1Z89A 2CCRA 3W7RA 3JWNC 1Q0XH 4JRYA 1DWJM 3LV5A 5BPPA 3F62A 4YLQT 2AJ3A 5F7LB 4BI7A 4N2MA 5CD3B 4XAZA 4JVWA 4MD0A 2ADIB 1JHKH 4S1RL 3VI3F 3M41A 2UY7A 4NC2B 4QNEA 3H3BC 3FO0H 4LL9A 3ZL1A 2N4IA 2VE6A 4WTWA 1RCQA 2BX7A 4YHKL 1HNYA 1E55A 2IUZA 4P61A 4NNXA 3B9VA 5CBJA 4M48L 5DVPA 1BWVA 3TEXA 1YEHH 1KPRB 5CZXC 2V9RA 4U6HB 5FA5A 3R06B 3KHDA 4NZUL 1BFVH 5T1MB 3T0BA 2EDBA 3L3OC 1YEKL 4BKTC 4HKZA 2W88A 4W86A 2FJFA 3LKSA 1DVZA 1HKFA 3DUSB 3NZSA 3WO4C 3AUJA 4OLYH 1KLUB 5KZMA 1DXEA 2W9DL 3I7SA 1V08A 3WL9A 2F53E 2CERA 4N9CA 4UT6L 1T7YA 3B2PA 3BANA 3AU6A 4RGNC 2YPVA 2W0PA 3MA7A 1UUNA 3VDAA 5KYUB 1H6TA 3QHZH 2EXWD 2BP8A 2HTKD 1LUCB 1BYOA 4OM0H 4LY4A 1QLFA 5AB3A 1N3NA 2B59A 2DPKA 4F33A 2DBLL 1QVBA 1QUMA 5CKAA 3AS0A 4GJ1A 3JS3A 4XUGA 2XFWA 4Y16C 5LA1A 5GGQL 2N7SA 5FSDC 4W89A 1R5WB 4EBQL 2G97A 3RPMA 2ZZ3A 2ZUYA 3A4JA 3BK0A 2FSEB 4CN6A 1EA9C 3GLCA 4Y9BA 1PLGH 2XV3A 4HU4A 4HKXB 3V6OE 3C0SA 3EHBC 2FTPA 3GBEA 5IWLC 1KTBA 4ZS6C 3TTSA 5CUSH 4DKEL 3PAZA 2QJHA 4MZ1A 4F2UA 3S37X 3CHDA 4HKBB 4K3EL 4KMTL 1Z41A 3W9DB 1OFOA 1KJ2A 5LGYA 4YDMA 3MHUA 1D5XB 4W9LC 1SXZA 1FWTA 3UX9B 4JO1H 5AC8A 1OPGL 4DPCX 4U1KA 3DFQA 5KJ4A 2IKGA 5ADPL 2WBJC 1WP6A 5HVFB 3S37L 3CU7A 2A3LA 4HJ0D 3O0RL 1UXMA 2R1WA 5IG7B 1IWAA 5C2BH 4JX0A 1TTBA 2BWQA 4ZD3H 1HCZA 2F18A 4OT1H 2ED7A 3GMNB 2ZADA 2R0ZL 4HU2A 2HJLA 1MVYA 3W02A 1WFJA 5DUBB 1NCDL 4DXXA 2X4NB 1ASPA 1E6JH 2VC5A 3N44B 2I9TA 2Q2LA 4OUOA 2YDAA 5J5RA 4GY7A 4KF1A 1ROCA 3C08H 5FDWA 1MEXL 3SCWA 5L2JB 2Q5BA 3T77B 4TL4A 3N3EA 2ICEA 4JCWA 2QNEA 3C5SA 2O5NA 4IFKA 2W65B 4C65A 4PJHE 4OM1L 3PWLB 2FPTA 2KZBA 1EERB 4LVBA 4LVDA 3N5AA 3CHQA 3PFRA 2YC1A 1B3JA 4DUWA 1L6SA 2C3ZA 3OA5A 5CLTA 4PJAF 3ES7A 3WLKX 1ISXA 1HI6A 3I9GL 1FWCC 5LXXA 4XCCL 5EZPA 2R23B 3TYFA 1TYJA 3VACA 1MFDH 2HRPH 3UYRH 4PN6A 3UJIL 3TA6A 1WA0X 5F3HB 4NM8L 1P1MA 2IAMA 3NCBB 5MKGA 2A9AA 4MDPA 4S1SH 2BVPA 3GMOA 5D71H 1KBJA 5I1EH 2ILLA 3GPSA 4K23H 2H6PB 2GVEA 3KLQA 1I4FB 1U95A 4F58L 1B3XA 3NL5A 4XD3A 2XJKA 2V81A 5D37A 4A22A 4XO4A 1S2VA 1YX1A 2NQDA 1G7QA 3QEUB 3V0SA 2F15A 3MV7A 1XDLA 1D5ZA 4QRRB 4HALA 2JXMA 5J6GA 1JVKA 5BNXD 2H2SD 2DS4A 5FAJA 1N8ZA 5E4OA 4ZMPA 4XGZA 1DTNA 3DX9B 1JPSL 5HHOE 4NUQA 1R3LB 3KS0H 4R96A 2Q02A 3MXWL 5D1QE 2AJVL 1QWGA 1W1ZA 3B5GA 2XN9D 1OX5A 1NC4B 4L37A 3KLDA 3IN2A 2ITFA 1LLZA 1WAWA 3JVAA 1EEYB 1KZYA 5F7FA 5EOTB 3MRDB 3LHVA 2OSLA 2J8UB 1ET8A 4HG4K 4X7DC 2DQFA 3CQKA 3SGJA 3SYOA 2G95A 3OWRA 3A3WA 4EXQA 1XG4A 3IS4A 2VFHA 3GSUB 4F9DA 1OWWA 4JN2A 2AJXL 3XINA 3QJAA 3CWNA 4PTNA 4PIBA 4JS3A 3ARGD 1N4XH 3K7UA 4Y2DA 1DFXA 4X5LA 1CDBA 1ZL1A 3HZMA 2Q01A 3N1GC 1F45A 4X2PA 4WWOA 5HQEA 4X7CC 3AICA 5ICXB 3U9UB 4HUMB 5LAXA 5TPWL 2VC2B 2AJYH 3E9TA 3DOPA 1OAUH 2JV6A 1D7CA 2X4RB 1QK0A 5IHWA 1DWAM 1EPXA 3C60C 1ZPTA 2QCHA 1SO5A 2IANA 3BKYL 3C2AH 5IMOA 7PAZA 1G67A 4JXCA 4EUPB 4PRPD 1KJVA 2C0AA 4P46A 3EDEA 1CK0L 1CLKA 4O13A 3HPZA 4ES4A 3MCLH 2H9AA 4B16A 1B3IA 1EX0A 3N34A 1S2AA 1XL6A 2GDQA 4NBZB 4P23A 3MTWA 1TJXA 3L5XL 3IJ9A 5HBBA 4IX2A 1BXNA 4DUVA 3X2QB 4ENZA 2DWTA 2GG1A 4DPAX 1IGYB 3IIZA 2FX9L 1MI5B 1TUPA 2D73A 3PRZA 4MCZB 5AW5B 5AC6A 2GSIA 1UXLA 5AC7A 5AZ1A 5JO5B 3WKNA 3TWCH 1Y0LA 4XNZC 4JRYE 5FYKE 5IQ9B 1NQ6A 3WLPA 5KUKA 5L6YH 1DVFC 3ZBMA 2VRJA 4OU3A 2VD8A 3OHXB 5SX4H 3LIZL 2Q20A 1SFHA 4PJGA 2WY3B 3SDXB 3IUIA 4TTDC 2ZOOA 4WY0F 1MRCL 2IH8A 4C55A 2E7FA 3I6TA 5CP7A 3GEFA 4IKJA 3OVUB 2BNRA 3A21A 1HCYA 5D2LF 2CZVA 3DU0A 3NQ7A 5FW8A 1Q63A 3HVDA 4CCDA 4HUWB 3MO1A 3OG2A 2J5WA 3BSMA 4ZQKA 4N0CD 3F65A 2XXCB 3VXGA 2YN3A 4P9HH 4R53A 5LIUX 2BLFA 1KFAL 4GD0A 2WUCH 4GQ0A 1H1NA 1HN1A 4WZHA 3QR1A 3M5YA 5LNEA 5FV1L 2A7PA 2IOOA 3TESA 2OWXA 5M3WA 2I9LA 2CA3A 4WX2A 2FLBT 1IC0A 2CJ3A 4ELMB 2PSNA 1YXCA 2YX0A 3WLNA 4Z3FA 5BS0E 2NZIA 4NNBA 4G70B 4B5WA 1NCWL 3N42B 3BT2L 3GRWL 5TDPB 4P57B 4MAYC 2VUYA 4N2GA 4I7VA 5EFDA 3ZIZA 4G6JH 1H0IA 3LEXB 1W2VA 3B2UC 1EFXA 1TLKA 3MKGA 1GYVA 4KVCH 1R3RA 3DFTA 3QIUA 3QPZA 2JB5H 3MAWA 1VGEL 3S46A 1CFQA 4PJDE 2AVGA 2ZC1A 3WMLA 4QNPF 3W1QA 3NJNA 3G5EA 1NLDL 3A67L 5AL8A 1B3ZA 1NWRA 3BUPA 1WFUA 4NWTL 3OJVC 1KWKA 4W5ZA 3Q8BA 1Q9LA 5DLML 4L23A 3RHWK 4J4PC 3AHYA 5HGAB 2QLVB 1BGXH 1NINA 2GJLA 4I3GA 4P3WA 4W87A 4ODVL 4NUWA 3VXMA 3ZMNA 1N19A 1PKQA 4RAUB 4ZPVA 3UAEA 5L2KB 2H47C 3QSTA 4ZFGL 3LN5B 4JZOA 4LPYA 1LDPH 3MMEA 3HKFA 1A3RL 1G43A 5DMGC 3LEYH 1UMLA 1FNFA 3G08B 3D0LA 4YNGA 5IJKA 1VPOH 4TOYH 4NP4H 3HFTA 1WBJA 1NF7A 5BO1H 3MCYA 3KUMA 3W82A 3HHMA 1GGOA 4K9EC 4NLAA 3GXIA 4IICA 3UP6A 3DK2A 4L5ZA 4CL7A 1UBSA 3PFMA 3VFGH 5CIPA 3R8QA 3SUTA 4ICMA 4BKLA 2J73A 5DDHA 1NP2A 5FA4B 3IK4A 5JXAH 1E8ZA 2ADJB 1GGBL 3DV4A 3ECWA 4US6A 5HGBB 3FCUB 2HRLA 2QVMA 3D09A 4KMQA 1S8DB 3TH3T 4K2UL 2Q8LA 3MZTA 1IE5A 3L4XA 3NDOA 4C57C 1EDYA 1P0KA 1L4IA 1HSAB 1LOLA 2H0FA 3P2VA 2DIKA 3EHBD 3PNUA 1V7MH 2UWFA 1TJIH 4AQEA 3WMSA 1U8IB 2DQJL 1LHZA 1T2QL 4KKQA 3WUWG 3WKQA 3TAOA 4M8RA 1XVSA 4MDIA 3WD5L 1W80A 5J0BA 4X7TB 3R18A 4PJBB 4PUDA 3ULUH 4OFPA 3UPCA 2NXYD 3QF0A 4AIEA 4DN4L 4LB8A 2EYTB 1CB2A 4DW2L 2O9TA 5DXXA 1E6RA 2OQHA 3HN3A 4GW5B 2FAUA 5MP6L 4B92A 4PWGA 1CB4A 4QSHA 1JRHH 3MNVB 2Y7GA 1RHFA 3L3KA 2BRRL 5D9MA 3ZL4L 2DQUH 3BMWA 2EE6A 4YWSA 4UQCA 2E4FA 2WHKA 2Y0FA 3BW9B 3QA3B 3NOYA 5T1DL 3IRSA 1FFPB 3DBPA 4QY8A 1T1YA 4YUEH 5JXEA 1OARH 4FA3A 4C6OA 1KO0A 2JELL 3P11L 1R3VA 5KVGE 4KH2A 3TZFA 1FG2B 4F57H 3KHJA 3RB5A 4KPHH 3W74A 3H22A 2OFJA 1WCBB 4WVRA 1Q6EA 4Z3EA 1DDHA 1JCLA 4PCYA 4E0RA 5IQLA 3ULVD 1OL0A 4RFEB 4FFVD 1SZNA 5CSSA 3SSGA 1RQ5A 3B7TA 3FH5A 1SN0A 2OO6A 4U33A 4M3KB 2AXWA 3N44F 4ELKA 4XMUA 1NBCA 4A66A 1F3XA 4IQEA 4D8PB 3QRGL 2FE0A 1VKXA 4UIOA 5IB2B 1CI1A 4YPGA 2HBXA 5LGKA 4J8RB 5FOOA 2CLPA 4AZ6A 1X5GA 5I8KL 1G0CA 3VKBA 4PULA 1RZ8B 3DFPA 3LRHA 5TQLA 5FV2A 4M7LH 4JTQA 3SPIA 3O3RA 4BQ4A 1Z5HA 1TQBB 4M7SA 4JG5A 4NKIL 3REQB 3FS9A 5LN8A 2H45A 3OHMB 4WKXA 5E99L 2PC8A 2E9MA 2YSSB 1XKYA 3K1KC 5K4ZA 5D96C 2IANE 2ISSA 3GH4A 1RZFL 3GHEH 3BAJA 4UAOB 4OH2A 4O1AA 4P2QA 2D22A 1KM1A 1B6UA 2WWKO 2G9KA 1W5NA 2XFGB 2EE3A 3T2LA 3TTQA 3FO1B 3EFDH 5IREA 4CQDA 3L7FB 2DM7A 1IC4H 4BH8A 4ZVJA 1S2UA 4L3AA 1ZGDA 1VEMA 2EDQA 3V6BR 4YK4B 4CBPA 3SBRA 2EDTA 1DXIA 1R19A 1Z2KA 3AJXA 3TN5A 1VESA 2EAEA 5IDIA 4F7KA 4CA4A 5CKSA 1J8RA 3S3JA 1A5MC 1XZ0A 2Z91A 3K2UH 2AJUH 1S1RA 5C0FB 2F6KA 2ZONA 2EILB 1XSOA 4WZ9A 5E6SB 2DQMA 4WV1B 4IYKA 5F0JB 5CSZA 4PS3A 1AQ8A 3N4FA 3FT3A 2ISDA 2J8UF 5TDOA 4NJAL 4Q7BA 1J7VR 4GYPA 1P0BA 2BNRE 4MLRA 4BY3A 1RJPA 4B2DD 2WINB 3A23A 4KFMA 4ORZC 3ZGIA 4U1JB 5A8MA 1MVUB 2DSVA 4L4VD 3MBEA 3LDBB 1VFBB 3JUGA 1G9HA 2ACQA 2B39A 1O0VA 1T8QA 5IM51 3IDIA 3DO3A 4LJ3A 3PAUA 3W1RA 4HMEA 2AXGA 2QGYA 3V55A 3S5SA 1YHPA 5AOJA 2HNHA 5TQ2L 2AV7A 2V3GA 4YVNA 2WIIB 4LVOC 4PJIA 4QE1A 1USQA 2OBGA 1E27B 4BXVA 1Y0EA 4IMEA 4YHKH 4DFIA 1IHIA 2OMTB 1NCUA 1UR3M 4QLWA 4M48H 1VYPX 5FD0A 1GL4B 2WNNA 1Z9SB 4UTBA 4FLHA 3IEAA 2X53A 1DUYB 4XG1A 1PFCA 4NZUH 5FKYA 4V33A 4WIQA 1FH8A 3M0HA 4QXTB 2YPLB 3BXNB 5CN1A 1I3UA 3OHIA 1TYEB 4K55A 2WLLB 4FHBD 2C3VA 1YEKH 4XD6A 1CDGA 2WZMA 4OFCA 1QLEL 3DHMA 2EEFA 3STGA 4Y2OB 2PW2A 3MUHL 3LNFA 2Y89A 1CDHA 1GGYA 4QCFA 5DTFB 1U8QB 4PWEA 3GO1L 2W9DH 3RWEB 3WJMA 4M4RA 1BIHA 3WHXA 4UT6H 2G4EA 4UT7L 4F0KA 4XX1G 3CH0A 4B9KC 2K8MA 4Y9AA 1BJ1H 4J3ZA 4D9RD 3ILQC 4YEFA 3BZEB 1PKQE 2DBLH 3T44A 5EF0A 2ZDSA 1E5UI 4FG6C 4MQ7B 3CC5B 2H3NB 2YJLA 2P0OA 4GMEA 5GGQH 4GT7A 1UA6L 1ZXKA 1J0JA 4EBQH 4HG4J 1THCA 3O3DA 4WF7A 3E0LA 3V0GA 3ZGHA 5CJ5A 2EJ1A 2GJZB 3MZNA 2DWSA 1X9LA 1MQRA 3D05A 4DKEH 2FJSA 1XQ4A 2XKNA 1W5MA 1S7XA 5EMJA 3AQDA 4NQCA 3LQAL 3BP4A 1B30A 3LOTA 3NQCA 4K3EH 5F0PB 1RK1A 3VE9A 4KMTH 2Y7EA 4I3RL 3BLBA 2PD9A 3MVSA 5FX3A 4PRID 1H51A 1OPGH 2P5WB 3HFML 2AXHA 4I0PD 5ADPH 4OCYL 3ABRA 3S37H 3QFDA 4V11A 3VTMA 4AZ7A 4B5SA 4J3OF 1TSHA 3O0RH 3Q06A 3JWNG 5BXSA 3WK1A 3MO7A 3EKGA 2FPVA 3ARWA 1TCMA 3QQ3B 1QATA 2R0ZH 4E8GA 1ODUA 1GONA 1B90A 3WI9A 1VSCA 2GLKA 3HRPA 3T07A 2AW2A 2YAHA 5CAHA 5HDBE 1NCDH 3F01A 2J2ZA 3TX4A 2VXTL 5CZ0A 4I9JA 1ZA6A 1IEBB 3KRUA 5CPOA 4XBGB 4LUYA 4M3JA 4CILA 4AEOA 3E8UL 2ABBA 2D2JA 4XH2B 1JUBA 2APTA 3W1TA 2V0TA 4ANWA 1MEXH 2Q86A 5KITA 4K1WA 4PJ8B 5BZWA 1ZLSH 1JV5A 3NZ1A 4EIVA 1RPKA 1EDGA 5JPMB 4BQ2A 2D31B 2GJRA 3T0EC 3HE6C 3HI1A 3NVQA 1NBZB 2Z1BA 1OX4A 8RUCA 1QO3B 2VW7A 1GHFL 2Y7SA 4ZFZB 3I9GH 4IRJB 3VGGA 4J1OA 4XCCH 4H9VA 1V0LA 3FU7B 4J3TA 2NTSP 2EINB 1KUMA 5LXVA 1PYWA 1NBYA 3CZKA 1TPFA 3UJIH 1DFBL 3T42A 3DENA 3WNOA 5GGSB 4NFCA 3G22A 4M29A 4NM8H 3BP7B 1Q9WB 1OFDA 2LV4A 4GRSA 2BZDA 4HH8A 4V1XA 1S9VB 1A5NC 1HKJA 3L95B 4ERIA 4UTWA 3BAKA 4UB0L 4F58H 4M03A 1KYDA 5EUOA 2DYPD 2VISA 5I00A 4QHMB 3FDGA 2A3AA 4OIBA 2Q7AA 1EANA 4L4TD 2XDHA 2W5FA 1UXWA 3G5WA 4HPGA 1DEDA 3NJIA 1PSKL 2JEQA 2WQ8A 4AC7C 2NV9A 3PG2A 3UTSE 1JPSH 2XN0A 3D39D 1H3XA 3MXWH 1LOSA 2VC6A 2AJVH 4JVUA 2WXLA 4DIAA 1AE6H 4HEMA 3NCXA 1DO5A 2EG8A 3DDGA 5EEVA 1S7SA 3QH3A 1KFBA 3RTQB 1R7AA 4O53A 3NIGB 2H32A 5BXFB 1BQHB 3L4VA 1I0DA 3GBNL 3VNLA 4QP0A 5AAWC 1E67A 4WUUA 1WCGA 3CV1A 5D33A 3RUGB 2AJXH 3D69B 1UH2A 2D7MA 2VYOA 4HPYL 5EOCJ 5I15L 2GTZB 1ET7A 4ATTA 4NAJA 4FXSA 1AGFB 4LAUA 4OJFL 3L3GA 4WGWB 1KZQA 5I8EB 3VFSA 4F20A 4MA8L 4BJHA 1KRCC 3KR3L 4GRLD 3QZNA 4D6GA 4JM4L 4HHLA 4NO2B 4UDTA 3KPPB 4EOWL 1VBRA 5TPWH 1RL1A 1MUMA 1B1YA 2J8TA 4O02B 1NANH 1U4FA 3SE9L 5KVMC 4JAWA 1PSCA 2PRLA 2XQYK 4AIZA 1AHWB 4EXAA 3BKYH 1WAAE 4FTVD 3VCCA 3TS8A 2PMQA 2WKJA 5LKYA 3MYOA 5K33A 5BRZD 4QOKD 3UAJC 2HT4D 3VFTA 1NFPA 2F6AA 1I1AD 2ARJB 5GS1C 5D09A 2B3RA 1ZVNA 1VHNA 1AGDB 3L5XH 3ZLQC 1M7JA 1U8CA 3UY7A 1AJ7L 3HS0B 1HP5A 1OZMA 1GZPB 2FX9H 2X7LA 1DDTA 5DUJA 3S42A 3FK3A 3ZSTA 2DUZA 5AKRA 5C8JA 3S5LA 4DRSA 1TIWA 2OGYA 5GZNC 1L3WA 2EDEA 2YAFA 4ZAKC 2VZSA 5EIQA 5BQDA 3DXIA 1WVZA 3TA3D 3TSMA 2ZSVB 4PJIE 1UZ4A 3G77A 1MRCH 3WS3B 4NQSA 3PV7A 5EU9A 3PWIA 3PABB 4RCXA 4HJJL 1QI2A 3KGTA 4YIQA 3OWEA 1RXLA 5ANMB 1RZJL 2BMKB 1E1FA 1XF4B 1QHZA 3VD9A 3VD2A 4AVJA 4YMPA 3PZTA 4JICA 4KWWA 5HA7A 3KXFD 2Q3RA 3LSCA 1A50A 2ZCLL 3A9BA 2C79A 4WY7L 2EEXA 4WHTA 2XUCA 1KFAH 2IQ0A 3KOYA 4WHYH 3SE3A 2OLSA 4BK5A 2CNCA 2UV3A 1ETZA 1XGTB 2EEBA 2BVQA 4Y9CA 4GUJA 4H9MA 3IK2A 5DRIA 3SKMA 3D18A 2B7NA 4JQIL 3BT2H 3HB9A 1JTOA 2PF8A 5B3SB 4X6CB 2Y3AA 3P62A 4GVHA 2XHNA 3BPOC 2CUMA 3VMOA 5JQIB 2AKRA 2EPLX 1OABA 5MEOB 5FHAL 1UR4A 1QSFD 1CFSA 4D6DA 1VGEH 3TBSA 4MXVF 5E2VL 3FCTA 2YCEA 3ZDZE 3LKRB 4L6OA 2P8MB 1NLDH 3ID7A 3IJHB 4NWTH 5K9QI 1RPXA 1K8DA 1MZZA 2P49B 4ETQA 5HNNA 5DLMH 3K72A 4DX3A 2BM3A 1MCWM 1WDWA 4ADJA 3ATYA 2CGYA 5F70A 4K36A 4ODVH 3TH4T 1ZHBA 2MCAA 4MWAB 1L5GB 1G9NL 4ZFGH 5BQ7A 2B7OA 2WYSA 1A3RH 4K7VA 4XP4L 3NVTA 3GDBA 3NQMA 3WTXA 1RP8A 4NJKA 5IROD 5LNSA 3G3MA 4NXSA 4UFMA 2YEVB 1FZOB 4WEBH 1T1XB 2E8ZA 3A4AA 1XGDA 3G1VA 3O9WB 1IBGL 1FA2A 1AH1A 5DQDL 1NGZA 3DROB 1TCRA 3IWVA 4I85A 3WDPP 1XSIA 2O61A 4WSKA 4REQA 2PYFA 2PXYB 3O45B 3OLDA 2YXFA 1GGBH 4G8IA 1C5DA 1LRNA 1DXFA 1KW1A 1UM6L 1GOMA 1AZNA 1EXBA 1P84K 4GYJA 4K2UH 3V0AC 1CICA 2RDUA 3MRPB 2V38A 3EWXA 1JMXA 2E25A 4HNTA 4MDOA 5ALBL 2ODOA 4O2EA 3RVUD 1DE4A 5T3XL 1A0CA 5ELIA 3O3BA 5C9XA 3MDUA 4GLRI 2R2EA 43CAB 4N86A 5DX7A 1T2QH 3S34L 1E56A 5KS9E 1XIWB 1NQKA 4NS0A 4JDEA 4AD3A 2NUTB 3RLVA 4MMZB 3KWUA 1R9YA 1N8FA 5C0DB 2G2NA 2P24A 3AACA 4P07A 2MANA 1FHGA 4DN4H 1R3HB 3JW7A 4JTSA 5HMEA 4DW2H 4ORMA 4GUQA 2WSKA 3NCFB 5MP6H 4RDWA 4F37F 1YMMA 4DJEC 3MGAA 5EUOE 2DOCA 5TQ0L 1WZLA 3WEZA 3K8LA 3H23A 1ZFJA 4IIGA 1KCRL 2BRRH 3NIFE 5T5NG 4LRIA 1FY6A 3ZL4H 1WC7B 3ARED 4K8RL 2JKNA 2O0TA 5AHFA 4APQD 2G3MA 5T1DH 3UBGA 3HMCA 2ESCA 4X9HA 3LSBA 2FQIA 5HVGB 5CEWA 3RXZA 3CZJA 1ZBCA 1HKMA 2Z31C 2JELH 1A9BA 2KDGA 2FJHB 5M1TA 4HEME 4MUZA 1N5AB 1F6AB 5CCJA 2BSSA 1HZKA 4OUUA 2R24A 5D7IF 4CD6A 3QJVB 4GX9A 3KCLA 2XWJB 4WW2C 3FH8A 5C0CD 2ZKMX 2CHWA 1OO2A 1P9MC 1YVLA 5C2GA 4GO8A 1EWEA 5AOZA 2QCGA 3HE7C 4WUUE 2JIEA 3NFSL 4AAJA 3ZUNC 3U0TB 3QRGH 3W0WA 9RUBA 3GC2A 4L61A 2X9YA 3B37A 5DJAA 4OVVA 2RJMA 1TPB1 3FJ4A 1GTFA 1T8XA 2XTJD 2PGRA 5C86A 1KULA 4YDJA 1H15B 1FJ1B 5JIKA 1S7TB 5I8KH 4H1LH 3TBBA 1JK8A 2V7HA 3VOCA 1E1CB 1YBQA 1RSFA 3EYOA 4DEUA 1E2ZA 4GKZB 3U5YA 5LGJB 1QU4A 3E96A 3HBPA 1FVCB 2VJXA 3UTZB 3UPRA 5KBDA 4NKIH 1WITA 4GMTL 5E99H 4ZW6A 1TTFA 3AO0A 2W9LA 2QSTA 5E6YA 3RX7A 4X80L 4CEUC 1RZFH 4HSQA 3UXIA 4AQ8A 1Z69A 2AK4E 1I1CA 3VCLA 2BY0A 2CW6A 5BW7A 1IQDA 3FO2B 1JCMP 3I6KA 4XD4A 4PLJC 2P8PA 5TE7L 4JTRA 3SCQA 3P3YA 3IMBA 3NDZA 3MUGB 4X50A 4WO4C 1WV7T 4MJ6A 2Q0ZX 3V36A 1YUKB 1YY9C 2D2OA 2EIEA 4UMBA 2P44B 1MN4A 1NDMB 5MI0C 4L9LC 2VELA 3DIVA 4OCXH 3LGGA 1ZY9A 4NKMA 4XBPB 1OT2A 4YNYA 3TZVA 3Q67A 3KVQA 3VGAC 4RW5A 2GFTA 1DZBA 1QD0A 2HZHA 2L3BA 1OFPA 4JANA 2VURA 3FQ4A 4TNVF 1QRNA 3U0WL 2CWXA 4NJAH 1EJTC 4JKPL 3T8LA 1JDFA 2AKZA 5F7EH 2ADGA 5LG6A 5MENB 3ARXA 4PG9A 3VKDA 2OXNA 1XIEA 4L3CB 3RP1A 5K39A 1KWGA 2XIMA 3P61A 3HFFA 3KPMB 3H6JA 1I1YA 4HA3A 2OI9C 1KB5A 1P69B 5G4HC 5IFHL 4YH6A 3ATAA 1MNUL 3EJZD 4X5PA 2P45B 3ISIX 1VZHA 2UZXB 4GY0A 2YHGA 2F58L 5TQ2H 4HWNA 3US1A 4Q89A 3PZUA 1EZUA 1A1OB 4M8QB 1FVEB 3L7RA 1ED3B 2YKKA 5DZOA 3GAYA 3D4GA 1UM4L 1AZ1A 3VFCA 1UJTA 3H55A 2XX0A 2EXSA 5L4FA 4NIKB 3W9EA 4HXBL 1W6LA 2ISFA 4GAJL 5HR7A 3V6FA 4DM1A 2J57A 3N2MA 1YNTA 2OZ4L 4JFWA 1TV2A 1S38A 2QKFA 1IJ9A 1V10A 3JSSA 1X96A 2FCBA 2YYUA 1QLEH 2ZC8A 3I9IA 3NJVA 3FF8A 2OT0A 2H8PA 3QUXD 4DJFC 3GO1H 4UFJA 2A4AA 2WSQA 4CCZA 4ATDA 4WDIB 4BCXA 3EF7A 4UT7H 4L8DB 5DY2A 4A04A 5FF2A 4ZBCA 3P77B 3PPEA 3V5OA 3HO8A 3NL2A 1M6OB 2H6UA 1L2UA 5IB5A 3HHRB 1KXQE 1AD9B 5D04C 3IIXA 2BZCA 1VR6A 4GIPD 4WKFA 4BI5A 4FJ6A 2BGNE 1IYXA 3CWGA 4DTGL 3TYDA 2HUEA 2EDXA 2A83A 1UA6H 3D1MC 1E73M 1E4WL 4S1QL 4JG0L 2J7CA 4HZ6A 1LDCA 3UBXB 2X1XR 1WX0A 2G41A 4G71B 4HCIA 1FNGA 4UQEA 2XXFA 3GXTA 1KIQA 4LPCA 3IMWA 2V8MA 3LQAH 3K71B 3CQJA 3EBHA 1FC1A 1CMOA 5KYWB 4KEVA 3G7TA 4I3RH 4LXFA 1XTLA 2PBOA 2VZTA 2YPIA 1SDAB 4FF7A 3DMMA 2C9XA 5E5RB 3HFMH 4LSSL 4OCYH 4MAUL 3RDTD 4RNRB 3QFGA 5A16B 2JJUA 3JT2A 1KM4A 2ZZ6A 2PPDA 2OU4A 1A2YA 1NAKL 3SKNB 3ES6B 1MDLA 1A8ZA 2PDKA 3BWUC 4YAQB 1W2PA 5CHNB 1FHUA 3RURA 2QSQA 1IL1A 1QP1A 1OANA 3TM6A 3KNBA 4BRJA 2I5GA 3UY8A 2TSYA 3CIWA 4JTAA 4F27A 4UQIM 2VZ3A 3KJ6H 4PB5A 4M1CD 4QRPA 5J6SA 3W81A 2VXTH 4TV5A 1TPWA 1W3LA 3ZO0A 1KV3A 5EHFA 3E8UH 1MUJA 2UY5A 5FCSH 1FVDA 5CPMA 3IPFA 1ITUA 4MFEA 2I69A 2GQ9A 3NJLA 3TJ4A 3KX6A 2VN3A 5E5CA 2W8CA 2BHZA 5H94A 2GGEA 2XYBA 1B4JL 2WLJA 3FT0A 3N9GL 2ZG2A 1TPEA 2HP4A 4YMZA 1TJ1A 5T5FL 4IKLA 3EKCA 5EU6A 4EQ2A 3CH1B 3V4VL 4U4BA 3K4ZA 1WS7A 1GHFH 1XSJA 1GSKA 1R87A 1LT8A 3CFNA 3LKOB 3RWHA 1X97A 2EAWA 1F2JA 2JLLA 5HD8D 2F54B 2FHBA 4R3SA 5AVWB 1UJ3B 4Y19A 2YD5A 1DFBH 3CHPA 4NQEB 3ET9F 3IBOA 1JNJA 4GNJA 1JDCA 2QIIA 3WLIA 3FNDA 1TFPA 4EI5C 1BHGA 4UB0H 3PBMA 5B39G 3OZYA 4ZMZA 4AMCA 4ODHH 3I6GB 4ZQOA 2IOMA 1ZLWK 4NO0A 4XZBA 3OGSA 2J9YA 1TU2B 3BPLC 4A7GF 3CAVA 1DSFL 1FLRL 1HHIB 4UAHA 1PSKH 2V4LA 3KVDD 1BQUA 1E6OL 1TMCB 2OR7A 5LBVA 4UBPC 4O0ZA 3ORWA 1C9SA 3WMQA 3FXYA 1OFBA 1FXQA 4FXLA 4H5SA 1E5JA 2IMRA 3I6RA 4N9EA 1N2RA 5CPTA 4CCEA 1WIOA 1M1BA 4H83A 2MOVA 1ZQ5A 3PGCA 3COOA 3CIXA 2ANUA 1FHLA 1FPTL 2OTUB 3MW7A 1ISVA 3W7MA 1U3HC 3V0FA 3KBFA 1VFFA 3GBNH 5CEZD 2XIIA 4TVPE 1SXCA 2R0WL 1HAUA 3AXXA 4HPYH 4GG6F 5EO1A 5I15H 2CCLA 4GWEA 2ZUTA 4ZFQA 3HNSL 3VDHA 4TXVB 2Z9TA 2OL3L 4OJFH 4QAWA 1T0MB 1CF1A 1HH9B 4ZTOL 4MA8H 4JAMA 2E9JA 1MQKL 3KR3H 3W26A 4JM4H 1TTCA 2Z4TA 3RYMA 2EIMB 2Q6WA 4D6FA 4XBSA 4EOWH 3NDZE 1HO4A 3WLJA 1QNOA 1HCFX 2BS9A 4M7TA 3OODA 3KH3A 4AZHA 3G6JF 3BAWA 3SE9H 3AMGA 4XPGL 5CBAA 4ZW7A 2NNCA 1E42A 1XCTB 4RL3A 2L0DA 5T1KA 1KRBC 3SD2A 2EVHA 3BPWA 1V93A 2W91A 3HRZA 5JR1L 4KTEL 4P2RB 4Q8UA 1F6PA 4KRPD 2OSXA 4JTKA 1IGSA 1R3JA 2PMZA 1QRNE 1ECEA 1HILA 1QOQA 4MMYA 5EMKA 5CR1A 4X98A 4QYAA 4Z08A 1Y5VA 4FNRA 3FN3A 3TFCA 2YR1A 4UINL 3SODB 1C93A 1W0MA 3MREB 4M6UA 1BMZA 3KS5A 3PQYE 1HKVA 3CSPA 5PCYA 3OKYA 3KCPB 5FYKL 4NOBA 1S6NA 1P84J 4Z0SA 4AVKA 2NX9A 4NQDE 5L0QB 2ZOLA 1NGWA 2IDSA 1NUFA 3NEEA 3WFCL 1TZHA 1U93B 3KYNB 1E90A 2H0PA 1GOOA 1AP2A 1ZLVH 2G5UA 3WTSA 1UVQA 4LPTA 2NNAA 3W1XA 3K3QA 1V6WA 2Y1VA 2QULA 1XV8A 3ECVA 4HJJH 4YHLL 3WIIL 4HS6A 2GK1B 1OD9A 4J1UB 4F9PA 5IHZB 1T22A 2YZ5A 1H3WM 3NAAL 3CO8A 5JHAA 2Y5TA 4UZUA 1T21B 2ZCLH 1E0TA 4WY7H 4N3UA 4IBYA 3VCNA 2DKMA 2MSPA 1NWSA 4HKPA 2XQYA 1OF2A 3VVWA 2MKWA 4LUSA 4QM1A 3EJYC 4FCHA 4AHPA 1ZUAX 1O7AA 2IADA 4LOVA 3OO2A 1O6IA 3N9KA 3WAJA 1RQBA 3BAEL 5DA4A 4EPBC 2EADA 4XWOC 5DANA 3WLWC 3ARBB 3DVGA 3O0FA 4UV7L 2ORBL 4JQIH 2XWEA 1EEXA 2QEZA 4JFFD 3N2OA 1AG1O 4GBXD 2VQTA 1FRBA 3DFYA 2OSWA 4B9CA 1ZLDA 2CO6A 3HZKA 2V5TA 3C5JB 1FX6A 4G42A 4GP5B 4FFZH 4BV1A 5FHAH 4O1CA 3KPRA 2PO6C 3KPLB 2HSIA 1JHTB 2EE0A 1HJXA 5E2VH 1IE4A 3BIAX 3VWJD 2R0KL 5AVRB 1XIJA 2YLKA 3WLQA 2QBWA 5ECJE 3BDBA 3WAKA 4JZNA 3SQRA 2FQFA 4G83A 3SDDB 4PR5A 2AQWA 3U82B 4G6FB 2WP3O 1NL0L 4IK6A 1JPFB 3WHE0 4FYTA 1O6SA 4A29A 1VFLA 3TO4C 4HPJA 3FOLB 3B40A 1QBAA 1LVEA 5IEHA 4PR4A 4PRDB 4QR7A 1G9NH 3Q48A 1FHNA 1BEUA 5KYXB 5IMLA 3RNDA 3H7BB 4XP4H 2AANA 1GOXA 3ITGA 1F9CA 2FB3A 2NX5B 4MJ4A 3FQNA 3O8XA 2GWGA 1W1TA 4GXPA 3DX5A 1WSST 2EP6A 2YOAA 4N9GB 4OVUA 2BIHA 4PTTA 5IOKA 3ES8A 3NK3A 3ZKSD 4PV8A 1QFOA 1IKNA 3S1XA 3L3JB 3P4MB 1IBGH 4XXDB 4NERA 3KWWA 5DHMC 1SLXA 5DQDH 4EMZA 3SDAB 1UT1A 1VZGA 2CKRA 2DLTA 1GS8A 5ICYA 2IS7A 2XV0A 2H5UA 3MFFA 5I0VA 5IB1B 1UM6H 3ZT7A 3UTQB 4E9SA 3N2JA 1YPZF 4V1DA 2J62A 4G8GA 5CZXD 1E7VA 4JFEB 5ALBH 3TXAA 4Y5VB 2Z1SA 1U3NA 1E9YB 3OKNA 4TQHA 1VRDA 1M5WA 4FAAB 8XIAA 5T3XH 4UTIA 1K8IA 3SRKA 3OB0H 5J1AB 4EXKA 5EU6E 5AOKA 1RUAL 1O6VA 4ZPTB 4P06A 1MUWA 5T9BG 5IHUL 5AVYB 1IAII 1OCZB 3OKDA 3S34H 3GYCA 1QA9A 2Z4QB 4PRBA 2HE5A 2EUWA 3SIZA 4YHPA 3NZ8A 4XNDA 3A64A 3PHOB 4RGND 5C0GA 2OG9A 1Q9KB 1NOAA 4PUBL 2X41A 4LU0A 3LZFL 3ARDA 2DJXA 1GEQA 1ADWA 5EGRA 3GGWB 4C58B 2NY1C 5C0IB 1HESA 4GISA 4ZOAA 3FFCB 5TQ0H 4R97B 3PSWA 2J25A 1KCRH 3VXUB 4BFIB 3WY1A 3UROR 4IBSA 1K9EA 4Y16D 1CZ1A 4K8RH 4OZFA 4FLSA 4XB3A 3DJZA 3DC8A 1K4CA 2YQ3A 2E1WA 2PFHA 2IH3A 3KD4A 5KVGL 5KAQF 3S36X 1FKXA 4DGVL 2FIKA 1MFUA 3LCHA 4ZS6D 3DN5A 3VD0A 2XCMC 1BQ5A 3ABOA 3KVLA 2ZIDA 3S36L 5AYUH 5E1IA 4F24A 2QMKA 2X87A 4ONVA 5D1ZB 3REVB 5KZ6A 4UNKA 2GJJA 5FJOA 3EWUA 2PA6A 4O1FA 2WBJD 1DBKL 4H8PA 1BMGA 2CDEA 1RAMA 5RUBA 4HD5A