1KY6A

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 65
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky6A02
1NVPA 1RM1A 3VN5A 2IV9A 2A7BA 1JFIC 3ASMA 4PY5A 1QN4A 1QN7A 1VTLE 5IYDP 2DWXA 2D0BA 2YMTA 2Z8UA 1QNCA 5CN1A 1B9KA 1QN3A 1QTPA 3ZY7A 1AISA 2D0CA 1IU1A 4BCXA 4ROEB 1TBAB 3H1ZA 1PZDA 1TGHA 2MJ7A 1GYVA 1NA8A 5IYBP 1QNEA 4WZSD 1QN9A 3OC3C 1YTBA 1W80A 1QNAA 2IV8A 3ZHFA 1OM9A 1QN5A 1PCZA 1P4UA 1NGMA 1GYWA 2D0AA 3HS9A 1KYDA 1R4XA 1KY6A 4B0AA 2VJ0A 1QTSA 1VOLB 1VOKA 4ROCB 1MP9A 3HS8A 4RODB 1QNBA 1YTFA 1TBPA 1KY7A 2DWYA 2E9GA 3OCIA 3EIKA 3MNMA 2G30A 1GYUA 1CDWA 1C9BB 1QN6A 1NH2A 1KYFA 1VTOA 1KYUA 5IYCP 1E42A 1QN8A 1D3UA 5CN2A
chains in the Genus database with same CATH superfamily
1CXFA 3X12B 1UZGA 3BPCB 2M1KA 1ZS2A 5CEZD 4XX5A 1PLGL 5BZDA 1WITA 3UYRH 4JO3L 2P5EE 4PWFA 1QN4A 3MV8A 3HAEG 2AXHA 3S7GA 3T3ME 2AF2A 3DJSA 4BINA 2QR1A 3N91A 4O2FB 4UOQA 1ZE3C 5GJTL 5BRPA 4UZUA 1UEMA 2EEXA 2EO7A 2I69A 5T3ZE 2XPGB 3DX3A 3KPSE 1QSFE 4PCTA 1HU0A 4K5NA 1SY6H 3PHAA 4HCIA 3VJ6A 2B1OA 2OX5B 2MTPA 2XWCA 3HE6D 3WE6B 2CAKA 1N6UA 1D7FA 2R56H 4L37A 1RIUH 3MXWL 1QFUH 4I3RL 3P1VA 5FGRA 1BPVA 2RQEA 1OTTC 1NFIB 1N5YL 4JREB 3Q8BA 1U8JA 1RL1A 2OS7A 3QDMB 2BCMA 3Q8AA 4N24A 1YUHB 4ZUTA 5C8JB 2X3BA 1INDH 3RL2B 2PXYD 2HX7A 2XV0A 3LN4B 4KAQL 3CFQA 2GUYA 4N6QA 4TN9A 5DWUL 3RTQA 1G94A 1E8WA 1ZT7B 3L9RB 3NGBC 3W82A 3QUXA 3UTSB 1T5WA 4IRZL 4XNXH 2ED7A 3P4OA 3ZHFA 2QVIA 4A04A 3EYOA 3H6AA 3K2IA 4JQXC 4D9QD 4EDWH 3ALWA 1FBIH 4JGNA 2ZYRA 3C60B 3D25A 4H8WH 1BIIB 2HX9A 4HIEB 4Q97A 5E6ZA 4QXWA 4E9WA 1SXSA 2RD0A 2L8AA 1BZOA 3L16A 4I0CC 3V6ZA 4W1TA 2EVJA 1JS4A 3DROA 1QI3A 1JMZA 2YC1A 3IFNH 5ESQA 8CGTA 3JV0A 1AHWB 3MGOA 2Z8RA 3NCJH 4ZAKB 3RUGB 4KJPC 4R4FL 1QSVA 1XO8A 3FTWA 4P2RD 1MCLA 2CSPA 1IEAB 4PV8B 4FA8A 5BRQA 2PXYB 4QY8A 1HI6B 3GLAA 1ZLWH 3EGXB 1AOHA 1TBPA 5T1MA 2R4SH 4AKOA 2J1WA 5AKRA 3TS8A 1PFOA 2NXZB 1HH9A 3T0AA 4MNQA 1ECZA 2PUQT 3PS6A 5D71L 4P2CG 4R7DB 2DB8A 4KZDH 1SYVB 4YBQD 3CSYB 5HHVH 2OYPA 1PKQE 1GGIH 3P30L 3VO0A 2IGFL 4NAQA 5K69A 4PJHF 1JZFA 4JRLA 1Q94B 2IALA 2OZ4H 3L5HA 5DWUH 2WCPA 5CJXC 5BXFA 2V7HA 5EOTB 3TLRA 3JWNC 3GUFA 1ZLSL 1W9XA 1ET5A 3M17A 3O2DH 3UYPA 4JO1L 2VQUA 4NPYA 4GI8A 3ESMA 4U4BA 1BZ9B 4JLRB 1VKXB 1QLRA 2QPFA 3STLA 3MRFB 3D08A 1KPVA 5HGAA 4OLYL 2FGTA 4LP5A 2DWXA 1TVBB 4Y2OA 5LO7A 4DKFH 3CNKA 3KDMA 4J3WA 4MLIA 4AMWA 3E8VA 3FU7A 3DIFA 3EYQD 4XBMA 1OZTG 4NO2A 5KVGE 3VI4E 5KSAC 1DZBA 3WNPA 1P2CB 1QSFA 4IOIB 1HEZA 4GW4A 1DBJH 2EE3A 3IK2A 4RWYH 1OK8A 1YEWA 1J1PL 2XA8L 1R75A 2YMXL 3LY6A 3NIFB 4JRXD 2QPDB 2VDKL 1TETL 4Y2NA 1E67A 4Z0XB 2VN4A 1XBRA 1U8KB 3SPVA 5ETUB 4E0RA 4M7KH 2O4EA 1ZT4B 3SKMB 3QJXA 3Q1SL 4C56B 1RUML 2DWDA 2AXGA 1BM3L 2KHAA 1E8ZA 2OMVB 3B2UC 4XPBH 5GGUB 3CVIL 3ORJA 1W16A 1J48A 4KU1A 2FB4H 1AR1D 4WK0B 1F4HA 5KSAD 1QASA 1XGTA 3WEOA 3UMNA 3SPCA 1VFUA 2YC1B 4ZYKB 3V7MA 2J72A 1MFMA 4G8IB 2ZSWB 1T2XA 4JHBA 3W2DH 2PWHA 2YKLL 3FTUA 5AWNL 4AYGA 1DSFH 4L8DA 2XWRA 4OVUA 1MRDL 1ZTMA 4MHHG 1DANT 2VSKB 1M3HA 4W9LC 2VH5H 5AZEH 3KH4A 1NGMA 2CBQA 4L1BA 1CR9L 1J8KA 1N68A 5GRUH 4JFFE 1BM7A 1RUQL 5FWRA 4XOAA 5TE7H 1XVSA 3PWUA 4UI2A 2Y6TE 5D1XB 1A2YB 2MSPA 4PJ9C 5F1OB 4UM9A 5BV7C 2VDQL 1F58H 1KPUB 3QI9A 1G9NH 1WA2X 1QTSA 1SLVA 4V1DA 1MW0A 1CO1A 2O26U 1SHWA 1E65A 1E8YA 4W9CC 1ANUA 1BMGA 1UATA 1ZDQA 1HL4A 3MTRA 2YAMA 4HEPA 4L3EA 4Y4HD 2ISDA 1OGTA 2WZ6A 2P46B 2XXGA 3ECQA 4KAQH 8PAZA 5AKTA 3U9WA 3S3JA 3KGUA 3DBSA 3QEUB 1WISA 3HVNA 1X4XA 1CE6B 4AM0A 4JO5A 4XPBL 4HFWB 3LQAL 5HHVL 4CRPA 4G7VH 1NICA 3LHPL 4ZZFA 5IJKC 5CP7A 4Z7NB 2ZKWA 4ONHA 1XR9A 3BAWA 3LKSA 2RIKA 3O4LB 1ZAGA 1E43A 1ZPUA 2IMMA 2XXFA 3BN9D 1HXYB 5DGRA 4MAYB 1MNUH 1F02I 4HD9A 4P99A 2BNRA 3AS1A 5CUSH 4LL4A 3ENEA 5HBBA 2VUYA 3MRQA 2D31A 4NJ9L 3E8UL 4N6RB 4LSVL 1PNDA 4S1SL 4WK2B 4YC2B 5IROC 4DVBA 1UTDA 1KB9J 1SLUA 4Y4HB 4NPJA 1NDMB 3KTUA 3HJ0A 1IBGL 3SJVE 1IL1B 1AI1L 4ZFQA 3IJHA 4HFWA 5T5NG 1FZKB 2IH1A 3PP3H 2AQQA 3D39E 4NAMA 5LGJA 1WBYA 3IDXL 1OTSC 2Z8SA 3T4AA 4OFYA 2FHFA 4B7IA 4TUOA 5CN3A 1XCTA 5LWYL 1UCBL 2YN3A 5GRVL 4UNTA 3FU3A 1R3KA 2B5IC 3EFDL 3EYFA 2C7UA 3QIUC 4JHAL 3KNBB 4PWIA 3VFSB 5IFJA 1QTPA 3FHAA 3ZY7A 3L5WA 1Z32X 1LE5B 1CF8H 3SGJA 2D4FA 3LKRB 3G9AB 3MNZA 4YSCA 1PVHA 3VG9B 5DZAA 3TOPA 4KRMB 1QACA 3P4MB 4HX1A 1CS6A 1T22A 4R96A 3QNYA 1YQ2A 4PCSA 4O4YH 3IJEA 1EHLL 5E1GA 3N0PB 5CFAA 4NDMB 3RKDD 2NYYC 4UTCA 1KGWA 3WN5B 1EAOA 2HN7A 1DVUA 5EFIA 1OM3H 4DKAA 2Y8QA 3CPLB 5E9DD 1OAYL 1FWXA 2YAFA 3D18B 4WV1C 1JF5A 3VXPA 3FRPB 1QNAA 1MHCA 4DERA 4TTDD 4KVNH 1LJMA 4WIQA 1IC5H 3IJYA 2J6EL 3MYJB 4UQCA 4N0UE 3NPSC 2DIBA 3COOA 1R17A 2WN3A 4EJZA 4U0RC 3DRQA 4Y5VB 3NQIA 4KK8C 3SCMB 1HSAB 3FSVA 3K4ZA 3ARPA 2RMNA 3VSVA 1KCBA 1QI4A 3H7BB 2VABB 3ULUH 1IARB 2WXKA 3N42B 1ZHNA 2FVNA 4XMUA 5HDQL 2F54B 3W3BA 2ZSVA 2QT6A 3TJHC 3UJJL 1NANI 4A1RA 5IJVB 4F7MB 3FO0L 4K8RD 1W6LA 2YA2A 5E5MA 4F33A 1F3JA 4GI9A 4XOBA 1NCIA 3FFCB 3V10A 2E7MA 1E4KA 1FNHA 2K45A 5AVXB 1CF8L 3RGHA 1XAKA 2J8HA 3EOTH 1OCRB 2ZCHL 1MFEH 1OK0A 1QRNB 4U1SB 4MMZA 3JXAA 4Z3IA 2NYKA 1NBZA 4HIXL 2VMFA 5KBKA 1M3QA 1MOEA 2CIIB 2D8KA 4H2AA 4RMSA 1JZ6A 3W11C 3U2SB 2NMSA 1O7DC 4OZGF 4BRVA 4OB5H 2BNRE 1NH2A 2Q76B 4PTTB 3UTZA 4QYOB 4D7PA 5CKGA 3NP4A 1C12A 1Z5HA 4HHAB 4WUUE 1FORL 2Z92B 1CFTA 5GJTH 1NCBL 4X5PA 4XVUD 1J5HA 4U1JA 1NVPA 2R1XA 4WQOA 4WI5A 1AY1L 5EO0A 5F0LB 4E9TA 5ACZA 2X1XR 5I8KH 1CPUA 4U1KB 1GJWA 3CLEL 4HIIB 3TEZA 1AXSA 5IMOB 1FV1A 2X4OA 4GKLA 4P2OD 3DTDA 5H8DA 5C2BH 2HT3C 3TTSA 3CSYA 4CN6A 3RL1B 3LRGA 2H26A 3JWNG 3VNZA 2JIXB 4X4KA 3WMSA 3GEWB 3I3DA 3C5ZC 3KWUA 5CM1A 4JM4L 4C47A 4JDTH 2VLRB 4OIFA 3ZIYA 3W5NA 1AQKH 3KMDA 1WFNA 2OJ1A 1Z9MA 5BV7L 1QATA 2KBGA 1KWGA 1QR1A 2YPKB 1Z9OA 3SQOL 3SY6A 3UTSE 5DVNA 1J5IA 5AOKA 2BHZA 4AUUA 3B37A 3MGTA 1EWHA 2VRKA 4PB9L 5AAMA 2GHWB 3CFJB 3V0IA 3SO5A 1S9YB 3DETD 1V54B 5KTEL 1KTDB 3TC9A 5J3HD 1BQLL 4QRTB 2I9LA 3TJHD 1SYSA 4Q2ZB 4KO6A 5KVEL 1K2DA 1ZWIA 3FRUA 4Q52A 4DOHE 2D0FA 2Q8AL 4WTZG 5K1JA 2H0JA 4ZX3A 4F7KA 1BIIA 4XN5A 3VFUB 1FFNB 2LVCA 5AVZB 3AITA 4OGXL 1E9OB 5E56A 1G6RB 3H9SD 3RPKA 4KXZH 5AVQB 1IBYA 4M93C 2JIXD 1GGBL 1I8LC 1RZKC 4JDEB 1HHKB 3FCBA 1UT7A 25C8L 1UUSA 5CEYA 4ZG1A 3O2WH 4I9WD 5GQBA 1YJDC 5H37G 4HFUL 5EEYA 4QRPA 3S3SA 2Y7QB 1H6EA 3PWPB 3ESNA 2FECL 5IHHA 5KYXA 4HCRA 2HRPL 3GDCA 4X6DA 1HHJB 1V5SA 4TQEH 5DQDL 1BF5A 2GCYA 4JDTL 5GIRB 3W2DL 1SLXA 4CADA 1J9CT 2EXWD 4X8JA 3UTZB 4BXVA 5FHBL 5FK9B 4NBZB 4NQVB 2BZ7A 1YC8A 1H8LA 4PRBA 3H7LA 1G7HA 2G4GA 2ZXAA 4G6FD 2BIOA 4JZJA 1XGYL 2IH3A 3MRNB 2V0AA 2X05A 5IW6A 1YQLA 3MNMA 4BFGA 3NBNA 3KGSA 3L54A 1A6UH 2P8MB 2RB8A 1FF5A 15C8L 4AQ1B 2HFEB 1NGYB 2AI0L 4LCIH 1CVRA 1X5IA 4PRHB 4OJAA 3IFOB 1UFGA 3DI2B 1M2VB 4NO3B 2C5DC 2CCLA 2WC7A 3VFTA 4XCFH 2O61A 3BWUC 2UY7A 4P2OC 2AAVA 4DP6X 2QRCA 4EXPX 1H5BA 2ZWKA 2Y5EA 3B1TA 2YOCA 4I1NB 1PX4A 3IWUA 5KSVB 1HWHB 1K5NA 1WTGT 2A9BA 2NY4B 4OGYL 5HDLA 5FF6A 1ZGLB 1EGJA 1BYNA 4KKBC 5AOLA 5IVNA 5IMLA 3H3PL 5IVXE 4GP8B 3UACA 3JWDC 2M2DA 3UROR 2IADB 3IDIA 5JIMA 2KZKA 1TR7A 4M48H 5C0AD 3KLQA 3WJLA 4NI3A 4KTEH 5HJBA 4OD2A 1HL8A 3NG5A 4AE1A 3ZYJA 4C55A 3QQXA 2ATPA 2BCKB 1NIFA 5FYLL 2WZ5A 2BVQB 2OTWA 4PJGB 43C9B 5DFVD 3OGCA 4JRWA 1CG9A 4TLSA 1A7NL 2Y7SA 3NZHH 5IBLC 1T03L 3FB5A 1H3VA 1GMEA 1DYZA 2KKQA 4XXDA 4XXDB 3ZDZB 1FAIL 5B7FA 4YHYC 1BBDL 1Z9SA 2GITB 1EEYA 1TTGA 5DS8A 3JVFC 3P4MA 5H35A 3ARUA 2IGTA 4MS8D 5GRVK 1GZQA 3KPOA 2DOCA 1B2WH 5L8LB 5ANMA 3VD9A 4CC0A 3V2AR 1DJHA 3OB0H 1XCTB 2YPVH 4LP4A 4DKDC 1A7OL 2ZG3A 4GKSB 1S7XA 2GAZB 4HIHB 3GM8A 3JYBA 3ZE1B 4M6ML 1OGAB 4WFFE 5D96B 5E1AA 4GRWH 3KL5A 4WI0A 1JE6A 5AUMA 5DJ2A 3BD3A 2Q5BA 4MDIB 4XNUH 2B1AL 2J8UE 5EZLB 2X28A 1U2YA 4KI5D 5ICXB 3EXJA 1N0LA 2VLJD 3ZUNC 4BQ9A 4HJEA 2VDPB 4OV5A 5IJKA 3HEIB 1Y6MR 3MMEA 5I6MA 5EC2A 4H8QA 5E6YA 4ZX4A 4JM2A 4FOMA 1VCAA 3O4LE 4NNPL 4HG4J 3GMRB 4JAMB 1OP5H 3TONA 3OAYH 1C5CH 4XPFL 2Z93A 4JFFB 2GSIB 3HI6L 4Z3HA 4DEUA 2R69H 3RY6A 5D1XE 4OFYD 2YUXA 4QD2E 3WU1A 2BWDA 3IMRA 3MRPB 2PR9A 5ICYA 4GW1B 3UBFA 1QD0A 4QRRE 4AJWA 1AQ8A 3PHQB 3A4EA 3PGCB 2VC2L 1KG0B 4PJEA 1QKZH 4S0HA 4JR9H 2L7EA 4RGMB 5HPMA 5C3LD 4Y88A 4LSDA 3NZSA 5JMOC 2H3XC 4UWQB 4X4MA 2A9CA 3P02A 3B7TA 4FHBD 4C4BA 1IIKA 3WKNA 5TFSH 3BSGA 5EBWA 4DP0X 4IKIA 3SDAB 4Y7OC 5E00A 4S1RH 2IGFH 1BF8A 3T4YA 4GKOA 2GSGA 1S9XA 2L7QA 3EUDA 4YK4C 4YFDB 2F7PA 2WXOA 1N19A 3VGBA 3QJVB 5E0QA 2ATKB 2WQ8A 3PWUB 5AW8B 4TL4A 1GA2A 1U58B 2GC4C 4PWJA 4LPCA 1I1FA 2OL3B 4LSSH 2VXVH 1Y07A 3MC0A 5L2KD 2WZPA 1GCFA 3IDYC 4OI7A 2EXYC 1FJ1B 1TYJA 3EOBB 3MA9L 3NCWA 2ENPA 2QDVA 3TIDB 2L0DA 1WP6A 2NY0D 1SJHB 1V3JA 4ODVH 4P3DA 3CH8A 1FVDA 1OAYH 1A6VH 3HMWH 3BRFA 2ZOWA 5EOQH 1DBJL 4MBRA 2AVFA 4MA8H 3LH9A 4ZMQA 3BUYB 2IWGA 5D96C 2YPKA 3Q8FA 5DMYA 1DVSA 3MLZL 3PG2A 5IOPA 1NBVH 1T5KA 3SKMA 3V5KB 4R5TA 1FL5A 1OQOA 1SJEA 2F7IA 1JXKA 1KGCD 3PQYE 2BERA 1CLCA 1KB9K 1XF4B 3L5XH 5BCAA 3UZVA 4KNTA 4QLRA 4DUVA 5C3IA 3T4NA 1QR4A 4BCZA 3R06A 5CIPA 1J5DA 1N67A 1U9KA 2MPAL 4R5VA 4BZ1H 2EYSA 3MNWB 4QR7A 3IXTA 4P4RB 4H20H 4X80L 1HFUA 4XMLL 2Z0UA 2JKTM 5I17B 4UT9A 1QRKA 4DEWA 2UY6A 4HC1L 3T2NL 5C0RH 3QR2A 3SZKC 3IDJA 4AYDC 5J1TC 4EQ3A 2OTWB 5IT2H 1BZ9A 2C3VB 3DK2A 3L3IB 4Y4FA 3OKOA 4OY9A 3VXTA 4FF9A 3DIVA 3D87B 4U2ZA 4UNUA 2ZJSH 3TBWA 2PPFA 3SPHA 3UYPB 2OXHA 1A9BA 1NBYB 3I2CL 4GRMA 2PYEE 2WV3A 4URKA 4L4VD 4HHWA 4JZOB 4H8HA 2LGNA 4JVPA 5D7LE 1ZLVH 4N0UB 5CWSB 1JVOA 5IFHH 1MCOL 4EI5B 2QR0B 1QSEB 3WIAA 3QWNA 4I18A 5IMLB 1A5FL 4ZPTB 5KVDH 1TOXA 3KPRD 5I9QC 4UT7L 4EEEA 1JGEB 1RJCA 4YSDA 2NLVA 5KSVA 2X4UB 4MA8L 1M7XA 3UYRL 3ZHNA 1W72H 5E99L 1MEXL 2X41A 1XB6A 4P07A 3VGAC 2AJUL 3KD4A 2FO8A 3O6KL 4BK5C 3ATAA 2DQEL 3C6SA 2ZXEB 3EHBC 2NSQA 5LNGA 2JK5B 4YDJA 5EZJB 5T1MB 2E86A 1WC7A 2HT4C 3VI4F 1FO0B 2D3VA 1L5GA 2OMWB 3HI6H 3MCG1 3K71A 3IGAB 3BKQX 3VFNA 4ERSL 3U9UA 2AK4A 2L7UA 1O6SA 2AV1A 2P8MA 4JY6B 1GC1H 4Y1AA 4WXAA 3U0WH 4JG1L 5AL8A 2RHEA 3FSWA 4AH2B 2BVOA 4M8QA 4WAFA 2YD6A 4AL8C 4NC1C 2EEAA 5F88B 3DXAA 1OTTD 1QZNA 1AD9B 4IRSB 3MJ7A 5MHSD 3MLVH 3POHA 3FQ2A 1RV6X 5B3JE 1CB4A 4NC2B 1H15A 5IBUG 1EZVX 4KDWA 1UA6L 3V4PB 3ZE0B 2F19H 2B5IB 4KRLB 3PQYD 5EIIG 2DTMH 4MNQD 3BVXA 4MJJA 5L9DH 5CN1A 3EBHA 3E0GA 1B9KA 4XP1H 1MELA 5GGRB 4CGTA 4JG0H 5B7EA 2FH8A 3TU6A 1DUZB 1W15A 5E94A 1P4IL 2IAMC 4KX9A 1MHEA 5KUKA 5FGCE 3DETC 1WWWX 2OJZL 2WQXA 2HZMA 1JCKA 2Y6SC 2ZWSA 2AEIT 4KK6D 5HDBF 2DQTL 4OTXH 4AVKA 2GSMB 5AW0B 4BSWB 4M43L 4ZFOA 3SKNA 2N7SA 3FQTB 6FABL 4BE6A 3JTSB 2X4SA 3VD4A 4Q6IB 4ODXB 3EOAB 2VXUH 1NAKL 2WPGA 4HQQL 4B9JA 1LE9B 1BVZA 3B9AA 3JT0A 4QUOA 1D9KC 2C4FU 1WHOA 2TSBA 2FDBP 1NGXA 3MRCB 5FYLH 4MGXA 2XTSA 4HUKB 3ALPA 2LQRA 3FAXA 4AYBA 3NCXA 4CUCA 5IG7A 3BWSA 3O8XD 5FA3B 4CC1A 3W57A 4GSQA 3WMPA 4DVBB 4MJ4A 1KTJA 1H8OA 5I1AA 2Y06H 1H0DB 1JWSA 1NCDL 3MA7A 3MRQB 5DQJA 2WYZA 4FG6D 4LNVA 5JO5A 1E90A 1QX1A 4G9FB 5BOPA 4PJ6A 1E4HA 3H4HA 4DGVH 2GUOB 2GJ6E 2NR6D 4BZ2A 4P9MH 4Z7UF 2UZYA 3EO0B 1TQSA 4JFEA 3OLGA 4PWKA 5EZOH 2KYIA 4Z78A 1FL3B 4XVTH 4YSSA 1UH3A 2AJVL 2VSCA 3RVTC 5TDNA 1ZT1B 3SOBL 3V8CA 3D39A 4QNPE 2ICWJ 3HE6A 2Q7NA 3RWGA 4FQHB 4QAWA 1YAZA 2CIKB 5ACZB 4BWTA 4XH2B 1A4AA 3UPRA 2IFGA 1MY5A 4H44C 3ZU8A 2BS8A 3BXNA 5I1HL 2C3GA 1M3IA 4HJIA 2EH8L 3U46B 2IFFL 2CBTA 5IR1A 1JHTB 1BD2E 3M7OA 5AB2A 2VXSH 1U8QA 2W9EL 1MDAA 1IZJA 3VD2A 1ERNA 3MBWB 3QJOA 1S46A 2B39A 2KL6A 1MFBL 3T6VA 1JTOA 1YY8B 4DGWC 2WANA 4NZUH 4YZWA 1NIBA 3R18A 4WVRA 5DJZB 5AOIA 5C71A 5FHBH 4Z9KB 4LSRH 3TO2A 4GP5B 4PY7A 2W1NA 1FH2A 3NCJL 3C6LA 3BVTA 4P0DA 4P59L 3GKZA 4DZ8B 3RWEB 2FUQA 3HAEB 1KGIA 5ADPH 5DMKB 5IEKA 5KYWB 2VDLL 3U4BL 3FB6B 4KJWC 3VQMA 3L1EA 2WBXA 3L4YA 3HE7C 1JHLH 2IAMD 2HWZL 3J8F7 1ZS8B 2Y1YA 4HCFA 1QLFB 2KC0A 1CXHA 2APFA 3VYPA 3LEXB 4XPGH 2YEZA 1F42A 1T2QH 3RLSA 2LLLA 2DQMA 2RTTA 4PCYA 5H2BA 1WJWA 4XCFL 3CTTA 3ILEA 4HMDA 5CU5A 5AVUB 1QBML 4L8BB 4YPGA 1ZGLP 1EHAA 1FSKB 4OCYL 2YLHA 4MRBA 3VGHA 3W0WA 4ERSH 2VJXA 1PZDA 1KIRB 1RUQH 2A0LC 2R29H 5C0IB 2K8MA 4HKZB 5DLMH 4LF3B 4LLQB 1ID5I 4BHUA 4X98B 1F3RB 2VXVL 3D09A 1DHKA 1BFOA 3D85B 3CSTA 3DMMD 3L1OH 3QQ4A 4WDIA 3U7YL 4FFYH 4JKMA 5HYJE 1P4IH 1ORQB 3PDGA 3AQDA 4LHUA 2QQLL 3V4PH 4PJGE 3OJ2C 4BFNA 5DYFA 4ZMOA 5IROA 4JKPL 4R96B 3D12B 5FOBB 1FPTH 1M1SA 4MD5A 2JOIA 2B15A 3DX1A 3ECVA 1WQVT 4UT9L 1LO2L 1IUZA 3ZXAC 3GLEA 1Z2KA 1A1NB 1KC5H 1LEKB 5DHYB 3QZWA 3IJ9A 5DHMC 3NEEA 2CLVB 1G84A 3CUPA 3LQAC 4PJDE 3PAYA 3CLFL 5JHDA 4QRRB 1TETH 1QUNA 1F8TL 1F4YL 4AV0A 1PIFA 1KN4L 1KJVA 3WKMH 1DJYA 3MRGA 3K1KC 3DNKA 1GOHA 1JDDA 3HOGA 4NEHB 1L7TH 4Z95H 3V5DA 2FWSA 3BFQG 1HZLA 3D85D 1KLGB 4NBXB 4Y19D 4N1EA 1RQ5A 2OM5A 3IFPA 1EJFA 2OV0A 3TO4D 2AEOA 2GG1A 4H5SB 1V3KA 1D9KA 2DKAA 5EBLA 4RFOL 3VFRA 3IS1X 5F7BA 1R19A 4CBZA 2C7FA 4Z7WE 2AXWA 5IKCA 4ELDA 7CGTA 2OI9C 3AU1B 3QQ3A 4JFSA 4ZAKA 4R6UA 1EH9A 4LDLB 5GS1B 1DO6A 1CN4A 3F05A 4NP4H 4QRRD 4HOMA 1DVYA 2PCXA 1N59B 4ABQA 5GS3A 5DJXB 4LPTA 4JHAH 4M6MH 1FDLH 4Y5YC 3X1FA 4PMFA 3GF8A 1SRDA 3I50L 2FJUB 4ZX5A 1PZAA 1YYLL 2BNUA 3QG7L 4HJGA 2IPKB 2MQ0A 5AOJA 1C1EL 1L3NA 1KXQE 1GC1C 1QW9A 5FAAA 2F8VA 2VE6B 1FZMA 1WS8A 3OAUL 6FABH 4BWUA 1BVLA 4P2QA 4MKMA 4LCVA 3SODB 1XT5A 4UU9B 1X4YA 3GK8H 2A9DA 3QULB 1KJ3L 4PBWD 1U8NB 2WXQA 2DZEA 2FQDA 4Y8AA 2X53A 1YEKH 1O7SA 1NJ9B 1HVXA 1WBZB 1T6WA 1YEGL 3ERXA 1DQQB 2CMRL 4ZMTA 1GKOA 1A6TB 5B4MC 3T04D 5FO8A 4L4TA 4HIJA 4M5TA 1YQKA 4XPGL 2G60H 4MA1C 5DLML 3QUMB 4NZFA 1CJYA 5T3ZD 5MEPA 3RURA 3D0VA 4LGRB 5E2WH 3TEUA 5B8CC 2E3VA 3ZKNC 3ZYIA 2WVSA 4ELME 3FU5A 2B59B 2Z35A 1MF2H 4DP8X 2NX5D 3V55A 5G55A 4GAYB 3T77A 2OTPA 4HALA 3C5XA 4ZDHB 3X1GA 4M6AA 3N40P 1S7WB 1CDJA 1IZKA 4G82A 1A64A 4APQD 2KLRA 4ODTH 4ES9A 5ESAB 3O2DA 3RX9A 3C6SB 1LK2B 3V5HA 3WE1A 1GL4B 4MZIA 3BH4A 3C60C 4PJ7B 1L9MA 4MMXB 2R83A 3BGMB 4JG0L 3SYPA 2DM4A 2H8PB 5GS1C 4UYQA 2QPUA 2WLIA 3B34A 4R2GC 2J3SA 1KNOB 1HTYA 3S96A 1A4JB 3WKML 5FR3A 4GUQA 1S7QA 2UZXA 4OJDH 4J3UA 2FGWH 1R47A 3X1NA 3V0JA 1KFIA 2OMZA 3NCYS 5D71H 5F1KC 3QQDA 4FQXC 1M7IA 5JNYB 1X5MA 4LRNL 3MRFA 3VXQB 3HMXL 3TN0C 3WYRA 3QUYB 1ULVA 3MOBL 2ZX8A 1WA1X 1AYRA 2ZZUT 5LGKA 2DY2A 1MFNA 4FAAB 4LLMA 5GGTH 4GQ9L 2FLBT 2OMYB 1L3WA 3VTTA 2FKMX 4EAJA 2I5WA 1U8OA 1E9QA 1TTFA 1XCXA 3VU1A 2FX9L 3NEOA 1K72A 5DFAA 1QZ1A 1YMHB 2PYEB 1UD6A 3QUZA 4P04A 4RRPA 1IFRA 3G3LA 1NAMB 4H1LH 5J6GA 1V27A 3HS0A 3VI3F 3VXSD 4MLSA 3TYFA 1LK3L 2JLPA 3RKDC 1ASPA 4PRAA 1TITA 5E8PA 2ZAGA 3FMGL 5B3SB 5EPMA 2V2WA 2P49B 5L4IA 1EZVY 4K23L 3OLEA 5T8IA 5CGBA 4DKEL 4NZ8A 5F9CA 4PS3A 3WLWD 1DJWA 4Y1TA 1JNLH 2R2HA 2J1KA 4FEMA 3SDCB 2D7NA 4FFTA 3NABL 4ZW8A 4L9LC 3I2CH 4G42B 2H2SD 3DV6A 1EJOH 4P9HL 4XB8A 1FNEA 5B8CB 3NIDB 1HZHH 4XXCA 2NY6C 5AVRB 2VXQA 2ESVE 3BKML 1MCQA 3QDGE 1TPXC 3BOVA 5D7SH 5DXWA 4AKQA 3GSNL 3W9DA 3QE5A 4JM2F 1TGHA 3JQOB 3B5GA 2K0RA 3P4OB 4DEPC 2XY2A 1NIAA 3I75A 5BUGA 3GI8L 4OF8A 4KV5E 4PW9A 3FQXA 4NNXA 4M7ZB 2IQAB 1HIMH 2XVBA 2WWMD 3IDGA 3NFNB 5LG1A 2DEWX 3OJDB 5CSZA 1YA5A 1ECYA 2KH2B 3CLEH 5DZJA 1ZEAL 3LRKA 1NC4D 1KXTA 2D7OA 5DK2A 1MZYA 1IGCL 5F3HA 1RZ8B 4PJEB 5C7XH 4UDUA 4MS6A 2AMUA 3MLTA 4DKEH 4FQLL 4JPWH 1A9EB 4X5XB 2MNUA 3G9VA 5LLIC 5D7LD 2J7LA 4NO0A 3MRBA 1ONQA 3AROA 2A73B 1RHHB 2W5PA 4EI5C 3UABA 4A55A 3RFZC 4OCNC 2BSTB 3BEWB 2AJXL 2HFGH 3OSVA 1XXDC 5JHDD 1J10A 2VRQA 1KFQA 4FMVA 5JN5A 3SDCC 1KBGH 3NRPA 1GSKA 1X7TA 2EVGA 3L3HB 4NM4L 5HDWA 4E42A 5AUMB 5KSUA 3C8KA 2DKSA 5C97A 4PV9B 5HD8D 2JXMA 3VFRB 3IAPA 5IROD 3UP1A 4LHUD 4QI3A 2E7LA 5DD0L 4JRYE 4XPAH 5IQ9B 4XVTL 3REVB 5FM5M 1ET7A 4XBEL 4WY7H 3NFSL 2HRPH 1CGXA 1RKRA 4JDVA 2H6PA 3STZA 1FNAA 5KL0A 3V0WH 1MG3C 3QZNA 2NRDA 4N4YB 3QIUD 4HKBA 1KF9B 2CH8A 3NH7H 2VR9A 3B5TA 3Q44A 4BFKA 1ZJBA 4TNWK 4KKLD 4PRDA 5I1EL 4PJFE 3ZL1A 3IVKB 1W0VA 4XNXL 5JOEA 4FLRA 3WFHA 5FOBA 4PJXB 3LMJL 3G5VB 3V6BR 5C3TA 2WKOA 4WHTB 4XP6L 4XRCA 5TE7L 1VGKA 3VI3A 3JV6B 1VEOA 2XQ0A 1ZV9A 4Z23A 1S7QB 2UZXB 1YJDH 3DSFH 2C34A 4FCHA 4NFDA 5HYJD 1QVOA 5EEWA 4DGIH 3VWKC 1WUNT 1QO3A 1P5VA 4X9IA 3DJTA 5T1KB 2IV8A 2FJHA 1LK2A 2CDGA 1BF2A 2H3NA 5C0BE 3NA5A 4KO5A 3NJJA 3J27A 1J9QA 1QW8A 1UT9A 3TZVA 1T21A 2AEQH 1A0QH 1MW2A 1ZS8A 4NOBA 3JTBA 5F1NA 1ROCA 2CUAA 3E2HC 1KGXA 2P80D 4PWGA 2D03H 3PWVB 4X5WB 4ZXBC 3VYNA 4DZBB 3L5IA 3BEVB 1PLAA 3N44F 1QLEH 5LBGA 3LXCA 4U6YB 1NDGA 4MDJB 3DIDA 4CJ1A 4L2LA 2Z31D 4WW2A 1YSOA 4N0FB 1HINH 2VW4A 1OP5K 1AS8A 1JXFA 5K93A 3BE1L 3TA3D 4LVOC 4QHKJ 4ETYA 4HPHA 4QXGH 4E2OA 1RZIB 2RR3A 1K8DA 1M05A 2DW5A 3UJIH 1F11A 4OZFG 3PWNB 1YJDL 3QZMA 5F9JB 4NZRL 5C09B 3RNKB 1RP8A 1FNGA 1NC2A 3ROOB 3GTNA 1FCCA 43CAB 2YQBA 1VJSA 3Q5OA 4KY1L 4WSGA 4ZMZA 3MLZH 1IAKB 4F80A 4RA0C 2G2RB 5D7JA 4E41D 4QRSA 5A6LA 3R0MA 4E9VA 5MEOB 2UZIL 3N1QC 1KV3A 4BIKA 3US0A 1G7QB 1NL0L 5ESVA 1KENL 3E6HA 1YEKL 3TFKC 4D9QE 1MWAL 2XPZA 3PXLA 2LU7A 4IOIA 3O81A 3B9KD 3U0PA 1KTDA 1XV8A 2BRQA 5CLXA 1BWMA 2H5AX 1P7QA 3MGTB 5BQDA 1V05A 1NFDA 4KX8A 5AG8A 4JFDD 1MNNA 1JUFA 4N87A 2W60A 4XPTL 4CU8A 4F58L 3KLHD 2JWYA 1MJJB 5D1ZA 4KDTA 1IEBB 1D6EA 1U3NA 1CQYA 4RQQB 1TTCA 1ZDSA 2E75C 3TYGL 1KCLA 1JPGA 1EAQA 2ENJA 2W88A 1BBJA 1KCVL 1OT4A 4P5KA 2BMKB 1BPLB 1XL4A 3HG2A 4HIIA 4WZSD 4PJCA 1GGBH 2HTKC 3MV9D 4NQEA 1JYVA 2XWBA 4GO8A 4ZFOL 3QFDA 1U4FA 1SVBA 2Z92A 1CFTB 2OP4H 3B9KB 1A14H 3APNA 1F4WH 5DHYA 3US9A 4CJ0A 1AD0B 4W6WB 4NCDA 2H6UA 1YPZE 2R0ZH 1XH3B 5D4IA 3KR3H 4NM8H 5JXAL 4NT6A 3QAQA 2ZXBA 4FDWA 2I25N 3FUHA 1ORQA 3D2UB 4HCRL 1YY9D 35C8L 2CM6A 4U6YA 2Q87A 4ZMLA 1JPFB 3RIAK 1N6VA 3C6LC 3UTTB 4F8PA 1M42A 5DHVA 3CXFA 1P6WA 5ICZB 1HQ4B 3DX6A 2P52A 4P2YA 3O9WB 2DBLL 4I2XA 1N5AB 2ITDB 4F9LA 1JERA 3C5JA 3E9TA 4DQOH 4H88L 2R2EB 3GIZH 1J8HA 1MCWM 1PG7L 2XJKA 1UWXK 3LNFA 2Y07H 4KNSA 2FJHB 5EEVA 2VL4A 3RWHB 4P5MA 2DYSB 1MVYA 3IPBA 4D9LH 4LARH 3GSXB 2ITEA 4FADA 4RGNE 1J8SA 4GQPH 2GW5A 4O58L 5FYJE 4MHHI 5EN2B 4WEMB 2IXQB 1NCJA 3OR7B 4K73A 1YEJH 1YEHH 2EYTB 3WY4A 5JHAA 4JUSA 3UZQB 1LWHA 3FCTA 3NIDE 3N04A 4JZOA 3MLWH 5IP4A 3ENCA 5J0BA 1KT2B 1EJOL 2A7BA 2ZOKB 3PXHA 4P9HH 3T9WA 1RPUA 2V9JA 4MMZC 4PJIF 4F7EA 1XF2A 3TCLB 3NVQA 3OX8B 1MJ8H 3VQLA 2C3VA 1CZ8L 3SEPA 1W0WA 3QORA 2N56A 4PRDB 3OHXB 1HCZA 4KWUA 2UVFA 3LNDA 3H3PH 3ETBF 5IB3A 2LVEA 5D7IB 3MBEA 3U0TB 3IGLA 4RFNB 5E08H 1OARH 4P5TA 4LSQL 1U41A 1BQHB 4YHML 2PW2A 3HC3H 5L2KA 1AR2A 3GBML 5LN8A 5J6HA 4PCKA 2FEDC 3CFUA 3L9BA 5TPWL 5J1AA 2GTWB 5MP6L 1G0XA 3RWGB 1CIDA 5I18L 2BPBA 2CGZA 1U8LA 4QRUB 2B9BA 1ZK5A 2J12B 2DYPA 3GSWA 2DDQH 5EO1A 3CMOH 1VFAA 3D34A 2LFGA 5E4IA 4LMQE 1A25A 2H9GA 3MTXA 5F9AC 3SGEH 2ITCA 3UL4A 2D3JA 2IFFH 2ESVB 3M1BA 2HT3D 1AC0A 1Z3GL 1K3IA 3FN0L 1N0XH 4HUXA 4NUJB 1G1YA 3FF8A 4L1TA 1FJ1A 2J44A 3QXTA 1ZXKA 3VDBA 4AVHA 4RAVA 4PU2A 2ZYHA 2YD8A 1XD1A 3CLWA 4X6DE 4OFKA 4LEXL 3EG9A 1YUKB 2I27N 3CZKA 1MSPA 4MXQD 2YK1H 3FQTA 4WENB 2A83A 5DFTA 4RETB 3QCUL 3KR3L 4NM8L 3IMWA 1L9PA 2GSGB 4E9LA 4CU7A 1ZVSB 3QPKA 1BW8A 3DPUA 3FTXA 1IGMH 4I2XE 3LXBA 2H41A 5KVFE 5TE6L 3U6XS 3P4LA 2BIHA 2GY7B 5FB8A 1NIEA 4WV1A 2WOYA 4TNVK 1TKWA 1MCFA 1UQSA 3PLYA 5DK2B 2LW3A 1ZJAA 4LL9A 1CQKA 4R4BA 5K39A 3PGCA 3VQ1C 3E6FB 1JK8B 2EE0A 4H26A 3NYKA 4BSVA 4K94C 4UAOC 1LD9A 5TDOA 1A3RL 4FNRA 3T1FB 5MHSE 3P11H 4JFFA 4UQAA 3QRLA 4OCRH 4ZS6D 4CKQA 2VLKB 4NP9A 2FX7H 4BQCA 2AK4E 1SXBA 4Y1AE 3F58H 2HAZA 5I6PA 3TBYA 3QUML 1CLOH 4C56E 3LIUA 4NRXB 4ZX6A 1XZ0A 1EUVA 3QUYA 3CX2A 4HU8A 1DSFL 3K4DA 1G9NC 1MPAH 2QQLH 1EJ6A 3C8DA 1NCUA 1A7QL 3FB8B 3K72B 4FLHA 4V1DE 5E5UB 2F53D 1CFVH 2CO3A 2P5EB 1S5HB 4PJHA 4YHZL 3HZVA 3D51A 1OV8A 1Q9KB 4BZYA 4LVNC 1YNKH 2Z8UA 1OKEA 3DX8A 3ESUF 4C83A 1A4JA 1C8QA 1TNNA 1WGOA 2NXYD 2O5NA 3QUGA 4P46A 2H8PA 1QFPA 1B0WA 2VTFA 4HZ1A 2E7LC 1P5VB 1WV7T 4X9BA 3DX2A 4LQFL 4LOFA 3EFOB 1N2RA 3JZ7A 4TLTA 1CGVA 4F5CA 4KITB 1P2CA 1QSFB 4HWBL 1HWWA 1HHIB 2JJVA 4I3SH 4KVCH 3H3BC 3PWLB 5FO7A 3WFDL 5E6IA 3HHMA 5AZ2L 3AUWB 5FCSH 3SCMC 2Q20A 3VXOA 4AQ1C 4JQIL 4XB3A 3VFVA 5FGCB 1FHNA 1N8OE 2NY7L 1ADQH 3QO1A 3LPGA 1CICD 3LXAA 4OLWH 4FNLL 4YSRA 3FB8A 4YOKA 4E5XA 1NGPL 2PWFA 2VQ1A 3MRLB 4OJFH 5CF3A 2OFQA 1NCHA 3CX5J 4K55A 2Q2EB 1XF5A 2F53B 1ED3A 2R56L 3MGAA 4I0PA 4P4KA 4TULH 4FQQB 2NY3B 4N8VB 2Q6WA 5DTFA 2BO0A 3OL2A 1GYAA 1IE5A 1ZHBB 3S3BB 4A39A 3OAZK 3KPMA 4IIQB 3RBGA 4JFOB 4P4RA 1JFHA 4W4OA 1N0XL 1JK8A 2F53A 1OAKL 4ZFGH 2HUEA 5D1QB 5JHMA 1BM3H 1U92A 1VRSA 3MRLA 1B2YA 2MOGA 4DTGH 2IJ0C 1MUJB 1RPKA 1S7SB 5HXMA 3DPBA 3UZVB 5A2AA 4HEPG 1PX3A 4X9YA 1LYQA 3GZKA 3PABB 4NN6C 4UUJB 4AC2A 4PJ9B 4PN6A 3REWA 2VAAA 4Z7NF 3T2NH 2BSBA 1FZMB 1H3PL 3WTWA 2EDOA 3PUUA 4I1PA 3FNKA 4HJTA 4YMPA 4WU7A 2WXJA 1K5NB 2ZD0A 1OE1A 5FF6B 1NWPA 1S7UB 3VI3E 2D73A 5B1CA 1ZGLA 4MMXA 2JXMB 2Z1KA 1KBKA 2XWJB 4GS7B 3BQVA 5E8NA 3L3HA 1MI5E 4Z7VA 2Z8WC 3LZQA 5C0ND 3WI9A 4FGMA 4PJHB 4S0TD 1RAMA 3QJFB 3KM2A 3CDFA 4JX0A 5ISZB 1NFKA 3OLDA 1OE2A 2BSTA 3MRNA 4NQCE 2VDNB 2WBJA 2ZWLT 4XN2A 4D94A 1C9BB 3VFGH 1TJIL 3TBYB 4PWHA 1EHLH 2JSFA 3DTUB 2CHWA 1A6TA 3JV5A 5F96L 1AGCA 1P4LA 4JFQB 2NY1B 4F15C 1DBAL 4UCFA 4HK3N 2WYTA 5JHLH 2OQJB 3OMAB 3OKMA 4Z3GA 4XXWC 2FKFA 2DLTA 5KSBB 3C9NA 3RX8A 5I1DA 4L37B 1SJMA 4KQ3H 4UU9A 3O4OB 3HCVB 5KVGH 1XL6A 5ITFB 1MFAL 3ATBA 5CEYB 5ICYB 2YPVL 5ISZD 3IN2A 2ZAIA 1AKJB 5F7NC 4UBDD 1MLBB 2ADFH 1JWUB 2GJZB 1WJ3A 1UB5A 2NY3C 1I1AD 4JHWH 2EUVA 1UD4A 4UTBL 4MX7A 3CZJA 1QFWL 2WGNB 5CJXA 4QTHA 4P2OA 4RGNC 3EG9B 4J7RA 4EUPH 3QIBD 3MFFB 5JYLA 3LHPH 3HC4H 2EDEA 2E0PA 4WU5A 4G9DB 1B0IA 1JTTA 4KK6C 3C09C 4G8AC 1TUPA 3K8LA 1EERB 1MCPL 3HRZA 2V3EA 3GHBL 1C5CL 3L1GA 1AVAA 5T1JA 3BI9X 3CH1B 4KFMA 2P9RA 3QGVA 2QKIA 2VISA 4M6OL 4P5MB 4FQIL 1M5Q1 1Q9OB 4LCWD 4DN4L 2EIEA 2R0LL 5AW6B 2YXWA 4JZNB 5KJRH 2DYPB 3QYNA 1HILA 1I1AB 1T20A 5GGRY 3RL1A 3ZT5A 2OOYA 4W9DC 5LXGL 4G43B 1B0RB 2WNWA 4EBQH 1UOVA 5IJBC 5D6DA 4O2EB 4QT5A 5IV2A 3VH8G 2CCWA 3RDJA 4M9OA 4OLWL 1U21A 3DV4B 1GGYA 4XP5L 5GS2D 4EE2A 5LJYH 1Z9SB 3A5VA 5CO1A 1DBBH 3L17A 3CAFA 1TXKA 5F9WC 1YDPB 4PTUA 3LRSA 1RH8A 4YE0A 4UF7C 4JHUA 2YZ8A 2Y5TA 2CDEA 2EXTA 1KCSL 5HYSG 4EALA 4NO5A 5HVWA 4GAGH 3OX8A 3QWOA 2V33A 3N42F 2CRMA 2BOBA 1IBDA 1KT2A 1G7PB 3FPYA 3ZKMD 3U6RA 3T6WA 1C7TA 1A3LH 2IADA 3IDIB 4TNWF 2UXFA 1EAJA 1DVFC 4F7TB 2ZFDB 3CFEA 3VG0L 5FUOH 2ZF8A 4YSUA 3U4EA 1N3CA 1KIRA 4F7PA 1SXZA 3MX0B 3GMMA 4M7KL 5J3HC 2BW5A 3M8OH 1RZFH 1NMBH 3BESR 2W81C 1B0RA 4P5KB 3FFCD 3GINA 3K1DA 4WFHE 3QEQA 1I4FB 1Z0MA 3PFUA 4OZGB 3OMZA 4P9HC 4LCYB 3L5JA 5C0DA 2JI1A 3OZ9H 1RP9A 1I3RA 1F3DJ 3LEXA 4PEEA 4R0LA 2ZX6A 1OTSD 3S37H 4OZIB 2PWWA 4XZ4A 5E9AA 5JXEC 3O11A 1KLUB 3B6SA 5EOQL 3AREA 4U0RB 2MZ8A 3L7FA 3MV9A 3T2PA 1PAZA 4N2GA 2XWZA 3VWKB 3HAEA 5IEKB 5KYWA 1UXSA 2O5ZL 4K5MA 2XNAA 1VFBB 3K0YA 3LRMA 3IGFA 4K9EC 5BMNA 4GIPD 1AG6A 2P47B 2A99A 4ORGB 5B39G 4Y2DC 1X7QA 4LIQL 4NFCA 2HPOA 4QHUB 5E5RB 4NQED 4MB3A 4X6DB 1LDPH 3LEVL 3AADB 5G5DB 1A7RH 3SDXA 3MNZB 5HY9B 3MRDB 4FNTA 4CL7A 4JE0A 3D3VB 3WS6C 5F9WB 5AKSA 1CMOA 1R0AH 1FLRH 1RCYA 1I9RL 1J1XL 3KNBA 5GSVA 5D70L 4I77L 2CPCA 3HKFA 4IRSC 3B9KA 1NZRA 2AGJH 5FYJU 1KZQA 5BNXD 2PCPB 4U2YA 4XH2A 1AZNA 4L5FL 1DQIA 2OSYA 1U93A 2AJYH 4Q7DA 4ZUVB 4JKPH 5HGGS 4BUQA 1BXAA 2BNUB 1P7QD 3CQFA 4LVOB 4BA8A 5I6OA 4D8OA 4PJ7E 1FL3A 1WZKA 4QKTA 2PN5A 3EYSL 5L2KE 1VOKA 1MWAB 2CRIA 4RQQA 1SVCP 1D5RA 2FLMA 4WLCA 2WVVA 4L05A 4KXBA 1RK1A 1FGNL 1SYSB 2YPLD 3X14A 1IC0A 2XVLA 2QVFB 3OH9A 3GMPB 4P3CH 4MWFB 5C0CB 1RZJC 5CD3A 3LZLA 2VLKE 3QI9D 2O5ZH 5MP6H 2VERN 5TPWH 2DEXX 5IVXB 4OAWA 2OULB 4KZ0A 4OZFH 1T04A 2WB7A 4WCYL 2B8OT 5HGDA 4E9RA 3AZUA 3ETSA 3TA3A 1DVFD 1KLUA 2JNZA 2WZAA 3B6SB 3LPOA 5FDYA 2FR4B 4KNQA 5E8DL 5GSRA 2HTKD 4YLCA 1NC2D 4XVJH 4CW1A 1A21A 4EUPA 3RZWA 2E6QA 3CE1A 1QN6A 3RGVB 2C9PA 2CLRB 2LU5A 4OF3A 1X5AA 4FG6C 1FLTX 4ZFOB 5C08A 2OJEB 2P80A 3QEGL 4UZGA 3VXUD 5ILTH 4G2AA 1GKEA 2QGEA 3HR5B 4YN3A 3E1F1 4ADIA 4N90D 4X99A 3CFEB 4F9PA 4R26L 4BFEA 3FUEA 4XB7A 2LAEA 2DQJH 1RY7B 2F0CA 3KYAA 3B2DC 3F7VA 4X6FB 1F11B 2VZUA 2XZCH 4FYQA 3S3DB 4BD4A 1KMGA 4OUUA 4GRMB 5AYQA 2L7JA 3EO1B 2BY0A 3Q0HA 3AXHA 4HBCL 4QTFA 1A3RH 3CVHB 3TZVD 1X7QB 5IBUB 4NQQA 2PP7A 1OW0C 1QN3A 2XN9E 1U6AH 2HKHL 4HISA 1OO2A 3F84A 4OD1H 4Y9GA 3WTYA 5DURB 5E2WL 3S5YA 2BC4B 1ED3B 4I0PB 5E5MB 4F33B 1D5BA 4F3FB 3HI5H 3K91A 1FORH 2BS9A 3MV7D 4UOJA 5I26A 5DEJA 1BAWA 1OPGL 2IOIA 3H54A 3L4TA 3M07A 5HYJA 1RJZB 7FABH 2ZONA 1U8IA 5AD0B 4C56A 2COQA 3T2OA 2GQHA 4D3CH 4XC3H 1J5CA 2NT1A 3HPJA 4HF5H 4HVBA 3QHZL 5FFOA 1LMIA 1I7UB 5BS0B 1R46A 4JO1H 3TE5A 4JKNA 4AGNA 5E95B 3IDXH 3CH1A 3WBDA 4K3DH 4FQJH 3D9AH 2G3ZA 3DX8B 1MI5B 3HRZB 1F1DA 5FYLD 1PLBA 1IC4L 4K7PY 3OMIB 2FRGP 2EDYA 2HVJA 3CPLA 3HZVB 3C8HA 3UTTD 2VXSL 3SD5A 2G9KA 4R4NC 3WNMA 1KWKA 5D70H 4AEIH 2DQCL 4NQDE 3EFFA 4F7CB 4N9OB 2ROXA 3CFBA 4TSBL 4CGUB 3ZE1F 3O41B 5H4YA 2VLKA 3VRLF 3LEVH 2IAND 2CDEB 3DYMA 2H2PD 5D2NC 1BOGA 4OSUL 4TRPH 3IMBA 4MZ2A 1RULH 1VESA 3T4YB 3EJJX 3MNWA 4WI8A 3T3PB 3R4RA 3U25A 4C7PA 3QR0A 2M8XA 5ES4B 2B3IA 1R3LB 2G30A 3B9KC 4FHJA 2XFXA 4U1HA 5HYSB 2C1PB 5DEGA 2XYCA 3GRWH 1XF4A 1YMMA 2NDFA 1UZ8A 1CXIA 1WIOA 5JTWA 1EX0A 3MZGB 4NHCL 4G70B 1G43A 1A7NH 4G7QB 3PP4L 2PXYA 3QA3B 4YBHA 6PCYA 4Q58C 4KROC 2UXGA 1J05A 1EGJL 1SMOA 2CZNA 4MAYA 4X8CA 4YSAA 3NSYA 3NCMA 5DF0A 3W9DB 5D7LA 3EUUA 4W70A 4TL5A 3S8FB 2XIDA 1XR9B 4ODSL 3QISA 3KDPB 2WXNA 3RY5A 2NY6B 4HGKC 4HIEA 4OV5B 2V9UA 4K5OA 2VUOA 4PJGF 1VACB 3EZJB 4YHZH 3QQ9D 2P8LA 2X4QB 2Q7YA 2Z7ZA 4MDIA 4PJFA 1MIEH 5I73C 2ICWA 1JCVA 3OR6A 5JW3H 4U7KA 1OOWA 5FFLA 3DI3B 5C0GA 2R2HB 4HUWA 3AVEA 2OI9B 2WYIA 5HHOE 4NZUL 3QDJA 3SDAA 2FLRT 1QFHA 2CXKA 5K5YA 2G3XA 1X5XA 3ARZA 3PABA 4UUJA 1UVQB 1PY0A 4RA3A 1ZK9A 2ZKMX 3BW9B 3K4AA 1PCMX 4LKCA 4AZUA 2HRGA 4M62H 4U1NB 2H32H 5INDA 3F2LA 3KZ8A 2WNGA 1N6QH 1SBBA 2CO7A 4GQZA 3LS4L 3F7QA 1BOGB 4Q9BA 4IK6A 4OBSA 4L8DB 1AD9A 5E2TL 1YYCA 2DF3A 4P4KB 5TQ2H 2MRYA 1JV2B 4G6JH 3B7RL 1SDDB 2DMCA 3TCLA 4HV8A 4JFZH 3CFCL 4UQBA 4DUXA 1MW1A 1XGTB 3GT6A 3GD1C 3BQUC 3ZSSA 2Q2LA 3U9UB 3QUZD 3X12A 2WQUA 1RIHH 1TZGH 3LX9A 1KCVH 4JPWL 4WWNA 1INQB 2A4EA 1N0LB 4KTGA 5J5EA 4NLAA 5F1IB 5I76B 4LASL 4OJCA 2FYYA 5DT1L 1I1RA 2V3FA 3ZKND 1BMZA 5BUPA 5EZIL 2EH8H 2APVA 3HPJB 2XX1A 4PSRA 1TJXA 1JGEA 4X2UA 5GGQL 4TVSa 1Q9LA 3NFPB 1HDMA 5C9JA 2QR0A 1U8IB 4BH8B 2Y7LA 4OF5A 4HOXA 2G0LA 5E8PB 3O9WA 2EDFA 3J7HA 5E24E 2DDQL 2D9CA 1BQHG 5ICZA 3FQ1A 4RMUA 1KXHA 2WUCH 2VSMB 2GITA 1QSZA 2WNKA 3AWGA 4HSQA 5DD5L 1KENH 1IAIL 5J8OA 4APQA 3FH8A 2B3RA 4UV4H 5A7BA 5H4ZA 5I17A 4U1IB 3T65A 4H26B 2CO7B 5DUBA 2NY5L 4R7XA 2GB2A 1H5BC 2WOBA 2N1TE 5C0EA 1LO0L 2NX5A 1Y18A 1SVZA 4ZOBA 1XSJA 2D3LA 3QUYC 3P9MA 4OZFA 3BPLC 4OGAD 2Y2YA 3PDOB 3SDXF 4GAJH 4IJTA 1MHPL 4MA3A 1PNCA 3IE4A 3QDJB 4M5ZH 3L4UA 2CKBA 3BQUD 1L6ZA 2XWBB 4JPIB 3ARBD 4A6YL 4ZTOL 4QWWD 4UT6L 1QUPA 1UWGH 2EABA 2Q3XA 4BV1A 1BBJB 1THCA 2H1LM 3QJQB 4XP6H 4EN3D 2D0HA 5JW5A 4NQEE 1A14L 5F6HJ 2CJUH 2XQYG 1N59A 2AQRA 3OWRA 4PRIA 4CMMB 3MJ9A 3ZL4L 3GO1H 2OKMA 4P2QD 3FYIB 3UO1H 3EYSH 3QFGA 3S48A 3SPGA 4XX1G 2Y22A 5D1QD 3DYOA 4TM9A 2XICA 3CFJA 5I1LB 3MOBH 2FSDA 4OAWB 1YPZB 5IKCB 3D7QA 3QWQB 2RFXA 3JZYA 1TTBA 3I3BA 1FC2D 5CJ8A 2KLTA 3VD3A 4GQQA 1LL1A 4NKOA 4H0HB 3CDZA 4N2EA 2D7MA 2UWEB 4N0RA 4HSAC 2HKPA 1F13A 2A3TA 1UADC 2LAAA 2I7OA 1XQ4A 2VWEE 2FB4L 3LIZA 5ECGA 1YMMB 4ZXBD 5HDOA 3TNNB 4TVPD 4O5LH 4U3HA 5I0VA 3J2PA 2F74B 4KI5E 3WGUB 4GBXC 2L4OA 3ABKB 4X4XA 4CVZB 2ZF9A 5ICUA 3ZTJG 4X42A 3VFWB 4U1JB 4OLEA 3MRPA 1JVLA 4BSJA 1RZJH 4TPRH 2ZPKL 5E4EB 5FIEA 4QYOA 3GSUB 3TO4A 3FJTA 2FEDD 2OXGA 2ZUVA 4HWBH 3QIWD 1LEKA 3H85A 2W92A 4MAYD 4WKZA 1A8ZA 4WFEE 5I1JL 1AIZA 2BY3A 2LU3A 3NIFE 3TWCL 3V4UL 5JOFA 4G9FD 1TUOA 2Z3FA 4AZ8A 4OLXL 2XHIA 2G5BB 1T83C 2Q3AA 1QQDA 3S4SA 4U1SA 2NY1D 1VZIA 5DC9B 5A2CA 4AIXA 2WUCL 2BSEA 3NAAH 1HU8A 1VFBA 5C07D 4YO0B 2EIJB 2LTQC 4OLVH 3CHOA 1YMMD 3VA6A 1UOWA 4UIKH 1EFXB 2GK0A 4LF3A 3WNIA 2ITCB 5GGSY 1U8MB 4TTDC 5CP3A 2V8LA 3O11B 1BG9A 1RJLB 3GSXA 3QVAA 3WJMB 4AM0Q 4OT1H 3WJJA 1S8DB 1TSHA 1A7PL 1Y7VA 1SPDA 3O2VL 5C0DB 1CGSL 2ZQKA 4UQ3B 2I7SA 1HSAA 4DPCX 2IANA 3VGGA 5A3ID 1LEGB 1IU1A 4UOW1 2H6OA 4KH9A 1AXTL 1SM3H 2BJML 4KK9C 5F7EH 5HDBB 2R1XB 5EO0B 1JZ3A 2NWVA 2JJSA 3RPBA 2YRBA 4M1DL 2YRLA 2WVUA 3EBGA 3RVXC 3AQZA 5E9DB 3KXFD 4H1LA 2O6PA 2EH7L 1ESOA 2N3JA 4XNQB 3U6RB 3U6XA 3WFEL 4DO5A 2CALA 1YTBA 1TO5A 2DWEA 2BVEA 4NCC2 3FRPG 4BEIA 2OYLA 3VDCA 2Y0SA 1OM9A 1EXUA 4K3EL 2RCSH 4OD3H 4AVIA 5JR1L 3TVMC 1R24A 5GZOC 2DKDA 1HE8A 4W9KC 5HHNA 5AFAA 3CK0L 4NPKA 2X0UA 1BX2B 2AXFA 5F7UA 3WKYA 3ZE2F 1J7VR 4PUBH 1ZTXH 2DV6A 2GC7C 4IRZH 4F7MA 1H9DA 4Z7UB 2ZP9A 2ED8A 1E40A 2IAMA 4NQSB 5FYKH 2WLKA 1F2XK 2OTUB 1WBYB 2HP4A 1XSZA 4B7LA 1CE1H 1JI1A 2NOBA 1ZKAA 1IJNA 2Y72A 2QKIC 1BFTA 2QQNH 4WI7A 1PYWB 1I3UA 2R4SL 1WA0X 1EEZA 5H2BB 4A6YA 4I2XB 4PJIA 2B1HL 2DI8A 3KBFA 4ZSOE 4PYHA 2ADYA 3F7KA 1QHOA 4K8RH 2D31B 2DD8L 4NOFA 2MCPL 5DEZA 4HKJB 2O5YL 1S9VB 3OKDB 3GFUA 2ADFL 4G11A 3GRBA 4Q6KA 3WTVA 1TTAA 2I9TB 1E6OH 3VCLA 3II3A 1BD2B 3MLSH 1B2WL 2HJFB 1MQ8A 1PSKH 3GMPA 3P11L 5I0ZA 5D7EA 5AW4B 2A1WL 4WI3A 2K7QA 4DK6A 3I6KB 1NKOA 1QQDB 3S4SB 1RK1B 5G4OA 2CHZA 3FT3A 3IJEB 4JCMA 3FSOA 4P05A 2H0PA 2X12A 5LHDA 2ORBH 3KPRE 4JNXA 3BVUA 3NEXA 2EE2A 1URLA 2CA3A 1ES0B 1M1XB 4XMXA 2O6EA 5L2JA 3S9DB 1X5YA 2HVKB 2APBA 1DFBL 3EKCA 5D5MF 4Y19B 3VXNB 2PCPA 2Z4QB 1P84J 3CC5B 1UD8A 5DD6A 5INCA 5HHOB 1AIFA 2IDCA 1DVFA 5A2LH 4X5LA 5LQBL 2XBDA 3UMTA 4OBRA 4POUB 4FL4B 4K0OA 3ZN6A 1MCPH 2D3NA 3PHSA 1NGZB 5DUJA 2Y3NA 3PREA 3PJSA 3WSQH 2YPLA 1SQMA 3B2UD 1A5FH 3IRPX 3OJDA 3ZKXB 3BKJL 1AGDB 2DD8H 1RULL 5HJ3A 5A2FA 3LSOB 2J8UF 4PJCE 4QOKE 5CBEA 3TPUB 3IS0X 3P2DA 3WAKA 4M1DH 4ENZA 1P5GX 4Z0BL 3HMXH 3PJNA 4WUUD 4ATWA 4PJ7F 4HT1H 4IEFA 1HXYA 1P1ZB 1AFVL 3OC3C 4AH2A 2P5WB 5GS0D 3F7RA 3PQYA 4NZJA 1BXVA 5IT2L 2NUPA 3V0HA 4JY6A 3S35X 3S36X 1TQCB 3FFCE 4IJ3C 4EKXA 5LB1A 2X1OA 4XO9A 2ODIA 5J11C 4BK4A 4X7EC 4OCXL 4ZFGL 1E4XI 5IB2A 1WVZA 5MEOA 1I9IH 3DOHA 5MEQA 3HHRB 3FCSB 2X4SB 1XSIA 5JW3L 1AXSB 5IMOA 4KQ0A 3RTQC 1I7ZA 2NY2D 3V4PL 4QF1B 3R19A 1OPOA 4PJDB 3QJUB 5EU6D 2RCSL 2UX6A 2XV2A 4YDVB 4M8UA 2DTSA 1JPST 3ENOC 4WUUB 3QRBA 1C5DB 2ZT9C 3H6JA 3BZ4A 3P4NB 2PWEA 3QFJD 4PRAB 3VI3B 2XIBA 2OPCA 1UJ3C 2BOBB 4AMKH 1A6VL 3HMWL 5HGBB 2JKXA 2X5PA 3WFHB 3T65B 1RZ7H 3ZE2E 3CBRA 4IGBC 4HA1A 3CFMA 1ZHBA 3G5XB 2CNZA 3UPAA 5L6YH 3N5AA 2DL2A 1YNTB 5JIKA 4OCWH 4TNGA 3ILQD 1XB3A 4OSUH 3RFZB 3DURB 4G8IA 1M7DA 1KJ3H 2A1WH 4GIAA 1N64L 4LU5H 3KPRA 2C9UA 1J86A 3RWFA 3FBQA 3VFNB 3VTMA 2K9UA 5EBGA 5CCJA 2JQZA 1O6TA 3RIKA 3PDKA 2V9TA 4N5EC 1DBAH 2HRHA 1B4RA 1KB3A 1UM4H 5T3XD 3BSZH 3V5KA 4XNDA 4JZNA 5IY5B 4IBVA 4OGQC 1RI8A 1FN7A 2Y2WA 8FABA 1U3HC 2VM3A 4J3OC 4N2OA 4QRFA 4IDJH 4H25A 3LH2L 4JBSA 3RUGA 3AT8A 2LAGB 5DQ9B 5TK2A 1CBJA 3L3GB 4JY5L 5CSGA 1AQDA 1OB0A 3BAXA 2VLJE 4I8DA 1AH1A 1UENA 3O9WC 3SE9H 4GXUM 3QPQC 3VXPB 1RFDL 3II1A 4DKFL 4JPKL 4KMTH 5HGAB 5T3XH 1AISA 1OAQL 5CLZA 4R9HA 3G6AA 3KJ6H 3MV7B 3B9DA 1JDCA 1O7DE 1CLVA 4M4RA 2X6AA 3PJLA 1GVIA 4ICWA 4L3FA 5D5ME 3KEHA 4NRYB 4WJ5A 3A0OA 4FCAA 1A6WL 2EILB 2DQEH 3G08A 4Y5YA 5D7JC 5HI5C 1L7IL 5HVHC 1OHQA 4MNQE 4XP5H 5I1IL 2GJZA 4BQ6A 1KTBA 1CDIA 4ZTPH 1G7LA 3P3SA 3RA7H 1L7TL 1GY1A 2ZP8A 3U7WL 5M94B 2BIMA 2CUIA 1DVQA 1YUHA 3QARA 5AVYB 5D1QC 5A2JH 4H0GA 1KPRB 3P0VH 4U1NA 1YMME 3ZO0A 4QXTB 2HH0H 4JVUA 2EADA 1E5AA 1IFGA 3BFOA 1KXTB 1BECA 2OX5A 3OLIA 4R97B 2QSVA 4EDXB 4ZW6A 1AHMA 2GFBB 5IQ9A 3BAYA 1GXEA 3KPNB 4UV4L 2J4WL 4Q8BA 5CSZB 1QOKA 4MJ6A 3IDMA 2XQBH 4N6RA 4NNXB 4PV9A 5BOZG 1VOLB 1HNFA 2ADIB 3Q13A 2ALAA 4JRYB 1A6ZB 1DJIA 1WFOA 4K71B 5DVKA 3IJSA 4E42B 4F2ME 3LPWA 3DK0A 4OVVA 2WBJB 3CCHB 3RKPA 3LH8A 4BCYA 3SO3C 3HR6A 5CU9A 5ISZA 2HCZX 4EOWH 4FFVC 5I0XA 1BDYA 3IU3A 4PGDB 1JD7A 2K4WA 3O6FC 4FA6A 2WGXA 2ESVA 1TMCB 2KI6A 2LT9A 2D7TH 3MRBB 3IM1A 5JA8B 2N01B 4L8CA 5DRNA 4AMKL 5I66A 4KKLC 4NKDB 4P46C 1X44A 4ODUB 1N10A 4W9JC 2P42B 5EO1B 2MFNA 4NB7A 2V17H 5A16B 3VXMA 3I6GB 2DQ6A 1JNHB 1Q9UA 1CZ8H 1EUTA 5DEGB 1S7RA 3L7EB 1S7SA 3MRGB 3MA9H 4KFZC 3TPKA 3ZSTA 2WBJD 2OW7A 5JQIB 3D52A 5EUOF 1ZVHA 1BGXH 2EIKB 5HDBE 2F1EA 4N0CC 4EN2A 5EORH 4YEEA 3KWTA 4F15B 5TE4H 3M46A 1GAFH 2VLJA 5E9DE 1F1GA 2FK9A 4M61A 4J8RA 1LWJA 3OGCB 1E9QB 4QHKI 3ESPA 2O6FA 4Z7QB 1Q8MA 2X10A 3NN8A 3JWNH 1R34A 1TG8A 4PGBB 2VN7A 5C2BL 4FNUA 1OGAE 3ISWA 5MERB 3HLAA 2NQDA 3L1FA 3QRGH 3W38A 3FUMA 1W72A 1E3XA 4NJAH 3ISYA 2XXMB 1WAAF 2QQQA 3F6IA 3QXAB 2PPAA 1DBKL 4S1QH 3WD5L 4KNUA 3JVGA 1TENA 3SKJH 4S1RL 1M71A 2V7NA 5DJYB 4PRPA 1XIWC 2F58L 1FNEB 3G5ZA 4GINA 1ZOXA 3DARA 4ZS6C 1AG0A 3GB7B 4I5BA 5AVWB 2GKIA 4X5RA 1HYSC 4Z7UE 4WNQB 1A9VA 3GXPA 3ZYZA 2ARJA 3DC0A 4RGND 3KPPA 3RIAF 3ZHLA 3WNNA 1IFHH 1EANA 4GKSA 1DJXA 1PKOA 3B8SA 4YNYB 3VFTB 4CU6A 5LXGH 5BO0D 3GMNB 2ERJB 2Z91A 2NNAA 4OM1L 2R0ZL 5HYIA 3VM5A 3VB8A 2YEZB 1LXTA 2FATL 3RX5A 2GK2A 4HXBL 3K72A 3T0EE 3GHBH 1MCHA 3QPXL 2BM3A 3CD4A 1QLRB 1YG9A 5H35B 5T3XL 3L9YA 3KYNB 4F37F 2Z35B 5DJ0A 2DQUL 3MNVA 1JNNH 4RISH 2PYEA 3DTXA 4WJG3 3MPCA 4Z76A 4BH7B 5TF0A 1I1CA 1P4BH 3VSUA 1YNTA 2EAEA 2XYBA 2QVTA 5M95B 4PY7B 3DJZA 3APMA 1LD9B 3AMLA 5DC4B 1TZIB 5TDOB 5I0DA 2FT6A 3KLHC 5IHUH 2CK2A 4ENEC 2ATPB 1EDYA 1PSKL 4WUKH 3LOWA 3B2PA 4JEGB 4WFGD 3TTYA 4PLJC 5T1KD 3TBSB 4LOVA 3LZNA 4JHZA 4Y4KA 1CI5A 3NOIA 3ULVC 1UQSB 3CZSA 4GSRA 4KK8D 3VVWA 5I19H 5T5FH 5IR1B 5K9KB 4XPHH 1WK0A 4XXWA 2X1QA 1E5ZA 4NKDA 4KQ3L 2NSMA 4HH9B 4Z7WA 3N44B 4ANKA 2CDFA 4DGIL 3CZFB 3MCLH 1T7ZA 4JDEA 3BT2H 4J2QA 2X9ZA 1ZSDB 1AE6H 1WF5A 4NN5B 1RK7A 3Q1EA 4MSWB 3DROB 2JV6A 1HOCA 3ZT7A 1BQRA 3FONA 4TVPL 5D2LA 3RZCB 4CN4A 2FCBA 1RIVH 4PQXA 3QPXH 2H47C 1MCEA 3OAWA 2QADB 3T77B 1KCRH 3VE0B 4BFJA 3PQYB 1OCOB 3FQNA 2W60B 4GBXA 1L0YA 2VLRD 3D0LA 3M1BB 1J0IA 4AJYV 1JWSB 1H0DA 3OWEA 4QRPD 5EU7C 2E27H 5T3ZH 1PDKB 2APSA 4PJ8A 3IGUA 2NOLA 5JOPD 4GBXD 1MF2L 4KJPD 2GJPA 1XGRA 1VHPA 2XN2A 4ZUTB 3H9SA 1ZIBA 5C7XL 1KDJA 1PZCA 4K8RL 3SE8L 4MNHB 1NCAH 4MNGB 3FZUD 1COBA 1G6VK 1ZLSH 4LSPH 4QTIL 1C16A 1YECH 1UM6L 4I77H 5CEZL 3FO1B 4XWOD 1IGFL 1KIUB 3H9SB 1S2EA 2RGSA 5FPIA 2ETWA 3NT0A 3RUGF 2XPGA 1LWVA 1A7BA 4F58H 1BLIA 4FFWD 4XP9H 3CU7A 1I53A 5I8EB 5BZZA 4F8OA 2HG5A 2EEDA 1K8DB 1P4UA 1BA9A 1WO2A 2YZ1A 3T6QC 3D2TA 5DJXA 1T4KB 2X38A 4C58B 3AY4A 1CBVL 1DP0A 4GBXB 4F7EB 1XF2B 5GGSA 3SJVB 2XKNB 3LCYA 1BVKA 1CI3M 3IAGC 3QZLA 4YXKH 4DF9A 4R4FH 1I1YB 1WFTA 3RB5A 4WEBH 4ROCB 1R5WA 4OJEH 2OP4L 3EJYD 4IBLT 4Z5RA 3WNKA 1NPNA 2J20A 3P0VL 4WWKC 1NGPH 4P5TD 4N0YH 3VU2A 1I3RB 2WLZA 3MBED 4JKWA 1IAOA 3RA7L 1BZQK 5E6RB 1SJXA 4F37K 5LAXB 1J5OL 3ZE0E 3FMGH 4G3YH 3F8UB 3QORD 3S34L 4HEMA 3P3YA 4O9HL 3V0AC 1CT8B 4FJ6A 3INUL 1SLWA 5CXPA 5D7KD 2N7BA 4XPTH 4RZCA 1EO8L 1QVOB 2HT2C 3D2UD 2WVTA 1INDL 3CJJA 5IQ7L 3MR9B 1SXNA 1FI8C 2NY4D 3QH3A 4G1EB 3TN0A 2BNQB 4WX8A 4OCSL 3KG5A 1CC3A 3CBJB 3A22A 5T5FL 2R15A 1EZSA 2WKGA 4PRPD 1RHFA 3IETB 3ASMA 4PY5A 3S5ZA 3P9WB 2JF1A 1UJ3B 5J89A 2MQ3A 2ZXDA 2A77H 9CGTA 3RWCA 1OAXH 1VA9A 3ML9A 1ILUA 4MMZB 3DGCR 4WGWB 3DOSB 4UAHA 2AQ3A 4IK7A 1FH5L 3T0EC 1AGEB 4F57H 4J3OH 2IWEA 5GJSL 1T1YB 1QFWH 3GMNA 4Y2LA 4OIIL 2BVPB 3LQAH 3ZL4H 4IMLA 3SHSA 4M1CD 4MCNA 3WNJA 3STZB 4Y1SA 3MJ8A 4ZTPL 2PR4H 2CIKA 4O2EA 1NEPA 5IV2B 3MODL 5EO9A 3O6ML 1K8IB 3NZ8B 5A2IH 3IJHB 5I75B 5DJDA 3EDDA 3ARDA 4N86A 3U0WL 1GYVA 3FTSA 3OV6A 4ZS7H 1LTXA 1NA8A 5EUOA 3REVA 2O3OA 2V92A 1WH0A 3IJ7A 4EQ2A 1FAIH 4JG5A 2YFNA 3QXAA 5F8QC 1FGNH 4HS6A 3TBTB 3VACA 2QQKH 5IMKB 1QLEL 1I31A 1UZ6E 1B9ZA 2BNRB 3FB6A 2GTQA 3SE9L 1NFDB 1F8TH 3PV6A 1IVTA 1T2QL 3B5HA 3KHQA 2C4FT 2NY5H 4DP2X 2MHAB 5JHLA 5H94A 4CKVX 1USZA 5D2NE 2HTLC 3RGBA 2VMCA 5ADOL 2Z6FA 1A7OH 3GSRA 4TKWA 1VCBC 1NFAA 4EO5A 1BZ7A 1J9RA 1SN0A 3ARGB 4M3HA 1GOGA 4EAIA 1OXYA 4LDCA 1Q1JL 4Q6IA 1BEYH 3PNWB 2J88H 3O45A 3AG1B 3VAEA 4TSAL 2WXHA 1IQWL 3GXTA 1JHTA 3KLSA 3FKUS 1AKJA 4I88A 4OTXL 1M4KA 5F8RC 2PO6C 2R7EA 4JHVA 1BMWA 3BXNB 4POZD 1E30A 1UWGL 1HQRA 5KYUA 4DUWA 1UD5A 3X1BA 4V1DB 4YR6B 5B38A 4H8WL 1VGEH 3BGFB 5F3HB 5DRNB 4ELKA 2RH0A 1GS6X 2VZTA 4I4WA 5FOJA 5KSBA 4ISVA 2I24N 4IKJA 3UADA 1YC7A 1NUFA 4G6ML 4XNYH 2FTAA 3EHBD 4HJJH 3GMLA 1CD1B 4LSTL 3GGWA 1D7DA 4L8SA 5CGTA 2ZUTA 2VDLB 1QBLL 3IMSA 1U2CA 1KGYE 3MNDA 4QOKA 3SBRA 3S37L 1ZV2A 4GS7C 4KROD 3ARGD 3T6ZA 1E8XA 1I3GH 4Y5XC 3TBCA 1I8MB 4AQOA 4N22A 1QKZL 2JKJA 1Z6JT 2MTAA 4NGHL 3VFMB 4OKVB 4XWGH 3CIQA 1XGPB 4EBQL 3LKSB 1S78D 1FGVL 1TQUA 5AVTB 1IAIH 4Q0XL 3PGDA 5DO8A 3AT0A 3VD0A 4PJCF 2I60L 5IYDP 2FSEB 3LD8C 3DGGA 4FQLH 2HRLA 1HINL 1U8CB 1DCEA 2YMTA 3PWPE 1CGTA 4UM9D 1U8KA 1Z66A 3EOAA 1EEQA 4D0CB 2O5XL 2VQ4A 4R83A 4YX2H 3CGTA 1A3LL 3RYMA 4LHQB 3PRZA 5HI4D 1FVCA 4RLDA 1UB6B 3CDCA 4I3GA 5F71A 4LARL 1KLFA 1AGEA 4RVBA 4I9WE 2ZKHH 5J6SA 1GGIL 4NO2B 4JMXA 3HJEA 4EZJA 4YQXL 1J18A 2YA1A 2C3XA 4BCXA 1JGIA 3BT2L 4OZ4A 4M1GH 3GEFA 5J12C 1BWWA 3EIFA 1MPGA 1T5XA 4QHNB 3K5RA 1GCYA 1VGKB 2P5WD 1A1OA 2HJKA 5HHXL 1JRHI 4A7GA 2Y1AA 4LSUH 4GMTL 1I9RH 2D2CC 5CS7A 3GC3A 4JPVL 4XNQA 3K6OA 1PEZA 1U3JA 4AEFA 5GS0H 5D72H 5IF0B 3DVIA 4YE4H 4EIUA 1LVEA 3UBXI 2EIBA 2UY6B 2OOXA 2B16A 3F58L 1KXVC 2XWEA 3HG4A 3MU3A 3Q5YA 2CO2A 3FT9A 2G9HA 4JJ5A 4JRXA 4G72B 4JQIH 5A6IA 5FHAH 4DN4H 2EDRA 1QSFD 4U6HA 1Q4NX 3GMQB 4KHXH 4NZTL 1QYGL 2VXTL 4R7VA 1V3LA 1MWAH 3KCWA 1AP2B 4JFHE 3QSKB 4P3WA 4YJZL 3CQQA 4MQ7A 1UEYA 4TYUA 5E8EB 5F96H 5I16B 1JJUA 4JB9H 5G4NA 2OR7A 4F2EA 1AGBB 2GVYA 2IIJA 4PD4J 2BXYA 1CICB 3RRQA 5FYKU 3WG7B 1PF3A 3KJ4C 4UTAH 2F08A 4Y7MA 3UBGA 2AEPL 3NIGF 4KKAC 5JQ6H 5GRUL 3GJFK 4OM1H 1A7QH 1ACYH 1L0QA 4NO3A 2JJTA 1LP9B 1UXMA 2J2ZB 4ZDHA 4L9LB 3V4VB 4AQ1A 2A9ML 2IBGA 4EOWL 3RI5F 5GS0L 2J25A 1MFBH 3BVNB 5I8EA 1UG9A 3IRZA 5IYCP 1KFGA 2H32B 4ONFL 5FV2A 1AOZA 4FP8H 4WHYH 4HK3J 3Q01A 3VGDA 3DO3A 1AO7E 3QNXA 4JO4H 3I3WA 2IO5A 2NUTA 2V7HB 5EOTA 2J88L 4WUUA 3RTQB 3Q1SH 3RQ3A 2ZOUA 3RVWD 2UV3A 3U9PH 5LN4A 3BZFB 1QN7A 1NJ9A 1VTLE 4LOUC 5AYTA 1C08A 1GMIA 3EYUL 3D69B 4P2RA 4MNGA 3ZKSD 3LKOA 4LFHG 4L0PB 3ZYOA 3PCYA 3PWPA 2DIEA 3AM8C 5JPMA 1MLCB 3TJEH 4FZEH 6PAZA 3VH8B 4QRBA 2QSCH 2PTUA 2MQGA 5FA4B 3BPLB 1IQDA 3UAJD 4PMEA 3PL6C 4M5ZL 1R3HA 3GJEB 5DHXB 1I8AA 4IIZA 5C0GB 1A4KA 1G0DA 2W07B 5HJDA 3BE1H 5DCCA 1PIGA 4OIAA 2FL5B 1UKTA 4KVPA 3I75B 3BT0A 1H6TA 2EXWC 1RUAH 3NSDA 1VIWA 2DJUA 4OGAC 4N2AA 3RTQD 2OR9H 4XHJD 1FUNA 4OZHB 1KB5L 2Q7AA 5IWLC 1BZDA 1DJGA 1RSYA 4AQ8A 4LAQH 2B0SH 5KS9F 1XGZA 4I3SL 4AK1A 4HZLB 3HUJE 2OL3A 2JTDA 4C8XA 2FGWL 3GMOB 3TH4T 1T1ZB 4OIIH 4JPIA 1PD0A 4GRWB 3SE4A 1T2JA 3ASOB 3A4FA 4IRJC 3UTOA 3DBXB 4AGOA 4WWKA 3ABLB 4YDLC 2FQEA 5BO1H 3QA3A 3AS2A 3PDOA 4AC4A 4M56A 1H6FA 1P1VA 1RMFH 1SBSL 4GAFB 5I9QB 3ASWA 2Z4QA 3CC5A 2EQDA 3N43B 4YE4L 4AGLA 4ADGA 5F3BB 2PPEA 5JW4Q 4K8RC 3D50A 4PSPA 3IH7A 4OM0H 5HPMB 3V0DA 2ZUWA 3PNWA 1BJ1J 3UGUA 4AGQA 2XFXB 5KVGL 4U6VL 1VZGA 1CFNB 2AJ3A 4OCRL 4GW1A 1Z5YD 3OZKA 3QS3A 4GSDL 5EU5B 2IWKA 1F45A 1T0MB 4XMZA 1OPGH 5E7FA 1UCTA 1CDYA 1YO4A 1JSYA 2N59A 2VUKA 3KWWA 4NNYA 5JLZA 3TT1H 1FIEA 1TIUA 2ZG1A 2FE0A 2MHAA 2QQKL 2VERA 1EXGA 2X6UA 3BISA 4O2FA 4HS3B 1HXMA 4ZSOB 4FHKA 3O41A 2XQYA 2AQTA 4XAWH 5CHNA 5DD1H 2YRZA 2XY1A 1D6VL 4AL8L 2VWEC 4K7PH 1UT2A 5BJTA 4O58H 4MYWB 1AO7A 3HKZA 1U30A 3BHBB 1D3UA 1LWWA 1PG7X 4XHJC 4JPKH 4FFZA 3ROLA 2CO1A 4WI0B 2QGCA 5GJSH 1P9MA 5J06A 1OTUD 1C1EH 3GS4A 3U4AA 3ATEA 2DQJL 2XZAH 5BS0A 1KBVA 3DX9A 2VQTA 3NJKA 4ANWA 3U30C 4N25A 2QLVA 1QAWA 5ESAA 4LRNH 5BJTB 2CG9X 2X70A 2V2XA 3IFOA 3D3VE 5A3IC 1XEUA 1NLBL 1JMXA 1MN4A 4GLRI 1VFOA 1CYGA 1A22B 1KJMB 4XO8A 1JIBA 2XTJE 4WO4B 3FHEA 2P7TB 2XIIA 4JFEE 3VG0H 5DMKA 4ZPVA 4YZFE 1HWGB 2X4NA 2DEYX 4TNEA 3D18A 3FOLA 3WIHH 1CG9B 1O75A 4BWWA 2BSRB 1FL6B 1WAEA 4GRLC 4XOEA 1JDYA 5D2NB 2OK0L 1WQAA 4HLEA 5DJZA 4HOZA 3ULVF 4BQBA 3S34H 5CZVH 4B9CA 1RUMH 5IMMA 4OZIF 1SN2A 3O6LH 2ID5A 3QUXC 5BUAA 2P5WE 5EULV 1E27B 1U8QB 4GEJA 4PGCB 3MOAH 4ZO9A 4CC4C 3PPEA 4RGMC 5DVLA 1HSBA 4UQ3A 4HPOH 3EOTL 3NABH 5JDJA 3G04A 3BKYL 1I9JH 5TTRA 2H1PH 2XFGB 1O5DT 4CMHC 4WO4D 5E2UL 1DTUA 4LPWA 2CCVA 4PI0A 4X9GA 5B1AB 3VWJC 2DBJA 3OQ3B 5EU3B 4B27A 3ULAB 4G8EA 4ODVL 2O61B 1KBBA 1FFQA 1DLFL 1L9SA 4EUPB 2CD0A 2CLZA 2XZQL 1PZSA 3CWAA 4N1HB 3ZZLA 1Y0LB 1DEEA 1MFVA 2LABA 1S9YA 4GP4B 1JZDC 1A6ZA 1MG2C 1O6VA 2K9FB 3KPQB 3LVTA 3PGFL 2PETA 1JGLH 5F7WC 3S2CA 3UEQA 2XHNA 3ZDYB 2TSAA 4J4PC 4RMRA 1UT4A 4MWFA 4LQ1A 4JUTA 4ZMWA 4ONHB 1NOLA 2R23A 2MPAH 3QUMH 4BFRA 1D9KB 2NQ3A 1IQDB 2WVVB 1KYOJ 5BQ7B 2GCYB 4HP5A 5GIRA 2B1HH 2DMHA 3AGVA 2BFVH 4C54A 3P2TA 3L81A 4IMKC 4PRID 3NJIA 3LS5H 3V5DB 3A6CH 4FA7B 5GHWL 4Z7AA 5KVEE 5JUEL 5BMFH 5BOJA 1RM1A 1JPTL 4RIRB 2CO6A 4U6XB 3UP6A 4JFZL 4QHLA 3ARBA 4LHUG 4OR1A 3B8YA 4WI4A 3RFRA 4XVSL 1FVEB 4FD0A 3BQUA 4WFFD 4XBPA 1KCUH 1RU9L 3OM3B 3O3AA 4ZAKD 5L7XL 4JFXB 4MJ5B 2ZIDA 5GGRA 2VO5A 3R1GL 1JWMB 3ZDXB 1Y1UA 3D3VA 4ZNEE 2DQDH 1BVOA 1YEDB 4HKXB 2JPIA 1IKNC 2HLFC 2A9NL 4KKBD 3MLYL 4KHTH 4MD5B 4YDNA 1ADQL 3BUTA 4XCYB 4YDIH 1VPOH 2P8PB 1XCQA 1D9KD 4XAWL 3RUGE 1NBZB 5DJ8A 5E99H 3F6LA 4PG2A 3QZOA 2CR6A 1AQDB 3MBXH 4P06A 4OI8A 3Q8CA 2PTTB 1FP5A 3NP3A 2ZSWA 5DJ6B 1TJIH 2X0VA 3SKOA