1KY6A

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
247
Chain Sequence
b'GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
molecule tags Endocytosis/exocytosis
source organism Mus musculus
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
total genus 65
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky6A02
3OC3C 2D0AA 5CN2A 1QNCA 1VOKA 1W80A 2IV8A 1OM9A 1QN4A 1NA8A 1QNBA 1QN6A 2IV9A 1B9KA 3OCIA 1TBAB 1MP9A 2D0CA 1GYVA 1QN7A 2DWXA 1KYUA 4BCXA 1P4UA 1TBPA 3ZY7A 4ROCB 4PY5A 1GYUA 1KY6A 1QN9A 1QTSA 1YTBA 4RODB 1AISA 1QN3A 1D3UA 1KYDA 1TGHA 5CN1A 1NVPA 3H1ZA 2DWYA 1KYFA 1RM1A 1IU1A 1NH2A 2D0BA 2E9GA 1VTLE 1VTOA 5IYDP 3ASMA 1VOLB 1QNAA 1QN5A 1GYWA 1E42A 1PCZA 4WZSD 4ROEB 5IYCP 1QNEA 1R4XA 2Z8UA 3ZHFA 3VN5A 1PZDA 4B0AA 1YTFA 3HS9A 2A7BA 2VJ0A 5IYBP 1QTPA 3HS8A 3EIKA 2MJ7A 2G30A 1CDWA 1JFIC 1QN8A 1NGMA 3MNMA 2YMTA 1KY7A 1C9BB
chains in the Genus database with same CATH superfamily
1DCEA 1FVCB 1T66D 5IHBA 1UM6H 1ZLDA 5JMRA 5DJDB 3Q8CA 1SRDA 1XB6A 2JB6B 2TRHA 1ZT4B 4KVCL 3V5DB 3EHBC 4EIBA 4K3HA 4N26A 3VMOA 5AW8B 3UO1L 2BSTA 2H41A 3WNPA 3CH1B 5C0FB 4MXQD 1DBJH 2B4CC 3HLAB 1B2WH 4GKLA 3ZE0B 4YSAA 2BLFA 2UWEB 3FUEA 5J12C 1CFQB 1QSVA 4MMXA 3QDME 2WPGA 1SEQH 2CHNA 4XMVA 2GCYA 2P5ED 4PUBL 3RFZC 4J4PA 4NB7A 1KCUH 4FXKB 3OLPA 2BS9A 4PJFB 3B34A 4HKJA 2Z1PA 4YE0A 5F88A 5IW3A 3LIZA 4UTBL 1H6TA 3MRGA 1HINH 2EDDA 2FHFA 4U1SA 3SZKC 1MFCL 1D7BA 1KN4H 4FZEH 4ES9A 1KYOJ 3VFGH 4DULA 1NVPA 5CP3H 3QUKB 4QKXB 5GGVL 3KTUA 2I85A 2UWEA 1F11A 3V5HA 3O3EB 3UZVB 2EIDA 2CLZB 3NCJH 5T5FL 1EXHA 1CD8A 1CTMA 2DY2A 3TZVB 4AYID 5ENWB 4CU6A 5C0FA 3KPNB 3IJHB 4G11A 3S0PA 3FQXB 3ARPA 1BQLL 4EKXA 1BVNT 4FFYH 4PY8I 4XP1L 1HXMB 5A7BA 2HTKC 1A6VH 3H2QA 1A4BA 2BOCB 5DF0A 3CVHA 2IFFL 3LRMA 3GKWH 2JCCE 3EGSA 2CK0H 4AQEA 5EB9A 3FT3A 5ICZB 1P69B 3N1MC 1NCWL 5K9QG 4M7LH 1YUKB 2OTUB 1I1YA 1LO5A 3IKKA 3QXAB 3MLYL 2YPKB 1Q9OB 5FF6B 3TF4A 2X7LA 3KHOA 1EA9C 1XDTT 3LVEA 4K71B 5L88H 1QMUA 4YDMA 4HU8A 1BD2E 2I60H 4WSGA 3QUKA 4KI1A 1IGCH 4PRHB 5CCHE 5EPCA 3A6BH 3PWUA 1XB8A 4AJWA 3GI8L 4XBEH 1U8QA 1WD9A 3MBEB 3OKDB 1WDAA 2KLSA 3FPXA 4ZFGL 4FJYA 1TENA 4NQDD 3AY4A 1PSKL 2WYTA 4B3EA 3DWTA 4QHKI 1JK9A 1BAGA 1RIHH 3C12A 1QA9B 1KLUB 1S7SA 4A2LA 1RZGB 4UUJB 2WWKT 3QH3A 1IE5A 2YZ8A 3HA0A 3WEOA 2VLLA 5IMOA 1I1YB 1YG9A 2BW5A 1ULVA 3MZGB 1HHKA 4WW2C 5AKSA 3TTSA 2OMBA 1U93B 1B6UA 2R69H 4G7QB 1LWHA 2IQAB 4I88A 3QXVA 2DWSA 1INQB 4FQJH 2OQJA 4MD5A 4MQ7A 2ICEB 1IEHA 3ZQ9A 2ZFDB 3N41F 2FEDC 3VM5A 3L2LA 3DBSA 1FO0A 4HCRA 3RB5A 4XO3A 2OLDA 3Q6GL 4GI6A 5CIPH 1D5MB 3C5ZD 4E9TA 5IUCA 5MENE 5GGUA 4O5LL 4JPKH 4JFDA 2W0FB 4J4PD 3ISRA 3S36H 1EEYB 4BQCA 5J13B 4KXCA 1HL8A 2BSSA 5D1XD 3IFPB 5ADPH 4Y1AA 5D7JA 4HV8B 2IWEA 5F21B 5KSBA 4I8DA 1BQSA 4J3XA 1JBJA 1P6AB 4EDWH 2XTSA 5KVDE 4N2AA 4AMXA 1SY6A 5JW3L 3CVSA 1KYOK 2VWEC 1A7PL 4IBVA 2NY4D 1BCIA 1QA9A 3B2XA 4D3CL 5JOFB 1KGCE 4OFYD 1J3MA 4F9LA 3B2PA 3DVIA 4FNPA 1AG6A 4NRZB 2X6VA 3K8LA 3DOSA 3ECVA 2BX5A 2DM4A 4HUWA 1KCVH 1NBVL 4OSUH 4CKVX 4CN4A 3O6LH 2UV3A 3I50L 4A1RA 3E38A 4YWGL 3FT2B 1I82A 1JNLL 2QEJA 4OTXH 4KC3B 4U05A 1MH5B 2Y6TE 2GIMA 2X1QA 3IGKA 1KIRB 4AQAB 3L7FA 1ZGLM 1FQ9C 5GS0H 1RUAH 4WNJA 4YL9A 2ITDB 5EF1A 5IOPB 2XWRA 3JVFC 2JKWA 1KBKA 1DL7L 1IAOA 2Q6WA 4UM9A 3S48A 2NW2A 3PWPA 1S7UA 1NICA 1P84K 4L8DA 4NN5C 1PCZA 3ZYZA 1ZGLB 3ARGB 2PNDA 3IVKB 1C47A 4EAJA 4WI7A 4EI6B 2NR6A 1OSEA 3A22A 3WKMH 2APSA 1MAJA 5IQ9B 1MCBA 4FL4B 4OF8A 1ET7A 1RU9L 1DR9A 4HGWB 1HTYA 2E5EA 4JE0A 4NKIL 3S3PA 2VLJA 3D9AL 3CSFA 1S9WA 3P73B 4NO3A 1JWMA 5E8NB 3FH8A 2V5RA 4OBSA 4UM9D 1LO4H 3MV9A 3CMOH 1P9MA 2ZXAA 4TNWF 2X6UA 5B3SB 5IHUH 3T65A 4CL7A 4G9FA 2UYLB 1UZ6E 1QFUL 3GSNL 5T33L 1CBVL 4QHMA 2VZTA 4NZRL 5BV7B 3U1PA 2YQGA 4XWGL 2VT0A 4Q52A 2ZCLH 4XMUA 3I9GL 4A2FA 2VXVL 4DKFH 1XF1A 2CNYA 5C0BA 3PREA 1A1MA 1QZNA 4TV3A 4XP4H 3TURA 4IKNA 3RVTD 3TF7C 5HVHB 1YA5A 3ZT6A 2D3VA 5DVOA 1UACL 3WGVB 1KN2L 2NOBA 3B2VL 3KJ6L 1JPTH 1KF9B 4YSDA 5DHYB 4KO7A 1Y6NR 1MCQA 1NPNA 1OGTA 1ASPA 2EP6A 3NAAH 2AJSH 2P7TB 4HIHA 3C60B 3ZBMA 2O6DA 3MRBA 3CN1A 3BCFA 3FSZA 1ZE3C 4K23L 3RVWC 1AD9A 1IEAA 2H0PA 4ZMVA 4Z76B 3JTBA 3NAAL 4JFWA 1H5BA 4Y4KC 1CYWA 1PVHA 3PU7A 1N64H 5DS8A 5F9OL 3U46B 1X7SA 4XHQA 1NMBH 2DD8L 2QQLL 1XBDA 2YRLA 3GSWB 4HC1A 2XN2A 1HH9B 2OM5A 5I6XB 2PWGA 2NYYD 4YZFE 5KSAB 1SVCP 1T89C 3EOTH 4B9ZA 4ZMPA 1CGUA 3ARGC 3O11A 4HXBL 2DD8H 2QQLH 3BZ4A 3W37A 1WGOA 3C60D 3GM0A 4K5OA 4CC0A 2OYPA 2G5RA 4EOWL 5F9CA 4HUVA 3CC5B 4G59C 4WI0B 3B37A 5D93B 3SBWA 1TZGL 2SODB 2VZ1A 5FOBA 4XNUH 1U3YA 2HVKA 4ANVA 4WSKA 3VI4A 3EDEA 3PG2A 2I9TB 3FJTA 4XP4L 3FSWA 3TPUB 4EI5B 3CIQA 3F8UB 4O9HH 1TZIA 2B08A 4Y7OC 3BVWA 5F3HB 5DRNA 5L0QC 5EEWA 1LO2H 3AQDA 2C3VA 5FUCE 1HXYB 2E9IA 5EBGA 1AYRA 3ZHKA 4G2AA 4FMVA 5BRZA 3A6OA 4XPHH 4LCWD 4R4BB 2P28B 4D0BB 1SLXA 3KZ8A 1LQBC 2LAAA 2YC1B 4OY9A 3M6DA 4FI8A 3PJNA 3BAYA 2EYTA 5I8OL 1G43A 4AL8L 1MFBH 3QIUD 3MDJA 1G7HA 2WNKA 1USQA 3G04A 4P5KA 1JPGB 5GIRB 5C07A 4O2FB 4P5TC 1I7RB 3LNEA 3QNFA 3C5JB 2A6IB 2KYIA 3HC2A 3MJ8A 1P0SE 3W81A 4KPHH 2F5AH 2DMGA 3U4KA 3D0LB 1SLWA 1FV1A 2W94A 2VDPL 4W9JC 3JWOL 4AIZB 4N8PA 3N44B 1FZKA 2P47B 5FFLA 3DX2A 1SZNA 3IGUA 1ORSA 2JJSA 1FLRL 2KS0A 3A67L 5HJGA 3SSGA 3ZU8A 4XVJL 2QKIA 3ZRFC 3V0HA 2NSQA 2CMRL 3DETC 1GOGA 5F7LB 1KG0B 4F93B 3AGWA 3V9FA 1WEJL 4LCCB 4NUGH 1MIEL 5B3JF 5F2FA 1ZV9A 1ZIBA 1C12B 2C34A 5I17B 3OKNA 2J7LA 2KQNA 5E1IA 5J6HA 1E4HA 3HBGA 3VQ1C 1ODAA 3WN5B 5BXFA 3U83A 1UUNA 2JLPA 2C7UA 1T6AA 2HT2C 3AVEA 1A7QH 5C0GA 1CVRA 2DH3A 2B59A 1EO5A 1JTPA 4Z7VE 2JIXA 3RURA 1HQRA 2OL3L 2CDFA 4NO0A 1ASQA 5BMFH 3GQFA 3PHAA 2AXJA 2OMVB 3NFPA 4HHWA 1U8LA 4AQ1A 5DUPH 3VI3E 1UXSB 3NJFA 3BQVA 2FBOJ 2VISB 5CZRA 3V9CA 1HILA 1FC2D 4L8CB 1WAAE 4X9IA 4P46A 1CLYL 2VQTA 4K9EL 3PXHA 4Z95L 3TXAA 3MRDB 4CFFA 2VR8A 3IPFA 3OAUH 2JIXD 1BVKB 3V4LA 3BAKA 3KLKA 4PP1C 2FATL 1JPEA 2PTTB 2HP4A 4YS4A 2QREA 3FSVA 4ECNA 3TV8A 4HHAB 4PRPB 4WEEA 3U0WL 4F20A 4W9HC 4AYBA 2Q20A 1FVDA 5FWRA 3EJZD 1AHMA 4WKZB 4M5ZH 4Y4HC 2BSEA 3GPEA 4D9LH 1M7IB 5DJ8A 5IB2A 1CCZA 1SYSA 2R4RL 2OJ1A 4PGJA 4I18B 3BH9B 4BFEA 3Q8AA 2IG2L 4G8IB 3ESOA 1JGUL 4HF5L 4LF3B 2WW8A 2OXHB 1MDTA 3IT8D 5IBLD 3U7YH 1CFMA 2DLTA 2ITCB 4LPWA 4F7PB 2GC7C 4ZPVB 1F58L 5IYCP 5I15L 2KL6A 4V1DE 2E75C 4NQEE 5CEZD 4PS4L 4KKCC 1VADA 2XZCL 4XH2A 4Y4KA 5DUPL 1JGEB 3T8XB 3ZHNA 3OXSA 2HWZH 4L4VE 2GABA 3PL6C 4PREB 4D94A 2ERJB 1G0YR 5AZEL 1HQ4A 5LG1A 2Y23A 1A9EA 1J5IA 4LIQL 3MOQA 5F1IB 4KJPC 1HH6A 2XFGB 3LH2H 1XR8A 1OAUL 4IBUA 1RL1A 4H8QA 4P3CL 5I8EA 3I85A 3W9DB 3HW7A 1I1CA 2IH1B 1JDCA 4P5TD 2PWEA 4Z7OE 2Y2YA 3FTGB 4TQHA 4GKNA 1M7UA 2CKBH 1SDDB 2Z35A 2VDOB 3T0XA 4KK5D 1CJYA 5IWLC 4M6OH 2DYRB 3KYKL 2JCCA 5DWUL 2PO6D 3PWJA 3QDJB 4P4KA 4NAQA 4LF3A 3L5IA 4KRPD 5IVZB 4AYGA 2EE3A 5HI4C 5DQ9B 1J1XL 1V3LA 3U0PB 4DK6A 2F7LA 3T0EB 4PJIB 2ZWNA 2W65B 4RX4A 5FYLD 1YNTB 1A4CA 4DPRA 3BPOB 4CVXA 1Q1PA 1BVOA 1M71A 1T0NA 1PD0A 2WBKA 3H8NA 3I6KB 1IJ9A 1ZA6A 2VN3A 3ARDD 3QA3A 4LLMB 2XUWA 2XOTA 4TRPL 4IRZL 4DIXA 3I6GA 3I02B 5BRQA 3KYOB 4O2CB 4PBDA 4DTGH 1LNUB 3DX9B 2Q7YA 4RGOL 1Z0MA 3CX5K 5ICXB 5J7CC 2R56L 1F58H 2DOCA 3VSQA 5CU9A 1EVUA 5F7EH 2EE9A 5EZJB 2DEYX 4MNGB 2JJTA 1OSYA 4OCLC 3L6FA 4Z0BH 3SQOL 2F8VA 1Z0NA 2CBOA 2JK5B 4Y9GA 2XKUA 3DIFB 2AV7B 2HPTA 1OD9A 4LIQH 5T5FA 3GMLA 5HYSB 4HS3B 3CZFA 4JR9L 4MCYA 4GKNB 4BJLA 4L3AA 4UT9A 3EYUL 1T2XA 1EEUA 3IKCB 4Q89A 5LNEA 5I23A 1TGHA 1JZEA 1QEXA 3L9RA 2GT9B 4J3UA 5AW0B 1JNNH 1QATA 4G42B 4U1GC 5J9PA 3TT1H 1F6AA 2YOAA 2FEJA 3B9DA 3PWLA 2R0LL 1A4AA 2JJUA 3GB7A 1R5VA 2HJLA 3I3BA 3H9HA 3RY5A 5IK3B 4WHYG 1IAIM 4K9EC 3FO0H 2DKCA 5BW7A 1A6TB 5EO1B 1H6EA 3M7FB 4ICXA 3WS6A 1JHLH 3P0YL 4PCKA 2D7PA 1S7TA 1RZ7L 5EO9A 4DP2X 4F92B 4WXAA 1W6WA 4BH7B 3KEDA 3KYAA 4UDTA 4A7SA 1T7YA 2FH6A 3FO0L 2B4CL 3BSZA 4K73A 5CSZA 1MJ7H 4YLCA 1RZQA 1Y18A 3SGDH 5SV4A 5E2TL 4Z78A 4A2MA 2A9AA 4FZ8H 4OZFA 4ZD3H 1YPZE 2WVUA 4X7TA 4PTTA 1FZJA 3EYQD 4L4TE 5FLVA 4NQUA 3EJUA 3TIDB 1XGUA 2QVKA 5I6KA 1ZCRA 2PLTA 4Z18A 2E7LA 2O5ZH 3L3GB 3S3SA 1MVYA 4CBPA 5FO7B 4XGZA 3HE7A 1QI5A 1XSKA 3OR7B 2XXGA 4NJAL 1P4BH 1A1OB 4JHAL 2V5YA 4ZSOE 3SODB 4BWUA 3P77A 1L5GB 5I2IB 1BV8A 3QO0A 5CWSA 2WBJC 1I7ZA 1JPFA 2Z7YA 2YPKA 4P4KD 4HGMA 3GSVB 3FMGH 2NY5H 1MAML 2R15A 3KVQA 4WU7B 1WUNT 4FP8L 2RJMA 1UZ8A 3DRTA 4DP9X 3DO3A 1CLOL 1KFAH 3BD3A 4MJ4A 2G3ZA 2OS7A 3EYVA 5I24A 5CGMA 4NKMB 1T5WB 2MWCA 3ZTCC 2H6UA 5EWIL 1EK3A 1GW0A 2DIBA 3QBTB 4OKVA 4U1LB 4XNMA 5CJOL 2YEZB 4GW1B 2C9VA 4FQIL 5KTEL 3L54A 4QAWA 5AUMB 1REIA 2BP8A 4QRPB 3OR6B 1C5DB 2I9LB 5D1QB 4CAGA 3HE7B 1L5GA 2WBJB 2H8PA 1S5IH 4KQ4L 4D2NA 2W88A 2WM0A 2QMJA 4FYTA 4PRHD 2HLAB 2YD6A 4QLRA 2E47A 2BHFA 3O9WD 5CCJA 4X7CC 5LNDA 4TULH 1A8JH 1KNOA 1P4IH 2Y6SC 4P4KC 4OI9A 2A9CA 1SXCA 5ADPL 2VDNL 3D18A 5I71B 4YSSA 5K9OB 3CDGB 5M7QA 5D2NE 1IL1A 1F90H 3PNWB 4BFBD 3P4LA 1KC5L 2R0KH 1EO8H 2LU7A 3NUKA 4LVOB 5GGUB 1IAKB 4PJAB 4ZS7L 4P5MA 1NEPA 4Q56A 4P9HL 5KYWA 3U7WL 2YWYA 2QVFB 1YMMD 3O9WA 5FDWB 5AUMA 1YJDH 2WQ8A 1FO0L 2XPGA 3DK2A 5C3LD 3R18A 1I31A 1NFDB 4OZIA 4DGYH 3FTUA 1ITCA 2HX7A 1PZUB 3HNSH 4R7NB 3RL1A 4QRRD 1JFQL 4KUZL 2J4WH 3EJYC 1LVEA 3APCA 5ICZA 2ODIA 3B56A 3R4DA 1Q0XL 2G2RB 1R3LB 3CXHJ 3IDIB 3DOSB 1ZRUA 3ZZLA 4TUKH 3KL0A 4NI6A 4GLRI 1XGTB 3D18B 3BI9X 5I1JH 4EIGB 3WXWH 4KY2A 5FO8A 4HIJB 3PWUB 2EVGA 3O4LB 1KSRA 5DT1H 1NGPH 4NLHA 4OZGF 3TZVA 4YOKA 4MA3B 1DBBL 1VEMA 3MV8E 1JSYA 2EE6A 4M5YH 3H7LA 1ZLUK 2VQUA 3P0VL 4G8FB 4W9LC 4KJWC 5SX5K 3WIIL 4YBQC 3CFBB 1HEJC 4MJIB 4LGRB 4I2XB 1N5YH 1GGIH 2VDNB 4Q6IC 3IVKA 1J8HB 3GMNB 4HK0A 4Z9KB 1IT9H 4LNRB 5CBAA 2HT4C 2CCVA 3PWPB 4CU8A 3AGVA 3IBEA 2BNUB 3UYRH 4NNPH 5FW8A 5A6MA 5HHXL 2GBUA 4K3EL 2HKHL 2EDYA 2PW2A 5JOEA 3RSMA 1BQKA 2OSXA 4MFHA 1EZVX 4KUCD 2CK0L 1UB6A 3QQ9D 3P69A 4UOW1 5FYJL 1PL3A 4LPCA 4BFOA 4KTEL 3F2LA 4Q97A 4OV6F 5FYJU 5JO5B 1MRDH 3RKDC 5TF1L 5D96C 4C56E 4KUZH 5TQ2L 3WELA 3DXAA 4J3BA 3GO1L 1EQWA 3M1OA 4JAMB 1F86A 4ZMTA 4PRIB 1QR4A 2R1YB 2AQ3A 1KGWA 4G43A 2L7QA 3QDHA 4NXKA 4QHMB 3T0EC 5IBUB 4CC1A 2AJSL 1HCYA 2XWBA 5LGHL 2CJUH 3FN3A 2WTPA 4ZMYA 4JO3H 5I5IA 3FAXA 5IGXL 1CURA 3SE8H 3IU4H 2FLMA 3FU7B 4KX7A 2AXFB 2DEWX 1N2RB 1NCHA 1OTUC 1I1RA 1XH2A 2IF7A 4HUWB 4M5YL 2Z4QB 1KY6A 3K1DA 4QRTA 1MSPA 1TLKA 1C7SA 1T21A 1CO1A 1AHKA 3HG0A 3TX4A 4UYQA 1WITA 1D3UA 4PJXE 3EJQA 1XR9B 2JOIA 1HKFA 1A21A 3WXVH 2ZX9A 2VMEA 2GIXA 3N1FC 3MJ9L 2FECI 1KB9K 2NR6D 4OQTL 4YFDB 1Y1UA 4U31A 5LXGH 4UZGA 4MAUH 2JB5H 2O6FA 1K2DB 3BIBX 1QLFB 1ROWA 1J8KA 1JZ4A 1T6VN 4EAEA 1OB1A 2IPTL 2VQ1B 2Z92A 4OJCA 5DO8A 1ZGLA 4XN1A 4HUVB 4P9ML 1MCEA 2CA4A 4L37A 1IAOB 4PWIA 4AEEA 1GGYA 4QJ4B 3QJFA 3HMXH 4I9WE 2P26A 4YIQB 3MROA 4XP6H 3SE3A 2CLVA 3QUZC 3KM2A 1G7QA 5DZNA 2WUBH 3HJ0A 1BFOA 1QEWA 3VGFA 3FCUB 1XL6A 1EERB 4PJCE 5I0WA 2UYLA 1HOCA 3S8GB 4TLKA 2C9XA 4N6RA 1DBMH 3HCVB 2EINB 2GQHA 2QPFA 1ZK5A 3BEWA 3IEAA 3TLRA 4U1GB 1XD0A 1IJNA 4MBRA 3RJDA 4AT6B 2XACC 4Z7QB 2I24N 1XF2B 2DQMA 1P2CA 2V3FA 2WVVB 3SYQA 2BCKA 3VCLA 5CHNB 1AANA 1JD7A 4KGLA 1S9XB 2A1WH 2EYTB 2ICWB 2IMMA 4K8RL 3DYOA 5BRZB 1RMFH 4HWNA 5ACLA 3KCPB 1FNAA 2YC1A 3UZQA 3D4CA 4MX7A 4NWTH 2FGWL 5CS7A 3WTXA 4L37B 1RZJH 1S7QA 4OM0H 3QYNA 1G7QB 3K0WA 1CGWA 2UVEA 4G8EA 1MWOA 3I84A 5T3XH 4YVUA 4JUSA 3NH7L 3VB9A 3WENA 2QSCH 5HYJB 1BXAA 2ARJA 2ICWJ 4KVNH 4YSQA 5DK2B 4KVPA 1XGPA 1DO6A 1YN6A 5HI3C 5I0VA 1F3JA 1KBPA 5E24E 1O9VA 3B7SA 4NGHL 3IMVA 1BVNP 4ZOAA 4A39A 1S7RA 5EF3A 1AR1D 5DJ0A 5GRJL 2EVHA 3SGDI 5IEHA 1N7MH 4JFUA 1BFTA 3ZZSA 1MZYA 2PYFB 5IMLB 4X8XA 3LKQA 1KLGA 5F7KC 4P2OC 1TF4A 4F3FA 4JUTA 1U0QA 2UUDK 3Q2WA 5FKPA 2SEBA 3T3MB 3T1FB 1T1XA 1E8ZA 3HI1A 1MCRA 5C0ND 5DJ2A 2VSKB 1N5AB 2P8LA 3RGVD 1PZSA 2X1OA 1YQKA 3F58L 4DUXA 4LCWA 2HUHA 2P24A 3Q5YA 4RIRB 5EO0B 5CF3A 3TEXA 2XDHA 4OM0L 4BGDA 2GJJA 4PJGF 2ALWA 3RIAK 4Q7DA 3WD5L 3E8UH 3NCWA 2JSFA 1TZIB 3W1ZA 4PV8A 2AI0H 4HA1A 3F7KA 1KENH 3QW9A 5T3ZD 3RIFF 3NQKA 2HKFH 2BSRB 4FQQB 2OOYA 1OGAB 1E8YA 4GJTB 4MJJA 4RX4D 5DA0B 4XVSH 1NOLA 4S1DC 1E43A 3D0LA 1P7BA 2VIRB 4WFGD 1TSHA 1TTRA 2H5UA 2P5WE 5FOBB 2LLNA 4JJ5A 2WQSA 4OGXL 4WX8A 1AO7D 4XHJD 5C07E 3FQYA 1EBAA 1UM5L 3LPFA 3M17A 4IJ3C 4Q74A 4UILL 2Y5QA 3FQNB 3DX0A 2CIKB 2WZPD 2PPCA 4WHTA 4XPBH 3VFUA 1UWFA 3WJMA 1UB5A 1GRWA 2ICEC 3QEUA 5D72H 3II3A 3CMGA 4EN2A 3SDXE 2MEJB 2HJFA 5BV7H 3DKHA 1M2VB 4N2DA 4LP5A 3QT2A 3ZIMA 3IF1A 4M93B 1FYTE 1ZS2A 4OF5A 3VXOB 1FH5H 1ORQA 3D0AA 3FTZA 4RZKA 1NCIA 4U6YA 2WZPA 3WN5A 5BXFB 3EAYA 4PGEB 3VFMB 2ZUXA 4GBXB 3PNRB 4N9OB 5IHZB 2CMRH 1HQRB 1RUKH 3GMMA 1KXVA 5J11C 3ZL4L 4FGMA 5I6LA 3MJ9A 3HB3C 2KPNA 3SD2A 4ES8A 4AYFB 5G55A 2YD2A 4RGND 2CIKA 4GAAA 1A2YB 3HE6A 3WTWA 1QN7A 1O6VA 1X5MA 3SDCC 3VMPA 3VXMB 3GRWH 1WFTA 4Z8FH 2C4FT 4PJIA 4X8CA 1K4CA 1Z9MA 2A5UA 3FRUA 2Z64C 1NINA 3RU8H 5IHHA 4JFXA 5IVZA 3CFJA 3GBML 4PLNC 2R8SL 3QR1A 2BY1A 4ERSH 3QHZL 3NIGF 3VXNA 5IVXE 1QTSA 1BVKA 3ZE1B 2DI9A 1G7JA 3RU8L 2EIZB 1NANH 4W1TA 5KJ4A 3I9AA 4PBWD 3VWJC 3B83A 5GGTH 1PIGA 2R83A 4L3EA 4RAHA 3H7BA 4YL4A 5EZPA 5IW6A 3HS0A 1SJVA 4ZTPH 5C0IB 4LSVL 3N2JA 5BVPL 3MA7A 3DO7B 4WWID 1QBLH 2CDFB 2VAJA 2M1KA 3CD4A 4NO0B 3UTTD 4IS6A 5DJZA 3ZQXA 1U8JB 1HHGA 4XMPH 2ZUYA 3ARZA 2Z93A 4E9YA 1GGUA 4NNXA 5C0EB 3O0RH 3BC9A 2AJYL 3BUTA 1AVAA 1TO4A 3MJGX 1HZHL 1L9SA 1N59B 4DKAA 1R5VB 2GTWA 2HJLB 5IFHL 5BJTA 2CRMA 4Y16A 1HH6B 2V9RA 4J6RL 1CPUA 2OTWA 3S35X 3IK2A 3U0TA 5DS2A 2WYIA 5IHLB 4LRIA 1WISA 1DEEA 1HQ4B 2PCXA 1JF6A 3K8MA 5CCKH 1TYRA 4FI6A 3RDTD 1FYHB 1CLYH 3PWNB 4P06A 2FT8A 2JIXB 3QEQA 3QJVB 2WUCH 1RPUA 1SJEA 1MQ8A 1MF2L 3S37H 4UAHA 1DJHA 3T4YA 4APQC 5JPMB 4YHKH 1P5DX 4GRLB 5I0YA 5C09D 1GYAA 3VFTB 3EYFB 1DUZB 4HJ0D 3NMEA 4PTTB 2ED8A 3L5WA 5B7EA 3ESMA 4GT7A 5F7EL 2CM6A 1GY1A 3RY6C 4AGOA 3U2SB 4WKXA 4E42A 3U9UB 1IILE 2FJHA 4YK4B 2OXHA 3BQUC 4LK4A 3S37X 3HG1A 1D2OA 1EZUA 4X6DA 3FYIB 4KNSA 4X6DE 1FZJB 4Y19D 1U3JA 5E00A 1K6QH 2VB5A 1JYNA 1FCCA 3KDMB 4GW5A 4K71C 3WJJC 5D5MA 4JR9H 3EADA 3NFSH 4PGZA 5TE6H 5ACZA 3TVMB 3NP3A 4O58L 3OHXA 4L0PB 4XAWL 2WSKA 4YDIL 1QN6A 3UJIL 1WSST 3QHFL 4XPTL 3O45A 1L9MA 3DUUA 1EHKB 4X5LA 3HE6C 4WI6A 4OLWH 1XIWA 2P5EE 4KU1A 1KLFB 4TTGA 1JMXA 2ZX5A 3GZKA 4B7LA 2VDRB 3P77B 3NEXA 4EI5C 3APFA 2XA8H 4QJ3B 4EJ1C 3CHXA 5CAYB 7PCYA 4NO2B 1QBAA 3QIWC 4OZHA 3WKYA 1T7WA 3TA3C 3WU1A 3CK0H 1CI3M 4LARL 4S11A 3WJLA 5D1ZI 3CN2A 5C0CE 3CFEA 2Q86B 1MCLA 2ZCKH 4JFQB 5GSRA 2VR7A 2XJKA 4OUOA 2F7RA 1HKLH 4I7ZC 4ZZKA 3RILA 3WFHB 2OX5B 5F97E 5MHSD 1ZVSB 1CTNA 1P4BL 1E5ZA 3DPUA 1BQRA 3BWSA 4HH8A 1C5DA 3I02A 3OG4B 3RX7A 1VFBA 2V7NB 1E9PA 2FRGP 3HJEA 3QO1A 5ICXA 3NPSC 4C8XA 5GRVK 4P5RA 4PGCA 4OZ4A 5C09B 2ED9A 1XIWB 3TIEA 5K9KB 5IFAL 3OSVA 1KJMB 2YD9A 3MV01 1MCJA 3QFDA 3B3BA 1DE4B 1Z9SA 3E6HA 3VFVA 4N8VG 4UDTB 1KGJA 2G60H 4V1DA 3OC5A 4AGNA 5AZUA 4PVBA 4IKLA 3CVHH 1YC8A 5EZIH 4UOQA 3ERXA 2EIJB 2NPLX 3MLWH 4NUPA 1B0IA 1OO2A 4LLUA 1IBGH 1FG9C 1MN4A 4ZMLA 2VDRL 1M53A 1NBCA 4UMGA 1RZ7H 3TA3D 2XBZA 2LQRA 3GMPB 1VACB 2BNRE 2EILB 4RMTA 3BAEL 5G4MA 4KVCH 4HKJB 1S46A 1WT5C 1JV5B 4ETQA 3SKJH 4V1DD 4WZ9A 3UYPA 3CWSA 4A63A 4F5CA 1ZSHA 2OJZH 4FEMA 5SWQB 2VDPB 4X80L 5DWPA 1DBAL 1H15A 4QRSA 3V4PL 1QX1A 3OHMB 1B0GB 2Y06L 4HSAC 2KKQA 4LRNL 3KWUA 3DMMC 4OU3A 2XU9A 1INDH 2OJEB 4W4OC 5GHWH 2GUOB 3LKRB 3UP6A 2I60L 4BH8B 3LZPA 1OEZW 1MG2C 4GXUM 4AG4H 4EBQH 1XGTA 2R1WA 3RB7A 4Y4KD 32C2B 3ZMEA 4Z7NE 3QUGA 1A6ZB 2EYSA 3HG1D 4BFIB 2WC7A 1QKZH 1A64A 3ARXA 3N85L 4LAJH 4X7TB 1H3PL 5FV1L 4FNLL 3B4NA 4HULB 4X7SH 4K7PL 3CQPA 5ESAA 3F12B 3BVDB 2ZXCA 2MCPL 1IKNC 2K8MA 2CHZA 4W4OA 1E6OL 1KIPB 2BVUA 3RWHA 3JWOC 4XE5B 4IM8A 4Y9FA 5E9NA 1ZT7B 4I2XA 5MERA 4U1LA 2VJXA 2F54B 3TV3L 1UC6A 4MCZB 5E94B 1GYVA 3KAAA 2PW2B 1XH3B 2O30A 2RACA 4MA1C 1FNSL 4XOCA 1J18A 3MLZL 3EZJB 3MRGB 1YJDC 1A47A 2QV2A 3QCTL 4GBXC 4J27A 2VLME 5JOPE 3BKJL 1NC2D 3RUGA 4QXUL 3UGUA 5TDOA 2IDFA 1FNSH 4PRAB 3RQ3A 4IBYA 5C0AD 1NKGA 4ODWB 4Y89A 2NT0A 5DEFA 2YPLE 4X8JB 3BKJH 2IBBA 3HKFA 4PJXB 4F7CA 1UCTA 2VRAA 3B9KC 2Z7WA 3OLGA 4CNIB 1LXTA 1LWJA 3BAIA 4XGZB 3KPQB 3O6KL 4P2RB 2ZPKL 3RWCA 1BFVL 3QDGD 5B8CC 4PJFA 3BP7B 3HE7C 3FT3B 5C0AA 4G3YH 1PYWB 4A2EA 4OF6A 4QOKE 1X5XA 4UM8B 1JK8A 3IRCA 1INQA 4NKDB 4PAZA 1P53A 5AAWC 1M4KA 4KTEH 4XI5C 3AW5A 3QXAA 5FCUH 3V4VL 1IM9B 3WDIA 4EDWL 4OQ1A 5IB1B 1QPPA 1U8PA 4TN9A 3IGLA 3QULB 5E8OB 3TA3A 2QQQA 1P4LA 1K4DA 4PV9A 3JTTA 4ONFH 3PABA 3QFJE 1RZ8B 3ARFB 4PJXA 4PP2B 4KJQD 5CD3A 5IGXH 4KY1L 1TR7A 4KRMB 3PAUA 4J3OH 3PHSA 5H37H 3VN5A 2BVQB 3KPPB 1WS7A 4TUOB 4B0MB 4KROC 3ZZQA 3PY9A 5TE4L 3KS0J 1KJ3L 5CBEA 3OKEB 2BIQA 3NDYE 5D1XA 1MFDH 3P2BA 1NGPL 2X6MA 1YEFH 3BGMB 3P9LA 3N1PC 3LPPA 2K70A 3CVTA 5E4OA 3RWGA 1BFOB 1QEWB 5I1GH 5GGQL 2ORBL 1MW3A 3WIIH 1M6UA 1NM4A 4NQXB 3TASA 4NPJA 4Y0GA 4HCIA 4QWWC 3P3UA 1OE2A 1SJMA 3ALXA 3C6LD 3VE0A 2IQ9L 4ODXB 3WFZA 2UY6B 2BIOA 4XO5A 1PCSA 1VF5C 3WUWB 1LDSA 1UB6B 2AQ1A 5GRXG 3I9GH 2OR9H 4JANA 5ITFA 1JGVH 5AAPA 3NIDE 1BQHA 3MRCB 2IQ9H 1Q0XH 3SEPA 4AJYV 4N0UE 3BO8A 3CXHK 3PP4L 1C7TA 5F7DB 2LTQB 2KZWA 3OKEA 3FN0L 5DD3H 2PCYA 4YO0B 2CSPA 1LGVA 3KPPA 4J3VA 5DT1L 3CFCL 4R7DA 2BVPA 4UU9A 3P73A 4JHVA 3VD5A 5B4MC 3IAGC 1X9LA 3RI5F 2A6JA 4U7SA 1KIUB 4JDTH 2MRYA 2MCG1 3AMKA 4EI6A 4H2AA 2Z4QA 4PI0A 3BVUA 4QRTB 3FQTB 4I77L 2ARJQ 2NY1B 1MREH 3QWOB 4LPYA 1KN2H 2VTFA 1NCNA 4LPTA 4I1PA 4ZRGA 1SJHA 3LNFA 3ATBA 5BCAA 2DWDA 4LSRH 1L4IA 4FQHA 1Z9PA 1H3XA 5SX4I 5B38G 5BRZD 4G43B 2GK0A 3V0AC 3ARVA 3IDYC 5FA4A 4L29B 3MCKA 3UO8B 4QO1B 3MRCA 2QSTA 3DYMA 5DUBB 4JO1L 3CMOL 3U4EB 1J48A 4WO4D 3JV6A 3LPOA 5ALBL 3H3PL 1U8KA 1HX0A 5IHWA 3HZMB 1D6EA 5AW2B 5INDA 4GFXA 2SEBB 2VMCA 5I0DA 4KVNL 3VXRE 2NXYB 2WXMA 1N26A 1AXSB 4XNXH 1J12A 1BIHA 1WBXA 2BIPA 3MGOB 3U6XA 1WZAA 5J6SA 4N1EA 1QR1B 3CSBA 4UIKH 4HFWB 4HJJH 2PPFA 1CT8A 5GRJH 3TCTA 4A7GA 3D69B 4G9DA 3UROR 4NUQA 4H26B 5D1QE 1P2CB 2K6WA 2G5BA 1IVLA 2NLJA 3GT6A 2C3GA 1YY8A 3TJEH 5CEZL 1L7IL 2HG0A 1HSAB 4K94L 2APXA 1FFPB 2YRPA 4KRPB 1MCOH 1JRHH 5TH2B 2UXTA 4TYUA 2NY1D 4YHIB 1TPXC 3HZMA 2OL3H 3MA9L 1HSBB 2UXVA 1KXTA 4YIQA 3FTSA 3CZKA 1U3ZA 1JXDA 2N59A 3DLQR 1BBJB 1QLEL 1MCOL 5I28A 4EUPA 1QBMH 4ODTL 5JXED 3F6IA 1OTUD 2HXAA 1VOKA 2YXWA 5EIVA 3CFKB 5DJYB 4TSAH 1DQML 3GK8L 1DQLH 2W9LA 1YUHA 2J6EA 3HMXL 1MCDA 4R2GC 4OCYH 4XVTL 5DQJA 4XVUC 4I0PD 3IF1B 4GKZA 4UQ2A 2CALA 3VVVA 1RJZA 2F19L 2QR0A 5F3HA 3VD9A 4TSAL 1TCRB 2WANA 1YY9D 3DRQB 3MOBL 1IC4H 2QQKH 5IJDC 3SO3C 3L17A 4P5KB 1D9KA 4MASA 4ZFOA 2JTYA 1YY8B 4GSQA 5JIHA 4TSBL 4AH2B 3O11B 3DTXB 1A7OH 1DQJB 4I3RL 3OH6A 4YDNA 3HZYB 4RMVA 4WI0A 5T3XE 4L23A 2AV1A 3H3KA 4CVWA 4J39A 5I1LA 4RSVA 3US9A 4JFEB 2H32A 3O2VH 4DP8X 4R2GD 1A7BA 4UQ3B 3GUFA 1MLBB 1KIQB 4JQXC 1SDYA 3W0WE 1D9KD 3GTNA 3QISA 5FR3A 4XWOC 5D4IA 3TNMA 5DRNB 1A2YA 2BH0A 4I13B 4AUUA 3W9EA 5LQBH 1H3GA 4MTMA 5DUML 4H88H 2HH0L 4QYAA 3GBEA 5CGBA 1NM9A 1UVQB 3APNA 5HSFA 3CWGA 3GLDA 1BG9A 3UEQA 3IB4A 3ZQWA 2F5AL 4N4YB 1TFPA 4GKZB 3AJ7A 1EMTL 3BT2H 1IGFH 1EJ8A 1UWXK 1WWWX 3NCCB 4LL4A 1V05A 4M3JA 3ZW3A 5I1IH 1CD9B 3ETSA 2CLRA 4OF0A 2ZXQA 2ZAGA 5DD0H 3R7RA 1BVLA 1KB5L 1W2KT 4NBZB 5E6UB 5HVGB 4DQOH 4IRJB 3CFQA 1EZVY 1F6FB 1P5UC 3ATAA 3KYKH 4XWOD 5I76A 1OCRB 1A7NH 2H5AX 1PD1A 2YXMA 5IMMA 4P48A 3U79A 1X5HA 2E9WA 5FV2A 2ZCHL 4IRSD 2O6CA 3QCVH 2RTTA 5C6PB 2IWKA 1M2VA 1MFBL 4YEEA 1EANA 2FYVA 4PD4J 3NTCH 3ARBC 1BLNB 2DL9A 3X1BA 1XSZA 2KPWA 4NNYB 2C4XA 3HS8A 3C5SA 3P4MA 3S3DB 1MW2A 5LBVA 3H4FA 2HFGL 4X6BB 1W8OA 3VD1A 4XTRC 1H6FA 3ZTJG 1UXSA 3H53A 1QSEB 2B77A 2BWIA 1I7UB 2KLTA 1R19A 4NFDA 4PJIF 2C1OA 3ULUE 2B1AH 2NY2B 4Y2DD 2XLLA 1JGUH 3N44F 1L7TL 2IGTA 3BH8B 5AL0A 4U6XA 3FCGA 1B0WA 3TP4A 1KENL 5C0GB 2BP0A 3O4OB 4S2SA 4I48A 3QFJD 5C9JB 1OT4A 4QXGL 1ETZB 4HGKC 5E6SB 4HEMA 5E6ID 1KBGH 1OLLA 3LRSB 2CQVA 4RGNE 4XO9A 3OMZA 3VXUA 1Y07A 4LL9A 4TTDD 5HVWA 3GLAA 1AGCB 1THCA 4ZTOH 3X11A 1EXUA 2LU4A 4K07A 3FO2B 3VG9C 1AMXA 4NNYA 3MRDA 1RIVL 4QHPA 2APFA 3GJFH 1UZGA 4LVHC 3CNKA 3UTTA 5ANME 4ZX3A 4KTYA 3D3VB 1U41A 3KXFD 1RIVH 3V5KA 2DKUA 2FJUB 3DOIA 2BHYA 4LGSB 2VL5A 3N1QC 4N90E 2EUVA 2CRIA 3C75A 3CN0A 4ZMWA 1W0VA 4YPGB 2GI0A 5T1DH 5IESH 5FWQA 2JMRA 3KR3L 5C7XH 5IJVB 2C8NA 4ONGL 1ND0A 2Q76A 5HGBA 4K3DL 3G6DL 1LE9B 1ZANL 4EXPX 1FHGA 2WLHA 3NPSB 4NCDA 4PJ5A 4RWHA 4L1HA 5IB5A 1G84A 2Y8QA 5JLZB 5C07D 5HGAA 1VJSA 2QPSA 1K9TA 2CO6B 3L48A 4U6YB 2FO4B 4IEFB 4KKBC 4YHLL 2VDMB 3D3VD 4IIQA 1FZMB 1U8IB 5C09A 6PCYA 5K9KA 3KBHE 5EF0A 3PJLA 1JGLL 1D7CA 5ITBH 1E9PB 3ARDA 4KK8D 1LEGB 3O4OC 2K78A 3CZUB 3EDFA 3Q43A 1GGCH 2V9UA 4HJ0C 4JCMA 5B22A 1DLFL 1SJEB 3V5KB 2R0LH 4LLWB 3SQBA 5GS1B 2IH1A 2JNZA 2R9HD 3T3MF 1CGSH 3RZCB 5DFVC 4PJBF 5CJOH 4XOAA 2CZNA 5C0RL 4NM4L 2WN3A 1T0PB 3C2AH 4GXVH 3WO4B 1VGKB 3FFDA 4QGYA 2K7QA 3EW3B 2MMXA 4UB0H 2XPZA 3V4VB 4MZ3A 4HXAL 3V0VB 3MXVL 4AQ8C 3T8XA 1TVDA 4G80A 4NM4H 4XRCB 4ZW7A 4EQ3A 1NC4B 2P48B 2JQAA 4N9GB 1CICD 4M5TA 3I9IA 3Q2NA 2IGFH 2YA0A 2Z7UA 4YDLB 3FB6B 4P2QE 5CR1A 3ABLB 2ATKB 2A77H 5EO9B 12E8H 3OZ9L 4FQLH 3TBWA 3TO2B 1E5UI 1AXTH 1RFDH 2ZSWB 3FOMA 1W91A 2VQ4A 2FX8L 4CDGC 4TPRH 4AEIH 4NIYE 1U2HA 4YH6A 1WIOA 2VDRH 1CFTB 1QFPA 3F7QA 2GVYA 4NUJB 2L4OA 2YEQA 4G7YH 1ZVSA 25C8L 2DWEA 3CHOA 4PHXA 5DFVD 3UCRA 2XHIA 3AABA 1RSFA 5JYMA 4TVSa 4ODVL 3EYSH 4WI5A 2OCFD 1RULL 3GS7A 4X80H 4NC2B 2DM3A 2BK8A 2Q86A 3FTVA 2DYSB 4MAYB 1J0ZA 3AT8A 1MJ7L 2Y4SA 3NCFB 5FA3B 4NOFA 2F58L 2OA9A 3GJFK 3ZT5A 1F3RB 3RWEB 4ZSOA 1XXFC 1B2WL 3QGVA 4OZFH 4YDZA 2L0DA 2XV2A 3FDWA 1OGPA 5KYUA 5IOKA 5SWSB 1SN2A 4YBLB 1X4ZA 2RIKA 5DDHB 5EO1A 4P5TB 1HU0A 1Q72L 2OP4L 1N8OE 3T6ZA 1ETJA 1F97A 4XNZC 1CF1A 4N3UA 3PXLA 3V0FA 2ZSWA 5DURD 1FL5B 3EFDH 3UZVA 3EYVB 3AWGA 1QUNB 4OLUH 4B53A 3GMPA 1KACB 2GJZA 3BLBA 2AS5M 1KULA 4KZEL 2XWZA 4Y16C 4OIFA 3DIVA 1PSKH 2ZKHL 4G3YL 4X8JA 2GHWB 4HLZH 4J28A 1HHJB 4JEGB 4XCFH 3WTUA 2X1PA 1R5IA 1WPCA 3UYRL 2EEDA 4R5XA 4B9KC 3CN4A 4GSUA 3MV8B 1J88A 4YSPA 2XTJD 3W5NA 4U1KB 1T7XA 3VI3B 2ZKHH 1BREA 3QHTC 2QPDB 3KRMA 4N28A 1J8HA 3K1KC 3NZHH 4OZ4B 5HDRA 1M6OB 4M9OA 1CC3A 2FGZA 5JZ7C 2QADB 1JI2A 1R3JA 4AVIA 4FXGC 5T1MB 3KPLB 5I74C 4NZTL 4PCSA 5C0CA 3S5LB 3GJEA 4FI7A 1Y18B 2XY2A 1RZ8A 4QTFA 5AOKA 3HLAA 1BIIB 4TUJA 4PRPE 3ZTEA 3H9SE 1M9WA 1X6LA 4GAJL 1I8KA 1OPGH 5IQ7H 4WI3A 2I5YL 3ULVD 1Q0EA 1G0DA 1HDMB 4WEUD 2O5NA 3PJSA 3U1SH 2X4QB 3DV6A 3SPHA 1CFSB 2FWOA 4JPSA 3VJ6B 2HZMA 2F1EA 4JG9A 3QH3B 1ZVNA 4X5PA 4ZS6D 1R1CA 4HDIA 1D3CA 3L1FA 3EJPA 1AHWA 4H1LH 4YVNA 3BZEA 2CJTA 2EKSB 3DX7B 2C4FU 5J06A 1JZ5A 2KDYA 4M7KH 3CSPA 4JPWL 5D4QA 4GQ9H 4ZAKD 5KYWB 1MCPL 1YPZF 1AGFA 4FF9A 4QIRA 4FFVC 1DIZA 4HJIA 5F96H 3PUUA 4HAKA 2XZAL 3GSVA 1IC0A 3L7EB 4XP1H 2VW4A 4Y7MA 4APXA 3REVB 3W5MA 2NSXA 3DHPA 4XNDA 4JFZH 5AVZB 1ZLSH 1WFMA 1XB3A 3QUYB 2J2ZB 2XTJB 4ABQA 4CKQA 5F7WC 5T1KD 4HIEB 3HVDA 4PRAA 4P4RA 5I1KL 5H2BA 2BRRL 2AQTA 4ELDA 1DVFC 5KSBB 4B96A 2ZTBA 3V6ZA 4G7VL 2H26B 4I3SL 5HDWA 3TZVD 2DS4A 5F7DA 3EGSB 1MRDL 3DVGA 2BP8B 1B0GA 2YQ3A 2DM7A 1QNZL 4G7RB 5C86A 1XGYH 1Z7JA 3HUJF 2ICES 3PWPE 4DEPB 5IB1A 3L9EA 1ES0A 1NLDL 1RJCA 3DMMA 3QORC 4K7PH 5DMKA 2ZWSA 4FQCL 3P9WB 1IQDA 3WL9B 3PQYA 3B1TA 3IDYB 3RVVD 4QNPF 1AGFB 2BINA 2V3DA 2C9RA 4JHZA 5FGCE 4LAQH 3JYBA 3RTQD 5L2KB 4OZIF 1A3LH 1DQIA 2ATPA 1OZTG 5IG7B 3L9YA 2EUWA 1TZHB 1AZNA 4NZJA 1YZZA 2W0PA 4WQOA 2V9TA 3OC8A 1XF2A 3D1MC 5DUBA 1UWEH 2YUVA 2FYYA 5KL0A 5I5MA 3VCLB 4BFGA 5FA4B 3RWFA 3ZHFA 3FB7B 3CSYB 3DJZA 1K8IB 1ID2A 1XCWA 2WBJD 4NYLA 4QOKA 4DVRH 4HIQA 4YC2C 5CFHA 4HJGB 4MNQA 4JGMA 2EKJA 3EIKA 2Y5TB 2FD6L 5L9DH 3OD3A 3BUIA 3RUGB 1RK1B 3VXUE 5FHBL 2G0LA 5I82A 3WKQA 4DVRL 1IGIH 5FUOL 3MLYH 4RMUA 4Y5VA 2G4EA 3D69A 4G9DB 1BMZA 1S78D 2RBLA 1H9VA 3AXHA 1QR1A 1NC2B 4M62H 5KBLA 2XPYA 1X5AA 2FEDD 4DGUA 2W07A 3KPSA 2P5WD 4RAVA 3WNJA 1P5UB 3MRPA 3QUXC 4N8UA 4A37A 4LB8A 3LX9A 1UGNA 3W3BA 1QLEH 1F02I 4N5ED 3G6AA 5FK9B 1JK8B 3MRBB 2P8MB 3P2TA 4JHUA 2YGNA 1HVXA 5SWZB 1BF8A 1OV8A 1ZOXA 3JWDH 3Q2VA 4F3FB 3BP4B 4IBSA 5LXGL 4YDLC 2VDMH 2BIIA 1I3VA 4G1EB 3HI1B 1CIDA 1BBJA 3VFNA 2FIRT 2IBZX 4ODHL 2DWDB 3C09C 3FQTA 4HLJA 1ZWIA 5DRXA 4EJYA 3O4LD 4WW2A 2AI0L 3HVNA 1AE6L 3BRFA 1T6BX 2OL3B 1K35A 2WXGA 4BE5A 2EDOA 4YSTA 1R24A 1RU9H 5FX3A 1NGXB 4N6RB 5DEGB 1PS3A 3W11D 2IPKB 1KTKE 4DUWA 1N0LB 4FNQA 3KLHD 5KZCD 1WTGT 1QO3B 1RJZB 2KMWA 3GMOB 3PWPD 4M8RA 1KT2B 3QJXA 1OSPH 2CDGA 2ZWYA 4PY8J 4U1HA 5HSHA 3HG5A 4OGXH 3H2PA 3WHXA 4RGMC 1BM3H 1GZHA 3A6CH 4WY7L 4MJ5B 3MJ9H 3QJUB 4KKPA 4P2CG 4RMQA 3QQDA 2GJ6E 5D93C 5JW3H 3VYNA 1FNEA 1LMKA 1UJTA 1VTOA 4L9DA 2KHAA 2AEOA 2Y7OA 2ARJB 1SEBB 3C9NA 4GRWF 1AXSA 1SEQL 1XEDA 3UTSB 2QZ5A 2CR0A 2WQRA 1G7IB 4YSEA 4FNTA 4XVTH 5I5JA 4HYTB 1T4KB 2FUQA 1I85C 1FAIH 4MHHG 5BS0A 1S9VB 4B41A 1FE8H 2ZE0A 2GITA 3ZDZE 1BZ7B 5D7LD 5HHQA 3PV7A 4U3CA 5CN3A 3OX8A 1FPTH 5KBMA 2HT4D 1LP9F 4GG6B 2R5XA 5D70H 4RAUA 1IAMA 5L4FA 3GMRA 2EDBA 3T3PE 1VRSA 5GIRA 3V7AE 4LLDA 3GSUA 3QJFB 2QDVA 5LLIC 3HC0A 2MOGA 4EMZA 4HIHB 2BJMH 5JW4N 2FX7H 3LEXB 4KK9D 3SDCD 1IZJA 2B39A 2Y7SA 3ULVE 1P6WA 4MCNA 3SJVE 1VFUA 2OSLA 4ZZFA 2I32A 3OJVC 3RI5K 3EOTL 4MB4A 5MEOA 5D1ZB 5D7IF 4BHUI 1ETB1 3QHZH 1RHFA 2IC2A 3FUNA 5JHDE 5BS0B 3W0WB 5ADOH 1F00I 1YN6B 3NJJA 3LHAA 4XNXL 3GHEH 1VKXB 3MCKB 3ARBA 2Y7NA 2GBTA 2WO3B 3NH7H 3QI9A 5D8JL 2E7LC 4P2OD 5IBTH 3CH8A 1FE8L 1DCLA 1JZIA 2ZCLL 4HWEL 3RA7H 2JCCF 5CGYC 5BV7L 5DC4B 2VUOA 5H4YA 1HYSD 4XP5L 1SOQA 4MS8D 5FOJA 4BSVA 5BS0E 5JHDB 1X5JA 1A14H 2ADIB 3N1GC 1BD2D 4M6AA 1DN0B 5D7LE 2NUTB 3WS6C 4HZLB 1GAFH 1YEIL 3L1GA 4GAYA 4K5MA 2BVTA 4P2RE 3E8VA 4PJ8B 3UJTL 1RVFH 1NCJA 1F13A 3A21A 2EDWA 2XV0A 1AIFB 2CHWA 5CJBA 3K6NA 3QI9B 5CCKL 2X4PB 3X11B 3I3EA 4MD4B 1L7TH 1QLEB 3SKOB 1TQBC 3MXWH 4V11A 4JN1L 1VKXA 4AM0B 1FN4A 3GNML 6TAAA 1I4FB 1QSFE 1TEFA 5ELIA 3FO9B 1AZVA 4PWGA 4M6NH 4C4KT 1J87A 4K94C 5CEZE 4JFOA 4XCEB 1T22A 4W9CC 1HE8A 2X09A 4JL1A 3OXRB 2FUVA 3QORD 1Q94A 2BHUA 1KYAA 1TT6A 4KTDL 2ZX8A 3VTAA 1ZK9A 4MNHB 5LCVL 3AUWB 3BT2L 3MGTB 1X4XA 5KSUA 4C56D 1R0AH 2GFBB 2QFRA 3WFEL 1OPOA 2X2YA 1KJVB 5EUOA 3HUJA 1LHZA 5B38B 2Z91B 4PJ8D 4UT6A 3DJSA 1PTZA 5KVFE 5IFJA 3C6LC 3R8BB 3WJMB 2H1PH 3AWFA 2A6DA 1OAYL 2DKDA 4B0AA 2ZICA 3B3IB 1KDIA 5AWNH 2DIAA 3P9MB 3H6JA 4I0PB 1FNHA 1D9KB 3LKOA 1PLAA 4MAYD 3T6VA 3LB6C 3ZKMC 2A6KA 1JPGA 2IFGA 3GM8A 1BBDH 2ADFH 3DTXA 3FTYA 3QPKA 1G1KA 4XPBL 3UJTH 5FGSA 5DHMC 3RGVB 4GYBA 5EF2A 3WO3B 3VQLA 5LKNA 1U4FA 1TTCA 4P04A 2XA3A 1ZANH 2DKSA 4HC1H 4Y9EA 1O7VA 2FR4B 3AY2A 2Z8VC 2X28A 3AM8A 3P4NB 1SY6H 2N7BA 3Q9PA 4LCCA 1ILSA 1ML0A 3KYMA 3HBPA 3L45A 3MCG1 5EN2A 1TYEB 3COOA 3NSYA 2PCPB 5I19H 1SY6L 4JLRB 2EACA 3IM1A 2GJ6B 3QQ4B 1U92A 1AJ7H 1RZIA 4OF3A 4PJBA 3IWVA 3T2NL 4ETYA 2GSGB 1KEGL 1YCSA 4M8QA 4QTHA 4GP5B 4H2CA 3SY6A 4PSRA 3AITA 4G8AC 2PPEA 3GEFA 3UIZA 3IRZA 4L3EB 3T4YB 3SYCA 3LSOA 1VGEH 1DP0A 1N4XH 1JN6A 2HRPH 3CXFA 1QFUH 3GSNH 3IMTA 1VEPA 1Q9WA 2FQEA 2JK5A 3IPEA 4WWKC 5T33H 5CMAB 2F8OA 2R69A 4Q0XL 3OQRA 3C60C 3IDMA 4BHUA 2YH5A 1NGQL 5FGRA 4N6QA 2YK1L 3EO9H 4EF3A 4Q9CA 2XQ0A 5IROC 1T20B 5C0CD 3JV0A 2DTMH 4Q2ZB 1CICC 4NNXB 2FJGB 2FKFA 1ND0B 5HGBB 4OT1L 3PF2A 5ABAA 3KYMB 3LQAC 1O7SA 4LU5L 3N43B 3UGEA 2JELL 2JVUA 2ZUSA 5GSVB 2CO6A 1H3VA 5EN2B 3FT4A 12E8L 3HAEB 5L7XH 4JDZB 1A6PA 1KBGL 2Z8RA 3PGDA 5KVGE 1JDYA 2Z7ZA 3D4ZA 4LARH 5IFAH 5CILH 1A6TA 4ONOA 1OK0A 3T4AB 4WZSD 4NKOB 4LSPL 2Y72A 1WHOA 5I1DB 1LLAA 3QIWA 4NQVA 15C8H 4C83A 4HIXH 4OCSL 4IS6B 3DJRA 5C6WH 1H3PH 1UD4A 2NXZB 3K5SA 3L4UA 4CW1B 1RAMA 4RRPG 3MRLA 3EFFB 3F6LA 4JRFA 4AGQA 3MLVH 2YFNA 3BKCL 4OFDA 1JE6A 1I3GH 4RGOH 4AXWB 3BP6B 3ES6A 5DSCA 4HS3A 3S4SA 3IJYA 3U9PL 4PI2A 1N70A 1GGCL 2H2PC 1J5OL 2PWDA 3QIWD 1G9ML 4FXGB 5F0JB 4X98A 5JA9A 3OGCA 2DQEH 3GRGA 4R83A 4JQXA 5L6YL 3V79C 2DLFL 3T0ED 3KYOA 4O2CA 1DEEB 2YA3A 2ZOOA 3HE6D 5J6GA 1PY0A 4U1KA 1GZQB 4OT1H 1CD0A 2MH4A 3K91A 5LXVA 4BKSC 3EYUH 1QASA 1A25A 4NCC2 4XZUA 3MXVH 2OW7A 3J2PA 4QRRA 3FB6A 3ML8A 1OM9A 2CBPA 1A4JB 4PW4A 1NA8A 5F0LB 3ZMNA 5IJVA 2QJDA 3KXFB 1L0QA 4PRBB 1BHGA 4UDUA 1HEZB 3R06B 4EI0A 5K69A 5CILL 4LKXB 3QAQA 2QT6A 2WIMA 3VNZA 4TVPL 2L7JA 2VDKH 3T0EA 3QYCA 4NBYB 5IZ7A 4AL8H 3WKPA 5TQ0H 3ABZA 4L9LB 1NOFA 4P57A 2LAGB 4TLUA 2Y2WA 3MRLB 3P30H 2PPDA 4FTVB 4JG1L 5J1AB 4Q11A 1WGVA 3QS3A 4P49A 1Q1JH 1WD8A 3V0VA 1KTBA 2F7IA 4FD0A 1WZ1L 3KDMA 4GW5B 4GW4A 4RVBA 3GMQA 4UWQB 2I5WA 3QFJA 2BVEA 4M93C 2JCWA 4PTUA 5HHOB 3MREA 4MMZC 4LCYB 3SDYH 1RPQA 1TTUA 1WV7T 2VERA 4KZEH 4ZYKA 1VFAB 1EBPA 3GBDA 1ZLEA 2IOIA 2DQJL 2D3NA 1Q9LA 5C71A 2V2WA 3RVVC 2HN7B 1D6VH 5CNHA 3CHRA 2QR1A 4FA8A 1NIFA 1VA9A 4RFNC 2I27N 3RJQB 5I8KH 3Q1SL 1W9XA 4YHZL 1PD6A 1IM9A 4GP4B 4LHJB 2BSTB 2EVFA 3VRJA 1HEZA 3R06A 5DI8A 1EEQA 1U8PB 1XGQA 3Q5TA 4URKA 2Y06H 1IAKA 3HNSL 4Y1SA 1DZ0A 4WHCA 4WFHD 4W81A 1I8LA 1ZT1B 4LBAA 5EN3A 5EULV 1JTOA 3SY0A 1KDJA 4QRBA 3W82A 3BZFA 1XCTA 4GKSB 5DZPA 1WS8A 5HYEA 4JX0A 2XV6B 1SN0A 1IM3D 3NSXA 3OH9A 4AZUA 3MV8D 1IM9D 3TT1L 4ACPA 4KTGA 2Y8LA 5DK0A 1IBGL 1Q9LB 1HWHB 4MA8L 5CEYB 1A3LL 3IMBA 2OJEA 2NSMA 1UD5A 4KRNA 2ZPKH 4ZJ9A 3KPLA 1KGIA 3RPIB 4Z7UB 3SPJA 1DLHB 2DB8A 4PY7B 4UTAA 1WTLA 5KS9F 1IIKA 5E5RB 4GQ9L 3ZE2F 5EEXA 9PCYA 3T6QC 4H0GA 2XI9A 2E6PA 1X7TA 3RUGE 4CN1A 3US1A 2ZUVA 2DM2A 3B7RL 3KGTA 4HDIB 3E6FA 4Y4FC 3R7QA 2WVTA 5IG7A 3QIBC 3ULVF 2CDEB 1QW8A 2DF3A 2GCYB 1BOYA 4BQ9A 3VG9B 1ED3B 4JKPH 4F8NA 1BMWA 2N3JA 1YEEL 2ZP9A 4JFFE 3BZFB 3H9ZA 3D7QA 5JMVD 5FDWA 5D6CB 4HCFA 5I1KH 2A9MH 1TOXA 2K4WA 4G6MH 1X5KA 4U6HA 4PUBH 1K3IA 2DQ6A 5DJCA 3ZIYA 3G6JB 2CXGA 3T9WA 1S2EA 5ID0B 1A6WH 1LMIA 1KBWA 2EXTA 4ATTA 1S8DA 5H35B 3V6OC 1MP9A 1C1EH 4U33A 4ABVA 5D1QD 1BW8A 4N2NA 5I15H 5MEND 3WEBA 3K7UA 1RK1A 5SWZE 1L3WA 3T09A 3M7OA 2NNFA 1FI8C 2Z31A 3C5ZB 4ODSL 1GW6A 5IROD 3NZHL 1W0YT 3KPNA 3O4LE 4F57L 3EXLA 4JPWH 4RFEA 5AW7B 4BCXA 3QP3A 1TQCC 5HBBA 5FO8B 1IO4C 1IC7L 3CWTA 3QQ9C 1IGJA 2X3AA 5HHXH 1UH2A 4G6JH 1U30A 4AEFA 3RE0A 1GCFA 1K4DB 2UUDH 2WLMA 1SQMA 3AADB 4UAOB 3P9LB 5DURB 4HV8A 3QUMA 5BVJB 1TVHB 1Q9OA 1G1CA 2EDNA 5DQDL 5CD5D 3GRWA 3BP4A 4OTXL 4CADB 5LAXA 4AKOA 1UCBL 4G1EA 4WTZA 1E4KC 2JB5L 3GZOA 2BMKB 3ZE2E 4PLJD 4IJ3B 3PMGA 5KEZA 2XFXA 4PRNA 4NEHB 4MQ7B 4Y4FD 4XX1E 3TFBA 3MPCA 4BXSV 4OCXH 5E51A 1P4LB 4FFZH 2MIZA 3N89A 3GXIA 2G75A 4F7CB 2X4QA 3DV6B 5JO5A 3VI4E 4JFDD 1QO3A 1GCYA 1HI6A 3WJLC 2EUZA 1U2YA 4K23H 3SDDA 1OB1B 5DEGA 1ZKAA 5E6RB 1BVZA 3CXDL 3F5WB 3D05A 3ME0A 3FU0A 3G08B 5GISH 1ASOA 2OMUB 2RH0A 4N1HB 5AAWA 1FFPA 1QBML 1X3DA 3ATEA 4KKCD 4DWHA 3EKCA 4LVOC 1SYVB 2ZOWA 4JB9H 3HR5B 1XIWC 5F9OH 5FC9A 3LQZA 3U7AA 2P80D 4L5FH 1RJLB 5T3XL 5EZLB 3CQFA 1A7RH 1YSOA 3BKYL 1K8IA 4BQBA 1GH7A 1RJYA 4HETA 5IQ9A 5LAXB 4TNWK 1E4KA 4KKLC 1FO0B 5GGRY 2BSBA 4OCYL 5CXPA 4ZFZA 1GKOA 1FN7A 3WE6B 1OTTD 1OL0A 5HHNA 1H5BB 2IIJA 4AT6A 4HWZB 4OV5A 5ISZB 2IPTH 4Q6IB 3T0VA 1I53A 4IBLT 1Z5LA 3ATDA 4XN5A 1NBYB 1NH6A 3WUWA 2NQ3A 5A2KH 1C4GA 3B2VH 3KJ6H 4POZC 1YUHB 5BUAA 2R1YA 3UERA 1N3CA 2PP9A 1D5ZA 3A6CL 1QOKA 2P5WB 3QRBA 2J3SA 3IFPA 4FXTA 4AVJA 3JWNE 3L8QA 4FXLA 3L3OB 4LAQL 3JV6B 5EH1A 1SFHA 4ZMAT 2V33A 1GYCA 1R3IL 3I75A 3TBSA 3TBYB 5BV7C 4OH2A 1IQWL 1QLFA 2PWHA 2Y7LA 3VSTA 3F83A 1DBML 3HC0B 1GC1L 4YDVB 2WOYA 1NCOA 3BGMA 4R84A 2NY7L 2XIBA 4GAFB 2FECL 4NQTA 4UQAA 5F1SA 2N56A 1J5HA 1XF4A 3KWWB 4JZOA 5FFOA 3TN0C 3LQZB 4MAUL 5AKVA 4RFOL 3D2UA 4XC1H 4YXLH 1MUJB 3QEHA 3VQMA 3NJNA 4QTIL 2NQDA 4KUCF 4JN2B 3UTSE 3AQZA 4PGDA 3PGFL 3QUML 4H7VA 3GJFB 4JFVA 1RQ5A 3WE6A 1WHPA 4OUUA 4Z0XB 3O6LL 1GS7A 1ZWIB 2B9AA 1PZ2A 1A9BB 4PWKA 3RGBA 1P7HL 5CHNA 3DHJA 4OZGA 1ZLVK 3JWOH 1MREL 4Z7NB 4A7GF 3QC5X 1RUAL 1U8MB 2JV6A 5FYLE 3VG0L 3EH1A 4J1UA 4KKLD 3WD5H 4I4WA 4B9CA 4MJ5A 1TQCB 4B6ZA 3DGCR 4ZMQA 4NP9A 3O2VL 4YAQA 5T1KA 2JWYA 2JKTM 4L3CB 1ZEAL 4C55A 4JFSA 4RIRA 5EO0A 2MTAA 1XF4B 4L3EE 2BWQA 1F5WA 2EO7A 5F7YC 1V3MA 4H40A 1F4XL 2HFGH 4GRMA 4PRPD 1CDUA 1PKOA 4H88L 3DJ9A 2B8OT 1HC1A 3OLEA 3UTSA 5FW7A 3SOBH 5EOCJ 5I71C 3K3QA 4C57C 1MCKA 1THAA 4JMNA 2G9HB 1QI4A 4EEEA 4BKTC 1KPUA 1A9BA 1YAIA 2O5XH 4DVBA 1MWAL 3SDAA 2DQDH 4LLDB 5HJBA 3EBIA 4P23D 3SDCA 5MEQB 4WFGE 3IBOA 1S3KL 4KJQC 1USZA 3LKNA 1XWVA 1TO5A 2QFPA 1OD7A 3D09A 3ZE0E 5F72S 2XN9E 4JHWL 2XTJE 1T2JA 2NX5E 1FPTL 3MRKA 1MLBA 4MNHA 2AZUA 2CCLA 2IAMB 5SV3A 1YQ2A 4AKQA 2BERA 3BXNA 1EMTH 4KRLB 3HUJB 4WFHE 4WTQA 4LCIL 1I7RA 3NA9L 3TCLB 3UG5A 3VXSA 4KAQH 3RAJL 4NFCA 5DVKA 3MKGA 4L8SC 1CT8B 4WENB 3FRPB 2N0MA 1YJDL 2NNAB 2VO5A 1WBYB 3P3TA 3MJ7A 1ZEAH 4GI9A 4P46C 4XR8C 1M7DB 2ADFL 2YEVB 2VXSH 5KN5A 5L2JB 2K0RA 2V17L 1BOGB 2H45A 2K4AA 1O6SB 4DSYA 1KPVA 2F68X 4FQ2H 3SO3B 1BQ5A 1IGML 1KT2A 3FL7A 4GH7B 1Z2KA 2QR0B 1ORQB 4R90L 4LHUG 1CR9H 3ULUF 2AABL 4UIMB 2AITA 2VM3A 1SLUA 1M9SA 3IGAA 4UQDA 4UNVA 2HT3C 1KGYE 2KERA 5B3JE 1RURL 2WZAA 4X4ME 4P3WA 5C07B 3BW9B 5DJ2B 1SHMA 4GBXD 4OJEH 4PLKD 1RIUL 3AC0A 5ALCL 5IIEA 5BUPA 4EN3B 2NXZD 4CRPA 1AQDB 1DVYA 5I9QC 3F05A 3CBKB 4R9HA 4HZLA 4ZO9A 3TCLA 2FATH 4NENB 1SPDA 5JXAH 1FZKB 1ACYL 1U8LB 4AQ1B 5HP5A 4Z7VF 4GG6A 4JVPA 1MHHB 1WQAA 3VXNB 5E7FA 2VN6A 4DEWA 2ZOKB 3WFEH 4PRDA 5E2WH 3O3DB 3BJ91 3DRQA 2DWYA 4G6AC 4HIIA 2YD7A 5FDYA 1Y7VA 5C0JB 4UILH 2JJWA 1T22B 1KPVB 3D39B 3D4GA 1S7WB 3BLKA 1YEIH 3Q6FA 5J6HB 3TEWA 4LVNC 1WAEA 1OOWA 2C7FA 5LGKA 4N2CA 2C5DC 2G2PA 4N5EC 2WUCL 4AM0A 1GOFA 4BM7A 4JCLA 1O0VA 1T66C 4ANXA 5IHZA 3KPMB 4YZFF 3ASMA 2V3EA 1T0MB 4Y5YC 3FUKA 1GIGH 5E23A 2HRLA 1EUTA 3S2CA 3QWQB 4M6NL 5IR1A 3DX8B 4KPHL 5ILTL 4QEGA 1DJYA 4Y1TA 3HN3A 5AKTA 5I30H 1BLNA 2LLLA 1A5FH 3EH2A 3VRIB 1Q38A 4L18A 4P46D 2EVIA 1A14L 5T1DL 3LH2L 1MFVA 1R3KB 5C7XL 3PV6B 5KYXA 1EZLA 5JXEA 1CICA 1JDDA 3NIFE 4WUKL 3TVMD 5AKRA 4ZPVA 2Y1AA 5IM7A 1E27A 1FA4A 5EV7A 2EE0A 4NKOA 5IKCA 3AU1A 3D51A 4YJZL 1QN8A 5C1MB 4MNGA 2R9HC 2H6OA 3KGUA 3ECBB 3RTQC 1N19A 1BF2A 3L16A 3VH8B 4ELKB 5C9JA 1A6UH 1KJVA 1PLCA 4WSJA 4MMYA 4QAMB 4X9YA 5E4IA 1JHTB 3F7VA 4WV1B 5J56B 3MRMA 1ZY9A 5JHLH 3UBFA 4GRWB 2YZ1A 5KW9H 2NY0C 3V4UH 5I1CL 4B9PA 4KQ0A 3OGCB 1FFOB 3KLQA 5ESVA 3ROOA 4ZOBA 2GW5A 3EO0A 4M6MH 1YECH 2WO4A 3SCMD 4ZUSA 1YQRA 1LE9A 3DDFA 3ZX1A 3PAVA 2WUBL 1UKQA 3PWLB 1ACZA 1SHWA 4N1CA 3BPNB 3V4UL 4WO0A 4Y19B 1NDMB 4TL5A 4CVXB 3WN6A 1I9JH 4YHNA 3L5XH 3D52A 1LP9B 3C08L 4HKXB 1DQDL 5I1AB 1WFUA 2WLYA 2NY3C 1SUHA 4OJFH 4LLWA 3SQBB 4UTAH 1GYUA 1N64L 5KSUB 3ULSA 1AJ7L 1XR8B 3ARBD 1OAKL 1C5CL 2ZP8A 2DYPA 2QKSA 4ZPTB 4K3JH 5SWSE 1JNNL 4IU2A 4DPCX 4XN7A 3EUUA 2VWEE 3TFKC 2PKDA 4XCNB 1BQUA 3F7LA 1WZ1H 4IMLB 3U9PH 1DVTA 2WYZA 5HI3D 2ITCA 4XPFH 4KHXH 4F7TB 1JL8A 3FF8A 3MRFB 1QUNA 4WRLA 2J72A 3U4BL 1N0XL 4NXSA 1AGEA 2PF6A 3NCEB 1UQSB 5GS1A 4WFEE 1D7FA 4F7PA 1QVOB 2NY0D 3B6SA 3NRPA 4JO2L 4QHUA 1R34A 1UA6L 4G6KL 2NY2D 4Y2DB 2DYPD 3QZWB 3FT4B 5KVDL 4B9YA 1OALA 1SM3H 2VW7A 2VZSA 2W9DL 3BVXA 3HUJE 5ACZB 4JPVL 4UNUA 1X6NA 2XZQL 2P5EB 3VI4F 3LEYH 3QEQD 5E6IC 5DJZB 3NSDA 3TONA 3ESUF 5E8EB 2DLFH 1YEGH 2DYPB 4WWKB 4XPAH 5KBDA 1FL6A 2JCCB 4JM2B 1JZ7A 3HNVL 3BP6A 3ES6B 3KLSA 4MRCA 5DSCB 2I7OA 2DQIH 2DV6A 2A3TA 3FTGA 4OZIE 1XGQB 3EFFA 2AJ3B 1Y1DA 2BHZA 2ZT9C 1RV6X 4OCWH 1TU2A 2YN5A 1UQSA 4NRYB 2WLNA 3F6JA 1FZOB 3EO1B 2E7MA 5AVRB 3L1EA 3GTTA 1JPSH 4N0YH 4M8QB 4N2LA 2PETA 2B5IB 4M7KL 2Q3AA 2WXFA 5AOZA 3S4SB 1I1AC 1N8ZB 1NCGA 4C56A 4PV1C 3GTVA 2AZAA 3QYMA 2YJQA 4QRSB 3CFIC 4I18C 2WKGA 3DROA 5IQOA 2X0UA 1CTOA 4HUXA 4YBHA 4ZXBD 4LKXA 4PG9B 1HHHB 3OC3C 3DX7A 2PPAA 3SO5A 5BZWB 2RMNA 5IB4B 2H3XC 4FQXC 1FL5A 1AQKH 3NCJL 3BQUB 4UV7H 4V2BA 5T5FH 4GO9A 4RWYL 1QHPA 1ZTXL 5T3ZH 3AG2B 2B1OA 2DN7A 5I2IA 1BYOA 2HMIC 1NC4D 1TQSA 2NY6C 4MNQE 4N2HA 3ZO9A 3CDCA 5FW6A 1EJ6A 1YMMA 4NJAH 3O6MH 1KFIA 5C08D 1O7DC 1DSFL 4HS8H 1B3JA 1MZZA 1BJ1J 4XMLL 2DEXX 4MWFB 4MKTA 4ACTA 3BJLA 5EUKA 2XN9D 1E8WA 1VFBB 2V7NA 4J3OG 5H37G 4DN4L 1N8ZA 4C56B 2JTDA 1G1OA 4M43L 2VM4A 5T3ZE 1NUGA 4ZYKB 2V2WB 2JF1A 1CLOH 1KFAL 4J8RB 2GHZA 3KCWA 1QN3A 4XCFL 4EAGA 2XG5B 2ID5A 4IRJD 4Y4HA 4G82A 1F4WL 3C5ZA 3A4AA 1CDCA 4HUUA 4LDEB 1JVOA 5JQ6L 4DJMA 3CHPA 3X1GA 4JE4B 4ZW5A 2EEXA 4LCUB 3KPRD 1UM6L 3LH8A 1MFAL 4M7ZC 4G7VH 3VXRA 1OSZB 3MJ6A 4M48L 3A0OA 5TE4H 1KJ2B 3F12A 3LV3A 5IVXA 2B0SH 3QUMB 4QHNB 4H8HA 1QUPA 1QNAA 4W70A 3OZKA 1U2CA 3O9WB 1HESA 3P30L 5HYJE 4ZAKB 4QRRB 2IDUA 5KYUB 1DFBH 4N68A 3TYFA 3I6LD 4IGBD 3BKQX 2W9EL 4HX1A 4I3SH 2UZXB 1TTBA 4XMLH 2HUEA 3D8MA 5GZOC 2ZWLT 3CFMA 4HUUB 2P4AB 1UWGH 3S5LA 4P9HH 4DP6X 1H8SA 2CLZA 2PO6C 4L9LA 3VI3F 1XSIA 3QQXA 5CP3A 5FGBC 4Z7UA 2CGYA 4X0KB 2W1NA 3JWNG 3NDZE 1FUNA 2X4NA 2Y1ZA 3ARYA 1MAMH 3BAJA 3SDDB 5B39B 1H0DA 3TWYA 1U8HA 1PZ3A 5I1EL 2KZ1B 3MFFA 4YHYB 4MA3A 4U6HB 2WQVA 4RAVB 4GW1A 2I9LA 5D1QA 1DSWA 2K9FB 3CVHB 4PJHE 1N2RA 2QKIC 1XSJA 2V9QA 3N43F 3ZE0F 1BQLH 2D9CA 3GIVA 3H6AA 1EHXA 2ED6A 1E67A 4GMSL 5JW4M 5IK3A 2VSMB 32C2A 4MQTB 1RZKH 3QG6B 4MXQC 3S88H 4MLSA 3LZQA 4X5WA 5GXBB 43C9A 2LV4A 3CPUA 4ADGA 2WXLA 1NCWH 1TKWB 3DMMD 4WJKB 1S7TB 4JZJA 4M62L 5GJSH 4PG2A 4IOFC 3ZE1E 2Q2LA 1OIOA 2CUMA 4NPKA 5JPNB 3MMEB 4R4NC 1QSFA 5MENA 2E86A 3DECA 3LNHA 1NMAL 2FHBA 3PNWA 2F2HA 3CUPA 4FQXB 4LPVA 4M02A 4R0LC 3VUAA 1KUMA 5KYYA 1OF0A 1I8UA 4L4TB 1P4UA 2AANA 2WXNA 2Y3NA 2AKRA 4NC0B 3V6ZB 2WJ5A 1JYWA 2LW3A 1M1SA 1D5IL 3PGCA 5IREA 1TZHA 3UH8A 3BKML 4XX1G 2ZONA 3N6YA 5TDNB 4JFHE 3PHOA 1FBIL 5CBAB 1U21A 2A6JB 1AISA 4XHJC 4MDRA 3SHSA 3QIUC 4FXKA 2D03L 3D25A 5AVYB 5H35A 1M05B 1NUFA 5I1HH 3O3UN 4ZI8A 4ALAL 1IQDB 3WL9A 4GG8A 4G5ZL 4RISH 1SXAA 5MEPA 5C70A 1SEBA 3C9NB 2AJVL 4JB9L 4YXHH 3BWUF 3TA3B 3BHBB 1OAQH 3QK0A 4D9RE 4HK3J 2F0CA 1TKWA 4RA0C 5JIKA 1JWSA 1ADQA 2EEAA 2VOTA 3DPDA 3DPBA 1PFOA 3OM3B 4EUPH 1F3DH 1YEDB 2EC9U 3T0AA 4FQ1H 4W6WB 3K71B 4Y5VB 1J0IA 3ZHLA 3HBZA 2ROYA 3IN2A 1KB5B 2HFFB 3D85A 3PWVB 5H4ZA 3EZ8A 5KSBE 4YZWA 1VCBC 1ONQB 2H47C 3LQAH 5AYUH 1U8NB 3P0VH 4B50A 2X3CA 4E2OA 4X5XB 5HVHC 1O75A 3GMRB 3ULUL 2AXFA 4QOKB 4Y2DC 4PJIE 4JHBA 2D8KA 2A0LC 2VC2H 4MNQB 4YAQB 5DEZA 4R4ND 1A6AA 2BO0A 4MXVF 3BGAA 1U3HB 5D9SB 4D8PA 1T2QL 1CDJA 5DD5H 3RFZB 2P8MA 5TGBA 3TYGH 1DJGA 2R0WL 1QTPA 2IPUK 2X7LB 2C3WA 2Y3AA 5GGSB 4DK5A 1A0QL 3W11C 5BZZA 5F8RC 3DX6B 5T1LB 3PE9A 2FZ3A 1H8LA 2W60B 4HG4J 4JS7A 5ECGA 5D7IB 2VDOH 4ONFL 5D1ZD 4UTBH 3BO8B 1WAPA 1DVFA 4ONHA 1FAIL 4L3FA 1J1PL 4P2OA 5F7FA 3CLWA 3ME0B 3SCMC 3T3PF 1KB5A 1DQMH 1JTTA 3GK8H 4HPHA 3PIQB 4Z6AT 1NIDA 2X9WA 3KWWA 4JRYE 2PTVA 3CPLA 3MRKB 4RGNC 2YSTA 4OGZA 4Z1PA 2H4EA 5TD4A 4HH9B 5EU6A 3R4RA 5FO2A 1W8NA 1B4TA 2OR7A 4WW2B 3QRFM 1WC7B 3LRHA 1QFWH 4M8VA 5D7LB 3H55A 4HFWA 2DLGA 5JHAA 5C09E 5IF0A 1LO4L 3V9EA 1YEKH 4JREB 2ZXGA 4P07A 1UFGA 1TJGH 4YDKL 4GG6E 2NTFB 4Z7OB 4PS7A 4X4KA 4BJUA 4KZDL 1A0QH 1RXLA 4J6IA 4NHUB 4WO4A 5ALCH 3PP4H 5FK9A 5IEHB 2MSPA 3ZTJH 3FFCE 3IDGA 2CLVB 2AEWA 4GUPA 5I0ZA 3V0GA 4BUHA 5AFAA 1UASA 1QFHA 4LOEA 5A2AA 5HDBF 4FKKA 3FTXA 7PAZA 1IBYA 3GPSA 4YGVA 1BECA 1P6FA 3BOVA 5EOTB 5EBMA 4EUPB 1G7IA 1UYWH 2QQNL 5BOPA 2QQKL 3MYZA 1NKRA 1NDGA 4FQ2L 1KGUA 2CKNA 2H0JA 5DJ6B 1SBSH 1QQDB 5J3HC 4BDVB 3B9KB 1P7QD 5KVEL 4ZDHA 2WNWA 5KSAA 3EFOA 3UZQB 2XVGA 4MDJB 1HL5A 5HJ3B 2LOEA 1E2WA 1CF8H 1MJJA 1C16B 2E8YA 2QVMA 3D08A 4ZK8A 1NMBL 3DA0A 4KKAD 1ACXA 1NFIA 4N2FA 4CBZA 4IU3B 4ZFFB 1MHCB 3WIFA 1HIMH 4UOJA 3IJ9A 2EJ1A 4FG6C 2AXWA 3LN5A 3PL6D 4PGBB 3QJSB 3VX1A 1DQJA 5IJKA 1O7DE 4LOUD 5CUSH 5AVSB 5CSGA 2F19H 5K59F 4KJPD 1N5AA 2P8LB 4PIBA 3AQYA 4N2EA 3OHXC 3K72B 3JTSB 4PJBE 1DFXA 2ZUQB 4M7LL 4TF4A 4K9EH 2NTSP 3Q3GB 4O02L 1PX8A 3FULA 1SOSA 3NRFA 3N40F 1BZ9A 1KY7A 1N18A 3B7YA 4PJDF 4K15A 3GZQA 4OGYH 2IBGA 4X4YB 4HPYH 3RY6A 3IGAB 4K3EH 1UHVA 4JFTA 1F4XH 4DPAX 1ID5I 4MAZA 2HSIA 2O72A 5A2LH 3V0IA 4CSSA 1R3HB 4ELMB 4I4WB 2DMCA 3S5YA 4PVLA 3BH8A 3WEAA 1K2DA 1D5RA 3K2UH 5D2NB 4HPYL 2IAMC 2YD5A 5C3TA 3FCTB 3D39E 3O3BA 1PAMA 5FUZL 2CRZA 5DHVA 4GMTL 3SKUD 5A40E 2DIJA 1CF8L 4JFEA 3OSMA 3HAEH 4TPSA 2VLRA 3LSOB 2WXOA 1AY1H 1IRAY 5ETUB 3WIHH 2MQGA 3DTDA 3OAUL 5DD6B 5ID1B 1I85A 1Q90A 2B1AL 2EDRA 4I5BA 2MKWA 1F4YH 3QCUL 3MRJB 1XL4A 3MUZ1 2ZOTA 4OD2B 3UDWC 2X4OA 3UBXG 2UX6A 1NWOA 4LLYA 3SZ6A 2BSRA 3D0VA 2NY5C 4NENA 4P99A 4G83A 4XBPB 4GXFA 5DS8B 1MF2H 3D9AH 4YHKL 1EZSA 3MYJB 4XODA 3EBHA 4YHNB 2JPIA 3NGBC 3HTLX 5TFSL 1C5CH 3IDJB 2WZ6A 2CLRB 2R2EB 1R3HA 2F15A 1IGYB 2QLVB 2F5BL 2RQEA 3ILQD 4XAKE 3EJYD 4E41B 1HNFA 4KKBD 5D2NA 1B90A 1JGVL 3DV4B 3NJXA 3P4NA 2WN2A 4AI7A 1PQZA 4FCHA 4R5TA 8FABB 4NQCE 2R29H 5DFWH 3BGFB 3NFSL 5TE6L 4FG0A 1J5OH 3LQMA 1BPLB 5L2JA 2HJFB 1ECZA 3K6DA 4FN0A 4XCNA 3F7YA 4F27A 5KSAD 2ILLA 1O6SA 2CR6A 3E9UA 3IS0X 5EC1A 1CIUA 3CVBA 4RMSA 3QC6X 5ECJE 3LZFH 7FABH 4JDTL 5F7BA 5IKCB 3LEYL 3C08H 4PJ5E 3FO2A 2FBJH 3LKOB 4M4RA 1S7RB 4F8TA 3D39A 1K72A 3IETB 1TNNA 4DT2A 2XVKA 5IM7B 4EVNB 4HHAA 2DW5A 4ORGB 4PRPA 4PJEE 2EC9T 3Q01A 1J1OL 2FJFB 3PV6A 5E7BA 1XZ0B 4OAWA 5TTRA 4WUUE 2WKOF 3KWTA 4HSCX 4PJ9B 1INEH 2R59A 3BUYA 1OQOA 2EO1A 3QDAA 1BEXA 2TRYA 4XMKL 1V10A 2V0AA 3T3ME 3HE6B 4JFDE 4PJAE 5L7XL 2GFBA 2VMDA 3N04A 3OPZL 4ANKA 3ARUA 2P3YA 1JHTA 4OD1L 3AG3B 4WV1A 4ZOEA 5FYJD 3GWJA 2Z8WC 5TDPB 3BEVA 5H37A 4WNQB 3A4FA 4NWTL 5ES4B 1LILA 1HWGB 3WNNA 1UOVA 5HYJD 2DQCL 3GRWL 4PWFA 4AV0A 3SE9L 1Z1WA 2ZUQC 3ZL2A 3HG1B 1LEKA 1CXLA 5E6YA 3VAEA 2ATKA 1F1AA 3IAQA 1JVLA 4DKTA 1U91A 2VE6B 2WLLA 1E27B 3O2WL 4HUXB 3VXRD 2B5IC 2AHIA 4RRPM 2DQCH 1WJ3A 4ERSL 5T3Z