1KY6A

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 65
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky6A02
1KY6A 1QN7A 1AISA 1QNAA 1R4XA 1IU1A 5CN1A 1PCZA 3EIKA 3HS9A 1KYUA 1KY7A 1NA8A 1QNCA 1VOKA 5IYCP 3MNMA 4RODB 2E9GA 1MP9A 3OC3C 2A7BA 1QNEA 4B0AA 1YTBA 1VTLE 2VJ0A 1NVPA 2Z8UA 4ROCB 3ASMA 1GYWA 4BCXA 1CDWA 1KYDA 3ZHFA 4PY5A 3VN5A 5CN2A 3H1ZA 1C9BB 1KYFA 4ROEB 2YMTA 1D3UA 1JFIC 1W80A 1TBPA 2IV9A 3OCIA 1QNBA 1TBAB 1E42A 1QTSA 1QTPA 2D0BA 1OM9A 1QN9A 1QN3A 2IV8A 1NH2A 1NGMA 1TGHA 1VTOA 1PZDA 4WZSD 1YTFA 5IYBP 1VOLB 1GYVA 2D0CA 1RM1A 5IYDP 3HS8A 1QN6A 1B9KA 1P4UA 3ZY7A 1QN8A 2DWYA 2DWXA 2D0AA 2MJ7A 1GYUA 1QN5A 1QN4A 2G30A
chains in the Genus database with same CATH superfamily
2VW4A 4PJAB 3S0PA 4GSRA 2NR6D 4PLJD 5FF6B 1NAKH 5C7XH 3C5SA 3NCCB 3WE1A 5L2KA 1H15B 5L9DL 2JELL 1IC4H 5EPMB 5E7BA 4YUEL 4P2QB 1DL7L 3LCYA 1PGRB 2YRBA 5B39G 1NCUA 3BH8A 3L3OA 1BW8A 3CC5B 4ZD3H 5IP4A 3MLYL 2YQGA 5E2TH 2R29L 2MH4A 3L4VA 3M1OA 5GS0H 2XFXB 2YARA 1QNEA 1M7IB 1T89A 3RZCA 3W56A 3BKYL 2SEBA 4LCUB 2PR9A 1C47A 4JB9H 4EO5A 1HSBB 1A4JB 1U3YA 5B39B 4QXUL 1BDYA 2DQUL 3I02A 3VXTB 3O11B 2YAPA 4XPFH 2VDQL 1N5YH 4TPRH 4M7KH 4P23A 2A99A 3P3UA 5FUOH 2IVFC 5KSAA 3LKPB 1BVKA 2BSTA 4BRJA 5KS9F 3SJVD 1JCVA 1DUZA 5GS0C 3PWLA 2DDQL 3UZVB 2D7OA 5DHXB 1AKJD 1L7TL 3CH8A 1QLFB 5F88A 2X9WA 3LXUX 1DJGA 1HXMA 2Z4TA 1A7PH 3HRZA 4TN9A 4UANA 3S3CB 2Y8LA 3N1FC 3U4BL 3LY6A 4OLUL 1S8DA 1MCRA 2DMHA 2WM0A 1P1ZB 2AABH 4GP8B 2X9YA 1C7TA 2O4EA 4GG8A 5HD8D 1BJ1J 1OAKL 2XN0A 4P99A 3WV0A 2VLLB 2VM3A 3E9UA 4Y9EA 4HPYL 1AS6A 1T20A 2VR3A 1B0RB 3QORD 5IY5B 3QPQD 4L5FH 5JW4N 3DVGA 3F6JA 4OCRL 3WMSA 2W60B 4X5PA 2GBVA 4AQEB 1QBBA 2WVSA 1RIHL 2AVFA 3QJVB 1SY6H 4DEWA 3MLSH 2VXQH 1J0HA 3V4VL 4FLRA 3AWGA 4LQ1A 4WGKA 5C0FB 1YJDH 5AW0B 3T5WA 3OAWA 4QHMA 1Z0MA 1F1AA 4OM1H 1ID5I 4ADJA 5IMMB 3T77A 4KK5C 1BXXA 1KXHA 1ZVSA 4UQ3B 2O3OA 4JL1A 1OAYL 1PJ9A 4FQXC 5H35A 2Z7UA 4UTCA 2A83A 1JRHH 4AE1A 5GJTL 1IAIM 3KDMB 4JL2A 3NQKA 2YBRB 4N2EA 3V4PH 3WLWC 4UZSA 4EIBA 4NZTL 2VRQA 8CGTA 3AABA 2OJEB 1HL9A 4Z76A 4DK5A 5F7BA 1VJSA 3M6DA 1F02I 2VGLM 5IEKB 5IFHH 4UUJB 4NX0A 2CO7B 1QPXA 1ORQA 2EDKA 4ICWA 4M8UA 2RHEA 4PAZA 2WWMD 4TF4A 4CN4A 4N3TA 3BPOC 1I1CA 1FH5L 3TJPA 3WBDA 1JF1B 3FUHA 2BVEA 1SFDA 3L3IA 4TULL 4A39A 1N12A 1QD0A 4H1LH 5B7MA 3W5NA 1D2PA 1QUNB 1QHOA 2YD3A 2ITCA 4X6EB 1E5ZA 1TZ8A 4H8QA 4NC0B 5D1XD 4FXGC 5D70L 4AZUA 3GSOB 3RWGB 1ES0B 2ARJB 5I1DA 1QEWB 3K5RA 3DIVA 5LKNA 1XGUA 1NCAH 4ZTOL 3JV6A 4O00A 2WV3A 4X6FB 3NPZB 2HT4C 1I8KA 1WO2A 2FSEB 1VACB 3G5ZB 4N0UE 4MBRA 4NP4L 4WI9A 4Z9KB 5ID0B 5L88H 1A4AA 4HG4K 3OKEB 4GFXA 4WNQB 4KQ3H 5D4QA 1I9IH 1NFKA 4N24A 4Z7NB 1HL5A 3UTSA 2ADGA 4RMQA 4HWNA 2Y6SD 3SGKC 1RZJH 1T7ZA 4IRJD 1KCBA 1CXHA 1SN0A 3CDGA 3VFRA 4QHUB 1N6VA 4ZXBC 3QUMB 4DJMA 2C9UA 1LHZA 2AW2A 1FZKA 2IOMA 4NBXB 4MA7L 1NEUA 1NBYB 3OJVC 4L3ED 2NY4D 4J3BA 2HUHA 4OD1H 1RU9H 4AQ8C 3RUGB 3L1EA 4W9ZA 1JHLL 2VSCA 4U1SB 3R4RA 1HJBC 4LPWA 1RJYA 2DI8A 1CFVH 2WLJA 3WEXA 2R8SL 1CGSL 3IEAA 3RVXC 3UCQA 3ZDXB 4ZT1A 3EG9A 3ESVF 1FO0B 4QRRB 1PCJX 1WWWX 5DJZB 4GO6B 5BO0D 2BNRB 2IWFA 5F7EH 2Z93A 2TSAA 1OP4A 2Y22A 1F4XL 4AM0B 3PAYA 2JHNA 4R7VA 1A7RL 4WUKL 2GSIA 3QQ9D 1WBZA 1MFDL 2GEEA 3N6YA 5CGYD 2LFGA 3X1EA 4ES8A 5K1NA 8PAZA 2R0ZL 2KC0A 3WKML 5GRXG 3EZJB 2ZYIA 3PNWB 1XIWA 1S9WA 2OS7A 4PJ8A 5JXEA 1RQ5A 5BV7L 3OXSB 2ATKB 5I66A 5DRZB 2A3TA 3QIBD 1PS3A 3T1WA 1B9KA 3ZY7A 4BQ6A 1GY1A 3BGFC 1MCPL 1SZNA 2PO6C 4IM8A 5DS8A 4IIQC 4K94H 4PJFB 3RJDA 3L95A 3VFVA 3RNQA 5FPIA 4TLKA 4FYTA 3UTQB 5JZ7D 1ULVA 4HC1H 4Y5VA 1EJ6A 4Z7IA 4NWUL 4H8HA 1HU8A 4NZDA 3LKNA 3ZHDA 1VADB 2XY1A 1U8JA 2HVKA 3LKQB 3P9LB 2FBJH 3RWFA 2WWNA 5F9JA 1DVFD 1L9MA 5JPMB 4H0GA 5I6OA 1JGLH 1KCVL 3KYOA 4QJ4B 4FXKC 4HJHA 1NGPH 4U6VH 4R90H 2D0FA 3VD9A 1JYVA 3GSWA 5JHMA 1U36A 2EIKB 5EC2A 2Y5TA 3QFJB 3V0VA 2XG5B 1NVPA 3F58H 4GSDL 2E76C 2FL5B 4GRLC 1MIEL 5TDNA 2QGDA 2A9CA 3V6FA 4CW1B 2F19H 1IVLA 1FRGL 3FCBA 2ZD0A 3H9SD 1QFWI 1ZGLM 1INEL 1IGFL 3F7QA 4DIXA 1PX4A 2A38A 3BZ5A 5FGBC 4M6OH 1COBA 1N3NB 1IRAY 3T0VA 5DWUH 3MRFB 4Z7OF 3A6BL 3HNTH 4P48A 3BVNA 1LWHA 3KPQA 5CWSA 5CGYC 1PVSA 2FAUA 3Q9QA 3P11H 1TQWA 4NM8H 1V5SA 1XGZA 2FX9H 4Z95H 3IXTA 2J2ZB 1ZIBA 3LQAH 4UDTA 2PPEA 5IHHA 4I77H 1BHGA 1GOFA 1ZHBB 2D0BA 1UYWH 2WYHA 3BJ91 4ZI8A 1SF3A 4PLOB 4FX5A 3MSPA 1P4BH 1XAUA 1LO4L 2MSPA 1L9RA 4LF3A 4G9FE 3EYQD 4TV3A 4OM0L 3BYYA 4EN3C 4RGOH 4NLAA 4OZGE 2IH8A 3KHOA 3GFUA 4NKIH 2VDMB 3L4UA 3OVUB 4J39A 4ABQA 3DJRA 3B6SA 3V0WH 2BDNH 4Z7VE 3IDJA 3L3GB 4FS0A 3VCLA 3FU9A 3M1BB 4U7SA 3BI9X 3P0YH 4F3FB 3C60D 1D9KC 1KXQE 3IMSA 1S9VA 4HWZA 4TSCH 2L3BA 5MHSE 2VR4A 2BVQB 2NZ9D 3FONB 3MQIA 4H8WL 4AEIL 5DTFB 1G5AA 3KVQA 1H6UA 1Z5LA 2HX8A 4NIYE 3GD1C 4H8PA 5HDBB 2YRLA 1VFAB 2ZUWA 4GS7B 1YN6A 2NNCA 1CS6A 3UJJL 3VXQA 2P5WE 5FO7A 4LNVA 3RX5A 3F7YA 5PAZA 3K2IA 2AXWA 3T6XA 2VN7A 3JV6B 3PDOA 1C08B 1AR2A 4OD2A 4MAYB 2XZAH 5E9DD 5A3IC 1QSEB 1SMOA 4NN6C 2DLHA 4C83A 2AJ3B 2MJ7A 4KKBC 2X6BA 4JY5L 1W6WA 2L04A 4KI5E 2DS4A 3MBEB 5BMPA 2Q1EA 3GPSA 3BX7C 3D48R 4L1TA 3WGVB 2AEPL 4NZRL 4E9RA 3K2MC 3ARGB 4ZAKD 3C8KA 3E2HC 4OIIL 1MCCA 4N22A 2ZOWA 4NC1E 5I9QC 3MA7B 5CBAB 3COOA 2B1AL 3IDUA 1WFNA 1B4RA 4TNVF 4MQ7B 1UJ3A 3PV7A 1DQML 3BWUC 4F7MB 4MNGE 1OHZA 1T4WA 1UFGA 4P3WA 3FTXA 3T1FB 1J9RA 4AVHA 2YFOA 2NOHA 4PRIE 1K72A 3MUJA 1PCXA 1IARB 2F5AL 3LPFA 3CDCA 3VXUA 1TZHA 1R3LA 1RZ7L 3CC1A 1M1XA 4JPWL 3FO0L 3CVHB 3SQOL 5HHQB 4LDEB 1G9MH 2NY5H 1A6VH 4U7MA 3O45B 4B41A 1MH5B 3QJZA 4A7GA 3WTYA 5JLZB 5G5DA 4R7LA 5DD5L 5CN3A 4F5CE 2VJXA 2B39A 4BZ1L 4HS3B 2K7PA 4P2OC 5A7BA 4Z0XA 4W93A 1ERNA 4XNUL 2GI0A 2QSVA 1OL0A 4EAEA 4AQ1B 4HK0B 4S0HA 4HGWA 5LAXB 2CZNA 5FV1L 1XVSA 3QJHA 5L6YL 2J5WA 1DFXA 5I1HH 1FGVL 3ROLA 5HDWA 3HAEB 1WG3A 1BIIB 5I16B 2PCFB 2RFXB 3QORC 1W2KT 1AGCB 5I19L 4GS7C 4KUZH 3TZVB 5DC4B 4KVNL 4D7PA 1INDH 4PD4K 2E27L 4IU2A 4FD0A 2NOZA 2XV0A 3TN0C 2FLBT 2FEEL 2VLRE 5TD4A 4KROD 4HVBA 5J0BA 2VXSL 35C8L 3LXAA 5ACMA 2J8UE 4JFQA 1IFRA 3MPCA 2I24N 3MJWA 5DUPL 2DH3A 3MRLA 3QI9A 5JIHA 4HKBB 2VM9A 1CZ8L 1FNEA 3HCVB 4FHJA 1B4TA 4LB8A 1UT1A 2BHZA 5IB1B 3KPTA 2HFEA 4OF7A 1ZVSB 2HKHH 3D39D 4WRLA 5F0LB 2B7DT 3HPJB 3UROR 2CDFB 4K73A 3BDXA 4RQQA 1J87A 3DGGB 1ZLUH 3S5YA 5HP5A 3LMJH 2XN9E 4U1NB 2D7QA 1Q4NX 5FDWB 3V7AG 1MI5D 2DWTA 2EAEA 2Y07H 4K7PY 2XHIA 4Z5RA 3SDXE 5D1ZI 5DS1A 1BOGA 4HWBA 3HC2A 4Y5YA 2BNUA 2K1MA 3QIUC 4M1GL 3ZKMD 4JG1H 4NKOB 2GJPA 1RZFH 5HJ3B 2C3GA 1IKOP 4IGBD 4CFFA 3UDWC 1R46A 3PP3H 4X50A 5I6NA 1N18A 3TWYA 3H55A 4JO3H 1KCSL 1JZEA 2HVJB 4RRPG 3A4EA 4NQVA 1RUAL 3LRLA 1PZCA 4JO4L 4J12A 2X0WA 4J3XA 2NQ3A 5JOFB 5L2JA 1YZZA 3GMMB 3BCFA 2H6PB 3BQUD 3Q2CA 1WISA 2B9BA 2CLRA 1JHKL 2VOTA 4LDOB 1YMMD 2CJSA 2WQRA 5C09A 5CEZE 1GKOA 3D1MC 1JPST 1M4KA 3UL4A 1CLOL 1GKEA 4X6FA 2WUCH 4OZHB 1MQKL 1J48A 2D3LA 3L1GA 1KFQA 6CGTA 3MFFA 3O2DA 3LNIA 2CHNA 3ESOA 4P2QD 4RFNC 5FM4A 5IB4A 1E4WL 2ZUXA 1U8NA 3RVTC 1NCWH 4PJHE 4MNQB 4ZMQA 1WP6A 1BQUA 2FT8A 2CSPA 1O75A 4MJ6A 3MOAH 4YLBA 2X4RB 4BSWB 2FWSA 5JNYB 3RGBA 2A1WL 3D87B 2BY0A 3BZ4B 5BS0B 3ARVA 1QZ1A 4QHUA 1X4ZA 3GI9L 3ZKNC 4E5XG 3O4LE 2IC2A 3LZNA 4A2FA 1TETL 5TE4L 3AROA 3B43A 4N9GB 1BZ8A 2DM4A 2EE0A 2X4SB 3IJHB 1MW3A 1QA9A 3TPKA 1GGIH 2ZKYA 5IFJB 3LPGA 1DLHB 1OCRB 2D7MA 2BZCA 2X4QA 3ECVA 3GSVA 2B16A 2FD6H 5ETUA 3I50L 3AQXA 5AN4A 2GCYA 3W0WB 1JNLH 3OF6A 3BQVA 4LEXH 1WA0X 3BIKA 2KLRA 1LWJA 2BRRH 3UIYA 3MRMA 5E1AA 3WLBB 4ENZA 5C97A 1I7UB 1GRWA 4FFYL 3P9MB 3HNSL 3R7RA 5CJQH 4W9LC 1C12A 5ESVA 1U8PA 3OB8A 2IDSA 2F8OA 5EEUA 3V5HB 3DBSA 4UOQA 3OAUL 2GIYA 4LZKA 4H88L 4B9PA 2DKCA 1TCRA 2W9DH 3BC9A 3OSVA 2CUIA 1DSFH 4M6ML 5GGVH 5BRZB 4FLOA 1LILA 3IGUA 3GIVB 3UZQA 4LSPH 2VDLB 3F5WA 2YIHA 1SOSA 4GH7B 2KS0A 2QQKH 2FYYB 2E4FA 4XPHH 5E6RB 5I2IA 3EW3B 1AGDA 3MXWH 4HQQL 1P9MA 1NC2B 2E5EA 3G9VA 1L5GB 3DA0A 4N2FA 4KXAA 3T6WA 3NIDE 1EXUB 5EULV 1QASA 2OXGA 2Q9OA 3FQTB 4HJEA 2X70A 1HEZB 4XP9L 4QCIA 1R3LB 3CWUA 4N90D 3U4KA 1IKFH 3CSYB 4FNTA 1WAEA 4MA1B 3RUGF 3PUCA 1EV2E 1TCMA 5K69A 1JUFA 4H1LA 2DM2A 15C8H 5C71A 4W9EC 1TG8A 2CCVA 4XBGB 2DLFH 1TQBB 3GDBA 5F89A 5T3ZH 1J88A 2LVEA 2YSTA 2AQ1A 3KPNA 5G55A 3O2VH 1ML0A 1MCQA 2X4OB 2IPTL 2Y06H 3ILQD 4P23D 1JL8A 2JIXD 2JCCA 3WUWB 4DKFH 3OC3C 3FQUA 1NBQA 3LQZA 1PZUB 1NOLA 3VM5A 4RX4D 4QRQA 1S9YB 3UMNA 4WI0A 2IH3A 4HJ1A 4X7CC 3ZL4H 2G5BB 3SYPA 2Z8RA 4OZHE 3DNKA 2PYFA 1WFOA 4WJ5B 1IB5A 3ECWA 2XHNA 3TCTA 2UUDH 3FTZA 2C9PA 1OCZB 4NJAH 4RMTA 5CP3A 2FX7H 4EXPX 1OM3H 1F97A 4GRMA 5DD1H 2EIZB 3VFPA 1GOHA 4M9PA 3ZDXF 5IR1A 3L1OL 4NXKA 4WHYH 2IANE 1T2QH 3O6FB 5J9PA 1I9JH 3QZMA 3HG1E 4ZTPH 2IH1A 1NEZG 3QDMB 4NOFA 1SMDA 3SGDH 5D7IF 2XKUA 3R8BB 5CJ5A 2YA3A 3KPMB 2DEWX 3FT2A 4OZ4B 1BFSA 4U1NA 4NUQA 2BOCB 3FO1A 4ZPVA 2HH0L 1K4CA 4XVTH 1KGYE 1M7UA 3OKOB 2ZOLA 3PJLA 2JH2A 3UYRH 3D50A 1EGJL 1YLBB 2AEQH 5EB9A 4PJAE 3Q6GL 3MLSL 2OTUA 4OLEA 4E41E 4WZSD 2DLIA 2DQCL 1U3HD 4S0SD 3ULSB 1T0OA 2CKNA 2OMTB 2N1TE 4H2CA 3WEXB 1R3IH 2NY3D 3SE9L 3NIFB 2NX5B 4YBQC 3SDXA 3QARA 1BD2D 3FOMA 5HGHB 2YJQA 3EYOB 4X4KA 1NMAL 5T3XH 4XMLL 4Y2OA 3T0XA 5I18L 1W8EA 4XZUA 2EE2A 4CADB 1QFPA 3VXUD 1G7JB 3SD2A 3RL1A 1XSIA 4XO5A 4JO2H 2NCEA 1MJUH 3TIEA 1WFUA 5I6KA 2Q5BA 5KANI 3B9KC 3SE4C 1XSJA 3UH8A 4IU3B 3LSOA 4NKMA 3MJ8A 4NP9A 4DP7X 2VDML 3EGXA 1IEBB 4DGUA 3U4AA 5KUKA 1NGZB 3KEDA 4B50A 3EKCA 4X9YA 7TAAA 3KXFD 2D03L 1PY0A 1DZBA 4TOYL 4UZUA 4JGMA 2Y7SA 1MREL 5LNEA 1RUMH 2H2PC 4U2YA 2D7TH 1DQLH 4MA8H 1HHJA 5KTEL 4Y4KB 5DD0H 4YZWA 4MDRA 5ALBH 5EO0A 5L88L 5JW4M 4OUUA 3SDCD 2AXJA 4MMXC 3DYPA 2NVMA 5MP6H 5FK9A 3INUL 1C4GA 3IDIB 3IAGC 2CHWA 1IQWH 3CLFL 2CDGB 3N1QC 1CXIA 4K3HA 4JDTL 5DHYA 1NBZB 4FFZH 4ZTEA 3G9AB 1U8PB 3UABA 1GY2A 4N20A 2VNCA 1OKEA 1K3IA 2LU7A 2DIBA 1WJ3A 4XB3A 3KBEA 3VXRB 3ARUA 3SO3C 4OD1L 3RIKA 1TIUA 1JFIC 2GK2A 2VLRB 3OCIA 2WINB 2K0RA 4E42B 5TQ2H 2GC4C 3RGVD 2JXMB 1CFVL 4QOKA 4EI5D 5LDSA 3TFKD 5JPNA 4CGUB 4HWBL 4EDWH 5J1TC 3IFOB 2XICA 2G2PA 1XBRA 3NMEA 2Y5TB 5CFAA 5GZNA 4J7RA 3BT2H 5A16A 2W0LA 1ACYL 1CGYA 4BM7A 3G6JB 3HR5A 4JHAH 4JN2A 5ICZA 1ADQA 1WHOA 1DN0B 1F4XH 1W0WA 4ODHH 4TUOA 4BYHA 1DANU 4XHQA 5JOPE 1MLBB 1WBXA 2WIIA 2LGNA 5FLVA 1N6QH 1KT2B 2NY2C 3C09C 1JPSL 4NPYA 4WKZB 5D71H 2X12A 5C2UB 1J8KA 3SY0B 4YO0B 4AMWA 5DGRA 3CWSA 3Q2VA 2XXMB 3FYEB 3QUYB 4RIRB 3KPQB 5CWSB 2NY6D 1ICTA 2Y36L 1X5MA 3IT8D 4PRBA 1ZVYA 3T0EB 1QYGL 5F9WC 5I75B 1F56A 3APCA 1IGTB 1P53A 5BJTB 1AHKA 3VD1A 2A0LD 5C0NC 3L3KA 3U0PA 1ZHBA 1G87A 1YPZF 4IOFC 2X6MA 2GTQA 4HIPA 4ZRGA 1B0GB 1UWEH 2QVMA 2XWDA 5JDSB 1WBYA 1F42A 5AW3B 3NCXA 3Q0HA 2Q6WB 1FNSL 3APMA 1LMIA 5I6PA 5IQ7L 2ADYA 2XTLA 2JB6A 3HLKA 4ODUB 1SLVA 1UOLA 1XF3A 4WSKA 5DLML 2YD6A 3IDGA 3L7FB 3RGVC 4FKKA 1J8RA 2G5BA 4L9LB 3GJFK 2HP4A 3A21A 2FZ3B 4YSPA 2ZP8A 5H2BB 1A1OA 1NFDB 3BP4B 3V9EA 3MOQA 3RBGA 2XZZA 5J8OA 3I0WA 4HHAB 4CL7A 2DI9A 4ODTL 1I7RA 1E28A 2JJTA 5DZPA 1ZGLA 4MD0B 3RDTC 1ONQB 4MD5B 5C6TH 1F90H 1AYOA 1IZKA 3BKJL 3MRBA 2LQRA 4XGZB 3EOYG 5GSVB 2FLRT 5EZPA 2X87A 3K6SB 3B5GA 3S34L 3NA4A 3MNWA 4G5AA 3IMVA 1HZHL 3P4OA 4Q89A 3DTUB 1AOHA 2IDCA 1MIEH 3TN0A 3CXDL 1IAIL 1MHEB 3KBPA 1KN2L 2M26A 3MLRL 5SWZD 3CVSA 2C4FU 4XHJD 4PVNA 3ZDZB 3EYVA 5C0CD 1CLCA 1UXSB 2AJUH 3MLUH 5GS2D 1N64H 2VC2L 3B8YA 4JLRA 3RRQA 4ZQKB 3WS3A 3B9KD 2R7EB 1DLHA 4DO4A 2GAZA 5E56A 2G60H 4XO4A 4NM8L 4M6AA 4RDQF 4LT7A 1JGEB 2DYPA 1S6NA 1OT1A 1U6AL 4ZZFA 1DVFB 3TPUA 1USZA 4PREA 4HLEA 4AT6B 3SKJH 4OQTA 3QDJE 2NX5A 3HS0A 4RGNC 4Z3HA 1NPUA 3NRPA 3DX6A 3QNZB 4YVUA 1ZSDB 1WEJH 4JRYE 3V5HA 3AXIA 3HOGA 4KRLB 2J5LB 4LCYA 3RU8H 3TL5A 3KYOB 4OLXL 2HFFB 3JWNG 1K6QH 3ILQC 4F20A 4NO0D 2AXGA 2CGRH 3PABB 3WSQH 5EEXA 1L4IA 2ILLA 2DBJA 4GQRA 3ZHNA 2NT1A 3S4SG 3TT1L 4BQCA 3FC8A 3JTTA 4DUWA 3SYCA 1SVBA 1UD2A 1E8YA 1ILSA 3F5WB 2VL5B 1H3TA 5AVYB 2ZQKA 4EI6A 2XIDA 4POUB 1IEBA 2FECI 3FPXA 4O58H 5FUOL 4AC4A 3JTSB 4JN1L 5JW4Q 1Y1UA 3FQNA 4K5PA 4LRNL 5K1JA 3QDJA 3L4XA 5L2KD 1F41A 2ID5A 3C5XA 4YE0A 4XX1E 1LEIB 5D4JA 2NR6A 3P77A 4NNPL 3WIFA 6PCYA 2YUXA 3FFOA 3OJDB 3PWPA 4K7FB 1PEZA 3FQTA 1CF8L 2X70B 3ARWA 3B3IA 3BPNC 3AUVA 1CD0A 2N7AA 5KYYA 5AVZB 2XVBA 4WO4B 5E24E 3VFGL 3CZLA 4S1SL 3BPCA 3TT3L 3TZVC 1YEGH 4EN3B 4XVOA 3GMPA 5CZKA 4OIIH 1NIFA 4W9KC 4NQQA 5D4HA 4R4ND 3BUTA 5ACZA 3V55A 4UDTB 5AOZA 2YUWA 3UPRB 3CBJB 4LHUG 4OCRH 3HKZA 3NP3A 3NH7H 2D0HA 1D6VH 2A73A 2AERT 2BJML 4PPTA 3ULUF 1TNNA 3LZFH 3ZLQC 4Y1AE 3RKPA 5FCUH 3KZ8A 1FN4A 4E42A 3WNIA 2O26U 1FLRL 4LLQB 3T8XB 1GGTA 5LGJA 2IGFL 3KL5A 4PSPA 3KD4A 3UAJA 4K55A 4JPWH 2NUTA 3SQOH 2WXLA 3KM2A 4Z3GA 1NDMB 1OAYH 2XA8L 3L3GA 4JQVA 3FB6A 4A7VA 4HZLA 1I9RH 3CVHL 4BZ2L 2PXYD 4DAGL 3TFBA 2Y7OA 4GRWE 5ALCH 2OM5A 2CDEB 2GJ6E 4FEIA 4ABWA 1E4HA 4FNUA 4HD9A 1JG9A 4A2DA 4MJIB 4NEHB 4G8AC 3FUNA 5KAQF 4NQEB 4KMTL 4KJWD 2DJUA 3SO5A 1C9BB 4Q8BA 3THMH 4ZFOA 2WKLA 1RZ8B 3GSRA 1X9QA 1TBPA 4MB4A 4N6RB 3PHOB 2WLYA 4PJCE 4EPSA 3W37A 3DUSA 4E5XA 4LXFA 9CGTA 3JWDH 5ACLA 1S7RA 2FIRT 4PBDA 1QO3A 4O4YL 3UPCA 2ZAGA 1DZ0A 3V0AC 1DQJB 4UTBA 1SXBA 2WLLB 4LKCA 3GO1L 5A2LH 3RUGE 4KVPA 1INDL 4GXUN 2OMZA 1NFIB 3ZMEA 5DJDB 1CXLA 3QJUB 3W2DL 5FO8A 1ID2A 5JNYA 3C8KB 1WCBB 2APSA 2VSMB 3Q6FA 1P4IH 4TNFA 5HY9B 3R19A 4HSAC 4FTVD 1FVDB 2AJYL 1JNJA 4ODUA 4WHTB 3VYOA 1KJVB 2KI6A 1KFIA 3T3PB 2EJ1A 4MMYA 4YHYC 2XWZA 3WN5B 3BQUC 1MXGA 1UH4A 4JHBA 4Z7NE 2DM7A 4H40A 2PXYB 3D3VD 5DD3L 2VLKB 4W4OA 3LZPA 1HC1A 1B6DA 1ADQH 4MAYD 3L5WB 4MNQE 2OSXA 2XN2A 3B3BA 1AIFA 1AI1H 3GZOA 3S35H 4QYOA 2G4EA 3NFSL 2VZUA 4F2ME 2W8CA 1ZLUK 5HYJB 1BAFL 5AVRB 2G75B 4ZNEA 2HKFH 5I1IL 4PUBH 1I8IB 3JYCA 5LBSL 3GUTA 3VMPA 5TE6L 2ZYHA 1R0AH 4YOKA 5JA9A 2NCMA 4HPOH 1MW0A 3JWNE 5E4OA 4HIIA 3MRPA 1T89C 2EO1A 3L9RA 2CR6A 2WO2B 2NOBA 3ROLB 1QNAA 3LRMA 3FTSA 4GAJH 4Q9RH 4BHUI 3IFPA 2QV2A 3D69A 4P2QA 3L3HA 3V6ZB 2NY1D 4X5QA 2VE6B 2CMRL 1RPUA 3L3OB 3BVVA 1TEFA 2ZCZA 1AMYA 1E5YA 4WW1A 5IW6A 2EH8L 3UP1A 3VRIA 3PAUA 4A7QA 2VKWA 3F00A 4Y4KA 4OB5L 4PJHA 4CVZB 1P2CA 1L5GA 2JKRM 3C6SA 3RZCB 3VD3A 1OAKH 3FQXA 5FO9A 4QYAA 1A4JA 3APDA 3SZKC 2GSGB 5B39A 4TSBL 1EZVX 4D9QD 1ODUA 1HNFA 3EZ8A 2CDGA 5IQ9B 4N28A 4HAGA 1T6WA 2WBXA 1S7UB 2UXFA 2X4UA 1OT4A 5T8IA 5C86A 5GS1B 4AV4A 1BBJB 4H44C 4KDTA 1IGJA 5CNHA 3U4EA 4H1LB 4PB0L 4K94L 2FJHA 5KSAB 4PCTA 3TYFA 3VN5A 3K8MA 4OM1L 4HC1L 5EMYA 4WFHD 4X8JB 1M2OA 5DJ0B 3QVAA 1NCJA 3K4DA 5J3HC 1M7DB 4E9QA 2XZCH 3QEGL 1UA6H 5GJTH 1CFTB 1ZTXE 1AZUA 3HE7C 4MMZB 1KN4H 4P2OD 3ULVL 3L5XH 1TTBA 2V2XB 5IG7B 4AQOA 3ALWA 4ADGA 1NQBA 1F6AA 1XH3B 1ZTMA 2YR3A 2N3JA 4C54A 3ULUD 1OARL 2A4EA 2JTDA 3DJ9A 4XXWC 3N44F 4R7NB 1RJZB 3SEPA 3QXAA 1OZUA 2RIKA 5EUKB 3JSSA 1PCMX 1N59A 1OSEA 2E7HA 1C5BL 1JFHA 3O9WA 2CLRB 3UTPD 5AOJA 1FH5H 3IJEA 1NICA 4XMKH 4OQTL 3B9KA 4B9IA 3QXUA 3SPHA 1VGEH 4RIRA 4WX8A 1AIZA 1JD9A 4LMQI 3CX5J 5C07A 3PWNB 3WELA 4LPUA 4XP4L 4CVUA 2UYLB 2O5ZL 4LEOA 2F54A 4LARL 5DMGC 3QNXB 3KPSA 1YEIH 2PPCA 1OD7A 3MGTA 3PWPE 1E5UI 3NSJA 4ZO9A 5KBMA 3TVMB 1N70A 5DI8A 1LEKA 4PJIB 5BV7B 1U4EA 4IKNA 1ET7A 5E4AA 2YBRA 1RM1A 4KKBD 2X0UA 1MJJA 1QMUA 4EBQH 1ZHLB 3LV3B 1AGBA 2LE9A 2JB6B 4H0HB 5F1OB 4P05A 2ED9A 1MNUH 5E5RB 4AYGA 4IOIB 1RZJL 1DBJH 3IJHA 4QHNB 4U4BA 3M8OL 4KKRA 1QA9B 5IFJA 4ZSOE 2GITB 4UUJA 4IDJL 5L4MA 2XDHA 4D0BA 1K9TA 1G6RH 3M17A 4XWGH 1XZ0B 2WMPB 4K3DH 15C8L 5C07E 2CXGA 25C8L 3PJSB 3RVWC 4KKCD 3WS6C 2OXHB 2FQGA 4NQUA 3X12B 1AP2B 3SKNB 3D39A 5ADPH 3V0WL 3ZX1A 2EC9U 2LTQB 2Y1AA 1X5YA 2Q3AA 2UUDK 3MV01 1M42A 4I5BB 3PREA 2HYMA 5IVNA 3K6SA 2BOLA 4KQ0A 5IOPB 3KLAB 4U1JB 3QR0A 4JPIA 4BE6A 4I85A 1V3LA 4WWPA 5D1XE 1MWAH 3EF4A 3IWVA 4A6YB 1JYWA 2WLLA 1A7RH 4HIQA 3HZKA 1I3RB 4ZG1A 1H6FA 4FXGB 2FKFA 2Z8UA 3OKKB 3VFNB 5KW9H 3MZGB 4L4VA 4YDIH 4ZUTB 1XGYH 4Y7OC 4MASA 3MRRA 3LIZH 4NUMA 4TUJA 3ZDXE 1X9LA 3NAAL 4B7LA 1NGZA 3K3QA 4K7PX 5DD1L 1KBPA 2P48B 2H45A 5H37H 3ECQA 4KMQA 2WBJB 2XKNA 4MS8C 1VFBA 4DVBA 3RUGA 2IV9A 2VDOH 2CJ3A 3NIGF 3N41F 3MMEB 2VO5A 3U46B 4NQXA 2P8MB 2WC7A 4RFEA 4YHKL 2H32B 4N5UA 4NUJA 2WLHA 4F1ZA 3NIFF 1MRCL 1IV8A 1MEXH 2BVPB 4JFED 1PAZA 3OKLA 3JV5A 3RFZB 4G82A 2X0VA 3Q05A 1GS6X 1DYZA 1YUHA 3FO2A 3RGVA 3S88H 2AEQL 3C2AL 2DH2A 1PKQA 1A0QL 1TQVA 4A2HA 4D9RE 4ELKB 2YS4A 4U1GC 4ODWB 4BXVA 3DIFA 4Y5XC 1J05A 1V7NL 2GFBB 1KPRB 1XH0A 3ZIMA 1SHSA 2QVIA 2EYRA 3STLA 4J27A 2CA4A 2O5YL 1VZGA 2VAAA 3WIFB 3L81A 4XMLH 4JR9L 1FNLA 1PVHA 4GAGL 1T83A 1EIBA 1JWSA 1YEKL 3IKKA 4LIQE 4P59H 4K7FA 4F8TA 3JUYA 4EZJA 1P4UA 3ZO9A 5AL8A 1RUKL 3L95B 3VFVB 1LWWA 4LCWD 2PO6D 3SQBB 1TLMA 4N0YL 1KDIA 4AY0A 2D0GA 5EU3B 4BSVB 3GGWB 3TO2B 5B8CB 1TKWA 1YN7B 3TJEH 3ZE0F 3V10A 3OGDA 4WUUB 3O6FA 5HPMB 1QSFD 3NZHL 2VDMH 3U7AA 1B4JL 1QG3A 1Q9LA 5J12B 3GRGA 1E6OH 4UM8A 1KFGA 3BXNB 4NKDA 4XPGH 4YEFA 1EHLL 3V8OA 4J3OG 5CKGA 1MCJA 3WO4B 5JIIA 2P28B 2VDPB 3ZL2A 4Z95L 5DUPH 2NY2B 3C09B 1O6SA 2HG0A 4TLSA 3OWRA 1FN4B 1OWWA 1S5IL 2PR4L 3GXPA 1XIWD 5JXED 3IDYB 1LO4H 1ZT4A 4WI6A 3MLYH 5FGBA 5JPMC 1SYVB 1YYLH 2HKHL 4H8WC 4FMFA 4MWFB 1QSFA 1QBLH 3QUKB 5IBUB 1IQWL 1F2XK 2HLAA 3CLFH 4FXKB 4EUPG 3NJJA 4YXHH 5GS0L 1SVCP 2O72A 5F96L 4WY7H 1FSKC 1TYEB 4PJIE 1NFDA 4QXUH 4Y1TA 2J4WL 3HI1A 2FLMA 4JM2D 3EOTH 1WFIA 4JFXA 4XTRC 1DEDA 1MW2A 1KYOJ 5F7NC 2PUQT 5EOTA 5DMIH 4HOXA 2V2TB 3V0HA 3FT4A 4U1GB 3RWHA 4XC1L 3OQRA 3MKGA 2QJDA 3O81A 3TYGH 1MFVA 4KKCC 4HS6A 5GRWA 1JXDA 4JM4H 3K0WA 5JZ7C 5ABDE 4LSRH 2J2ZA 1PTZA 2X05A 1UB5A 4MSWA 2MCAA 3QZWB 5DMKA 1CT8A 1NGYB 3FBQA 2OMXB 3ZE0B 3ZR6A 3VD0A 3T65A 1R17A 3I75B 4JFDD 1FC2D 3WNNA 2X10A 1OAQH 4PJIA 4JO8A 5IT2L 5D5ME 1ORSA 2WWOA 3VU1A 3N2JA 2Q8AL 3GIZH 3TBVB 1OSPH 1F4AA 5B3SB 5CKAA 4NDMB 3I9PA 3OC8A 5GRYA 3EYVB 4C4KO 1QRND 4M48H 1AGFB 5MI0C 4P9HL 1I53A 3CWTA 1B6UA 1J8HD 3TA3A 2AK4B 1NGMA 4CN6A 1FVEB 2GJZB 5GGQH 4ZS6C 4PCSA 4OCWH 2HTLD 1ZLVK 3FOLA 1ZV9A 2BNQD 2WYZA 4NNXA 4JCLA 3WFHB 4ZFOL 1FGNH 2R9HD 4BKTC 4HKZA 4PJ9B 2BVQA 3V4VH 2NUPA 1DVFA 2WWMC 3B7TA 5DTFA 1FE8L 4CA4A 5IVXE 3DECA 5BQDA 1W16A 2IADA 3GSNB 3BIAX 1GPOH 3HS0B 5IW1B 1XGTB 3NJLA 5FO7B 2YUZA 2DM3A 3PUUA 3UAJC 4PJDA 4ORGA 3D2TA 4PI2A 4JPIB 3UZEA 5IGXL 4PWHA 3QXWA 1A3LL 2OZ4H 3KL3A 4UOJA 1NMBH 3OH6A 3S3BB 5JW4R 5BZXA 3UYPB 3H2PA 4MYPA 2A6IB 1HXMB 5FB8B 4L29A 5IMOB 1T7WA 4KRPB 3GJFH 4P5MB 1BVLA 3HHRB 3SKOA 3V0JA 4KKAD 4PG2C 4RDBA 2YEZA 4JZOB 1UATA 3ZBMA 3FQNB 2PABA 4LLUB 3U0WL 3X14B 3GLDA 1CDGA 5CSBA 5JOEA 1DSFL 4M6MH 1NANH 3DV4B 1J0IA 1VFBB 3AFLA 4KVNH 4PG9B 1PZAA 3QPQC 3LHPL 1T20B 3VAEA 2AC0A 2HZMA 1RIUH 5E1QA 3PXJA 5ISZB 2IJ0C 2W60A 4L4VE 2BINA 3J7HA 1OAUH 1EO8H 2VDRH 3DX9B 3FUMA 1YUKB 3CXDH 1NCAL 2PP8A 4X6DB 5EORL 5KVDH 4PRID 1MH5A 5I5JA 3U9WA 3L2LA 3QQ4A 1CDWA 1L6XA 4WEMB 5H8DA 1W0VB 1I9IL 3POHA 3SDAB 5KVMC 3ZQXA 1DQTA 2DMKA 1KLUA 1NWOA 3RGVB 4DOHB 1WQAA 5JHBA 3EBGA 4D0CA 1NCNA 1DSYA 4WO4C 2H0EA 3GKWH 1PKQB 2WVTA 2YRPA 3ELQA 3DBXB 4HJGA 3RDJA 4YPGB 2YGNA 2F53B 1B0GA 5JDSA 1PNDA 2WCGA 4JS7A 4ZZKA 9PCYA 1QNBA 1U6AH 4JFFD 2X1QA 4WWID 1M57B 3ZGIA 4Q4EA 1E4JA 2EYTA 2EH7L 1U58A 3H7BB 3BH9A 5KSBF 4PLKD 5M94B 3HG1B 3UTSD 2DY2A 3FU7A 4L4JA 4XB8A 1R5VB 3QDME 4GBXA 1B88A 4MA3B 3ZYZA 3F10A 3QR2A 4PW3A 3HE7D 2D8KA 3B9DA 1FFNA 1EZSA 5KSAD 1RP8A 4N25A 3OJMB 1KCSH 2OPCA 4NZFA 3L3IB 1A25A 1T1XB 1T2JA 4JO4H 2V6HA 1KXVC 4IGBB 5B7EA 1T0NA 4WUKH 1DJHA 5KVGH 2V8LA 4FP8H 4M5YH 4WSGA 2HFEB 4Y5YC 5ID1B 3IGAB 3DRTA 2Q7YB 4LAJH 4N2DA 1MFCL 3C5SB 5E9AA 5JHDB 2NT0A 1OTTD 4YHIA 1E4WH 4U1IB 1NFIA 2Y7NA 2XBTA 4O02L 1NCWL 1T1ZA 3MLTA 1ZY9A 3N04A 2BP0B 4NO3B 4F33A 3GHEH 5FO8B 1S7WB 3BAYA 3MOAL 1A3RL 3VFMB 2WXIA 3FTGB 5I8OH 4R8WH 1AFVH 4ZW3A 4G8FA 1LTXA 2QMJA 2UZIH 2VMEA 3M1CA 3HZ3A 2EQDA 2JB5H 4XNQA 1P5GX 2WLKA 3N0AA 3M17B 4NLHA 1OALA 5D72L 5KVFE 2X1PA 4H0LC 5GGSB 4F92B 1ED3B 4U1LB 4CC0A 4D0DB 1H3XA 1SJHB 4WW2B 5EU6E 3J8F7 4KY1L 2HH0H 3NABL 5I17B 2RACA 3BAWA 3QUZC 3RY6A 3I02B 4L1DA 2YC1A 3FSZA 2A6KB 2CR3A 5K9QI 5KSBB 5D8JH 2GTZA 5ERWA 1K4DB 3CFBA 1XX9C 1AIFB 2Z93B 3WG7B 1LO0H 3FYIB 5KJ7E 4GP5B 4PJBB 5HYJA 1XCQB 4NM4L 1WA1X 2Z4QB 4HUNB 2G75A 2HRPL 2R1WB 4B0AA 4FNQA 1T04B 3OAUH 4AX3A 1SF5A 4WI5A 1CT8B 1G84A 2I26N 1LE5B 4XI5C 3DXAB 1F8TL 2ITDB 3BVTA 4N2OA 4DP5X 3GT6A 5ISZE 4BKLA 2QPDB 2KYIA 2F58L 2DQJH 1FBIH 2AKRA 3LQAC 4Q2ZA 2XETA 3JTSA 5HGAA 3IE9A 3I6SA 5FYLD 3Q06A 4PQXA 4BXSV 1FJ1B 1KV7A 3MJ6A 2UX6A 4JRFA 1GCYA 3ZQ9A 4B53A 3WKYA 3N41B 5I0VA 1HHGA 2QQKL 3VFUA 4P0DA 4AJVA 4DVBB 2IG2L 2Z8VC 4N1CA 5C7ZA 5HJBA 1GS8A 5L4IA 1WRFA 3K0YA 5CCGE 4WTZA 4XNMB 3KWWB 4YQXH 3GO1H 2NXYB 1DQDH 3EYSL 5BXFB 1I7UA 1LD9A 5D96C 3VH8A 2Z91A 3LKNB 3VVVA 4FTVB 1B2YA 1DBKH 3GSNA 3JXAA 4NO2B 2VDNL 4PRNA 3TONA 1U8JB 2XTJC 2F18A 3T4AC 5IB2A 1RVFL 5IMMA 1MXDA 1MHHB 3KYMB 1UYWL 5B21A 2BSTB 3WJMA 4HH9A 4BWWA 2DMCA 3LEYL 3KNBA 1XTLA 2I9TA 1E8ZA 2Z31A 1VIWA 2JCCF 4PP2A 5CEZL 4HS8H 4TLTA 4R4FH 4JDTH 4PV8A 1HHIA 2W80C 4DT2A 2XPYA 4MAZA 2DMGA 3O2VL 1GTNA 5FB8A 1ZEAL 5DRXB 1THCA 5IEKA 4F2MA 1RUPL 1AY1H 3A4DA 4HZLB 5F9DC 4JDVA 4Q11A 2ZG2A 4QNPF 5DK2B 3MI6A 1KBWA 3IJ8A 4G6FD 5EN3A 3ULVC 3BDBA 4LLWB 4CSZA 4H8WH 5AFAA 3F12A 3HS8A 1KBBA 1DVSA 4PUBL 3MROB 4W9IC 5TTRA 3ULVE 1PAMA 3MV8B 3RURA 4HPOL 2Q8BH 3MO1A 1A4KA 1E9PA 3F7PC 3N9GH 1GYUA 1RLWA 4QHMB 4ONHA 1EEYB 2GY7B 4J2QA 3HKFA 1OTSD 4LBEA 3O3DA 3K4AA 3V4VA 3VWKD 2CMRH 1O9VA 1MOEA 1LMKA 4G7QB 4YSSA 3DPTA 3C9NB 4ZTPL 2JQZA 4LNRA 1OCWL 2AEPH 4HMEA 4NZRH 1QSED 1RLBA 2F7PA 1UCBL 2BP3A 4YHPA 3STZB 1KJ3H 2H7WA 1D7CA 2X4OA 5TF1L 2V9JA 2E9GA 3CDGB 2FGTA 5KS9E 3APNA 2Y36H 2Z1KA 2J55A 2DLEA 2BP8A 4C4UA 3CQFA 2KPNA 3RWEA 5E6ZA 2MOVA 4WU5B 3D51A 3OAYK 5CINH 4DERA 3SIKA 3KGSA 1X4YA 3WN5A 2NNXA 2GT9A 3C60B 2ALAA 3W57A 2X3BA 1MFBH 4PJHF 5CLTA 5F1NB 1F00I 4G7SB 5EOTB 1RUQH 3O2WL 1T22A 1AR1D 3RWHB 3T6QC 3FSVA 3ZTJG 3AU0A 4N90E 5DJCA 4M4PA 3BAXA 4KXZI 4FDWA 1E7VA 1QEWA 4ANWA 1YEHH 1KIQB 3U7WL 1D3UA 3ZDYE 1I8KB 3ULVH 2NW3A 3PDOB 3QDMA 5I18H 3O4LA 2NLJA 1NGYA 3X3GH 2RAMA 4YSQA 3V4PA 4A6YA 5IVXA 3FU3A 1YSOA 3BKQX 1U92A 4DW2H 5DGQA 2AEWA 4U3HA 4N0FA 4XP1L 2YEVB 3AM8C 3BKJH 4PHZA 3WDJA 1K4CB 4XWOD 1NEZA 1QLEH 3QXDA 4NRZB 4I3SL 2PWEA 1T0MB 4M7JH 4UNTA 5E2WH 2VH5L 2NX5E 1PG7X 3IXAA 3QHZH 5F7MC 2VWEC 4GSUA 1UM5L 4XNQB 3DURB 3DXAE 3O41A 2DQFB 1FAIL 2F8XC 5L4JA 4RWHA 4XP4H 4BSJA 4XNYH 2IAMB 3FQXB 3HUJE 4IOSA 1EUVA 1JDCA 5E1GA 5C08D 2Q20A 3DDFA 3TTSA 3JVFC 3H3KA 3CFNA 1M1XB 1SQ2N 3IYLW 2HVKB 4X4YB 3O45A 4G2AA 3INUH 4KH9A 5C0CB 3SYQA 5F1IB 3REVB 4PJDB 1BEYL 4ATWA 5I1LA 1GSKA 2FJHB 3L2MA 3EO1B 2JPIA 1RURH 4PD4J 5FWQA 1BD2E 4FQCH 1WFMA 2BZDA 4JO1L 5I1EL 4Y0GA 5FYJH 5EU6A 4PJFF 4WEEA 2J43A 3L54A 1P4LB 4OQ1A 1YEEH 2F68X 1G6RL 4XWGL 3DXAA 2QSTA 1VSCA 2A6IA 2OW7A 4XMVA 4IIQB 2P80A 2HSIA 1ACCA 3EGXB 4CUCA 2W65B 3F7VB 4ELMA 4Z7NF 1H3PH 1UQSB 3UTTE 2PW2B 3HN3A 1KEGL 3KW8A 3HN8A 3MLZL 4XX1G 2QTVA 1HHGB 3ABGA 4POZD 1BG9A 4LSDA 5DUML 5JXAL 3QIBB 1MWAL 4O2FA 5DVMA 4QXVA 1D5MA 2FR4B 1MSPA 5AW4B 1OO2A 2V3DA 1QRKA 4JDZA 1VA9A 3P1VA 4UU9B 1QFUH 1XO8A 4ODVH 1F58H 2EXYC 2UY7B 5D7JA 1KC5H 3IFNL 3L4WA 4FAAB 4K8RL 1W0VA 1XGYL 5EZOH 1S4IA 2XXFA 1TZGH 1EZUA 1MHPL 5I74C 1SBSH 5T1LD 2Y25A 1GHFL 4KHTL 4GG6A 3GXTA 1UB6B 4PJXE 2XX1A 3QHFL 3GI9H 3G7TA 5HJDA 4PV8B 1DQQB 1TUPA 4QHKJ 5EIQA 1MELA 3KPLB 1SYVA 5DK0B 4YHKH 4HX1A 1KTDA 2FCBA 3O6KL 4FQLL 4G5ZL 4L8DA 5CS7A 5I28A 1D6VL 1R24B 4BIKA 1DN0A 4JFZH 5DJYA 3LZFL 3ISYA 4DGYL 3NA9L 1UA7A 4WTQA 3G04B 4OZFB 2GEQA 4EI5C 4D3CL 1WDAA 4R6UA 4XCFH 1X7QA 2IGTA 1PBYA 3R18A 1VKLA 3W9EA 3F62A 5J6GA 2M1KA 3ZO0A 3TBSB 4PRHA 4ODTH 3FDWA 1T7VA 1T5KA 1UENA 3H9ZA 2NY3C 4JFEE 4YO0A 4L0YA 5I6XC 4R4BB 2HMID 5ABAA 2OMYB 2W9DL 2HUEA 3L4YA 4PW4A 5AW8B 3UO8B 1RULH 4RZCA 4RESB 2KLTA 4Q58C 4YHIB 2K4WA 3ZDZF 2UWEF 4JR9H 5DC0A 1HTYA 3SPIA 1YNLH 3UBFA 4NQEE 4Q74A 1YYCA 1IFGA 2I60L 4DHLA 2CRYA 5L7XH 5TF0A 4M1DH 5D1XB 4HQQH 4UB0L 1A9BB 4WJG3 3N42F 1QTYT 1M5Q1 5D1QB 1AOZA 4L9LA 3GDCA 4XVJH 3VCLB 3GS0A 2GJZA 2EDQA 1B4JH 1BPVA 4D8PB 4JKLA 4HHGA 1GC1L 4X2UA 3OMZA 3EJPA 4KKQA 3K71A 1EHLH 1CMOA 4M4RA 3DMMA 1PCSA 2J1YA 3LDBB 1KLFA 4LCIH 1F11A 5DURD 4NI3A 3DSFL 4YR6B 4AW4A 3T08A 3VTMA 5KYWA 3JZ7A 2R5XA 2X4TB 1OW0C 3OKLB 3I6LE 3OC5A 1QSFE 2R2EA 2WVVB 3ZDYF 4XC3H 1QP1A 2EDOA 1RZKH 2WQUA 5BZDB 1U33A 2WYTA 4EAKA 2Y3AA 1LEGA 4HGWB 5EZJA 1I7TA 2YFNA 1QR1B 1U3HB 3QPKA 4P3DA 4XVUD 3U48A 3N85L 2ZOKB 4AQAB 2XU9A 4P23C 4AEEA 5HVHB 1OLZA 3EJJX 5LDUA 2FBRA 3PGCA 5E0QA 3RX8A 3CNKA 1N2RA 4R5TA 1EZLA 5E6IB 3L48A 4XAKE 4D8OA 4IU2B 4WQOA 5I2IB 1CIDA 3VXMD 4LRNH 4P2RE 2FECL 2HN7B 1GOGA 1UACH 2OXGB 2X6AA 2VMDA 4X5WB 4MCZA 3KYNB 1EAJA 3GEFA 4R0LB 4U31A 4NO2A 2CLVA 1U93A 5FKAB 5HPMA 3ATBA 5DZLA 5CCKH 3IM1A 5FM5O 4W81A 1KCRH 4Z0XB 2VR6A 3VA6A 3MN8A 4E9XA 2ODHA 3JWNC 2ZUTA 5I76A 3OHMB 3M46A 3MJ9A 4NGHH 5F6HJ 2NRDA 2EXYD 4YFLF 3A6CH 3AWEA 1YAZA 2ICWI 1JGVH 1I3GL 3E7JA 2MIZA 1Q1PA 1KELL 4PFEA 1P5UC 3G5WA 4NYLB 3LEXA 2COVD 1AAJA 1BP3B 1DP0A 3SCMD 4EAJA 3BHBB 2HLAB 2IH3B 3E1ZA 3RWIB 3KCPA 3DGDA 4MKMA 4IBUA 5DSCA 5DVNA 4YBQD 3CFEA 4HJ0C 4QRTA 2XA8H 2NPLX 2FGWL 4P4KC 3OJDA 3PWPB 1KJ2A 4KOBA 1I1FB 3C87A 2XBDA 2BVTA 4HT1L 2JCCE 1S7VB 5T3XL 2OZ4L 1DLFH 4FCHA 3GK8H 3OR7A 4XAWH 2E8ZA 2CJUH 2PTTA 4JANB 2EIZA 3BZFA 1BJ1H 2UY7A 4P46C 2K70A 3H9SE 1KB5L 3ETBF 1A2YA 4UV4L 1PZ3A 3GSQB 3P4NA 2CDFA 4RQQB 3FT1A 4M43L 4AJYV 2WQ8A 2VABA 4YHNA 1QOKA 1CF1A 4GW1B 3FN9A 4GG6B 5ECJE 3S48A 1OAXH 4FFVC 1MRFH 3KR3L 4PJAF 4QAMB 4UBDD 5T5NF 4NIKB 7FABL 5EWIH 5EA0L 2YHGA 3AXLA 4Z5RB 1IKNA 1IM3B 4JZJC 4K9EH 3VFMA 3RWEB 3AADB 1M3JA 3LZOA 4Y5YB 1RHHB 1EO8L 3QUMH 4PGBA 4ETYA 4YVNA 3UBXB 1QNZH 3MREA 3HS0C 3ILPB 4U0RB 3FO9B 3W39A 4NBZB 4JFDA 4UT7H 5T5NG 5J11C 2AAVA 1AD0A 4Y4HA 2ZNWA 1OPGH 4FZEH 3KM1A 3ARSA 4XO9A 4OCXL 4D9RD 1U95A 5I17A 4JREC 3OWEA 1HCVA 1CICC 4ETQB 3MJ7A 1NAML 2GJRA 4OZGA 5KSBA 4Y9CA 4ATTA 2PW1B 2CBTA 4Z8FL 3EYOA 4JRWA 5HYJD 4Y2OB 1EO5A 1SPDA 1HHKB 2FIKB 4AQ8A 4XR8C 4AGNA 4PJBA 2ZSWB 1G7JA 4TQPA 3NFSH 4I8DA 3D30A 1D5ZA 4O2CA 4EDXB 4HG4J 2VLKD 3VXSB 2PYED 3QUZB 3RVUD 4L05A 1D6EB 4BFBD 1IC1A 3Q8FA 1E42A 2XQYA 4FF9A 3UG4A 2X88A 3NPSB 3WIIL 4UNVA 5FXCH 3QEHB 5F0JB 3RVVD 5IJCC 1G1YA 2H1LM 3EAKA 1L0PA 3TO4A 4IU3A 3VGBA 4DO6A 2CUHA 2ZUQB 1W8NA 3FB7A 4F58H 4PJEF 4JE0A 4Y9BA 4ODHL 3QPXH 5EN2A 4PJCB 3LQMA 2BS9A 1RK7A 2LLGA 1FI8C 3GSVB 3QQ3B 3FQYA 5I6MA 2APXA 4OUUB 3NSCA 2BP5M 1YEFL 4HIEB 4J6RL 5F3HB 3G08B 5ELIA 3D5OF 4LP8A 2OMUB 1QYGH 4LP5A 1VGKB 1C8PA 3DX1A 1CGVA 1RZGA 3K74B 4MNGA 4YGVB 1S2EA 3GYRA 1KTRL 1MFAL 5F89B 3E6FA 1ZPLA 2J1ZA 2NYYC 2X1OA 1EJ8A 3MTXA 3BWUF 3OHXB 1BZDA 3PL6B 5B38B 4IMKA 3LH2L 4QTIH 4G8IA 3T3MB 1Z9SB 3QWRA 1HWWA 3P54A 1X5HA 4L8SB 4NCDA 1NDGB 4XE5B 3JWOH 5HVWA 1JWUA 4A37A 3PP3K 1RSFA 1T66D 1MY7A 5IIEA 1T03H 5D9SA 5CR1A 1KIRB 3QZOA 4PI0A 4LE8A 2VDKB 1THAA 1QABA 1UWXK 4P2YA 2P52A 3RIFF 3V0EA 1PF3A 1GXEA 2NOEA 2ESVD 3H9HA 2QSCH 4JDZB 5K9QG 1IT9H 1SM3H 2ZX9A 3HTLX 2VN6A 4M3JA 1AQDA 3VFSA 1JI1A 1JZHA 4P2CG 4OQTH 4P59L 4ONHB 3RWDB 4JY6B 2RH0A 3U6XS 3WKNA 3D85D 4UT6H 2XTJD 4LSVH 4WFED 3QORA 4KROB 2ZG3A 3K8LA 3ZVVA 1VKXA 3HBZA 4LARH 1V55B 2MPAH 4TVSa 4JM2F 1M56B 2FHCA 3MLTB 4LRIA 3RVTD 1O7VA 1C5DB 3QO1B 4LFHD 2V17L 2AJUL 3OAYH 4IBYA 4X42A 2A9ML 3LQZB 4YHPB 1OP5H 5K9OA 3O9WC 2WGXA 4OAWA 1Z2KA 5IESH 1DSWA 1OQOA 4PGDB 3EYSH 5KSUA 5BOJA 2YN5A 4L8DB 3D06A 3BVXA 4YHZH 5GGUA 4CJ1A 4RH4A 2DWSA 3HZYA 1DBJL 4OGXH 5AVTB 3S5LB 4LGSB 3CH1A 3CFEB 2PR4H 3C60A 3ZE2E 3D2UB 5DQDH 1HCZA 1HFUA 1Y6NR 2D9QB 1KGWA 4LHUA 2OSLA 4XI5D 1U8MA 1IAII 2W5PA 3NJHA 5CEYA 5A2CA 5AAPA 1NKOA 1JZ5A 1U8KA 4R4FL 4HFUH 4V1DE 1QI3A 3CSBA 1UWGL 2Z92A 1K6QL 3TP4A 3OZ9H 1YPZE 4X83A 4X9FA 3WSQL 1OQXA 3GI8L 3EJQA 4NZ8A 3ERXA 3KPSB 3LKOA 5IVXF 1QKZH 1HAWA 1N39A 1GL4B 3U6RA 1Q0XH 4AYFA 3TN0B 3D6GA 4IEFA 3QUZD 5CJ8A 1G0DA 4BBWA 2IO5A 4L1HA 4BRVA 2QVKA 5GRUL 3D08A 2ZOLB 1MN4A 3SDXF 1HKLL 1FNHA 1RFDL 2E9JA 1G7PA 3OQ3B 2QT6A 4MX7B 1CDUA 3PCYA 2XFGB 3K5SA 1N0XH 1G0YR 1G7IB 5D7JC 4DTGL 1BGXL 5HI5C 2WB1A 5FUCC 3WY1A 3KS0J 5BV7C 3TJHC 1OAQL 4ALAC 2HTLC 4WSJA 4QY8B 1KCWA 3L17A 4EQ2A 3GIZL 1OSPL 3Q5OA 4S1SH 3B9AA 3BD5A 1SDDA 2CUMA 4M48L 3KYKH 3BEWB 4H4NA 2WTOA 1XQ4A 4JKWA 1TFHA 5HI4D 3VXTA 3PAZA 2APWA 5TDPB 5GZOA 2R0WL 5HHOA 4WHDA 4G80B 3HE6B 2XG4A 4PRIB 3C08L 1JTPA 3S37H 4AIZB 1BVOA 3EO9L 4P2QE 1MZYA 1L3WA 3KLAA 4U1JA 3UBXI 2I9TB 2K9UA 3CUPA 3CMOL 4AV0A 3TIDB 5DRNA 3S88L 3NACL 4LLMA 3FU8A 2IGFH 4PVMA 5AB0A 1YQKA 1A0QH 5L2KB 3F04A 3I74A 1NPNA 3SPGA 3B2XA 1JNNH 3LZRA 2EVGA 4JRYA 1YMHB 4X6DE 1CGUA 4BZ2H 3WDHA 1TQBC 3IPBA 1P69B 2A74A 3ISRA 4QGYA 2VISA 1NMBL 4OJFL 4OJEH 2WLNA 2OI9C 2HN7A 5F1SA 4NC1C 3SDYL 2Y8QA 2EDBA 3SSGA 4K15A 1MLBA 3HC4L 4LHUD 4X5WA 1TLKA 5FHBH 1QVOA 3X3GL 3MV8A 1ZT7B 2AJXL 2O6CA 4PRDA 1BAWA 4WU7A 3MHZA 4FFZA 1TJXA 4PJ8D 4XXWA 3U0WH 5DQ9A 2WLZA 2WXGA 4XP6L 4RVBA 1EZVY 5C0FA 2RD0A 1OGSA 3QB7C 4JRXA 3QFJE 4B95C 1U3NA 4I3SH 1HESA 2AV1B 4BWTA 3B7UX 3LHPH 5E9NA 4P5RA 1PD6A 4FQJL 1FORH 3CHXA 3TX4A 5EU5A 3C75A 1FYTB 3CFJA 3CVDA 4XPGL 3Q1SH 4K8RC 1FAIH 5GRJL 3QULB 3NFNA 3QI9C 4PJ5B 4H20L 2AJYH 43CAB 5A3ID 1IGCH 1PZDA 2GFBA 3F2LA 2Q86B 1WFJA 3T8XA 3T3MF 1S3KL 1TZIA 2FB4H 2L4OA 5DJXA 1JDAA 2VR9A 4WU5A 3KPLA 5DK0A 2NUTB 3WY3A 3EXJA 2WANA 2FZ3A 1R9FA 2G4GA 3SBPA 2XN9B 43C9B 1QBLL 1ZHNB 1LWRA 5KYUB 2VDLH 4KKAC 4BUQA 4ERSL 5DJYB 2JKLA 1CDYA 4LIQH 5KS9B 5CIPA 4LLVA 4JO1H 3BO8B 3RE0A 3H9HB 3S35L 4M7ZC 1FNGA 3AACA 4PGCA 2VQTA 4X6EA 2FT6A 3HMWH 1JV5A 1BAFH 2ZUVA 3AB0C 4PJEE 4M3KB 2GVYA 4X5RA 3QG7L 4YIQA 4F8NA 1TU2B 4PRBB 3LN9A 2O5XH 3PHOA 4MBOA 3UAJD 1KY6A 2OL3B 4XO3A 4JFSA 4PEEA 2IPUG 1QO3B 4POYA 1EA9C 1YEWA 1G7LB 5EU4B 1BLNB 1XF2A 1PG7H 2H0JA 4LL9A 4UOW1 1PEWA 4RDQG 1FL6A 4ZYKA 1DEEA 4NKQB 2CO2A 5MEPA 1TQUA 1WBYB 2Q6WA 1HEHC 2R9HC 4NRZA 3KAAA 5J12C 3U25A 1N10A 2B3IA 5D7KD 2R7EA 1OAJA 4WHTA 5E8OA 5DEGA 1SMAA 2MCPH 1VTLE 2FJFA 2IFFH 3V2AR 1UZGA 2Z0FA 1PNCA 3N1GC 3TF4A 4PVBA 4YHLL 4X6CE 5FFGA 4JFXB 3GXMA 5CZRA 2G0LA 3WU1A 4OZGB 4IRZH 3BWSA 1BOYA 4TQIA 1QI4A 2DLTA 5DUBB 1FN7A 1X44A 2XLLA 2JB5L 3RI5F 4PB0H 3KPOA 2COQA 3H1ZA 3REVA 4N0RA 4QRRD 2D3NA 3QJRB 3KBHE 5IROA 4ENED 4AIEA 5JYMA 1Z9OA 3HHMA 5EU6B 1H3WM 1UB5B 4MMXB 2VLJE 1UA6L 2FQDA 2R2BA 5TGBA 2OYKA 2IAAC 3SYOA 5IHBA 4JFUA 3AS1A 3BN9D 3VWKB 4PV1C 1KZYA 3L5XL 3UJTL 2XC8A 5LN8A 5F0PB 4JM2C 3PG2A 4IKLA 1RV6X 1DVFC 2HJFA 4N68A 1SLXA 2L8AA 4HD5A 3QRGH 3KJ6L 3DSNB 5E8PA 5KBKA 2Z35A 1PX8A 3VFWA 2LR4A 4Y5XA 3WY4A 3SB3A 1TDQA 3CZKA 3I9IA 3VX0A 1YA5A 2YPVL 3FT0A 1UVQA 4YSAA 3R1GH 4O2FB 3O0RH 1YTFA 3NGBB 4B0MM 2YA2A 1TSHA 2BSRA 5FHAH 4PJ9A 1I31A 1KNOB 3O11A 1NGQH 2BMKB 1SUJA 2C1OA 3KWXA 5IWLC 3KH4A 4M5SA 1V7ML 5TDPA 1LO5B 4JZJA 2YXVA 3GEWB 2Z64C 4G7YL 3SODB 4HJTA 3E6FB 5ICXB 1G9NC 3X13A 2BWIA 1QN6A 1J3MA 4YQXL 3GBML 2GSIB 4JAMA 4M00A 4X8JA 4YHOH 5DJ0A 5FYJU 2BVUA 3VQLA 1QLFA 1X5AA 2E9IA 4X8CA 4IRSD 1M7DA 1CIUA 1D7DA 1DBKL 3PDGA 3BRGC 3K2KA 1GC1H 2DWXA 3TBYA 5AL0A 1FP5A 5E00A 2F0CA 1QI5A 4AYID 1NL0L 1G43A 3GBDA 3CLEH 2XZQH 4OFQA 4RFNB 3OKNA 3CSFA 3H53A 4JPKL 4L0PB 1A1NB 5E03A 1FZMB 4G8GD 1KY7A 4KZDH 4JFOB 3U79A 1CC3A 4N2BA 4XC3L 1FYHB 3LXBA 2QPUA 2AITA 4KRPC 4MJIA 4M7LL 4AQ1C 1BFOB 2VTFA 4WO4A 2ENPA 3GZKA 3V4UL 5I5RA 2BHFA 3MNVB 5J6GB 4JB9L 2YXFA 1VPOH 4OLZL 5AQ0A 4HWEH 4X6DA 3HB3D 1Z7JA 3HFFA 4FQXD 5E2JA 3EH2A 4E68A 1GAFH 2FDBP 2UY6B 3CFDB 2NX5D 3ZUCA 2VDQH 2JJWA 5FGRA 4DKAA 3ASMA 3L2NA 4XPAL 3UPRA 5J3HD 3DXAD 1I1AC 1SUHA 4ZPTA 4AITA 3CDZB 4Y1SA 5E1HB 5IB3A 4HJGB 3S3JA 2CCLA 3JVGC 3MV8E 4KO5A 1RZKC 2YD4A 3H42L 2K7QA 2B0SL 3D4CA 3D8MA 1SOKA 4YDKL 3LPPA 4QRUB 3GSWB 4RMWA 4DULA 4K2UH 2E74C 1AE6H 1C16B 1W72H 4MJIE 3D52A 4HXAH 4Z7OB 4IOIA 5IQNA 1U41A 4WCYH 3PL6D 1WGVA 1AKJB 3VXME 4M8VA 3ILPA 4MXWL 3FU7B 2DKUA 2CLZB 5DMGD 4ZUSA 1QFOA 4UAOB 1FHGA 5JMRA 2ZXBA 5HHMD 5KBPA 3VGGA 3V6FB 4I2XA 3MRCA 1JF1A 4JW3A 4AYMC 5JOPD 3US0A 1GS7A 4FULA 4NGHL 3CE1A 5CXPA 4C56D 3CHOA 3Q01A 4FG4A 4F9PA 3UTSE 2W9EL 4FNLL 1JGVL 1I3GH 1XR8A 4JG9A 4AH2B 1TQTA 2MJWA 4N87A 3WGUB 3VSVA 1FZOB 5CBEA 2Y5EA 2C3VB 3CQPA 1O5DT 1ETZB 3EJYD 4GIAA 5F7DB 3RZWA 4L5FE 5H4ZA 5IHZB 1CXEA 1KXTA 3ALXA 1QACA 1FHNA 2BOBA 3CIAA 4G3YL 2WXPA 1CBVL 1RHFA 5CSZB 3U6RB 1RUQL 4HIIB 1BLNA 5AZUA 5JHDA 1XF2B 2WUBH 5JW3H 5FW6A 1LQSR 3HUJB 5KWYC 3S8FB 2FE0A 4DFIA 1SDAB 1T1ZB 5HHOE 1GYVA 2FNBA 2ZJSL 5SWQB 1LO3H 1HL8A 3QDGB 2WO3B 2GUYA 3VB9A 3MRRB 3GK8L 4GAGH 3IMTA 3B2PA 1LP9F 5B1AB 2DJMA 3TBTB 4HAKA 4JJOA 1F0LA 1T7XA 3MBEC 5JUEL 1P7KA 3Q8BA 2P5WB 2PXYA 1GGBL 3FZUD 3TASA 3ZRSA 2IG2H 1DQVA 1QLEL 1AISA 4AL8L 4RRPM 3MV7A 4R2GB 5F3HA 5GS1A 4NUJB 2OCCB 4QWWD 4OVUA 4Q0XL 1V3JA 1WYJA 3CW7A 5K9KA 4FA6A 1N8ZA 5G5DB 2EECA 5DMYA 2OA9A 2YA1A 4XNYL 5E2VL 4NCC1 5DZAA 5EG6C 5KUMA 3U9PL 3JTBA 4OY9A 2QADC 3CBKB 2R1WA 3WMPA 1LP9A 2KHAA 4JHWH 2K78A 4EZKA 2ADJA 3NK4A 1GGUA 2DQTL 3LEYH 4TUUA 4TLUA 4GBXC 2G9KA 1OPGL 4FZEL 3VWKA 5BRPA 2DEXX 2Y6TE 4OCXH 5KSBE 5C0CE 3MDJA 5KEZA 2BO0A 4YXHL 4B3VA 2G3XA 3OAZH 4JY4B 3NBNA 1NAMH 3VDAA 2A74B 1UD8A 3T0EE 4PY5A 2VWEE 5ISZD 4JQIA 2YSSA 3VGAC 1AY1L 2N01B 2P8LA 1U21A 3II2A 4QIRA 5DLLA 5LAPA 4BA0A 1BWMA 2VRAA 3DK2A 5FYLE 5FO9B 2ZXDA 5T33H 1EDHA 4XC1H 1Y0LA 1ZK5A 2R0LH 2ATAA 1CL7L 1AQKH 3WFEL 3OPUA 4PRPB 3CVHA 2CU9A 1OIOA 3MACH 5HHQA 5FYKD 5HGBA 3QJXA 4JRYD 4GQQA 1QTSA 3QZPA 1BVNT 1G7HB 1M7XA 1TJHH 3HZMB 1GC1C 3NJKA 2XVGA 3VMOA 5I5MA 5C8JA 3MRGA 4E9LA 3L3JB 2FVNA 4Z3TA 3ZSTA 1HYSD 2B4CL 5G4OA 2C34A 1RAMA 3FT3A 3NFNB 2NR6C 4PLJC 2R15A 4PJ5A 3QA3A 5D2NC 2VDOB 5AZ2L 2MNWA 4R4NC 4YDNA 2EZ0D 1IM3A 4P9HH 3MCKB 3MKKA 2K3HA 2EILB 1HZLA 1OGAA 4NI6A 1NANI 3CN1A 3PWUB 1JK8A 2VYRE 3I6LD 3L08A 2MTAA 1CICB 3DX8B 3QC5X 2RR3A 2E7DA 1XH3A 4WI8A 4CBPA 1XR9A 4EJ1C 2AJVL 3TZVA 2BIHA 1FGNL 3EAYA 1CFBA 4JFOA 1H5BB 5J1AA 3R8QA 3CVIL 4A2MA 1MUJB 5GRZA 3DIDA 4YHML 5LXGL 1SXSA 1AHMA 4YLQT 2JMRA 3MLVL 3P30L 3HJEA 2KZWA 1GPOL 2ERJC 2IQ9L 3VSQA 4KJWC 2DQHH 3CPLA 1FZJB 2GJ6D 3EGDA 1BF2A 4UQ9A 3OLGA 4QTIL 3ILDA 2NOFA 3CFDA 3GB7A 5IB1A 1A3LH 1CGWA 5B1CA 1YEHL 5CEZD 1NH2A 1YMME 4PJGE 3WENA 4D3CH 1EK3A 3QUZA 1PJWA 2NLVA 3RY5A 4KI1A 1T03L 2XT1B 2UV3A 4NUGH 5EOCH 5PCYA 3WY2A 3RB7A 1NA8A 3RDTA 3V52H 2AAAA 4NHUB 4GI6A 1CDCA 4TMPA 3DUHA 2Q7AA 5C0BE 2IWGA 4G11A 3CC5A 1G7PB 1RULL 2NXYD 4WEBH 2VQ1A 5ANMB 2X4SA 3VXNB 1MI5B 2EDHA 5LBVA 1CYWA 1F4YH 1FVEA 2WO4A 4OCNC 5FYKU 3U9UB 2FO8A 4HSQA 1OAUL 2VDRL 4R97C 4J3SA 4UT6L 2ESVE 4HKZB 1ACZA 1DBBH 1CGTA 5GZOD 1CR9H 2Z31C 2GK0B 3AT0A 1MF2H 1R47A 5EHFA 3D25B 5AW9B 3HC0A 1LXMA 5JORB 5DWUL 4KKZA 4Z7WE 1SLUA 3K1KC 4I9WD 4ZFQA 5K39B 1IGIL 1W80A 4A6YH 5IB4B 2WQXA 1L6PA 5B7FA 1F4HA 4I2XE 4QXGH 1I3RA 3CUPB 3B2UD 5IVXB 4OGXL 1HVXA 2V7NB 3LKSA 3O0LA 3TNNA 4JJHA 4DVRH 3T2LA 2TRYA 2A2QT 1JOIA 4HU2A 2Y23A 3O3EA 2HJFB 1A8JH 4KFMA 4GLRI 5SWQA 3WIAA 2PMZA 4YC2B 3NZSA 5CLXA 5DJ2A 3IH7A 1WA2X 1QN9A 3KPPA 4RWYH 3KYAA 4MQ7A 3F05A 1JD7A 1D5BB 1A6UL 4JPQA 4A1RA 4BH7B 4AJWA 2C3HA 2BDNL 3CBRA 2K45A 1FDLL 1S7TB 2VDPH 3NP4A 5MEQA 3WTTA 3MLZH 4Q97A 4JG0L 2GYSA 3OR6A 1UKQA 2J44A 3HE7B 4MMZC 2WZPA 5I73B 1BZ9A 2P3YA 2IEPA 2XJLA 5AVVB 2MHAA 2NYZA 4DPBX 1ETA1 4P07A 4E36A 3HG0A 5EDSA 3DHMA 3CXHJ 3E38A 4X4YA 5BRZE 3RFZA 2XOTA 3V5DA 5K59F 3H9YA 3FU6A 4PRHD 5TK2A 4HC1A 3MJ9L 3JT2A 1GMIA 4IOFD 2ZCHH 4DETA 1LO2H 2CGZA 4K8RH 5JTWA 1TUOA 3UTTB 3K2UH 4A2LA 2C1PB 4K5OA 5J4MA 3IAPA 2FHBA 1HK6A 1A3RH 3WN5C 1AFVL 3IJSB 4XHJC 4FFWD 1YECH 3QEQE 1CK0H 4QRPB 3V5KB 5ICYB 1G94A 1HHHB 4RSVA 3FSOA 5ITFB 2BPBA 2DV6A 3ARGD 3GMQB 3GZQA 3EDJA 4J6IA 2F8IA 1NCHA 2BHYA 4OF8A 2R0WH 3PU7A 4X7EC 3CH1B 5G4NA 2ZXWB 5HGGS 3QEUB 4Q4IA 4C8XA 3DO7B 1GZHA 4I1NB 3MXVH 3HG2A 4OI7A 4DNLA 1UM4L 4YXKH 5LG6A 1D5MB 1MWAB 4E9TA 1MFUA 1LO0L 2W1NA 3ESMA 1UT9A 5B1JC 2QZQA 2BSSB 1LK3L 4IGBA 2V5SA 2OULB 5DHVA 1ZSHA 4YAQB 3VB8A 4N5EC 2Z7WA 2FO4A 5AYUH 5LBSA 2Q0ZX 5F3FA 4UINL 3QJFA 1EFXD 4K07A 1WK0A 2F58H 4K3EH 4XOEA 1PLCA 4QKXB 2AMUA 2OKMA 4BFKA 2ADGB 5K93A 1DEEB 4BJUA 2BOCA 3OLEA 3N1MC 3FH5A 4N8CH 5FOJA 5C09E 5FAAA 4AMXA 5I8CB 4AE0A 5A2KH 1HOEA 2PPDA 1D5IL 4YK4B 5HYSB 2HZHA 4XP6H 2MOGA 2XWTB 3OKMA 3NEOA 3VG0H 4ZMOA 5C9JA 4KNSA 4JJ5B 4P5TB 2PCXA 3X17A 5F9WB 2H2PD 5I75C 12E8L 5I1GL 2EEXA 1C1EH 1KBGH 3GSNL 2PTUA 3DRQA 4NCC2 4Z7VA 2YC1B 2TSBA 1FUNA 5GRJH 1RVFH 1XCTB 4QTHA 2JVUA 1UXLA 3CFBB 2NY6B 5C0IA 4NBYB 2Y1VA 4P04A 1H8SA 4UT7L 5I8EB 1KXTB 4L18A 1NIEA 4KQ3L 4JHVA 2P24B 1Z9NA 5CSZA 1U2YA 1LYQA 3PWPD 4DP1X 4GUCA 4L9LC 4PY8J 4Z78B 1XH2A 2VLRD 5DRNB 1ANUA 2JE8A 3RDTD 2WHVA 4W4OC 4GAYA 3VUAA 4AL8C 2OI9B 4APXA 1NTDA 2GBTA 3QRFM 4IBTA 4LIQL 4KKLC 4L29B 3D18A 4V33A 1HI6A 4CSTA 1E43A 5T3XE 3IDNB 1OD9A 2Y07L 3PNWA 5GGVY 3QCTH 3V95A 4JQIL 2NY0B 4JFPA 5CD3A 5DR5H 1EPFA 4TPRL 4IRJB 3TV3H 2H3NB 5ETUB 1Q9WB 1OGPA 3DOHA 1UG9A 1M71A 2O5XL 2GCYB 3TEWA 1W6LA 1G9EA 2AK4D 2YOCA 2X2IA 5JIQA 5D5MB 3PMGA 1WZAA 3PFQA 1S7XA 5C0BA 1T4KA 1UACL 3IDIA 4QEGA 1K8DA 1XGTA 2EKSB 5DHYB 2HT2C 4PRNB 3U4BH 5CZXD 2R39A 4OFYD 2VO8A 4Y4KC 1ZVHA 3LB6C 5C0GA 3OZLA 2FKMX 4HH9B 4XXCC 4A67A 1R3KB 3T2NL 1LEGB 4PIBA 4DCQB 1I8AA 3AXHA 2MCPL 5HHXH 2QREA 1T6BX 4Y2NA 1NM4A 4FFWC 4QT5B 3V9CA 4HPYH 3B2DC 3MV9E 2WZ0A 5H94B 4G7VL 3MR9A 1JXFA 3T4NA 3H2QA 4L5FL 1KELH 2CO1A 1YEJL 3LSOB 5D2LA 4BFJA 2GBUA 5E9DA 2EYTB 4IBWA 4WWKA 5CP7A 2GTWB 4IMLA 1ESOA 2X42A 2H5UA 1RXLA 1U58B 1DANT 1SY6L 1ZHNA 5KYUA 4XWOC 3VQMA 2IQAA 4RGMC 5E8NB 5TDNB 5D93C 1FZMA 4GEJA 3J2PA 4KRMB 2HVBA 2BWQA 1ET5A 1DVUA 3PIQB 1Y0LB 3F12B 2QADB 5EU7E 1HEZA 5EO0B 3P2TA 3HE7A 4J1UA 1KT2A 5DS2A 1IC7H 3TLRA 3MRFA 3V4PL 1P5UA 1M53A 4YIQB 4PGZA 2XVKA 2V0AA 4LSQL 5INCA 1JZGA 3CK0L 2H5AX 2C9VA 1HIML 2X7LA 1B2WH 3CFUA 3SE3A 4GSQA 4RISH 1OZTG 4UV4H 2PLTA 2C9XA 3FT3B 4LNRB 4ZPTB 3H0TB 4OT1H 1BECA 4N26A 4LF3B 4ZW6A 1C7SA 4W9HC 4GT0A 5K9JH 4L8CA 4CC4C 4M7JL 4DP2X 3IFLL 3VFOB 3OPZH 2JNZA 4TQHA 1TT6A 3F58L 4NSKA 1KIPB 4XB7A 4HFWB 3OGOE 2BH0A 3GMQA 1I1AB 3EADA 1W72A 2X09A 3NIGB 3ZDYB 2ZWNA 2F19L 1OW0A 3HLAA 2CO6B 4CDGC 3IVKA 3QUML 2A77L 4XPHL 4ZUSB 3N40F 1WUZA 4TNWF 4ZTOH 2YAHA 2N4IA 4P9MH 3EBAA 3OKDB 1BMWA 2FX8H 3GXDA 3K91A 3FCSB 4NN6B 5TE7H 4BCYA 1G7QA 4H25A 2OW6A 4FA7B 1S7VA 4J3OH 3IDMB 4GRMB 1PW3A 3S97C 3BGMB 4HJIA 4HYTB 4XP5H 4A63A 3VWKC 4GG6F 2WAQA 2AZAA 4LU5L 3AREB 1IEAB 5I1EH 3X11A 3GTNA 4XGZA 2OR8A 1WAAA 4RAVA 2YEQA 3P4NB 1YNKL 3Q8AA 1DBAL 3DRTB 3QH3B 5D5MF 1J5OL 5IQLA 3UFIA 2ESVA 5F9AC 3T3PE 5A2FA 1CI5A 2ITDA 5AYTA 1RU9L 3RDTB 2XX0A 2WIMA 5GISH 5F7KC 4HFUL 5MEOB 4EMZA 5FOBA 1PIFA 1TR7A 2XWXA 3L9BA 4HEPA 4RNRA 3GSXB 5ESAA 4B97A 2VLMD 3GHBL 4WWNA 4DK3A 4RODB 5CR8A 4JRLA 1OCOB 1RHHA 2N0KA 3P0YL 4N2MA 4PGBB 1JYXA 3UBXA 1L9QA 3VFUB 2YKLL 1GAFL 4DUVA 1ASPA 1UZ6F 3EFFB 4FFYA 5CILH 5A6MA 2JIXB 1JFQL 4Y19A 4UT9A 1W15A 4IBZA 2E6JA 1HNYA 1QR4A 1T80A 3PY9A 3TEXA 1MFNA 3X1NA 1F58L 3P73A 3IJYA 3Q3GA 3FOMB 4NJAL 5L0QB 3VM7A 4FTVA 1YHPA 1U8CB 4E9YA 3MZTA 3WTWA 4Z3IA 3TA3D 1F86A 4BINA 5EU7C 5JORA 4CADA 1NOFA 3WKMH 4HS3A 4LCYB 3L4TA 1XCQA 3CN3A 4W9DC 4F7TB 2ZTBA 2AV7A 3TBWB 4X9BA 5CMAA 5EZLA 3SKUD 3VNYA 1T1YA 2YD5A 2YPLE 4KXZH 3GMLB 4Z7UE 5HJGA 1MCLA 1UZ8A 3OKYA 1U8HA 4UOW0 5DDHB 1HOCA 4Q2ZB 2XACC 4M29A 3K80A 1HWGB 3CHPA 1WTLA 1HQ4A 4JQXA 4NWUH 3UOAB 3OKNB 5CLWA 1AGCA 1IIIA 3S7GA 4Z7WB 3UACA 2CIKB 4ZQKA 5DC2A 3WS3B 2DYSB 3TVMC 3UYRL 5CD3B 2OR9H 2F5AH 4AGQA 3NPSC 3D09A 4JRXE 5LGYA 5C70A 1RK0A 4WTXA 1A1MA 1PZ2A 3MROA 5A43C 4Y2DD 4M3HA 4FQHA 3ZKMC 5KYYB 4FL4C 5I15L 3P3YA 4G8GA 5E8DH 4YWGL 4KGLA 1SN5A 4PB9H 3V5DB 4GKOA 1UXMA 4WKXA 1F6FB 1X6NA 4FG6C 1A5FH 5DZNA 2VXQA 1J9CT 3ARQA 1RCYA 4P49A 3HC4H 4TNGA 2VB5A 1XGRB 1ZS2A 1UT7A 3BPNB 3KNBB 3VWJD 4DKDC 1LE9A 4F15B 5IB3B 2ISDA 4PY7A 3S37X 4UAOC 4NWTL 4NPKA 4ABVA 1OT2A 1P7QB 1JXJA 3C5JB 4WWKD 5D2NE 1JYNA 4KUZL 1V5JA 1ZLSL 1OGAB 3IGKA 3VH8G 5L0QC 1NCDH 1CDHA 1CICA 3DX8A 4HUKB 1P1ZA 4I0CC 1EBMA 1FL5A 4M5TA 4Y16A 3Q1SL 1NAKL 2IMMA 5C7XL 3O3BB 3EJCA 1R24A 2LAAA 4JFHD 4N3UA 3PWJA 1V54B 3NCBB 2R23B 1MCOL 2WN2A 3IPFA 3TN0D 4OFKA 4I77L 5CZVL 3GMMA 1DQLL 4JK0D 4JHWL 4DP6X 3BZEB 4M93B 5ALBL 4S10A 4R5VA 4LRIC 1IBDA 3TTYA 1M9WA 2DQTH 2CKBB 4DGVL 3US1A 4PBXA 4PRAA 5E2TL 4A66A 1ETZA 3CDFA 4RGOL 3T0EA 5CEXA 3DOSB 4NERA 4UOZA 5E6UB 3DWTA 1EBPA 4X9GA 3MOBL 3L3KB 5H37G 2FJUB 1AHWA 2WJ5A 1U92B 4B9ZA 2DBLH 1ZVNA 4L4TB 1XAKA 1QUPA 3D39E 3DO3A 2G0KA 1JDDA 5F93C 2P42B 2R0LL 4AEIH 2C7FA 2J56A 2DIJA 1JZIA 3IXAB 5AOKA 3K1DA 5EO9A 1OK0A 5F9CA 2OMWA 3FU0A 4QO1B 3S36X 4ZBJA 1L9NA 4OF0A 3DETD 3CN0A 5DFAA 2YD2A 4JJ5A 4P5TA 3B2VH 4QRSA 3BT2L 1L7TH 2HG5B 1OAZH 3N3EA 2EDNA 1UOWA 4H2AA 1OP3K 5F1NA 3I9AA 3ZQWA 2B5IB 1P84J 5CFHA 3GXFA 4HOZA 1XSOA 4GUOA 4NQTA 4K71B 4XODA 1CLOH 4R9HA 4IDLA 4LSTL 4YN3A 3V6OE 3KWUA 1KIQA 1A8ZA 4KBPA 2EDEA 1N7MH 3BP7A 4MD4B 5D71L 2ICES 4PJ6A 1P1VA 4LCWA 1OTTC 4X5XA 3C08H 3S37L 1DQMH 5GIRA 3FZUC 3UX9B 2V7NA 1A6AB 2YLKA 3NFPA 4OJCA 1GZQA 1XEUA 3AQYA 3MCG1 1MCNA 1RK1A 1ZV5A 3EHBC 2D0CA 4QXTB 3UTOA 1BZOA 1XD1A 2XXCB 3FH8A 1FVDA 4IGBC 1P6FA 2FGWH 1JRHL 3NZ8B 3O6MH 1YMMA 4I18B 3QNFA 5H4YA 1D9KD 3ZXAC 1BF8A 2ZP9A 2WZPD 1IE5A