1KY6A

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 65
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky6A02
1QTPA 1PCZA 5IYBP 1B9KA 1C9BB 1GYUA 1KYFA 1VOLB 1CDWA 1AISA 1QNAA 1KYUA 1NVPA 1QN7A 1RM1A 1QNBA 1R4XA 1NA8A 1QN5A 2D0AA 5IYCP 1QN9A 5CN2A 1W80A 5IYDP 2DWYA 2IV9A 2MJ7A 1NGMA 1QNCA 4B0AA 1IU1A 1KYDA 1QN4A 4RODB 1PZDA 1VTLE 1GYVA 4ROEB 1E42A 3OC3C 1VTOA 1QTSA 1QN8A 1P4UA 4WZSD 2DWXA 1YTFA 3EIKA 1TBAB 3ZY7A 3OCIA 3H1ZA 3ASMA 1TGHA 2D0BA 4BCXA 1MP9A 2IV8A 2D0CA 2VJ0A 2YMTA 1KY6A 1NH2A 2E9GA 1QN3A 2A7BA 3VN5A 1TBPA 1D3UA 4PY5A 3HS8A 1QN6A 1VOKA 1GYWA 1OM9A 2Z8UA 1JFIC 4ROCB 3HS9A 2G30A 5CN1A 1QNEA 3MNMA 3ZHFA 1KY7A 1YTBA
chains in the Genus database with same CATH superfamily
3J2PA 2QTVA 4AV4A 1MIML 4WNQB 3LB6C 3T8XA 1YNTB 1W8OA 4QY8B 4K3GA 2W94A 3GD1C 1NPUA 2DQIL 5DD1L 2CBPA 4I8DA 2DQ6A 5D1QC 3EUDA 3EYSH 1RUMH 2J6EA 4PRIE 4GAJL 1XH3B 5C9JA 4Y5VA 5E6ID 5HI4C 5I75C 5D7JB 4ZO7A 3RFZB 2XY1A 3FQXB 1QNBA 3DVFA 1I7UB 4NGHL 4KTDH 4UZGA 4F2MB 1P5UA 2BS71 3APNA 3IDJA 4MS6A 1UZ8A 5IK3A 4JANA 2VDRL 3WJJC 1KJVA 4Z7WF 1J05B 3RVTD 4LDEB 3CIAA 3CHQA 3N0AA 4NI6A 1ZLSH 3VXMA 2VGLM 3D2TA 5DJAB 3IJ9A 3LTVA 4HZ1A 3SQBB 1CD8A 1L0QA 3SO3B 3DX7A 4RGOH 1OP5H 2Z34A 4U2ZA 3GI9H 5FYKD 3CTTA 2D7PA 3MKKA 4LL9A 4WU7A 5TF1L 4F37K 2R1WA 3GXDA 1QFPA 1JHTB 3PDOB 3BPCB 4FN0A 1NBQA 3MFFB 1JPFB 1OV8A 1UD6A 4E9TA 1KTJA 3KYMB 3LNIA 5C70A 3U9UB 1TCRB 3R06B 3QUXA 3N89A 4ZS6D 3QDHA 1BBJB 5D70H 3Q8BA 1S7XA 3B5GA 4PREB 4DZ8B 2P5WA 1IBZA 3JYCA 5DD3H 5LJYH 4E68A 2JCCA 3ULSB 5D1QA 4Z7OB 1J1XL 4JFDA 3V4VH 1A3QA 1B6DA 4DN3H 1TNMA 1T1ZB 1UT7A 4PS4L 1KIRA 4PHXA 1ED3B 1E5ZA 5E6IC 5EUOF 4L2YA 2CR0A 4IKLA 4FKEA 5G5DB 4Z9KB 4NHCL 1PDKA 5D1XA 3QFJD 4LPUA 4XCCH 3VVWA 3L2NA 2FR4A 1ZHKB 2BNUA 3GMOA 4LKXA 1TJIL 4EEEA 3TN0B 1D9KC 4TPSA 1QSED 4ZDHB 1JP5A 5DGQA 5FWRA 4R5VA 1WLHA 4OY9A 1LXTA 1CLCA 4KI1A 1JZJA 4FTVE 3DUHA 1YYML 2EDQA 5EBWB 5D1XE 3QP3A 5AB2A 1YQ2A 2XG5A 4AQZA 4RGMC 1AXTH 3CBKB 3I0WA 4EZLA 5DFVD 4OCRL 3MR9B 3SO5A 3COOA 1LO2H 3BAEH 4PJEF 3U1PA 3SKUD 3FFDA 3G3LA 3FTGB 3FOMA 4OI8A 5KAQF 4LEOB 1U21A 5AG8A 1SF3A 4JG0H 1OAQL 4ETYA 3C6LD 3MXVH 4QOKA 3VI3F 3EHBB 1KIPA 4ZS6C 4QWWD 3BUYB 3RX7A 1CE6A 1AHMA 2BVQA 2CU9A 2JSFA 4H1LG 3SEPA 2EZ0D 4R97C 4R7NA 1EAPB 4DOHE 1VZGA 3HE7A 1SFHA 5AVUB 4XH2B 3T4AB 3SYOA 4YHOH 3P3TA 4UI2A 2PWHA 4G1EA 4FDWA 4IMLB 1EVUA 3OKKB 3WTWA 1AR1B 3OZ9L 4QRPE 1Q4NX 5L2KB 1IVLA 5C92A 3DBSA 5G4OA 5CEZD 5DZVA 3VWKD 3F6JA 2X4UA 3CWSA 3MV8B 2OJZH 4MFHA 2DQHL 3VYNA 1M1XA 2OJEA 2XN2A 3PHSA 2WSPA 4HD9A 2CCWA 4PY8J 1WFMA 4PJBF 4AEHH 3GHPA 4YSOA 1M7DA 5T1DH 4Y5XC 3LH2H 2F54D 7PAZA 4HWZA 1XCXA 4PV9B 4PHZA 3BAIA 5ERWA 1NGMA 2DKMA 4LCIH 4OUOA 3NH7L 2G75A 2AQ2A 4AL8L 4Z7WE 1QPKA 1W0YT 3MGTB 2XACC 4KKZA 1NCWH 5CU5A 3EH5B 2DJSA 1OGTB 2UX7A 3PP3H 4JGJA 4PIBA 4EMZA 2C3HA 1A5FH 4ZNEE 1YQVH 3K3QA 5BRZD 1IIIA 4EI5D 4R2GC 1IE4A 2KZ1B 4OJAA 1J8KA 3V6BR 5DVKA 5JUEL 1TPXC 1KBKA 2E6PA 5T33H 3RGVC 3WELA 5CZVL 5I9QB 3QR0A 1P7KB 2FRGP 1ERNA 4PGDB 3DSFL 5C09B 4DAGH 2YHGA 3CZKA 2NUTB 3TCTA 2WQSA 4ETQB 3BDYH 3HPLA 3QZWB 5AOLA 2QR0B 2RQEA 3NRFA 4LVEA 4IM8A 3VWKC 4GXVL 1UUNA 1P9MC 1BFVH 1YUKB 5FUZH 4C56B 2EADA 1AD9A 2X42A 4X7SL 4PSRA 1Z7JA 1PLGH 3VSVA 5ES4B 2VAAB 5D1ZB 5DJCB 3NGBC 1G7JA 1P69B 5EUOE 3MZTA 3SPVB 4BK4A 4Y7OC 5H35A 3FTSA 4MNHA 4F15C 4EIUA 4DUXA 1BVNT 2ZCKH 1QN6A 1DBJL 4W81A 3EFDL 4OZIB 1UA3A 4YHMH 3CN4A 3N40F 2N0KA 3P9MA 4ORGB 3VFNB 5DD5H 1F1GA 3MV01 3PP4H 3ECQA 4GKNB 3BGMA 4LHQB 1KCLA 1H3PL 5TE4H 3OHXA 2E7HA 4U1IB 3U30B 3UTTB 3EXJA 1KPRA 3H85A 3JV6A 1M42A 3BKJH 4ELMB 1W0WA 1QACA 1U8JA 1J1PL 2HJKA 4OAWB 1WIPA 3RGVA 3WIHH 4JHZA 4PJEE 1AHWB 4EN3B 1FO0H 1JCKA 3QEUA 5B3NA 4S1RL 1MZZA 3A4EA 3IE9A 2XBTA 3M88A 4AQAA 3VH8G 4I48B 2X3BA 3BFQG 4GNKB 3VI3E 4JRYA 3HJ0A 3C9NB 1DQDH 2C1OA 3IDXL 4AITA 1N6QL 2BCMA 2EIEA 3TA3A 4WUUA 1LVEA 2WN3A 2WXLA 4LLVA 2J71A 1QUNB 3ZMRA 4JPIB 3TN0D 1A9EB 3D09A 3G6JF 2KI6A 4XC3H 5TPWH 5KZCB 2XWJB 4JRYE 5GS1C 2FO4B 2F5AH 1AFVL 1G9NL 2IGTA 5FM8A 3S34H 5AAPA 1ETA1 4IJ3B 4PJBA 4X6FB 3MRHA 4YPGA 4MVBC 4IDJL 3ZDWA 2A4ZA 1OO2A 4PIRF 4JDEB 1VFBA 4NQCA 4IS6B 4AVIA 4DZBB 5L8LB 1KN2H 3JVGA 5DHVA 1OD7A 3K72B 1GZQB 4XTRC 2Y1ZA 5IG7B 4PJBE 2VZSA 4JCWA 4AI7A 3GO1L 2Z31C 4GG6F 1YY8B 2HX8A 2DMGA 4I0PB 4RETB 3IH7A 2AP2A 5EFIA 3KW7A 3EHBD 4XZUA 1HXYA 4AQEA 1OAXL 3QUYC 1VTOA 5K33A 1SBSL 2ZXBA 3MOAH 1Z9SA 4FHKA 3LZOA 5CLZA 3BW9B 3QUMA 4G8IB 2FUVA 3G04A 4Y2LA 3V8OA 3UIZA 1DBAL 4LIQL 4EIZC 1I8LC 5LXGL 1RULL 3RGHA 3MLYL 1AR1D 1UURA 2R2CA 1FCGA 3AREA 1ND0A 1R3IH 5D8JH 5L2KD 2BIOA 2YFNA 3WMSA 1CQYA 2AK1H 3O3AB 4AMKL 3MV8D 1ULVA 4FC3E 4TRPL 2VR5A 2XTLA 2IMMA 2X2YA 4HS8H 3BKQX 2X7LB 3AS3A 1AP2B 1KJMB 1NTDA 4GXUN 5SWSB 2AAVA 4HLZH 5T1KA 3ZKSD 3AUWB 1ZPUA 3LKQA 2IPUK 1MWAH 3VVVA 5DI8B 1SOSA 2YPLB 5ABZA 2XTJB 3WLBB 2VLJB 3DLQR 5J9PB 3VJ6A 5HYSG 2A6JA 4Z7UB 2CLRA 3NBNA 2Z8UA 4ZQTA 2FKFA 1TLKA 3BPLC 3SE9L 4FNPA 1MPAL 3KYOB 2Z31A 5C3TA 3WHE1 5DJZA 4OM1H 1FGNL 2OPCA 3QUYA 1OSZB 4G71B 4M6MH 1II4E 2C34A 1IEAA 1MFAL 3W0WB 2XSKA 3CFDB 1NDMA 4BCZA 4CMMA 2ZQKA 1N39A 1WHPA 5J13B 3VU1A 4U1KA 3UAAA 3KVDD 1YN6B 1BAGA 3ETTA 3JTTA 1E6OH 1F4WL 1I8LA 2DI9A 4FJZA 5D7HA 4NOBA 3GLEA 2CR3A 1F58L 2C9AA 2HLAB 3LKRA 5ESAB 5C09D 2WZPA 2MNUA 2OV0A 5J6GA 3BAKA 3EGDB 4PJAB 2H7WA 2PR9A 4UTBH 3WG7B 1HXMA 2CRZA 1Z9LA 1ZY9A 1SUHA 4C56D 5ISZA 2G9HB 2F74A 1NPJA 4H25A 3P30L 5F1NB 3FBQA 1SHXA 3CFEB 3K7UA 4DVRH 4QRUB 3SDAA 5D1ZD 5EWIH 2ARJQ 1GY1A 2ZWZA 4NUGL 2FNWA 5J1AB 3ML9A 2H9GB 1MRFL 4HGKC 1MI5B 4XB8A 2GB2A 1FZOA 4XAKD 1KB3A 2ZWYA 5EG6C 3MRLB 3I84A 5EEUA 4EPSA 1BM3H 2ZUXA 1FNLA 4W9ZA 2RB8A 4U1JA 1KIQB 4PBXA 3G6JE 5D2NC 1KYDA 1KB9K 3RIAK 5EO9B 1RZIA 4CBZA 5F0JB 3UTTD 2GI7A 2LU4A 4W6XB 3VD9A 3FB6B 1GHFH 3AY4A 2EXWD 3DHUA 2DKCA 1QSFA 2ZOLA 3QWRA 2JF1A 2WINB 5FUCC 1EFXB 3VGAC 4DP0X 3VXOA 1JK9B 4R9HA 4JZNB 3S5ZA 2X9YA 3U7YH 1UADC 4YGVB 4NM8H 4EN3D 1S7WA 3E6FA 1KTDA 1R3HB 1FFPB 2FIKB 3KPQB 4X0KB 1BQHA 4XAWL 1H6EA 5I9QC 4WY7H 1FL5B 5I8CA 4GG6E 1T2QL 5CJXC 1OEZW 2V8LA 4FOMA 4MD5A 5J6SA 1K2DA 2CKNA 1S46A 1ZWIB 4ODVH 1W0VA 2H32B 4IRJA 3BVNA 2Q8AL 2NDFA 1S9YB 2COQA 3V55A 2AANA 2CCLA 1RJCA 3GJFH 1NH2A 2R9HC 2P8LA 5E08H 3FO9A 5LWYH 3BN9D 5KZCD 1TQUA 1NCTA 3L9BA 5DRNA 4DKFH 2YD1A 2NOHA 1R75A 4G9FE 1HEHC 3G5YB 3GMMB 2FAUA 4FZEL 2B1HL 3X17A 5EIIG 3SE6A 2J3SA 3WMPA 2EEXA 5MHSD 4MZRA 1IBBA 4XN4A 3BKCH 4PBVC 4NQTA 1FH2A 2ZKMX 3KDPB 3TCLB 3OB0H 2DWDB 1E4XI 2I9LA 4J4PC 4XCEA 1B2WL 3QNZB 3QO0B 3NCJH 4I0PD 2G60L 4LPWA 4ZPTA 2GBVA 2YZ1A 4J6RH 2WKGA 5TDNB 3L1EA 1KJ3H 5A7BA 1AHWC 3T09A 3EBIA 1OW0C 1SYVB 5SV4A 4QMEA 3FQ1A 1ZOXA 3HNSH 3N9GL 4F7CB 3F58H 1FORH 1ZVYA 5AOJA 4YX2H 2Y25A 2YGQA 2DEYX 1D2OA 1YEGL 1U8QB 3X13A 3QULA 1KXVC 2JKWA 3MMEA 1ZGLM 2AMGA 2ESVE 4PWIA 2BFVH 2Z4QA 5H94A 1UD2A 2A5UA 1M05A 2X53A 4NNXB 1KLFA 2NY1B 2QBWA 3LNFA 3BEVA 2AZAA 1H3GA 5I8KL 3CFNA 1IGYB 1RZ7H 5L2JA 4NCC2 2LV4A 1MHHA 4Q9QH 4ZOBA 4PJXF 5SWSD 1RUAH 2QLVA 5DHXB 3CGTA 4O2FA 2NUPA 2JI1A 3B3BA 2VLJD 1ZHBB 1C9SA 3CZNA 3C5SA 1X5LA 5IB4A 4NRYB 3HZMB 5I1IH 1RUML 4IHOA 3KGSA 4FABH 4OD3H 4U6YB 3NZ8A 3IRZA 5G55A 2D73A 5LCVL 3T77A 2LAAA 4IBYA 1O6TA 1WC7B 5L7XH 2D4FA 4B53A 4DCQB 4KTDL 4M6NH 3BLBA 1BMGA 2IAMB 2NNXA 3BN3B 4N0YH 3ESVF 3W0WD 1QTYT 1UJ3B 1ZLSL 1PU0A 4HOXA 1CIDA 2Z93A 5T5FH 1VZHA 5ICXA 2MHAB 4H0IA 3P11H 1Q9UA 3CX5J 3VRIA 1KXVA 2MQGA 2VE6B 3LQAH 3D39E 4ZODA 5M95B 1J5HA 4QUOA 5HGDA 1X9RA 2ZX9A 3GI9L 2GITB 2ILLA 1ZT4B 5IVXB 5HJ3A 3VFWA 5CGBA 4KTYA 1X7TA 1G9NC 2VITA 2B20A 2WLYA 4OFYD 1N10A 3LIZA 3I9IA 5BZWA 2AVFA 4G8GD 3RWEB 4AV5A 5DSCA 1TMCB 1E3ZA 1H0DB 3FRPA 5D70L 4AK2A 2HJLB 1OLLA 1S5IH 3A21A 5DD3L 3WFEL 2EXSA 1ZVHA 1MI5D 1ZLVK 3V4VL 1RXLA 3NZHL 2DW5A 1YQRA 2D8KA 3HC4L 4DN3L 3BKYH 2CO7A 4A6YH 3EGSA 3E7JA 4UQ3A 3L6FA 1BHGA 4MD0B 2AC0A 4CU8A 1PYWB 4XCCL 3LPOA 2QQKH 2VLRE 5ANMA 3ATFA 1Q9WB 4BE5A 3K5SA 3DC0A 1B4LA 1BECA 1BEXA 2A6IA 2H4EA 3AXLA 2C9RA 3FB7B 4R90H 1L9OA 1EFXD 3TO2B 4HUCA 5KTEH 1IM9A 5SWZA 3Q7JA 4KTEH 4NQXA 1HHKB 3KLQA 3RAJH 3VFOA 1G6VK 1KDIA 3CZUB 1AXTL 5HDBB 2V7HA 3K2IA 3PWPA 3PAVA 1LO2L 2IAAC 2X6AA 3AS0A 3BAEL 3SPCA 1TETH 1ORSA 1ONQB 2P7TB 4JG0L 4V11A 4NKOB 3MXVL 4JKKA 4LP5A 2DQTL 1J0IA 2CDEB 2ZXDA 4ZXBA 1BQUA 1FLTX 2CO4A 3B43A 2G2PA 1IAKA 2CK2A 4KROB 4PJCB 1I1AB 1HOEA 3Q9PA 4PB9L 4XO5A 5E4EC 2IGFL 4GKZA 2RALA 4XBEL 5T3XH 3TO4B 4LLYB 4YHOL 1ITBB 2D7NA 4WI5A 5AYQA 5EOTA 4X4ZA 2MTAA 2WQAA 5DVMA 2F9BT 1PF3A 4H8HA 5JIMA 4PGBA 4TLKA 4PJXE 1T2XA 4PJ8A 1CU4H 4PD4J 5ADPH 1AOHA 1T20A 2J12B 3NIGB 5F3BB 5DFAA 4MS8C 1PY9A 3ULVD 3QIWA 2CNYA 1BJ1H 3PABB 1N0LB 4HIHB 2OMWB 1T0PB 2H8PB 4AEHL 3VGEA 3DOHA 2B15A 2E9BA 2WZ6A 3MRKB 4MJ6B 3RDJA 1RJYB 5T1DL 2WZAA 3GSVB 3LH2L 1YDPA 2EIZB 1JL8A 1XF2B 1UM5H 2EDHA 2E4FA 5GSVB 1J1OH 3LVTA 1G1CA 4Z0XB 4QXTB 1WCBB 1NCWL 3V0EA 2E7CA 4FQXB 4NN5C 1A5FL 1VADB 1UWXK 5DEFB 4AJVA 3BRFA 1NFIA 3K6FA 4WO4C 2ZP9A 2A9DA 5T33L 4Y4KB 3QZMA 4QXWA 3D4GA 5HHXL 1U58B 3HZYA 3GXFA 4WWID 3MA9H 4PS7A 4OV5B 1EEZB 4Z0BL 3ZRFC 3L08A 4LLAA 3STLA 3AS1A 3BDYL 1Q9OB 3FB8A 4M9PA 4FXKB 4X9BA 3UBXG 2EDDA 2ED8A 2YGVA 1Z3GH 4TQEL 1BEYH 3UYOD 3BQUB 3TEZA 2IAMD 4DO5A 1OL0A 1WO2A 3IDIA 5K9OB 2NXYD 3KLHD 3IXAA 2AKRB 3N1MC 1GIGL 1EQWA 2WNKA 2Q3XA 3DUUB 1BXUA 1HEZB 2BVTA 4AIZA 4OIAA 3S35X 2ZCKL 4Q6IB 2VDNB 2FEJA 1IC1A 4RQQB 4ZW8A 2F7RA 4YHML 4MA3B 3JYBA 2WK2A 5D7LE 5DD5L 1KCWA 3VW3L 2R1YB 1MCOH 3PP4L 4MAYB 4O2EA 3ROOB 4P8QA 4OM0H 3IFNH 5I1LA 2Y1VA 3O3EA 5TE4L 5TFSL 3WO4C 5IYCP 3BKJL 4YDVB 5E51A 4BQ6A 5C0CA 2WQVA 3MJWA 3IVKA 3S4SG 3RKDC 1E6JH 5C0GB 4MJIE 2R23A 3V5KB 3FCTA 2NX5E 3WKYA 4LL4A 3EOYG 1T21A 4XVOA 2QDVA 3NACH 4FA7B 3P3YA 1U91B 2YC1A 4ZFFB 2EEFA 4PGEB 3Q5YA 2CDGA 4Q2ZA 3KR3H 1E3FA 4B9YA 1TJGL 5HDQH 5I1CH 5GZND 1G87A 4PWKA 4B5ZA 1O6SB 2IG2H 2KDGA 3AY2A 3MLRH 4G6ML 1ZLWK 2NXYC 3KLHC 3ZTJH 5KSAB 3APFA 4YDIH 1NJ9B 2QFPA 1W8NA 5KBMA 4H1LA 5BO1H 4C83B 3JTSA 5JORA 3IJSA 1SVBA 3LEXB 4N2HA 4BZ1H 3C8DA 1B0GB 1TVHB 25C8H 4XX1G 4PMEA 2JK5B 1T1XA 1YQMA 5CILH 3WFHA 1V8HA 5ENWB 4XPHH 5I73B 2AI0H 1KN2L 2EDLA 5LBGA 2P9RA 1PQZB 4L3EA 1MJ8H 2WXJA 4JL2A 3ZE2B 4HZLB 1TQSA 5JHMA 4GIAA 5FGCE 2OTUB 3E9TA 2Y5TB 2ZIDA 3D18A 3CZJA 4QPEA 2R2BB 4MB4A 1YQLA 3MBXH 4XN7A 1YPZB 1IC7H 3SKOA 3EFOA 1CFVL 3MOAL 4KROD 1I1AD 4EVNA 5C08A 4A1RA 3ZK0A 3TO4D 4HD5A 4YHLL 1ACZA 1ADQH 1U2CA 1GW6A 2XN9E 4P4KD 1TIUA 3ZQXA 4L8SC 2CGYA 2BIMA 4E9YA 4XT1C 1R3IL 4S2SA 5D8JL 1YHPA 2AK1L 4EDXA 3FN9A 3TT1L 4Q9RH 4HV8B 4OJYA 3OLPA 4HIPA 2DYPA 5F89B 5AENA 3JWOH 5GSRA 2MRYA 2EP6A 4F7PB 1MWAL 3FH5A 5BV7H 2WBJD 4PG9B 3PY9A 3BVVA 4ONHA 3BJLA 3LD8C 3MCKB 4XP6L 2E7LC 5D2LA 1I8MA 3PFQA 3IDNA 3OJVC 3O11A 2QADB 4R5XA 5CR8A 5AB9A 4JY4A 1F90L 4OQ1A 4J3OF 2WCPA 3JQOB 4G5AA 5TD4A 4OM1L 1ES0B 4E2OA 2H3KA 4B9ZA 1I82A 1KNOA 2YAHA 3L3KA 4FQXD 3CPLB 4M6ML 4F8OA 4PTTA 4KVPA 4ZNCD 3GXIA 3IE4A 4WV1B 3IGLA 5DJ2A 2OXHB 5LNDA 1XF1A 5F7EH 4JG1L 4L8SA 2IANB 4NUQA 5DWPA 2JJTA 1E6OL 1HOCB 4Y4KD 3UG5A 2EE3A 4P4KC 4PJGA 3UP6A 4AH2A 2X40A 1AQDA 1HH6B 4E0RB 4TV3A 1HESA 3UIYA 2ZOKA 1V54B 4DETA 5EO1B 4EBQH 2JJSC 1TFPA 1XIWC 3VFGH 1CGYA 1TTGA 4ODUA 8FABB 4ESKA 2NCMA 3BQUD 2Z92B 3DJSA 5FGRA 1I7TA 1QLEH 1YMME 4LMQI 4H4NA 3VMOA 5I76A 3OSKA 3L9RA 4R83A 3B2MA 4XVUC 3GSNH 3HFFA 5EWIL 3FJTA 3FK3A 1D5XB 2WBJC 1RKRA 3O41A 2YQGA 3P02A 3OGDA 4Y7MA 3VFVA 3RA7H 1DLHA 2H4LX 1Z9MA 3FO1B 5AL8A 5C07B 1BM3L 3VH8A 1DJYA 3BISA 2BWDA 4YXLH 3TVMB 4MAYD 5B1KA 3MRGB 5HYEA 3B37A 3EO9H 5LGKA 4WFFD 5E03A 3WN5C 1WBZA 1LQSR 1XAKA 3KCPA 1S7QA 4KPHH 3RTQC 3T9WA 1UWEH 3DYMA 3V4VA 5F3HA 1GKOA 2CHDA 4KNUA 4V2CB 3SDCC 5EO0B 4JFTA 5DMYA 3U7YL 4BQCA 4TQIA 3EOTH 4NM8L 3CDYA 3EW3B 3T0EC 1KGCD 2ZNXA 5GGTL 3ARUA 4ZAKC 3JUYA 5D71H 5JOPE 1DVFB 2FYVA 3KXFE 3HB3B 4OKVA 3ENCA 2JJSA 4U3SA 2CLZB 2HUEA 1VKXB 1G9ML 1FAIH 1XIWA 3KPPA 4KK6C 1TTCA 2L3BA 1HQRB 4CNIA 4L5FE 4N5EC 5EDXA 2EVHA 4XOCA 3MRNA 2GHWB 5E9DE 4GAGH 3LQZA 3ZHFA 5AW7B 3N06B 5E08L 5DUPH 1JNHA 5D7IA 4J3UA 3CXDH 4DKFL 1SNRA 4RFNB 4HKXB 3GUFA 4UNTA 1GRWA 3M1CA 1A3ZA 2OBGA 3UBHA 5FYJL 4KZEL 3WLWC 4AYSA 3F7RA 4TN9A 3GMQB 3BKCL 2W65B 3C6SB 3ZDZF 3ZTJG 5E4OA 4IL8A 2QLYA 4GBXB 4OCNC 3SGJC 2IDFA 2MNWA 4GKLA 3S36X 4KX9A 1G6RB 1CGWA 4U1LB 3E8UL 3SDCA 2KQMA 2OTWB 2BC4A 1OE3A 3NCJL 5DVLA 2AQPA 3MLXH 3HR5B 2IFGA 5TDOA 4A2FA 5CBAA 1AI1H 1OF2B 4F1ZA 3QGVA 3T0EA 4HZAA 4MNGB 1KJ3L 2ZCLH 4U6HA 2XPYA 2YEQA 2DLGA 5F6HI 3T2NH 3O2DL 4ANKA 1JYWA 1JCVA 4HW6A 5HYSA 2WOBA 3ZSSA 5IIEA 4LBEA 4YX2L 3EBHA 4S1SH 3UTOA 4IRZL 4XNZB 4NQUA 4QHKI 3IPBA 4UIMA 2ICWJ 3T8MA 2GSGA 1QLRA 4PJHB 1UEMA 4D8PA 2BFVL 1SBBA 4FS0A 1GL4B 4AKOA 1KWKA 5IUCA 4G8AC 2P5PA 4JDTH 2EIMB 1RZ7L 1YRKA 1KTRL 3LPWA 4HGMA 1S4IA 2NSMA 2X3AA 3OJDB 1RUKH 1JRHH 1QSVA 1RIVH 1KXHA 4N2LA 5KVEH 3OSMA 3SGJA 1BYPA 3SQRA 2O6EA 5I1IL 5E8EB 3QA3A 2QADD 1Y0LB 4GRMB 2DEXX 1QKZH 4FABL 1WUNT 3EOAB 2ICCA 4DPRA 3MRDB 2BSSA 5B1CA 1USQA 2ATKB 5EEWA 3MRJB 4O2CA 1BFOB 2ZUVA 4M6NL 1ZKAA 3VXTB 4NN7C 4HS6B 1R0AH 4I0KA 2EYTA 1RURL 1LP9F 1N70A 1CQKA 2HFGH 3NCCB 2GUYA 3IGUA 2H1XA 2OSYA 4WJ5A 5DK2A 1EGJH 4L48A 4JPWL 4N86A 5DQJA 5L8JB 2CG9X 3GSXB 2HT2D 5T5FL 5MEQB 1GPOH 2B5IB 3SPHA 3I85A 3G08A 1B88A 2D31B 3L7EA 4PJ5B 1DHKA 3MLSH 3U1QA 1LMIA 3O9WA 1F4YH 5JR1L 3EF7A 1UT9A 3NPSB 5ELIA 4WFHE 2A73B 1YTBA 3BC9A 1TEFA 3B8SA 3CPUA 3D2UA 4HALA 5HHOB 3D1MC 3I0XA 5EORH 4G1MA 3DTXA 1KDJA 1S5IL 3QZWG 1LILA 2E27H 1IE5A 3K6OA 4JEGB 4JPQA 4I4WB 2ITEA 1FZJB 1XHHA 2WUCL 3FCSA 4F93B 5HYJB 3BKYL 3MV9A 4C8XA 2QADC 5DS1A 5C07D 1TLMA 3PDDA 4C58B 3AZUA 3ECWA 2O72A 3IETA 3NRPA 4P59H 3TVMD 5JLZA 3JV5A 3WIHA 1M71B 4RAVB 5IB1B 1QN9A 1AGEB 1NBVL 1IFRA 3TEYA 1FO0A 3WKPA 1CD9B 4XC1H 4NXKA 2E8ZA 1GYAA 4UM9D 2XQYG 4JFED 4R90L 5JHBA 3LHPH 1IEBB 1T4WA 3OG4B 4L3AA 2CKBL 3BD4A 4NAQA 3ZDXB 5ICYB 1QHQA 2R1XA 3FO2A 3ZDZE 3VDBA 4KTEL 1G7QA 3TLRA 1LEIB 1COBA 1DUZB 2DQGH 4IOSA 5E2VL 2DJ4A 3HBGA 2ZPKH 4OFKA 4KX8A 1MCFA 5EIIA 1DVFD 2AXFB 4Z7VF 1FNSH 1RJZB 3T8VA 3TBVB 2YEZA 3E3QC 1R3KA 4UMGA 5I8EA 1R24B 1DR9A 4G8EB 1BF5A 1XL6A 2UWEB 4QIRA 2UYLA 4NO2A 4OFIA 4PJIA 4GAYB 3MODL 3IEAA 4PRDA 1CBVH 2PWEA 2X89D 5IQ9A 2B9BA 2XVLA 3HC0B 3A3YB 1OT4A 1OQXA 2NW3A 3QJUB 1ZLUK 3VXRE 1WBYA 1GZHA 3OXRB 2MCMA 1FAKT 2ZOWA 1JZ8A 5KSUB 5HSFA 4H0LC 1LK2A 4NO3B 1BD2B 2VZ1A 3FXIC 4GBXD 3II2A 4JFZH 4G7QB 2ICEB 3OPUA 1CU4L 4H26A 1T6WA 5ADPL 1OCZB 1U8NA 4XXDB 2X5PA 5EU6D 4Y4HC 3ZO9A 3ULVH 5KG9B 4QXGH 3JWDH 5IF0B 1K5NB 2UY6B 1XCQA 3PLYA 3OKEB 1M7IA 1S9WA 5KYYB 1A2YB 1OAYH 2BSRA 1BAWA 4KWUA 3QXTA 1LO4L 2IPKA 3D33A 1LP9E 3S6CA 4HUWA 3L4ZA 4FQPA 3BZDA 4LHJB 1JPGA 4YVNA 1MWAA 5D7SH 4GFTB 5IBLC 3PIQB 2BCKB 1FQ9C 3AWFA 3O4LB 4QHMA 4JHVA 5CZRA 3HMWH 4U1NA 1KYOK 2K8QA 2CD0A 5IBTL 1ETJA 3G5XA 5IJBC 4IGBB 1NGPH 2WWMD 4FFTA 4WW1A 4XBMA 2I9TA 4OJEH 1J8HA 2CO2A 2VL5A 5I24A 3VRJA 3ARXA 3C87A 1JNNL 1FVCA 3QNYA 4LPCA 3TIDA 3CFBA 2CGRH 3VYPA 1DQLH 3MA9L 2WYIA 5FO7A 2MCG1 3TPUB 1IM3B 3BJ91 4YS4A 5GJSH 3IDMA 4IBWA 2ZTBA 2G5BA 3EO0A 5KVGL 4ZX5A 4P46B 5JDSB 2F6AA 4Y4HA 4OI7A 5I6LA 2UZYB 3TJHD 2JELH 3UMTA 4MQ7B 3W1ZA 4FQCL 4N0FB 1FFOB 3K0WA 5E8NB 5DUBA 4IEFA 3DVNA 5EC2B 5I1DA 4NO5A 4WNJA 2PMZA 1G9MC 3BYTA 5IW3A 3OZLA 3TIEA 1EXGA 2ZKYA 5JW3L 4UTBA 2H6PA 3PCYA 3VFMB 3DRQA 1WRFA 5I17B 3LKNB 4FEMA 3EO1B 3ZKXC 2VTFA 1NINA 4YHIA 5B3JF 4Y5YB 4ZUVA 4KVCH 3KDMA 4PJ5D 3ZVVA 4Z3HA 3BCDA 5EZJB 3AFLA 4JO8A 1DL7L 2WLNA 4XB3A 1K72A 1SHSA 4XN9A 1OE2A 3QXAA 1D7FA 1IBGH 3BP4B 1E6JL 2BIPA 3GSUB 4J7RA 5HHOD 1I9JH 2AJ3B 3MI6A 4Z7VE 2WWMC 4NO0A 2Z8SA 4QO1A 5CEYB 1N59B 1FNEA 1OAZH 3DETC 1WZ1L 3K4AA 5AVXB 3NN8B 1KB5B 3RWIB 2K9UA 2X4RA 5FX3A 3NACL 1BQ5A 1HHHB 4UOQA 3QCUH 1SMOA 2YMXH 3CC5B 1KFAH 2DF3A 1JWUA 4MJ5A 1HWGB 2NPLX 2X1QA 4MZ2A 3RL2B 4MXQD 3GUTA 4IOIA 3KR3L 4LF3A 3IU4H 4Y4FC 4JW3A 4KKBC 5I1CL 2V5YA 3HI1B 3CSFA 2E5EA 2IF7A 3GKWL 2IG2L 2CBTA 3GMLB 3MRPA 3WFBL 1NWPA 1Y6NR 2GCYA 3HNVH 3Q2LA 3K6IA 3ATEA 5B7FA 4YDIL 1R5IA 5I6NA 1T0MA 2V9UA 3PQYE 5J7CC 1S5HB 3BP7B 4BZ1L 1BZOA 1Q0YH 4ODTL 3GJFA 4GW1A 1H15A 4JRLA 25C8L 4JKLA 1O7DC 2Q7NA 4WZ9A 5ICZA 5CILL 1VGEL 2ITDB 4Y89A 3RSMA 1RK1B 4H8UA 4XPHL 5JIQA 1HILA 3Q1EA 1MJ8L 4JQVC 4UNVA 1TMQA 3TBSA 4NKQB 2WTRB 5HVGB 3PWLB 2AJSL 3EH4B 1T1YA 4P07A 5DD0H 3VUAA 1IC7L 2VMFA 4S11A 2SEBB 3BZEB 2DZEA 1R3JB 5DHMC 3OKOA 2DMBA 3EH1A 3T3MF 5ESQB 1RM1A 1ADQL 2MFNA 2IQAA 1UACH 4HT1L 4PBDA 4Y4FA 3SNSA 1BD2D 2PO6C 1VSCA 2OJ1A 3HNTH 4M7JH 4NKDA 1R5WA 1KTLA 3OKMB 4WJKB 3QUZA 5IB5B 3ARRA 4KBPA 3P40A 2VR3A 4LEBA 3ZXAC 4FZ8L 1TZHA 4ONGH 4ZFOB 3U6RA 3KBPA 4N87A 3LKOA 4K5NA 4XVSH 5T1LA 3WNNA 4L9LB 1M6OB 4CVXB 5F70A 2W91A 3JT2A 3VXUA 1L7IL 3GIVA 3VFPB 5BV7L 1NAML 3V6OC 3FQUB 4NC0B 2VMJA 1IAIL 4X6CA 4YFDB 1VCAA 4JQVA 1J0KA 2OSLB 1Y18A 1IGJB 4ROEB 3L5WB 5E1IA 5J11B 1NLBH 3VXUE 3MRBA 3O4LD 4X6BA 3DPTA 4GUPB 3EDFA 3MJ7A 3NJFA 1VFUA 2WJ7A 2HRGA 2FK9A 3PL6B 4LLMA 5CBEA 4C4UA 3D4VA 2CO3A 4ELKB 2GUOA 5B3JE 1FVDB 1OP5K 1HWHB 2PO6A 4N4YB 4I2XB 4A7SA 2ADGA 1FPTH 3RUGF 3NFNB 2Z1PA 4ZUTB 1T5XA 2D0CA 4ACPA 2FQFA 5KYWB 1DVXA 1IM3D 5C6WH 3NZSA 4UDUA 3W9DA 3ZGIA 1ETB1 4EBQL 3L3OC 4N2FA 3CK0H 4G7SB 5T5FA 2V7NB 4P46D 3VFGL 4AEFA 5IMLA 1Y6MR 2AJUH 1EXUA 1MDTA 3SQOH 1D5BA 1R46A 4I1RA 3S4SA 1DBML 1QLEL 3BEWA 4MDIB 3A4FA 2QPUA 3K6SA 3VB8A 3CDFA 3GSNL 2J1YA 2BMKA 2VDOL 2IOMA 2KT6A 5TK4A 2BVPA 4WEBH 4FMKA 1MW1A 3RA7L 4BZ2L 1NBYB 1XSZA 4RGNC 2ZP0T 3ZHDA 5HHMB 1AIFA 4F7MB 5C0JB 4M93B 4XO8A 4YXLL 4LSUL 1F86A 5IW6A 2VXQH 4UM8A 1I8AA 3N43F 5FYKE 2F7PA 2J2ZB 4PP2A 3HAEB 1JHLH 5CD3B 2DLIA 2F19H 1YNTF 3CFQA 1UWEL 2JH2A 2WIIB 4FD0A 4A6YA 1A7OH 3AU1A 4JB9H 4J3WA 4Z7QF 4XBGA 3R0MA 3NEOA 1FSKC 1A6PA 1P5GX 2FX8L 3V10A 4P04A 1KG0A 3DMMB 1JGIA 5A2CA 1A1MA 3C5ZB 1FYHB 2CIIA 3ZZLA 3CVCA 4PY7A 4ZW7A 1NLDL 4BSWA 3K2MC 2OZ4L 5E6ZA 3T0VA 3L3OA 4FQHA 3Q2NA 1L9TA 2O61B 2L0DA 4F33B 4JZJC 1NOAA 3VFTB 3AAZA 4NKIH 3V0VB 4PUBL 1W80A 4P46C 4DQOH 3RURA 4Y16C 3D25A 1U8MA 2HX7A 4DHLA 3QFJE 3VAEA 3ARQA 3MOQA 3T3ME 3FT1A 4NZFA 2XKNA 4NYLA 4OLVH 5DUPL 5K9QG 2WHVA 1LWWA 2J57A 1G43A 3UZEA 5C0AA 1U3ZA 3CXDL 3EJYC 3QRGH 5GISH 1QSEE 3CSBA 3F5WA 4FXLA 2EDKA 3CIQA 1RJLB 3RWJB 4X5RA 1FYTA 1XGRB 4YAQA 4AYMC 4PRBA 2WXRA 3OGOE 3V6ZB 5DMKB 3GSRB 5FK9A 1U4EA 5JHDB 2H1LM 3GTVA 2FJGB 4HH8A 4PJDB 1VPOH 5K1JA 2YXMA 5DRXA 5KJRH 5DDHB 3ILPA 2BINA 3JWNH 1QR1A 2NY0D 1OCWH 4HKBA 1B3JA 4J3XA 4Z7OF 3MLXL 2YD3A 1AI1L 4RISL 1UHVA 1A22B 5T1MA 1O9WA 3ZLQC 5HBBA 2FWLB 2ZCLL 4OCYH 3WNMA 4D9RD 1MUJB 5EPCA 3I3BA 1O9VA 3N85H 3CVDA 4NP9A 1EERB 3K71B 3RWGB 3ATDA 2WKOF 3RUGA 1JGDA 4HKZA 1QO3B 3EOBA 1UQSB 4JZJA 4W9EC 5IV2A 1MAKA 3N0PB 3PP3K 3D6GA 2MTPA 2VLMD 4U4IA 5FA3B 4XPGH 3CVTA 2FECL 3MV7D 2IMNA 3C8KA 4JKNA 3FT2B 5A6LA 1MHEA 1N64H 4XHJC 2E86A 2HUHA 2K7QA 3RUGE 5CEZE 4JDTL 3TBYB 1LE9A 3ILQC 3D3VA 3I75B 3V0HA 3M46A 4HUVA 3KPRA 2IXQB 2KZWA 3QEHB 1OTUD 1J8SA 4BH8A 1SEBA 4UB0H 2HFFB 1JRHL 1FJ1B 2GT9B 1RIVL 5JNYB 3CZEA 4M8QA 4L4JA 3ROLB 2F54E 4HXAH 1QKZL 3MUGA 4N9GB 2EE9A 4R3SA 5C0BE 3V6FB 4AEEA 4EI5A 3AXIA 1P7HL 1KBVA 2BSDA 5KVDL 2FO8A 4LLDA 3QG7L 1QD0A 2NY0C 2WQXA 3ARFD 3BIBX 3NJXA 4WNQA 4LRNH 3N55A 2A4EA 4KK9C 4LKCB 2EABA 2XWBB 4QY8A 3PGDA 2FJUB 1KGUA 3UAJC 3VWJD 1EGJL 2A6KB 2MQ3A 3WTYA 5BRZE 1XH3A 2PP7A 4YFLF 1ZTXH 4P3CH 1YYLH 3ILDA 1BFSA 3FQXA 1MRCH 1PW3A 3FTVA 4XNBA 3DTUB 5D7JA 3RFZA 2CZNA 4Q0XL 2HT3D 1GPOL 2APVA 3KGRA 43CAB 1A6AB 5HVFB 2BVOB 4Z7QE 1WISA 5JN5A 4E9XA 4FX5A 2CHNA 1F4YL 5IHUH 1WD9A 5J06A 4P5TC 4TSAH 4E41A 3WEOA 5DJAA 4MMZB 1UB6A 3Q0HA 1JZHA 2M2DA 3SQBA 4N1HB 5AVRB 3FU3A 4F2ME 4M4RB 1W72B 1GOGA 2G4GA 2C3GA 2E7DA 2XX0A 4EXKA 4ZZKA 2EIDA 1OTUC 4TQPA 5IR1A 2E27L 1ZK9A 3QDJB 1UZ6F 5HHQB 2HLFD 3BYYA 3BPCA 4W4NA 1IB5A 1JPFA 1MFEL 3OAWA 4NPYA 5BJTB 7TAAA 5HD8C 4IIQA 3ESUF 5HHMD 1TCRA 5C0NC 3JXAA 3MVSA 5ACZB 3QDGB 2CSPA 4ZO8A 1BBJA 3HPJB 2AITA 3NP3A 4XC1L 3ARFC 3SZKC 2HVKB 3UAJA 4DZ8A 5B8CC 2EDBA 1YNLH 1J18A 3EJSA 3VWJC 2QMKA 2F1EA 2J56A 1IC4H 2QELA 4XNQB 4OVUA 1SQMA 4J6IA 4ACTA 4KOCA 1ED3A 2ZOTA 3F01A 1NCGA 2ZUSA 2D0BA 4WI2A 2EICA 3DMMD 5GRVK 1FN7A 2ZPKL 2HT3C 1ZHKA 2WKOA 4Z7OE 3KW8A 1D7CA 4HCRH 1HKLH 1BQRA 4P5TA 4DPAX 2H3NB 4ZDHA 3SIKA 1ESOA 4M6OH 4LCCB 1EFQA 1GGTA 3HHMA 2XQ0A 2R69H 5F1IB 4BZ1A 5EC1B 3QEQA 4OZIF 4KDVA 4V1DB 5BV7C 1PKOA 3U6XS 1CBVL 2NY3B 4ANVA 1ASOA 3RU8H 2NYKA 2PXYC 1KBPA 4AOFA 2HLFC 3FTGA 2HKHH 2JKIS 4FLQA 3L17A 4ELMF 4LEOA 4OFQA 4UT7L 2YD0A 3WV0A 3J27A 2XPZA 2W0FA 1U0QA 5JHDD 3WDJA 5B8CA 3BUYA 1PLCA 3ES6A 2JTDA 1YLBB 5B22A 2PR4L 4B9CA 1GGIL 1NCOA 3HN8A 4FHJA 1EAPA 1G6RH 1EJOH 3OPZL 4KKAC 1ADQA 1RPKA 3I74A 4XH2A 3T4AA 2YBGA 2PP8A 3GEWB 2FWUA 2YEVB 4QXGL 4CC1A 1A4CA 3JWDL 4CFFA 4Z6AT 3V0WL 3UW2A 3EGXB 3HR6A 3FOLB 1OAYL 43C9B 2D0AA 2VO8A 4H8VA 2P8MA 4HDIA 1U3JA 1IGIH 4BA0A 3PXLA 4MRQA 2HVBA 2IDTA 3CFTA 2P42B 3WNIA 1SHMA 2V4LA 3V4PB 5D7SL 3ZMNA 2G2RA 4HJ0C 1AG0A 4W70A 3VU2A 2OYLA 5L2KE 3WE6B 2H26A 1FZMB 2FTAA 2X1XR 4PV9A 5JA9A 3MV8E 4YLQT 1OK0A 1NGPL 3BUBA 4U3CA 5I66A 4CADB 5JXEC 2W0LA 4XMZA 5DQ9A 3O3BB 4POZD 3OM3B 3MGTA 4FNTA 4URTB 5JW4M 4FQLL 1OGTA 2AABH 2SODB 4PRHA 1INQB 2VW6A 1FHNA 5GJSL 3LQMA 4JGNA 3VNYA 4F57H 4BJLA 3F65A 4OGXH 1QFWM 4P3WA 2MPVA 5D2NE 2OMTB 1UZ6E 2YGPA 1WFUA 2AQRA 2NNAA 2VR7A 3FAXA 4UINH 2PF6A 4NHUB 1JUFA 3Q3GB 5C09A 2NY6B 3K8KA 1UCBH 5FUCE 3E1ZA 2NUTA 2JHJA 1HSAA 4Y2OB 4DOHB 3QZWA 1PMYA 4EDWH 2QR0A 4EAEA 3H9HB 3NFSH 1CO1A 5T5NG 1KLGA 2DN7A 3KM2A 3BT2H 1A9BB 5MEOB 3PFUA 3MCLH 4GRWB 3FAWA 4KVCL 1KEGH 1AGFA 1JGUH 1L9SA 3GSNA 5C09E 2YH5A 3OLDA 5D1ZA 4F8LA 5DJCA 4N2EA 3M07A 1S9XB 3IJEB 4YDJB 2HCZX 3H3KA 1IBGL 2ZF8A 3RWFA 5LG6A 3U6XA 2DMCA 4Z7UF 2EH8H 3H0TB 5JXEA 2XQYA 4OIIH 5F0LB 2ETWA 4JM2B 4ORGA 3UC2A 4C56E 5EN2B 3WTXA 1LO0L 3WS3A 3RX8A 2C3XA 2QQNH 1T4KA 1C5DB 4GKNA 2BIIA 2AEOA 4JPSA 2FJFA 3O45B 4MCYB 5ID0A 4U1IA 4W4OA 4HEMA 3WKNA 3QCUL 3CFJA 5D4IA 1AS6A 1KFAL 3IBEA 4K5PA 1JVOA 4OZIE 5EU5B 4XAKE 3IU4L 4OKDA 3Q01A 3GJFK 3QDGD 5E4IA 2GYSA 4Z95H 3UTPD 4OAWA 3US9A 2JQAA 1HZHH 4EN3A 1PCZA 2C4FU 1HZKA 3UTTE 3CFMA 4K0OA 3KM1A 4NQED 4KK5C 4ELME 2QKIC 1OGSA 3ZKND 1RAMA 4A2LA 4LAQH 4LQ1A 3LKPB 2VH5L 1EHKB 3C9NA 3S37H 3LZNA 3OB0K 4ZTPL 4Q11A 4IK7A 3FBKA 1DDTA 1Q0YL 1R5VA 4XZ4A 3AG1B 4N2CA 1FCCA 4F8TA 5CN3A 4JPIA 1W2KT 2APTA 2EE2A 1I53A 2EVFA 1MFBH 2XWJA 1XZWA 1RHFA 2IADA 2FO4A 4XWOD 2ADJA 1MJJB 1JK8B 2WVVB 1CXIA 2YA0A 2WB1A 4V1DD 3PWUA 2V33A 4JKWA 4MDJA 2UX6A 4IS6A 4LVHB 3WKQA 5AAWC 3QJFB 3FTYA 5IG7A 1HI6A 1UACL 4R7DB 4ZOEA 4I0PA 3VD0A 4WWPA 1XXDC 3L54A 4AW7A 5MHSE 1BF8A 4DFIA 1N18A 5C0RH 3CQQA 3NJIA 4KY2A 4NOFA 3BI9X 2R4RH 2VJ8A 3AACA 3KPSA 2M1KA 3MFGB 2QKIA 5AUMA 1LE5B 1N5AA 2DQJL 3W56A 4YZWA 4ONGL 3BW9A 3UO8B 4XVSL 4PJ9B 1NIBA 4YXKL 2O5XL 4DJMA 4NPJA 3VSTA 4KJQC 5CGYD 1XGQB 2ICWB 4H40A 5BS0B 1EUTA 1NAKH 4A2MA 4KHXL 1J5CA 1CGTA 2UZXB 1JF1B 5F88A 5A1AA 4PRPA 3FHQA 1WFOA 1YA5A 2JXMB 1I7ZB 2BY3A 4F5CE 4XHQA 4GIOA 4TLTA 4LCCC 2N7BA 1AP2A 5SWSA 4CRPA 3OJ2C 3QJTB 1DSWA 2IVFC 2K45A 2YPLA 3K2UL 5E9AA 5J9PA 3WLBA 2VLJA 3LN4B 4KK8C 4BELD 4ENED 2WWKO 5FKPB 1RCYA 2L7EA 4OJDH 2X2UA 4BFOA 5K39B 3DX3A 3FSVA 3CUPB 3QJHB 3ARYA 3SDDA 3KLDA 3WJMB 5F7HA 5SWSE 1YC7A 4TOYH 1FPTL 5CSGA 2VQTA 4PLKD 4TNGA 4E5XA 3ASNB 5BOJA 3GSOA 4HHWA 3ULVF 4OLUL 4TSCL 4Z7UE 1EGJA 3RWCB 1DVZA 3CFDA 3JT0A 2WQ8A 4XMPH 3OF6A 1UYWL 3UPRB 3CK0L 2Q7YB 3PV6B 4XBPB 2KQNA 5L4JA 4RMRA 1M57B 3IXTA 3SQOL 3PXJA 2CHXA 5DZAA 3LN9A 1QBMH 1VOLB 5CGYC 1SN2A 4AGNA 4N5UA 4XXWA 4APXB 2HLAA 3NJKA 2NY6D 1TR7A 3BAWA 5ESAA 3W0WE 1MCBA 2F8XC 1N9PA 4JPKH 4RESB 4WEBL 2ZUWA 4PJAA 2GW5A 5EZPA 2DKUA 2ID5A 1BG9A 4HQQH 4Q58C 2XT1B 4F91B 5LNGA 1NCIA 4ABWA 3KD4A 3RPIA 4OR1A 5DFTA 2VXQL 4FFZL 1J9SA 1RQ5A 2X87A 1ZJAA 5F1NA 1RD6A 4NZJA 3OH9A 4QRUA 5IJKA 4FERA 2F19L 3KJ6H 4DN4H 4KH9A 4WCYH 5J1AA 4ENEC 2H9GA 1U8CA 4KXDA 2IOOA 4HX1B 3WEAA 1JV5B 2OX5A 2HXAA 2PCPB 1YQKA 1A7OL 1VEOA 4JB9L 3ZKMC 4XP5H 3MRLA 2F18A 4JM2D 1ZA3B 4G8GE 3DBXB 2AW2A 3M45A 4LB8A 4C4KO 2VN3A 1MCKA 4KVNH 3U2JA 3B7RL 1SLUA 5EO9A 2KZKA 4HMDA 1KB5H 1MELA 4OLZH 2DB8A 4KMLB 1KB9J 4YH6A 4H20H 4GS7B 4Q7DA 4YHPA 4A7UA 1MI5E 3VACA 1KPUA 3W11C 1LGVA 1P7QB 1K4DB 2I7SA 1ZVSB 1QI3A 2LTQC 4QKTA 4R26L 4E9WA 4EO5A 1JK9A 2DQMA 4L4TA 4JZNA 4NKIL 3VG9B 1LTXA 4DQOL 2YMOA 3GBLA 4GH7B 4YGVA 3QJRB 2MQ0A 5LGYA 2YJQA 3JWDC 4X4KA 2X05A 3ULXA 2FIKA 3QIBB 3REWA 1GSKA 4OLVL 2BSED 3A6OA 3S98A 2O6CA 4NNYA 3NCMA 2AZUA 4YSAA 1JPEA 2WBXA 2WJ5A 4QF1B 5IVXF 4TNWF 1NMBH 1YAIA 3D85B 3IAQA 1A6VL 1UOLA 2FD6H 3OWEA 2APXA 3VQ1C 4H8WH 3L3IB 2QEJA 1RL1A 2Y2TA 4XPBH 1S7UA 1G7LB 2XKSA 2RCSL 4KJWD 4QRTB 2GIYA 4WW2B 5IUSA 3EBGA 1P1VA 4I18B 2A77H 1C5BH 1E2VA 1W6LA 1I9RH 1OCWL 4XCYB 4A7VA 1BZ9A 1RIUL 2P47B 4W9JC 3GMMA 1JDAA 1ZT7B 5IEHA 3KE0A 1R3LA 5AYTA 4ZG1A 2VZOA 4CUCA 3L5JA 5L6YH 4WI7A 4NQVB 5DEJA 5DO2C 2DWDA 1HHJB 4F8PA 4OCSH 1MAJA 1IO4C 3LNGA 2NQ3A 2O6PA 4QHLA 1HL4A 2J44A 1Z9OA 1PZBA 4JO3H 1W15A 4IMKC 5A2BA 5GQBA 5HVHB 1HAWA 3CVBA 2AGJH 3D05A 1J10A 2A9AA 2XXFA 2CCVA 1X6NA 3D0AA 3UTQA 1L4IA 4HEPG 1J5DA 1N64L 4LDCA 2GJ6D 1MFDH 1TVBB 2VLLB 3BHBB 4LPVA 4K8RD 4NLAA 3T0WA 5T3ZD 1CDWA 2V0AA 3GRGA 1NGWB 4F58H 3UTZA 4EF3A 3ULVE 5BS0D 4WSGA 1U8QA 4YSTA 4UB0L 5GGQH 4GMTH 1F3JB 1Z3RA 2YQ2A 3RB5A 2M26A 4NNXA 4HF5H 5F72S 1IAOB 4NZTH 4GG6B 4HXAL 1FIGH 3CLEL 3HVNA 3L3JA 1XGUB 2PPEA 1BVKA 3GIZL 5E5MB 3FN3A 1IGYA 2HMIC 2Z8WC 3MROA 4PJCF 1CI5A 4AKPA 3ZX1A 2LHAA 2A3TA 3IDUA 4GEIA 4LRNL 3DARA 3N40P 5D96C 1ZHBA 3ZIMA 5BRQA 1O7SA 1JZ7A 4FFYH 1OAUH 5GGUB 2VL4A 3RBSA 1X5IA 2JKTM 3HZMA 2EDFA 5E8OA 5LXVA 3IKCB 1LXMA 1YYLL 4JAMB 1MRCL 1JZ2A 1ICTA 1UT4A 1H5BB 1WC7A 4IMKA 1FUNA 4YBQC 3U2IA 4U1GC 4DCQA 5K9JH 1EJFA 4UUJB 1F8TL 1NEUA 1H8OA 3NIGF 2IAMA 5FUOL 4K7PX 4X4YB 1FZKA 1NIEA 1QQDB 4EZKA 4YC2B 5EZLB 1JPST 4L18A 1OWWA 5KSVB 4JFXB 1BXXA 4HJGB 2NR6D 3UZVB 4EQ3A 1ZT1B 1NWOA 3HRZB 3EJZD 4H8QA 4UYQA 2DQFB 2VE6A 3QS3A 4JR9H 1XCTB 4QRSB 2MEJB 3O8XB 2R0KL 3PNWB 3OQ3B 4HUUA 5EZIH 3WIFB 1ZGLP 2GPZA 3BGFC 2FYYA 1OT2A 4AE0A 1CGVA 4ZYKB 1IBFA 2KL6A 4OGYH 4R4FH 4CMHB 1CT8B 1LK3H 3D9AH 1BZ8A 5LBSH 4N0UE 2YMTA 1DO6A 5LNEA 5FHBL 2G4EA 1GR7A 1UC6A 1H0DA 2VDQB 3O4OC 4YHZH 1TBPA 3HLAA 5AW6B 1ORQB 2ZXAA 2ESVB 4HIJB 1ACYH 3KNBB 2BSTB 5IVXE 3FQYA 4MQSB 1YNLL 4IJTA 1OGPA 1DE4B 5K1NA 1IC4L 4TUJB 2B1OA 1MRDL 2X70B 4M6AA 4LE8A 2EINB 2J5LB 3FL7A 3QI9D 4N22A 3NMEA 3OAYH 3BO8B 1SDDB 3OC5A 2M8XA 1Q9WA 1YNKH 4LCWD 3QZLA 3P77B 1CZ8L 3FB7A 1HKLL 5I1HH 1OTSD 3CVHL 2VDPH 1C1EH 3TO2A 3TL5A 3MRIA 2GIXA 4M6OL 3CG8A 2LLGA 1HHKA 2VXSH 2NR6C 4JO2L 5H8DA 1A1OA 3QIBD 2BOCB 2VDMB 1UTDA 2AK4A 2E9JA 3QORD 4M1CC 4TPRL 2ODHA 4AENA 1PZCA 4P2RB 3RU8L 4TULL 4JPVL 2ZCZA 2DWEB 3D85D 3AG4B 4M1GH 4DP9X 2DM7A 4GSUA 4NKOA 2Z9TA 1N19A 3P0YH 3N2JA 2CDEA 2AEQL 3SDXA 2BWQA 1IQDB 1EJOL 3OKDA 1XD1A 4Q6KA 1EEUA 4F27A 1P4BH 1PG7X 3BXNB 2EECA 3NCYS 4QTFA 4LESA 4Q8BA 3FFOA 5E5LA 4ODHH 3QI9C 3B9DA 2AV1B 1ZXQA 3QQDB 1M56B 4K9EL 4PJCE 3VNZA 3TYGL 4WF7A 4MXWH 5TGBB 2FL5B 2LE9A 2Y6SC 2E75C 4M3HA 2KHAA 1IGIL 2FHFA 2MNJB 1OTSC 3H9SD 1SGKA 4GG8A 1ZHNA 1U95B 4K23H 5IJVB 2H8PA 2OMWA 1PNDA 3SPIA 5KVFE 3WFDH 3QIBC 3H7BB 4I1NB 3RY6C 1KXTA 1RH8A 3IJ8A 2OSWA 1TYEB 4DPBX 3EDJA 2BS9A 3QORC 3CAFA 3LZRA 3NIGE 4Y2DB 1NC2B 3ZL2A 1CDCA 4X5XB 1XF2A 2OL3B 5GSVA 5GGVY 3OXSA 3WCYA 2Y9RT 3ZE2F 3K2KA 3SY0B 3BUDA 1I3VA 4K94H 3G6DH 2X4NB 4FQXA 2AABL 3WUWG 3TM6A 1REIA 2A83A 5EOQL 3MJ8B 2H45A 4M1DH 1YPZF 3FFCB 4X7TB 5DEFA 3IMBA 1T3FA 4F57L 5HYQA 1VFAB 4XNYH 1TO4A 1NIFA 2VB5A 4P2YA 4Y1TA 2CE6A 1NEZG 3WD5H 1EEYB 4IDLA 2XA8H 1XF4A 4XCFH 4H5SB 2YJLA 4UINL 4Z3TA 2NNCA 3IGAB 1A64A 1AJ7L 4GKSA 1SY6H 1NKGA 1EEZA 1W91A 2KMWA 1QPPA 2XQYK 2YRLA 2E59A 5E1AB 2EE6A 2AEPH 4EDWL 2HT4D 5MEPA 3NFSL 2B8OT 1Y1DA 4M7LT 5AYUH 2WGNB 2BJMH 3BT2L 4OU3A 4PLJD 3MNMA 1IGCL 3MCLL 5K9OA 3CHSA 2EYRB 3MRQB 1PJWA 4M61B 2AKRA 4XPTH 5B21A 1KEGL 1NGYB 3NDZE 3RY6A 5HGGS 1W8EA 1KV7A 2CPCA 1HEZA 2IDSA 2E76C 4PJXB 4ZX6A 4N2MA 3X3FH 4BKLB 1U30A 1ZS8A 3IAPA 1NGXB 4RQQA 1KENH 3D7QA 5F7UA 2FZ3A 3MKGA 3ZYOA 4MA3A 4KQ4H 3US0A 1FL6A 3U7AA 2Y4SA 1JG9A 5DTFB 2MOVA 2VXQA 3WL9B 4ZFZB 3FULA 4TLUA 4JFVA 3DIFB 4JVPA 1K4CB 4YR6B 5IB2B 3F7YA 5FO8B 4KKCC 5DEGA 1E40A 4PR5B 5GS0L 3JWNC 3CWUA 4K71B 5D1ZI 3WS6C 2DM4A 4DO4A 1OARH 1U3HB 5C0GA 1Y07A 4Z95L 4X5WA 4BUGA 1HZHL 1X7QA 3CZGA 3ZDYB 3NJJA 4WFFE 5JW5B 5IQOA 2VISB 5AW2B 1PIFA 3UAEA 4ZFFA 4X8XA 3CHOA 4PGEA 1F13A 4BXSV 3CFCL 3KPLA 2EYSA 2V17L 2IH9A 4LAQL 3QK0A 4W9DC 1TXKA 2HKAA 3H6JA 3QCTH 3S37L 4AIEA 2ZSWB 3HAEG 5CKGA 2RGSA 3WFZA 1KGCE 1IUZA 1XL4A 1DEEB 1GA2A 2CRIA 2WO4A 4MZIA 4BIKA 3MJ6A 5BUPA 1KBWA 3P4NB 5E94B 2XQBL 5KSAA 4FI7A 2Y7QB 2WANA 1XCWA 4ZQKB 3S97C 4XE5B 1B4RA 1B90A 2VMEA 3T3PF 4B41A 3VA2C 5F7MC 2R2EB 5J56B 2WO3B 1SM3L 2MPAH 1NFKA 4KMTH 1DSYA 4P2RD 3SSGA 5ENWA 5BMPA 3QHZH 4WHYG 2JTYA 1PQZA 4TNVK 3LXUX 3T0XA 3WS6A 5JW4N 4HZLA 2NZ9D 3QUKA 4UT9L 2PW1B 4ODXB 4UTAH 2C4XA 3D0VB 4DGUA 5D7LB 4I9WD 4HU8A 1D3UA 1YEEL 2AEIT 1YPZA 1BZDA 4I88A 3GK8L 2IH1A 4I87A 3O3DA 3G7TA 3ZE2E 1AO7B 3H2PA 5DHDA 1F4XL 5EB9A 2IWKA 3RGBA 4A55A 3KWWB 3FSAA 1M2VB 2X9WA 3N1GC 4MJIB 5DEZA 3Q5TA 1PZ5B 4NERA 5DD6B 1GTNA 1YPZE 4UU9B 1T66D 3OC8A 4Y19A 4MA7H 1N4XH 2A1WH 2WCSA 1AE6H 4CC0A 2GFBA 1A6TA 2WXIA 4GKOA 4QDGA 5F89A 2FATH 2XPGB 4HS3B 4P99A 4M48H 3DOIA 4F7PA 5GIRB 2VM9A 5TF0A 5CJ8A 4FYQA 4J3BA 5BNXD 3MCKA 1HH9B 1ZHLB 3RJDA 2FECI 4IRSC 1BZ7B 2CH8A 5KW9L 3T0DA 4XMLL 2PCFB 5E2WH 1SXZA 2PYFA 4Y2DD 4BCYA 1NC2D 4K73A 1F6AB 5EU4B 4FA6A 1JMZA 1ES0A 2VMDA 3GGWB 2C3VA 2EKSB 4JFQB 1GS7A 5GXBB 2DWTA 4TSBL 1DANT 2XWEA 2H5UA 4G42A 2W5PA 1JRHI 3MLZH 1G1OA 4WV1A 3HCVB 3LYRA 2OMUA 2WMPB 3FFCD 4XMPL 2DJUA 2VWEC 1DN0B 2F8VA 3P3UA 4L8CB 1DP0A 4RZCB 2WQWA 1ZEAH 2IANA 5HGBA 2J73A 2WXMA 1HOCA 1QBML 2FLRT 5E2TH 3VE0B 1A47A 2QQLH 3VFSA 3G6AA 1HH6A 3L4TA 3ASWA 4YSPA 2QGBA 1HSBB 3DX0A 2QFRA 1T66C 1ZTXE 5HHPB 5EO1A 4DUVA 5ABAA 4PLNC 3TZVB 4ZD3L 3SBWC 8FABA 5HHNB 2F7LA 2Z92A 4L3CA 2ZXEB 1THCA 3A23A 3QFDA 3ESMA 4XO9A 3QZPA 1J88A 3DDFA 2N3JA 4Z78A 1JJUA 1E4WL 3FTUA 3KJ6L 2YGOA 4DN4L 4WCYL 5EMYA 4QHNA 4BKSC 5JHAA 4ZSOB 3GNMH 4ADGA 3EYFB 3ARTA 4W9HC 5CU9A 1CICD 5EEVA 4TNEA 1EHLL 4BCXA 3VQLA 3PG2A 3GRWH 3D4YA 3MRGA 4KVNL 1GC1H 1AC0A 4FLRA 3AADB 2V3FA 4OLZL 3SE4C 1P6FA 1NCUA 4H20L 4A7TA 4AMWA 1P5VB 3HG1A 3T3PE 4ZFQA 2MCPH 2YUWA 1U6AH 1YEDB 5C07E 1QZ1A 2DICA 1X5GA 3KJ4B 4IBZA 2J88H 5DJ8B 2H6UA 1GAFH 4LSPL 5A16B 5AOMA 1RVFH 4DESA 1QRNB 2Y7LA 4K9EC 9PCYA 5JQ6H 1X5ZA 2X41A 2NYZA 4HCRA 4JFEE 4WHDA 1U8OB 4CSZA 1VKXA 1CFQA 2CLZA 1EK3A 4R4NC 1UKQA 3HS0B 3SBWA 1TT6A 2G0LA 2JE8A 3GWJA 3X14A 4DEPB 2FD6L 2ZAIA 3IGFA 1YAZA 2R69A 1UWFA 3SOTA 1ZRUA 1E50A 3AT0A 3LMJH 4IBTA 3IK2A 2D4DA 3GBMH 3FQWB 2BHUA 5F6HJ 4XPBL 1I1FA 4LEEA 2ATPA 4ISVA 3GRBA 1HVXA 3VFUA 2ED9A 3BWUC 4GXFA 3ARBC 2KS0A 5MERB 2UY7B 2A77L 1C5BL 3GS0A 3L2LA 1MREL 4HKXA 4QHKJ 2FJSA 3SGKA 1I9RL 4HG4K 2F5BL 4TUOA 4QRRA 4W9GC 3S35H 1CICC 3F83A 3QW9A 2ZICA 2ZWLT 3GMQA 4HWBL 5L6YL 3W39B 5IFAL 3ZQWA 3SE4A 4GBXA 4LSQH 5GS0D 2OMBA 3R4RA 4M5SA 4OCSL 3IPEA 1G6RA 1T5WB 3IMUA 3NIFB 4U1LA 5AVSB 2K78A 5IJCC 2HTKC 1E4HA 3E2HC 3PWVB 2HJFB 4N0RA 2FSDA 3I9GL 2X38A 3ZDXF 3C5XA 2AJVL 1TQCB 1U8HB 2AGJL 4S1DD 1IGTB 3GM8A 1D3CA 2BOBB 2DDQL 3QQ4A 1SXSA 4MNGA 3TT3L 1CE1L 4G72B 4MJHA 5EUKA 5ID1B 5KBDA 4N2GA 1ZLEA 3RVVC 3T1FB 2YD7A 3PHQB 1AO7D 3V5HB 4QR7A 1NANH 4EAIA 1KO9A 3CSGA 5EU6E 2ZKHH 2VN4A 5AW8B 5TQ2L 3SCMD 1RZFH 1QNCA 1LDPH 4ANWA 3RZCC 4HKJA 4CVWA 5FF6A 2MMXA 4MXVF 4J2XA 1JDYA 4PJHA 3NAAL 5GGQL 5ITFB 1ZSDB 4GMTL 1KGXA 2UWEF 5F9JA 2VCOA 3ARBA 3LN5B 2A9ML 3B9KC 1BM7A 4HF5L 5MENA 4NZTL 2Q87A 3QWOA 3CHRA 3HG0A 3KXFB 3W5NA 2WLIA 5D7KD 4NENB 5EEZA 3H54A 1SFDA 2CIKA 4TVUA 2Z35A 5B1BB 3F0ZA 5GZOC 1LO5A 1QSZA 1QG3A 2OI9B 2NY4B 1C08B 3H6AA 1UD5A 3OJDA 1XF5B 1O5PA 3U79A 2VXTL 1OGAA 1XR8B 2B4CH 4XP4L 5DS8B 4NWUL 4PTUB 3M17B 2NNFA 4JDZB 4PJ7B 5CINH 5E8EA 3E80A 5LDUA 1Y0LA 3FZUC 5GS0C 1NCDH 5FYJE 2C8NA 3MRDA 2PCYA 2HFTA 3K0YA 3CWAA 2AJXL 1BFOA 1KTBA 4BV1A 1PCMX 35C8H 1RI8A 4MTMA 5EU3B 5K9JL 4RSVA 2DAVA 1CDIA 5H37H 3DHMA 3KBEA 3RNQB 5CJ5A 2WSDA 1ZK5A 2X9XA 3PJSB 2HA1A 2I07B 3ATAA 3CVIH 5AW0B 1JGEB 2YIHA 2J1XA 3ULUL 2X3CA 4CSPA 1WF5A 2K3HA 1VERA 3MNWB 2OW6A 1OSYA 5CS7A 2WXFA 4MMYB 2HPTA 3SCMC 5I30L 4PMFA 2AJZA 4OLWH 4JR9L 4P23A 4OQTL 4CN6A 5M7QA 3ABZA 1ETZB 5EZIL 4NFDA 2O3OA 3B9KA 2W60B 2ADIA 2YAQA 4F9PA 3JSSA 1JGVL 3G5VB 3TZVD 1LK3L 5GZOA 1H9VA 3L13A 2E0PA 3CZFA 3IJYA 4AXWB 3FUDA 4KQ3H 5C2BH 3ZO0A 1U2HA 3B1TA 1BVZA 4DK6A 4YHZL 2MKWA 4YFEA 4GRLB 4FLOA 1LDSA 4PJ5E 5IW1A 1C9BB 3EYUL 1WYJA 3GMRB 4KJYB 1MG3C 5BW7A 1CGSH 4I4WA 5GS2H 1FZJA 5HYJA 2V3DA 3DV6B 5FKAB 1XGZA 2VSCA 3KYKL 3RWDB 1QLFA 1A3LL 5HHOE 1S78D 5EOCJ 3CFKB 5FGBC 1BLNB 5IB1A 4BFIB 5FV1L 3FH8A 4N1EA 3P0GB 1YNKL 4X8JB 3VXQB 3BIKB 2OMVA 4ICWA 3SKMB 1DJGA 5I1HL 1IEBA 1M9SA 2VDPL 4W6WB 5E00B 3BZ5A 5CLYA 1QUPA 5LGJB 3GFUA 1DUZA 1Z6JT 2V37A 2Y07H 4QNPF 5K9QI 4LSVL 1A1NA 1FNGB 2N1TE 5FYLE 4GYBA 1QRND 2WZ0A 5F93C 4R4BB 1CD0A 4AY0A 1T0NB 2AXFA 4OGZA 4X6DB 2Q6WA 3TBVA 3ZDXE 1AQKH 1R24A 3LH9A 4LCVA 2WWKT 4M62H 3FO0L 4M1GL 1L6XA 4MWFB 4TTDD 3V6OE 2BLFA 3FQTB 4GAYA 1FHGA 5DK3A 3G5ZA 3P0YL 3EYQC 1A7RH 4HUXA 3L5HA 4YHNA 1PZ2A 2HLEB 3HC0A 2R2HB 4MXVE 3ZE1B 2YLKA 4R96B 2UWEE 1E28B 1P4BL 3V5DB 5KSUA 5FGBA 1IIKA 3VGGA 4NO3A 2D9QB 5BZXA 4HJEA 2CM5A 3WIIH 2G3NA 4ODHL 4X9GA 5EF0A 3GB7A 5FOBB 3LZLA 3ZRCC 5GHWH 1NOLA 3F7VB 4DTGL 1BX2B 4R0LB 5CF3A 1ZANH 3DA0A 3KPTA 4UQAA 4NKMA 2G9KA 1OB1A 3NEEA 2HL8A 3SE3C 4DP1X 4XCNB 4JO1H 5FM4A 1BD2E 5KG9A 4CAGA 1YZZA 4WI3A 4EKXA 5IF0A 1BWMA 5AKVA 3RG1C 1TQTA 4N8PA 4D7RA 4QCIB 1MCWW 3DX8A 5JPMC 4GB9A 1E7VA 1A2YA 3KEDA 2XA3A 3BUTA 5IROC 4WSKA 5K9KB 2W07A 1B4JH 3ZDZB 2X4TB 3HKZA 5I1GL 1ZDSA 3HW7A 5DC9B 2DBLH 2H5AX 4TTDC 3PIQA 2BCKA 4K94L 1TZAA 2PTVA 4A7GA 2AXGA 4C4KT 4M1DL 4FYTA 4GUQA 1P7BA 1E2WA 4RGNE 4XNYL 4IGBA 4OF7A 4X6EB 1KYOJ 1C16A 2CBMA 2D3LA 1ZAGA 4PGJA 5EIVA 3AROA 1QNAA 3DGGB 3OR6A 3O4LE 4X4XA 1FH5L 3EJQA 4Z8FH 4LP8A 1SY6L 1RZKH 3AWGA 4JL1A 1I7RA 2X4SB 3GLAA 12E8H 2GJZB 1UM6H 4ODSH 3TPUA 2AEPL 1NKRA 2BNQA 2L7UA 3BVUA 3SE3A 1JXDA 2YR3A 3S36H 3VXRB 2BNRE 3Q2WA 4WVRA 5JDSA 5AYUL 3OGCB 2BJML 2AQTA 3TH4T 5CEXA 2F68X 2IV9A 3O6FB 4JHAL 4MQ7A 2VN5A 1URLA 1JN6B 1JZGA 2NY2C 4JY6B 4LHUB 4N0FA 4XMKL 5AKTA 5FFOA 5KYUA 5JPMA 2Q76B 5D93C 2JQMA 2GAZB 5IROA 5H37G 1KENL 3X12A 4DP5X 2R0LL 5I17A 4X7DC 4GJTB 3LKNA 3RI5F 1RPUA 1G9HA 2QVMA 4HJSA 4LAJH 3H2WA 1K5WA 3UJIH 1DZBA 2P8PB 5EZJA 3ET9F 3FSOA 3QDMB 4IKNA 4A7QA 2BY2A 4QNPE 4JM4H 4KRPB 3DGCR 4LNVA 5AZ2L 4WX8A 5H4YA 4BFFA 3F7LA 2ARJB 5B1JC 1F1DA 4PV8A 3WN6A 2EXYD 3K6DA 5E0FA 1N59A 5CJQH 3TYFB 1YEJL 4QYOB 3NN8A 1KB5A 4TUKL 5PCYA 2NOEA 5B39B 1F6LL 3S5LB 4CVUA 5KYXB 3CC5A 1O6VA 1SJHB 4MA8L 4WLCA 4LL1A 1VFOA 3E38A 4AM0A 3BAYA 3D87B 4GQZA 2C9QA 3GMLA 3ECVA 5GGSB 3NTCH 4IU3A 2WAQA 3ULUD 3O6LL 3IMTA 1NC4A 4WWKB 1WHOA 2XIIA 3DXAD 4L0PB 5KS9A 3S8WA 1PEZA 3S3PA 3UPAA 2W38A 4MNQB 4EJZA 1MFNA 1S5HA 2EHBD 5HJGA 1I31A 1R1CA 1LEGB 3ZZQA 4JCLA 2VDMH 2P5ED 4RZKA 3B3IB 4YVUA 1JPSH 4IW4C 1WA1X 4Y1SA 4POYA 3HC3H 4FXGC 3QHZL 4ODWB 2BH0A 2QQQA 1XGTA 5IBUB 4XGZB 3KWUA 5AD0A 3KH4A 3CBJB 3PWLA 4F3FB 4BK8A 2EXYC 2WQUA 5E70A 5FDWB 5C71A 1EHAA 2SEBA 4OJCA 3UTSD 4CDGC 3AQDA 4GQQA 4O58H 4HAKA 4OLXL 4M3JA 3T65B 1QMUA 3WDHA 3F3HA 2FKMX 1LNUA 3GMNB 5D5MB 2NOFA 3W9EB 1S7SB 3FUJA 4JFUA 5EF2A 2JB5H 2XKUA 4D9RE 2X12A 1N8ZA 4OTXH 4RMUA 4HJTA 3UJTH 4MA7L 4E42B 2A1WL 3ULUC 1BF2A 3OAZH 1RZGA 4AG4H 4ZFOA 1AE6L 1K8IB 3HBPA 3WUWA 2OQJB 1DLFL 2W9EH 5IFHL 3T8XB 1V7ML 4OB5H 2XZQH 3WTVA 1M6OA 4CVXA 4FKHA 2VLME 1NDGA 3MDJA 1NEZA 3MV7E 4LOFA 2WVSA 2VUKA 1J0YA 3F6LA 3FUHA 4Y9GA 4DP7X 5LBVA 2Z0UA 4FXGA 5E2WL 3GBEA 2OSLA 5GGRB 2CJUH 1HE7A 1IGJA 2QDWA 2OL3H 3KPOA 3L5WA 1JZ6A 1XXFC 3PWJB 3IDJB 4GSRA 3QIUB 5G2NA 4JANB 1KJVB 5BQ7B 2DMHA 3ARGC 1KIUB 3WY4A 4FFYA 1A0QH 1U8KB 5CZXC 4ADIA 3MLZL 1NMAH 2R56H 3PL6A 4B97A 2F53D 4J3SA 3HI6H 4ELKA 3TEUA 1FVDA 2Z7ZA 5CMAB 3DX7B 4MHHI 1HAUA 4W9KC 4I2XA 3HC2A 5E2TL 4WKZA 5TH2B 2QQLL 5ESVB 3ZHNA 1BPVA 3SJVA 4BGLA 4ZUTA 2R1WB 2HVJA 2LLLA 2PYED 4PRNA 3S2CA 3CHPA 4FYRA 2LAEA 5ALBH 4OZGA 2QHRH 4UANA 2V7NA 4LOUD 4X9YA 4Y1AA 3UDWC 1ZE3C 1WICA 4LP4A 3BGAA 5M94B 3NVQA 1S7XB 4PW9A 3V2AR 2FWOA 3BP6B 3O6FD 2P5WB 2V9JA 2NYYC 2JCCB 5D1QB 5DRWA 1OIOA 1WTGT 4X9FA 4HISA 3ZTEA 5I75B 4I9XA 3GNML 5J3HD 1KIRB 3IT8D 4FFWD 5LBSA 1MCHA 1NBYA 3JZYA 3RJOA 4F7MA 1QI5A 3GRWL 3HUJB 1F97A 1GC1L 2VM4A 2BNUB 1MVYA 2XZAH 3KZ8A 3ARGA 3GMOB 4MLSA 3TWCH 3QDMD 5CD3A 5F7BA 4YUEL 1KUMA 4N2KA 1P4IH 2FBJH 4KRPD 2WIIA 1YEHL 3B5HA 1B9KA 5HHME 2XWXA 5IVZB 3BFWA 1B6UA 2VC2B 2XG5B 1GAFL 5CUSH 1RVFL 1JHKH 3C5ZA 3DECA 4I3GA 3BPNB 1T6AA 3GTNA 2NXZC 1L9NA 3GT6A 3FOMB 1KN4H 2XYCA 4F33A 1C8QA 4JN2B 1ML0A 2B7DT 3V0VA 5ALCH 3ZE0F 3BAXA 1JZFA 3FUNA 1FN4A 5E6RB 5BMFH 3ZT6A 3ARDC 1CE6B 4B9IA 2B59A 1RPQA 2WXNA 3L7FA 2DIAA 4WWKD 1GKEA 3MRCA 1MVFA 3IKKA 4UOW0 3CLFH 4N6QA 1UB5B 4UQEA 5E6IB 1X9QA 4F9LA 4M7LH 4G1EB 1RJLA 1OPGH 2HH0L 4MNQD 3S35L 3L95A 4HP5A 4FFWC 3APMA 3A6CL 5GRYA 3MNDA 1EZVY 3RX5A 4KC3B 3V6ZA 1DN2A 3ZN6A 2BY1A 2FT7A 4K94C 4WHTB 5K93A 4LSQL 1D9KB 1VCBC 2FJGA 1T5KA 4PJDA 2X4UB 1HCZA 3O2VH 2OJEB 4ANUA 2P28B 2OYPA 3FW6A 4RGMB 1OPOA 4GMSH 1F11A 1L3NA 1M7DB 1X5XA 5JHDE 1Q9LA 4E36A 2FQEA 1U3YA 4HWZB 4NAMA 5F71A 1CLVA 5ERWB 3MZGB 4AZ8A 1U41A 2AV7B 2W88A 3K71A 1PZSA 1ZVNA 4ZS7H 5FB8A 3C08H 1QO3A 5F9OH 1RZFL 1UQSA 5E99L 5GJTH 1BW8A 4PVBA 4HGWA 3SBPA 4CA4A 2V2WA 3RPJA 5INDA 4HK0B 4K3DH 5FA3A 3ARDA 3RVXC 4R7VA 4CJ1A 4LSTH 5BZDB 1KFIA 1Z5HA 1BFTA 4MYPA 2R29A 4LPYA 2F58H 4OZFB 4R97B 3BWAA 1P53A 4DKEH 4BBWA 1BVLB 1EMTL 3FT2A 1S2EA 2H2PC 1JWMA 1F6FB 4U1SA 3TBYA 3PWNA 3MJ9H 4AT6A 1TFHA 1IAIM 1XSKA 2MIZA 1EV2E 1MHPL 2JWYA 3MRRB 4RAUA 2D0HA 4FQ2H 2VR9A 2HFFA 4M5ZH 2GT9A 3GLZA 4KY1H 2W59A 5IGXL 5CINL 2X4OA 3HPLB 2ATAA 5EBMA 1NCDL 1CK0H 4N9GA 1QSEB 3V6FA 4JDVA 3UROR 4UV4H 4NQDA 2VW4A 2LABA 3P0VH 3QIUD 3NJGA 1AD9B 1MW3A 4PI2A 1SRDA 4Q4EA 5EULV 1A6WH 2XWBA 2Z3FA 4LKCA 4RMVA 4DGYH 3MRFA 4F80A 1YYCA 4FA8A 1G7JB 1RV6X 3VXMD 5C0EA 1YEWA 4MNHB 2WOYA 1QBLH 2A6KA 3H2QA 1N2RA 2ZYRA 3EKCA 3INUH 3P9MB 3VI4F 4OZHA 5IREA 4R8WH 5HY9B 1JI1A 3QZBA 1AG6A 1R4XA 1TENA 1DBKH 2CUAA 4J8RA 1CLZL 2XXCB 3BGMB 4IOFC 4X5LA 5CKAA 43CAA 3ZYIA 3ZYJA 1KPRB 1I1YA 2BVOA 1QZNA 3JV6B 5DLMH 1MNNA 1W0WB 4JHBA 4R2GB 1NL0H 1U8JB 2PETA 3RZWA 3O3UN 4K5OA 3LB6D 1TPXB 1CXFA 2HJKB 4KQ3L 3RGVB 3O0RH 2CHZA 4UF7C 3TJPA 2YSTA 5C2BL 4M4RA 2P5WD 3QEUB 5LGHH 1MJ7H 5E1HB 5D1QD 2H0FA 3KL0A 4JFDD 1RSYA 1ODAA 3LS4H 5JPNC 3QDJA 5HI4D 4RMTA 3KBFA 3ZE0E 5HHQA 5I6MA 4Y5VC 2C1OB 3VWKB 4YEFA 2DMKA 3TV3H 2GEEA 5AOIA 1DCLA 3K1KC 2VSDA 5ACZA 1P5UC 2C1PB 1URZA 4LLVB 1XB8A 2A6DB 1X44A 4U6VL 1IJ9A 3NGBB 1EAJA 4P49A 4HJHA 4YSUA 2NOLA 4UZSA 5KVDE 1DBBH 1USZA 5C0BB 3EIKA 3P4MA 5JOFA 3MRHB 4YPGB 5FWQA 1W9XA 1H3VA 3MLUH 2BP3A 2X6MA 1I3RA 3QDGE 4XN2A 3UTPE 3UACA 3F04A 5FGSA 4BSVA 1MSPA 1OSPH 3F10A 3NA9L 1I85A 3X11A 3W38A 3I3DA 4NQEE 4GRWF 1CMOA 2YA2A 3UXFA 4PRIA 1AQKL 1WAEA 4HUVB 4K5MA 2H3NA 4HBQA 3RIKA 3NK4A 4L05A 2BDNL 4M62L 5HJDA 1AOZA 3CZLA 3P4OB 2YXVA 4DERA 3TURA 4QOKD 5EFIB 3QUXC 4BWWA 4PY5A 1MLCA 3QWQB 2CK0H 1A7RL 5DXWA 3RDTC 4JM2F 5C3LD 2YPVH 3LZFH 5JPNA 1TQBC 4Z7QB 3QUMB 4XOBA 3ZTNL 1RZ8A 4WRLA 2IFFH 2YUXA 1RLBA 2FH8A 1U8IA 3OL2A 4UYPA 5IOPB 2JJVA 3PAZA 3OH6A 2ZKWA 1XGYL 2HWZH 4UTAA 2CMRH 4RX4A 3ISYA 3NK3A 4V1DE 4WKXA 5D1XC 1GMIA 3PUUA 1RIHH 3RE0A 3RYMA 1D9KD 5GHWL 5A6MA 4QTHB 2GC4C 4PWFA 1OTTC 2O5NA 1ZANL 5GS1B 2YWYA 3PUCA 1CF8L 4LEXH 3B8YA 3U83A 3TF7C 5IQ7H 5T1KB 4NJAL 4IU2A 3MBEC 4B60A 3JBG7 3LKQB 3T2PA 3PF2A 4L2LA 3VJ6B 5KWYC 2A6JB 2CLRB 5F9WC 2HPOA 4FG4A 5JW4R 3BPNC 1HCFX 4NB7A 2Z31B 1HYSC 4Y9CA 1XAUA 1OF0A 1B4JL 1D5ZB 1Q1JH 4JN1H 3SGEH 4NN6C 1MQ8A 3VRLF 3QUYB 1TTAA 2DBLL 2Y36H 4Z3EA 3UL4A 1WSST 3BVXA 3RDTA 2VXUH 2HZSA 3VI4E 3ORJA 1JGLH 1NDMB 4OJFH 3F84A 3B7SA 4NPKA 4F8QA 3ELAT 3GJEB 3HE7C 1HQ4B 1MCNA 1AGCB 4CADA 4LLUA 4EZJA 4L5FH 4FTVA 5E8PA 2VDRB 2P48B 4HWEH 1GC1C 3LKRB 1INEH 4KKNA 1HHIB 3A67H 3AJ7A 5I6OA 4Z8FL 5IMMA 5J6GB 5EEXA 1RZKL 1Q0XH 4PJFF 4ZUSB 4ODSL 1UM6L 1V55B 2W92A 5CM1A 1HXMB 4MCNA 3SN6N 1HINH 3MBEA 2DLTA 2F74B 2OMTA 4H25B 1F3DH 4AVKA 5MP6L 1SMAA 3U1SH 4K7FB 4E9VA 3CCHA 1WFJA 2L4OA 3BPLB 1HS6A 1FZOB 3KMDA 2P24B 1G7IA 1OP9A 3H9HA 4M43H 1URIA 2ZCHL 2NOBA 1RZIB 1A9BA 3BZFB 4KU1A 3P2TA 1UFUA 3UJIL 4UWQB 3PAUA 4AX3A 2EXTA 4X99A 2VDLL 3I6GB 3KHQA 1A4JA 1QSFB 2ZOLB 1WV7T 3GBNH 4J3OH 4QRPA 4R2GD 4AM0Q 1S9XA 3A4AA 3IJEA 1A65A 4NBZB 4YDJA 3VXOB 5AG9A 3T6ZA 1A4AA 1LD9B 2NSQA 4U0RC 2DQCH 5F97E 3RGVD 4ODBD 4JM2A 1V27A 4QRQB 4C59B 1SVZA 1WZKA 3GRWA 4GRWE 5CJQL 5HJBA 1C5DA 2IJ0C 2ZX5A 5I1JH 1VA9A 4MCYA 3QB7C 3LRHA 4MD5B 4A2DA 3MO1B 3TPKA 2VERA 4WO0A 2XWTA 2XZCH 1PX3A 1OP4A 2I7OA 3CD4A 5EU5A 4YSQA 3APDA 4FQJL 3TA3D 4FHBD 4Z7WA 1L7TH 4WUUD 1N3NB 2P8LB 3L4VA 3NTCL 1M1SA 2D7TH 4KRLB 5DRNB</