1KY6A

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
molecule keywords ALPHA-ADAPTIN C
molecule tags Endocytosis/exocytosis
source organism Mus musculus
total genus 65
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky6A02
1KYFA 1TGHA 1R4XA 3ASMA 1GYWA 1QN9A 3VN5A 5IYCP 1GYVA 2IV8A 2DWYA 1MP9A 3OC3C 1D3UA 1QNEA 1QTSA 2MJ7A 3HS9A 1VTLE 2Z8UA 1GYUA 1OM9A 1KY6A 4BCXA 1VOKA 3OCIA 1KYUA 1P4UA 2A7BA 1NGMA 2D0AA 2IV9A 1RM1A 3H1ZA 1QNCA 5CN1A 4RODB 1NVPA 2YMTA 2E9GA 5IYDP 4B0AA 1B9KA 1W80A 2DWXA 1VTOA 1JFIC 3ZY7A 1IU1A 2VJ0A 1NA8A 5IYBP 1KY7A 3EIKA 4ROCB 1C9BB 3ZHFA 3HS8A 1PCZA 1KYDA 1QN5A 1E42A 1YTBA 1QN3A 4WZSD 3MNMA 1QN4A 1VOLB 1QN6A 1PZDA 1QTPA 2G30A 1YTFA 5CN2A 1CDWA 1QN8A 4ROEB 4PY5A 1TBAB 1QN7A 2D0CA 1QNBA 1NH2A 1QNAA 2D0BA 1AISA 1TBPA
chains in the Genus database with same CATH superfamily
4WHTA 4LVHB 4XCYB 3EJSA 1WZLA 1CK0H 1CF1A 4MCYB 4WSGA 1W72H 3IRPX 3SODB 4C58B 1A7PL 2GK0B 2GYSA 4ZW6A 4HIXL 5EA0L 2PPAA 1BM7A 3WFHB 1Q0XL 1SEQL 1UWGL 4MJ6B 4JRXD 2CBTA 3UGEA 3NSXA 4PRPD 3KYMA 4GFTB 3APCA 1L0QA 2J5WA 3D50A 4JREC 1BVKA 4EZJA 1BGXL 4NSKA 4JZJC 4LP4A 4XTRC 3B5TA 1WBXB 4EKJA 4I5BA 1SPDA 1WFTA 4XE0A 4QO1B 4HLZG 4PB9L 1E28B 2XG4A 1P4BH 4HPOL 2QSQA 2WBJC 3LKOA 2C5DC 5IESH 3MRQA 3HS0B 3QNXB 4HIHA 4DEUA 1CTOA 2WYZA 5KSAC 4AT6A 4K23L 2VE6B 3K74B 2R8SH 1CXKA 3R1GH 1T1WB 2VDRH 4FP8H 4L1BA 5ICXA 1A7BA 1WHOA 5JXAH 2WTRB 3BIBX 4OJCA 4MB3A 4Y5XC 1CF8L 2VLRE 1OTSD 1F18A 1YPZB 4YHYC 5L7XL 4HZAA 4U4IA 3MI6A 1F6FB 1QFPA 2DMBA 1BVNT 5F3FA 2WJ5A 5A2JH 1OAYL 5CN3A 3RIAK 2ED9A 1IAKB 5EF0A 4AMXA 7PCYA 4BZ2L 4H0HB 4PJEE 1CICD 1H5BC 2M83A 3MRFB 3HE7C 1FN7A 9CGTA 2NY0C 2EH8L 4UBDD 1D5IH 2XXFA 5IMLB 1BFOB 4HP5A 4JQVC 3H0TB 4X6BA 1F86A 5IQ9A 1JMXA 4JN1L 4Y1AA 5EU6A 5HI3D 1U8KA 4AIZA 4LLVA 2VW6A 2NW2A 4PJDF 5F7WC 4F3FB 3TT3H 2NSMA 4IJ3C 4YIQA 1I1FA 4RGMB 1YTBA 1Z1WA 1R34A 4MTMA 4B41A 1QRKA 5I8CB 4U7KA 1C5CL 3FB7B 2YXVA 3L3HA 3P3YA 2WVVB 2D7MA 4ODUA 2HN7B 1BZ9B 2A6JB 1A6WL 4NZTL 4L8SB 4BE5A 1TIUA 5MEOB 5MEND 5LBSL 4F58L 2P80A 3NIDF 1YEKL 2F5AL 5GIRA 5BV7B 3IU4L 2E56A 1T7XA 2O5NA 1MFVA 4N2FA 4DUVA 1LWWA 3PJLA 1HKFA 4ZFFB 4OAWB 5FV2A 4FOMA 2BZCA 4IM8A 1U30A 4AQZA 5CSGA 1YC8A 2YK1H 5HGGS 4J3VA 5GS0C 2LFEA 3JYBA 4Q6IB 5TE7L 5BRZA 3GMRA 4U6TA 4PP1D 1OARH 3GI8L 3TVMB 5L4JA 2GABA 5BS0B 1D6EB 2PR4L 2QQLL 2FNBA 4ZUWB 1TVBB 1E9PA 3TWCL 1Z6JT 1MUJA 2R1YB 4NFDA 4NO5A 4ENZA 1QN9A 1QPXA 3SY0B 3T5WA 1O5DT 2B1HL 3PAVA 3K3QA 4L29A 1Y6NR 4DNLA 1XV8A 3TFBA 3Q3GB 3DJZA 5JPMB 1ZHLA 3VFPA 4XWGH 3NGBC 4PJBB 3UTSE 1J8HD 5IJKA 1K4DB 4LSPH 2NPLX 4FI6A 4N0UB 4U6YB 1GCYA 4RGOH 3AQXA 4YXKL 4EDWL 3CSBA 3V2AR 5HP5A 4HZ1A 5EEZA 1MAMH 3RVTC 3OLIA 2W9DL 5K39B 4FQ2H 1YPZF 4P99A 3CIQA 1GSKA 2D3NA 2I26N 3KPQA 2BM3A 3M8OH 2BNQB 3GBEA 4D0BB 4M9OA 5HI4D 4XMWA 2WQVA 3LB6D 4JO8A 4PJIE 3QCTL 2LE9A 4MQ7A 1MRDL 1IC4H 4P4KD 4KK6D 1DSWA 2IOMA 3NTCL 3Q44A 3MA9L 3IJYA 5F9OH 1XCTA 1K6QH 3PJSA 4BH7B 3CC1A 4IJTA 5D7IB 1PS3A 5KZCB 4N87A 3KPLA 3DIFB 2VAAB 3U9WA 2H7WA 4AGQA 1KYAA 2R2BB 3CFEB 5D1ZA 2G75B 2OYPA 1EMTH 3L7FA 5IJVB 1X7QB 4JM2C 1Q9LB 2JXMB 2Y9RT 4UQCA 3G6DH 2CSPA 3CGTA 1GHFH 1NGQL 2DBJA 2QGBA 1SLVA 2NY4D 3S4SB 1DFBL 2AEPL 3DBXB 3AAZA 3QFJB 1VFBA 1Q94B 1HEHC 4N68A 1UD4A 3GSXA 1JD9A 1DQDL 2NY1C 2GITA 1RUAL 1PFOA 1ES0A 4GP5B 3K72B 2CNYA 1QHPA 4IK6A 1YEDB 2XIIA 3T08A 1H9VA 4YK4B 2HKFH 3Q8CA 4OGQC 3VMPA 1JZ5A 4OQ1A 1DEEA 4WCYH 3B7UX 4POZC 1YY8B 1CYXA 3SY6A 2H9GB 2CO7A 1PU0A 3R4DA 4G3YH 2IGLA 4K5OA 3WS3B 2XICA 2ADFL 1CDWA 4Y19D 1NCAH 4BRVA 1W91A 4DPBX 3INUH 3ZZLA 4IRJA 4K3JL 3ZTNL 2VAJA 5DC4B 3RY5A 2RQEA 5C7ZA 5HPMA 3CZLA 3ISWA 4XNZB 3F7VA 4TSAH 3QUMH 1RPQA 3FT2B 1M05A 4WWOA 1AOZA 1LWYA 2QBWA 4OFQA 5DHYB 1IMHC 4F7EB 3KWWB 4AJWA 2P5EA 2D7NA 1QQDA 2X6UA 1LEKB 1T83A 3IMBA 3MMEA 4APQA 2VISB 4NI6A 2F53A 3NZUA 2N0KA 2QVMA 2EIZB 4FDWA 4GIPD 1DDTA 5L4IA 4AVKA 4MYPA 1GZQA 3NJFA 3GTVA 2ZSWB 3UBGA 1EHLL 4RCAA 4N8CH 1K8IA 2EO7A 3P4MB 3V6FB 3CN4A 3BZDA 3EBGA 4W6YB 1DJIA 3LIUA 2YPKA 3DTXA 3FO2A 4GAYB 5HYJB 2EKSA 4G7QB 4P9MH 4AYFA 5I1IH 2BMKA 3OAWA 4DKEL 1IFGA 1CLOL 1DP0A 2FR4A 4GPVA 4MHHG 5F6HJ 1NCJA 1XCQA 4L4VA 4AYEC 5DK2A 1HEZB 5LNEA 1VOKA 2XWZA 1ADWA 3O6MH 1U2CA 1KN2H 1HC1A 3AZUA 4D9LH 4IDJL 4BH8B 4PJFE 5D7IF 1K85A 1R6VA 4QWWC 2W60A 2HFEA 1CBVH 2BSSA 1ORSA 2XBTA 3OG4B 3MJ9H 4S1DC 4PJXA 3WIIH 1A6ZB 1KDJA 5CCKL 1WRFA 2XQYG 4F9LC 4G6JH 3WEAA 3DSFL 4OCSL 2HT4C 1DJWA 1M7UA 1JHKH 3AJ7A 3GLAA 1IEAA 3ZE1E 3L5JA 4ZMZA 3GZQA 3IFOA 2E47A 1W72A 1D3CA 1XAUA 5KTEL 1WFMA 1DLHA 5DEJA 2X2HA 3QFGA 3TTYA 3KPSD 2O6CA 1HCYA 4B60A 2X0VA 2YQ2A 3P9LB 3UYRL 3X3GH 1ID2A 4L5FE 5HHMB 3SPJA 3WJMB 4WNJA 5DJZA 4RA3A 2AV7B 3QWRA 4RFEA 1GS8A 3RJOA 3MV8D 1QHOA 1IC5L 4RX4D 2Q7YA 3C6SB 1M1XB 5MHSE 3SDXB 4AM0A 4A66A 4QT5B 4LOEA 3H3PH 3FO0L 4J1UA 2WCGA 4NO0D 5F1NB 5ILTL 2A6IA 2L0DA 1KB5L 3AITA 4GW4A 5KW9L 2YA0A 2GTQA 4IKLA 4ZUVB 1OD9A 2O4EA 4UT9L 1P7KA 2Y72A 3ARRA 2OKMA 1MAKA 3RTQC 1D7BA 4KO9A 3CMGA 5E51A 2WW8A 2NY6B 1CD9B 3O3DB 1NH6A 2FSEA 3MUUA 4EO5A 1L7TH 1EVTC 1AXIB 1U3HC 1SLWA 4X4YA 1QFOA 1PCMX 4JZNA 2ALWA 4P2AA 3BUQA 2ZUSA 4N3TA 2B8OT 4ICWA 4W9HC 2DLFH 3O8XD 2WVTA 4FF9A 3QIWC 4I13B 4KQ4H 2J5LB 4YL4A 4HETA 5C0CA 3UP6A 4TULL 3CW7A 1MZYA 2FEEI 1RSFA 1M7IA 4M6NL 1TYEB 3E0GA 3X14B 5KVDE 3MBWB 1I1YA 3IDYC 2BIOA 3QRGH 2ZUXA 3HNVH 1X5YA 3MO1A 1SLUA 4J12A 3F6IA 5JPNC 4C56B 1N9PA 5FYKH 3KYNB 4O9HH 4DESA 4K3GA 2ORBH 2WQUA 4N2GA 1QSFA 4NPJA 4FJZA 2DEWX 3HLAA 3BKYL 5T1LA 3GMQB 5J6GB 2YS4A 4IMKA 3VAEA 3D4CA 3SOBH 1SQMA 3VJ6A 43CAA 3FAXA 1TMQA 2B5IC 5AKVA 1OF2B 3EKCA 1AACA 1C7TA 1FPTH 5JMOC 2XN9B 3G5YA 3KPRB 1NEUA 4ZX5A 1J0JA 4B3VA 5JIHA 2EVIA 4MD4B 3LY6A 1U8HB 4U3HA 5GGUA 3VWKC 3NJKA 2YBRA 3E8UH 3WFDL 3P30L 3RWDB 1TQCC 4PSRA 3KLQA 4IOIB 4XXCA 1DVFC 2IADA 2Q87A 1KIQA 5ISZD 1GMIA 3T0AA 4AV4A 4M61A 2Y8QA 3T2LA 1H0DB 2F5BH 2BSED 4PYHA 2J1XA 4EXPX 1GTNA 4R8WH 4K3HA 5MEPA 3WIFB 5DMYA 5AAWA 4JAMA 5DUBB 1AP2B 1JYVA 2CO4A 3L3OA 4GKZA 3GTTA 4HMEA 2EDMA 3GRWL 3CPUA 3D5OF 1QWHA 4RWHA 4ZO7A 5DMKA 1DJHA 3SDXF 3EG9B 1AD9A 5E5RB 3RVXC 4YFLI 4JFEB 1LVEA 1JYNA 5D1XB 3MNVB 1SJEA 4YDIH 4Q0XL 4KRPC 1MCDA 3QPKA 5EN2B 1KJMA 4JGJA 3ESMA 4K15A 3QPQC 3S6CA 4F1SA 4X6FB 1UA3A 2HFTA 1F2QA 1QLEB 3KCPB 4DQOL 5I6XC 1WBZA 3DUSA 4ZNEE 1DBBL 2CA3A 1YQLA 5DI8A 4DJMA 3QHZL 4LPWA 5IW3A 5JORA 5FHAH 1HYRC 3FRPA 5T3XL 5ECGA 5H94B 4RDBA 5T3XD 4KK9C 1T4KA 1QN7A 1FNEA 3CBKB 4NWUH 5TGBA 4EJYA 3X12A 5DRNB 3RDTD 4GMTL 3PL6D 3OAUL 4N2HA 2VLKA 3PV6A 1QR4A 1Q9WA 4GUPB 1SM3H 4R4BB 4YHIB 3WFEH 4DK5A 3RQ3A 1B0WA 4DZBA 2FBJH 3BPNC 1H3WM 1L9PA 2X10A 4YDZA 2E7HA 2K1MA 3UC2A 5D7JD 1OE2A 3SDYL 4A37A 1OB1A 3IJSA 4DAGL 1Z3GH 4QEGA 3V4VL 4YHZL 1KPRA 4ZTOH 3FCGA 5I5RA 1VFOA 2BVOB 3IAQA 3C2AH 4KK8D 2Y69B 2KDGA 4JKWA 5IQ7H 1XGRA 2CIKB 3IFLL 3JTSB 1MEXH 2VXVL 1N8OE 1DHKA 2F7OA 4Y2DC 4X4ME 2BSCA 2VDPL 2ENJA 2EE3A 1E4WL 4L37B 3J07A 4A39A 3QBTB 3TBVA 5F7EL 2ADJA 3BKCH 5C0EB 1FGNL 2YOAA 4TSBL 3M45A 1J9CT 4MA3B 1Y6MR 4OBRA 1ACXA 4Y5YA 5CF3A 5IB1B 2JB5H 1KYUA 3GD1C 5INCB 3KWUA 4ZS6C 1GY2A 5DZPA 5IM7B 3U30C 3V4PA 1CGSH 2KLRA 5LBVA 4XP1L 2FJGA 1SBBA 1KLFB 1NOAA 2AK4A 5D7KD 4RZCA 4WHTB 4BA0A 4EI6B 2Z64C 2E8ZA 1QFWL 4JDEA 4PMEA 4MASA 3HB3D 4OLWL 5EUOF 1Y6KR 3VG0H 4HAFA 3AU1A 4HCFA 5AW7B 1TTAA 2NSQA 3I6KA 1QRNA 3RPBA 2Q6WB 1VJSA 2XWBA 2AK1L 2XACC 1M6OA 3QUMA 3LS5L 4BYHA 3KYMB 3BQUC 5HDQL 2VO8A 1BVKB 1ZLSH 2V9TA 2VXSH 3UJJH 2BIMA 3C5ZC 4NSKB 1CI3M 1BWWA 4UV4L 1KBWA 4PRHD 4YHOH 4Z0BL 3NVQA 4I5BB 3ZBMA 5I1LA 1P4IH 5CJXC 4M62H 3ISRA 4M5ZH 1MWAL 2XG4B 2FKMX 1RZKL 2V5RA 3LKOB 1XCWA 2QADC 2OW6A 1WEJH 1IGJA 3GZPA 3MRQB 4MAYD 5CZXD 2OJEB 4HIHB 4L05A 3H2QA 4YBQC 4I77H 4G80A 5FWQA 2WQRA 1YDPA 1L5GA 2QQNH 3NSJA 3RZCD 3QAZB 1KCBA 1F4YL 4LCUB 5ICXB 2DQTH 2NNRA 1AO7A 5KUMA 5EG6C 1RU9L 3BE1H 4WKXA 2ZPKL 1GC1H 5EBLA 4WTQA 2XPGA 1A65A 1CDGA 5HYIA 4AVJA 2EE0A 1WFOA 3OZ9L 4JG0H 3PHAA 4L23A 5EFIA 3MVSA 5EULV 1WV7T 3SE3C 1CCZA 4JBSA 2EYRA 4ZOBA 4KBPA 4X6BB 5FUZH 4RRPM 2DMKA 3CSTA 4TLKA 1NCTA 4Y1AB 4AIZB 1U8KB 2CM6A 3MXVL 1T7WA 4LLVB 5C8JA 2NW2B 3M88A 3NCBB 4IW4C 5F1KC 1N64L 3E6FA 4YIQB 4HLEA 1C16A 5AKSA 2DWYA 2WQ8A 3CZJA 1MJ8H 3QXDA 4M43L 2WGXA 4R26L 4F8PA 2HX7A 1BFSA 1A6UL 1OOWA 3L3HB 4X0NA 1SBSL 2F18A 4ODUB 1JYWA 2DTMH 4Z23A 3JWDH 2EDFA 2ZXBA 4KVCH 2P7TB 5D72H 4AQAA 5GIRB 4HFUH 1FZKA 2BVQB 8CGTA 2OMYA 5JUEL 4LBAA 4KDTA 3FK3A 5AW4B 3T4NA 1USZA 2Y7NA 3SCMA 3MXWH 2GBVA 3EOTH 2CG9X 1NAMH 1CZ8H 1JPGA 1YEFL 4UTBH 4TVPH 5BW7C 1WD8A 1SN5A 5D71H 5F21B 1RURL 2WYHA 3UDWC 2IF7A 4GLRH 4DKDC 5BVPL 5IFAH 5BRZB 1FJ1B 2WXRA 3GMRB 4YWGH 2ZJSH 5FCUL 1W2KT 5GRVK 3WXVL 1C4GA 2WN2A 1CVRA 1E9PB 3UPRA 5SWSE 5F93C 2E76C 1MUJB 1FYTD 4P59H 1KC5L 1OIOA 2EHBD 1CDHA 3K6IA 4L29B 4YDKL 3BXNA 5EPCA 5E9DA 2WBJA 3D7QA 3GEFA 2FX7L 1A3LH 1ZHLB 1OP5K 1KB3A 3VFPB 3LIZH 2DJ4A 4U7SA 1JAEA 1NGPH 2OPCA 1UHVA 3FT4A 3QNYA 4J3WA 3EJPA 4JO2L 3H9SA 5HYSA 4KKRA 5F7MC 5AFAA 1I1AD 4RBPH 1EHNA 5JHLL 3NACH 3MV7B 2DJMA 1UZGA 5HVHB 4L2YA 5I0XA 4WWNA 5I15H 3S5LA 5DZJA 3BW9A 1S7TA 1W8NA 4X5WA 1KELH 2FUTA 3ARDC 4GI9A 4NBZB 4FNLH 5AN4A 3ZE0E 4MQ7B 2L04A 2CPCA 3A6BH 5ITBL 3IH7A 3S35H 5FA4A 4I0PB 2W0KA 3GSNL 4QY8B 3V8OA 1E5AA 1PX4A 3WG7B 4YSAA 3CXDH 2I27N 4ECNA 3IJYB 1XCTB 1EJFA 1R17A 1E6JL 2WOYA 3FH5A 2FQDA 3PJSB 5DS2A 3TC9A 1UFUA 1AISA 3LXCA 3Q1SH 1NLBL 4URTB 1I9RL 5D1QD 3BH9A 4RQQA 5B1AB 4MSWA 1T0MB 5IBTL 3KPLB 1BZ8A 5SV3A 2KQNA 2LQRA 3MREA 1NGYA 3L2NA 4CSZA 5D1ZB 3CVSA 3L7FB 4HEPG 1VF5C 5DHMC 4KRLB 3B7SA 4Q58C 3UIYA 4R7NA 3TN0D 1DQTA 1D5ZA 3UADA 3P73A 1A2YB 4XN8A 4PJ8C 3AAZB 3OAZK 1CU4L 1H8OA 1VFBB 4ZBJA 3DMMA 4X8JA 4HH8A 3T1WA 3CZEA 1NIAA 1SVCP 3FF8A 3GSXB 2GITB 1ES0B 4NUMA 3UTTE 4XI5C 2G9HA 1DQIA 4OB5L 1UJ3A 2JOIA 3UERA 5GSVB 3SJVE 1I1RA 2L3BA 3A0OA 3RWHA 4G8GB 2H4LX 3FRUA 1DEEB 1K2YX 5AZUA 4AQ8A 2CO7B 1BLIA 4PJ7B 1E4XL 4MA7H 4C83A 3RFZA 3I6SA 1P7QD 1AQKH 1T5XA 3W0WA 4H2AA 1IGCL 4IRJB 4IGBD 2EJ1A 3IKKA 4P2YA 3BPLC 4UZSA 2WKLA 3LZOA 4F5CE 4PJEA 3F7VB 4G9FE 2LVEA 1M05B 3O3AA 5DHXB 5KVDH 3DX3A 4PGCA 3CFJA 3ES6A 5CU9A 2P5EB 1QQDB 2AJVL 5D8JH 5HHQA 4GP4B 2YO3A 4JO1L 1RZJC 3MMEB 3PXHA 4TUJA 4FABH 4H8WH 4PWIA 2KERA 2OOXA 4I8DA 4M4RA 4KX9A 2XTJD 2F53B 4B96A 2YGOA 1A4CA 2NX5E 1T89A 3HBPA 2MPVA 4ZO6A 1IBDA 1GZQB 2FBRA 1TVHA 1ZK5A 4HOMA 2BLFA 4XP9H 1KYOJ 1ETZA 1UCTA 1O6TA 1G94A 3LEXA 4O2EA 1AQ8A 2AQQA 1SUHA 1GYAA 5C08E 4WXAA 2AABH 2OYMA 1EZUA 2OTPA 2YPKB 3DTXB 1NC2D 3FO2B 2EKSB 3MBEC 3MNMA 4AYFB 4YL9A 2V37A 2VC2H 5C0ND 2BMKB 2X53A 2FR4B 2ZCKH 2D3JA 1MCWM 3R8BB 1OSZA 5G2NA 1XCQB 2GIMA 4L4VB 3SQBA 2ZF8A 3DX4A 5DK2B 1XGYL 1OT2A 4PIRF 3JTTA 1HESA 5KYWA 4JY5H 4AJYV 3S37X 2COQA 4N25A 3AY4A 4C7PA 5LGHL 1B3JA 3RKPA 3LDBB 1HNGA 5EWIL 4TLUA 2W60B 2HFEB 2NY7L 3EFOA 1C1EH 1CFQA 2BSSB 5EU4A 4P2RE 2ATKA 3HE6C 4PJXB 3RVWC 4GSQA 3I84A 1EEUA 3S2CA 1XZWA 1JF5A 1R4XA 2V7NA 1IGTA 1N10A 2VUKA 1A22B 1FNGA 4P3WA 2UYLA 1IEAB 3JXAA 2OULB 2ZNXA 3IFOB 1MHPH 3HCVA 1W72B 1ZCRA 3O3BA 3HLKA 5AVZB 1DLHB 4D8PA 1PG7X 2NYYD 1T0OA 3GJEA 1JZIA 2D9CA 4LSVL 2Z7YA 4F15C 3DETC 4K8RH 2N1TE 1LEIA 2RACA 4EAKA 5FX3A 1HWHB 4MBRA 5DJZB 5DQ9A 3FQ1A 2XX1A 4RFEB 4JUTA 2ZUQC 1KV7A 2Q8BH 3RPJA 4UDUA 3HBQA 4PU2A 5EZIL 4AM0B 1ZANH 3EOYG 1SXNA 1BZ7A 2JI1A 4J1UB 4X9YA 4A7GA 1GOGA 3CHSA 4H1LH 4HCRH 4PWJA 1A6AB 2A6IB 2M8XA 3W9EA 4DN4L 2RJMA 2WV3A 4B9JA 1F3DJ 15C8H 3K0WA 3EYUH 4JHVA 2KZKA 4P05A 4PJIA 3KLHC 1P7KB 2WSKA 3QIBC 1W8EA 2X28A 4L9DA 4QMEA 2GJ6E 3K8MA 2VN3A 5F6IC 1ZA3A 1IBGH 2NNXA 2VDRB 3TDHA 4JFFD 2FSEB 1AOHA 2HUEA 2ZCHL 4ADGA 3PMGA 3KBEA 3LJ3A 2IQ9L 3WV0A 1TUPA 4X4YB 3F7RA 4JZNB 1A7OH 2IMNA 4FQLL 4WFED 1CLYL 3EH4B 1MDAA 2OCCB 3TNMA 4XXDA 5JXED 4JRWA 4ZAKA 3A4AA 4ENED 4PGBA 1M7IB 4TNEA 4Z7OB 1RZQA 1I1YB 3L9EA 4WFHE 5ACZB 4B0MM 2MNWA 2I60L 2C9PA 3MO1B 2AGJL 2YUXA 3L4YA 1B9ZA 1R3HA 3QG7L 3Q7JA 4FFYH 1U91A 5EMYA 5I1EL 2NR6A 2OR7A 4N9GA 1TJMA 4XT1C 1QSFB 5HDBF 1A7NH 3HLAB 3K6DA 3LRKA 2K6YA 3B2VL 3T2PA 5LGKA 1S2EA 4WI0A 5T1LB 1JGEA 1VOLB 3KLKA 2VMCA 3TJEH 3HRPA 3MRMA 3MAWA 4ODTL 3VJ6B 3VNZA 2B4CC 4HSQA 4JFZH 2NNCA 5BZXA 5I2IA 1FO0L 4PJXF 1SF5A 1FQ9C 4NBYB 4F7MA 4XO8A 2JF1A 3TEWA 5KVGE 5EIIG 3KS0H 5GGUB 1CL7I 3Q05A 4DO5A 4AL8C 2ZCLH 2YBRB 1J5OH 4G6ML 3CLFL 2WSPA 3GWJA 4QD2E 3Q8FA 5HHOE 1KIQB 5FO9A 2P42B 1JTPA 2X2JA 1L3WA 5FYJD 3V95A 4GSDH 5K1NA 2BVEA 4HDIA 3TBBA 1HHKA 1MDTA 2OMXA 1RIUH 3HN5A 2VKWA 1PZ5A 4MNQE 5AOJA 4YZWA 5MEPB 3ULSA 3HVNA 5LNGA 4ONOA 4JAMB 4CGTA 3BUTA 5T5FA 4YHKL 5GISH 4GKZB 3F05A 2F9BT 4RDQF 1DVYA 3GM0A 5ADOL 2F08A 5KSBE 3SGJA 5DMKB 3O2VH 5DZOA 1H19A 1AD9B 1U8MA 4ONGL 1BDYA 2VDNH 3QYMA 2DYPB 2FATL 2B59A 2WTPA 5TE6L 3ELQA 1SJEB 1MJUH 1BHGA 4Y16A 3K5SA 3LIZA 5LQBH 1WYJA 1I9JL 4IBYA 3MNZA 1KJMB 1QPKA 2AQ1A 3GMPA 3N55A 3KYAA 5HYEA 4Y2NA 3VO0A 5LXGL 2YQBA 2J1ZA 1C12A 1WBZB 1OM9A 3DUSB 3PREA 2HPOA 3KTUA 3U4KA 5KVMC 1DCLA 1ZTXE 2E27H 3NFSL 4TRPL 1VEPA 2R83A 3P77A 1GTFA 4PJFA 3PQYE 3FRPB 3QIWA 1C08A 3EGDA 1T4KB 3PWPD 1FNEB 5M95B 6FABH 3K4ZA 2JB6A 5TGBB 3X12B 2GJJA 2HT3D 2XOTA 4W70A 2X4PA 4K3EH 4Z7OF 3UX9B 3VCLA 4KUCD 5DZLA 2R0LL 2VLKB 1OT1A 4N2AA 1Q9WB 2YQGA 4K7FA 1S7QA 4Z3EA 4Q9RH 5IGXL 2R9HD 2FZ3B 2XVGA 3NJNA 4NCC1 5IHUH 3IJSB 1P53A 3FQ2A 3PGDA 1SXBA 4WUUD 2PYED 4MA1B 2FX9L 4UUJA 5DDHB 1DLFL 2IH8A 3OZLA 4PS7A 3BWUF 3II3A 4OFKA 1F42A 4HUWA 1QN5A 1ONQB 4L9LC 1V7NL 1XGRB 1HDMA 3RGVA 1GGCH 3ZDWA 1KJ3H 4A2EA 4YNYA 3FU5A 3FB6A 4X98A 3SN6N 3ZKMD 3WKPA 4FE9A 5GRUL 3WDHA 3TBVB 3GZOA 1F02I 2IDQA 2OQJA 4QRAA 2ADJB 4XPAL 3PPSA 4OCXH 4Y5YB 1BQUA 3AACA 1E65A 2XNAA 3KVPA 4U1KB 5JOPD 1LO0H 4G7YH 3RA7L 5ABDE 2QGEA 2FRGP 2Y06H 4JKLA 2XWEA 5IVZA 5KS9E 5EF1A 2CO1A 4RWYH 5I24A 1MQ8A 5LGJA 4Z7QE 1JZ7A 2FJGB 2AK4B 1JTTA 4RZCB 1IT9L 3ATAA 2YKKA 2WUBL 4FX5A 4JDEB 3CSFA 4O51B 1RMFL 2UX6A 4XCEA 4PY7A 4LPVA 3T8MA 3AU1B 3CN3A 4TS6A 2Q8AH 3PWJA 1QP1A 2WLLA 2W65A 3I6KB 3NZHH 4GSUA 3ZQWA 4B97A 5J0BA 4JRYE 2ADGA 1T0NA 2XWBB 1M6OB 3QUMB 3FZUD 2OR9L 1OHQA 2X4RA 3IF1A 2VXQL 4OGAD 1QI3A 3MGTA 3LN4B 3OMZA 3OC8A 2IFFL 4OZIA 5BCAA 4LHJB 4S0TD 1CDJA 2V0AA 3WKYA 3NCJL 3S97C 1KV3A 1NBQA 2BXZA 3OKDA 1IM9D 1IGJB 2ZXDA 1MNUL 1WGOA 2EUWA 1PNDA 1MJ7L 5E8OA 1OWWA 4FNRA 1YDPB 7CGTA 1CTMA 1WSST 1WQVT 1XH3A 1L5GB 2WBKA 2WYIA 4F1ZA 1NQBA 2ZNWA 4Y7OC 4WWID 5C2BL 4P5MA 5DZNA 2Q3AA 1RZJH 3JV4B 4HWBH 4P57A 5GSRA 3HBGA 1LE9B 1FH2A 3EAYA 1AO7B 1EDQA 2K6ZA 4LDOB 4EAGA 5EBLB 4BFNA 3U6RB 3UTPD 1QI4A 2XKSA 3S5YA 2XPGB 3ASNB 1HIMH 3SBWC 3EJYC 2A1WL 2DLIA 1CXLA 3DOHA 1TPXC 2CUMA 5LWYL 4NN6C 4PVLA 1XB6A 1BZDA 1EZSA 2OK0L 3E9TA 4MCMA 4RFNC 4M7LL 4M6MH 5BRPA 1MFDH 1D5BA 3WJLA 1ZHNB 2EYRB 3QIUA 2X2UA 1KFGA 3QDHA 2NOZA 2DAVA 1NA8A 3KH3A 5JLZA 1QATA 4U31A 3CG8A 3KG5A 4GRLA 3TH3T 3E6FB 5L9DH 4DP5X 1C16B 2ZX6A 3QXDB 4EALA 5E6IC 2VR4A 1JZ2A 4MXWL 3VW3L 2N0MA 2WKGA 1OVZA 4DW2H 4Q8BA 4PFEA 4R97C 4ZO8A 3ZT5A 4YXHL 1NM4A 1JHLL 3BPCA 3CN1A 4XZ4A 3JWNG 1QTPA 1FZKB 1UUNA 2OMYB 3TZVA 5T3ZL 5EOTA 4QTFA 1Q9UA 4EUPH 2QKIC 1PVSA 3SCMB 4BFGA 2A9MH 1D7CA 4H1LA 2BHZA 4M3JA 5JQ6L 5KSUA 1JPGB 5HHXH 2BVUA 2C3XA 2PKDA 5LN8A 4LPTA 3U25A 4BQCA 1MIEL 2HWZH 1OOAA 1RIVL 4DP0X 1BXAA 2EDBA 1RK0A 2NY2D 3O6KL 4JREB 5CP7B 4CL7A 2YUVA 1KCVH 4JZJB 5DC2A 2Z6FA 3L95A 1QG3A 3SE9L 3UPRB 5F88B 1JP5A 4NZJA 2IQAA 1Q0YL 2MMXA 1T1ZA 3T77B 5FV1L 4DETA 1NZRA 5I6OA 1NANI 1XH2A 1J1XH 3QDME 1WT5C 3BXNB 4KY1L 5E9DB 4XO3A 1FFNA 2WBJB 3P3UA 4NRXA 4P5TA 1EFXA 2EH7L 2XY2A 5EU6D 3ROLA 1U8NA 5KSAB 3RNQA 5AWNL 1E2WA 1MCHA 3FT4B 3QNYB 4BKSC 1Y0LA 3H9SB 4PLOB 1E4KC 5HYSB 5EIVA 1KJ2H 3EDJA 1HWWA 4JFTA 4Z76A 3TV3H 5L6YH 4OF3A 5BJTA 4FFYA 1JNNH 4OM1L 5F89A 3TO4A 4BUQA 4M5YH 4WEBH 1LWHA 2GT9A 1QSEA 1DVUA 1U0QA 2P80D 3D09A 1TNMA 2WWKO 4UMGA 1GPOH 3S5LB 3ZKSD 3BW9B 1S7TB 3DOIA 4N8VG 5JMVD 4HISA 1D9KC 3L4XA 1H5BB 2IIJA 3LRSA 2VZ1A 5FA4B 2DBLL 4PTUA 1S5IH 1HSAA 4Q9CA 5DTFA 3OF6D 3V0JA 3ZHDA 3O2WH 4GSXA 5TDNA 4JN2A 1DO6A 3V5KA 1I53A 3X17A 4XVSH 2VUYA 2JMRA 3NJHA 3BH9B 4RQQB 1QBLH 1BZEA 4MSWB 2ZTBA 1AHMA 5HD8D 1HU0A 2O5YL 1NGYB 4B9ZA 2PW1A 3B2UD 5DJ2A 5MERA 2B4CH 1D5ZB 4MXQC 2YJQA 3BP5B 4XRCA 2Z35A 3AG2B 1LWVA 3P73B 4Z7UE 1NM9A 4D9RD 3GHBL 5IW1B 3DMMB 4X8JB 1VB9A 4XAKE 2P52A 1EBAA 25C8L 4LRNL 3CVHL 4ODXA 2VTFA 3NSFA 4PRBA 5BPPA 2H0JA 3HNTL 5JMRA 4ZOCA 4AL8H 4QAMB 3MRDA 4AJ0A 3HFMH 2G9HB 1EV2E 5FPIA 1UJ3B 4WO4D 1LK2A 4ANXA 3ARGC 1YN6A 1QWUA 3QQ9D 3RWHB 1KEGH 3QWOA 1TQBB 2FWLB 5GHWL 1TYRA 4QNPE 3FRUB 1OZUA 5I8EA 1I7TA 3JWOC 1M42A 4CVWA 5AW5B 3CWGA 4M3HA 5F7AA 2ZD0A 4FYTA 4C83B 3RFZB 3N44B 4WI3A 3W0WB 1T5XB 3AS1A 4OUOA 3K5RA 1AR2A 3U4BH 5J57B 2HAZA 1AI1L 1J0KA 4XN2A 2DQDH 5GS1C 3T2QA 5ANME 3DNKA 3FF7A 2L7UA 3LPOA 5FC9A 3T09A 3GMNA 1YY9D 1I9EA 4PJEB 5I1KH 3O3AB 4BFFA 1A9EA 4LIQL 5HVFB 2JE8A 4O4YH 1FH5H 3CFJB 4PGCB 4XMTA 5JIMA 1X5GA 4NDMA 5HHQB 5E4EB 4TUJB 2CBPA 3ML9A 1JVOA 4MGXA 4D9QD 3BN9C 2QPDB 4M4RB 1WA0X 2H5AX 3WY3A 1G9MC 1IKFH 3UAJD 5DZ9A 5FDYA 2H2SD 2GIXA 4NENA 2YLKA 1ETZB 4X8GA 1MFBL 3LEXB 4O2EB 3AC0A 4EOWL 1PQZA 2X89A 1WFNA 4ZMLA 4WDIA 1TJIL 3N41B 4ABQA 3DI2B 1WISA 1OSZB 5IJDC 5KVGH 4JPKL 3C60C 4U6HA 3SQBB 5I30H 4DEWA 1T2QL 2MCPL 2WP3O 3EJZC 3VD1A 5DC9B 3C09B 5KYWB 1I4FA 3X1GA 4D8OA 2RH0A 4TXVB 2YEZA 2RTTA 3TA3D 3IGFA 3GF8A 4Z6AT 1N4XH 1ODAA 2BHUA 3CU7A 4JRXE 4KKAD 4NKIH 2XSKA 4PRPE 4W4OC 1E7UA 1MCPL 3EFOB 2HH0L 2DQIH 1CFQB 2GW5A 1SVZA 4TVUA 4WV1C 5EU4B 3S88L 2ATKB 4IRJD 4HGMA 5E4OA 4HBCH 4LLAA 5SWSA 3DX8A 2O5XH 1AZBA 1IGTB 2V7NB 2OSWA 1UKTA 1FNGB 2UYLB 1AD0A 2FQEA 2X4SA 5GJSH 4HWEH 2BP8A 2F58L 3O3BB 4ANVA 4JM4H 2Z8SA 4KTYA 3IVKA 2J6WA 1UQSA 3Q9QA 4IRSD 4APQD 4D8PB 1S7UA 1SFHA 5MP6H 2DW5A 3GGWA 3GJEB 5HVGB 3HPJB 2XRAL 4JNXA 4IBWA 3UH8A 3HMWH 2DMHA 2XI9A 3PWNA 1LEIB 1WLHA 2PP9A 3DUHA 3F62A 4C59B 5C0RH 1WD9A 2NXZC 3B2PA 1LP9E 5EF2A 2BY3A 4UDUB 1TJHH 1ZTXH 3D2UD 5C71A 1INQA 1BZ7B 3N44F 4J2XA 1JXFA 1QN6A 2PWHA 3CSYA 2X44D 1KTLA 4PEEA 3W57A 2FWSA 4BUGA 1NCBL 3UPCA 1F56A 4PJIB 2HLEB 2AKRA 1DDHA 5FM8A 4XVTL 1QKZL 4PJEF 2NUTA 4JCWA 1DE4B 1KN4L 1P84K 1X5AA 1Q1JL 1XO8A 3A4EA 4E9SA 3SPIA 5CILL 1LYQA 3O6LL 4HWBA 2Q1EA 2Z8VC 1J8RA 2I5WA 4DQAA 2J25A 2MKWA 3QR2A 1FVCA 1UXSA 1PMYA 2VDML 3KWXA 4R90L 3ZDXE 3IDIA 2EUXA 3TNMB 1Z3RA 4XPHL 4ZAKB 3MLPA 2EIKB 4PGBB 2AEQL 4AWJC 3BISA 1HL4A 3EGXA 4NQDD 2HKAA 3BC9A 2PP8A 2E46A 3GINA 4IRZL 3WE1A 4UT7H 5MENE 4MQXC 2GC4C 3NH7L 1JRHH 4WHYH 4XP5L 4FNQA 3N41F 2E7BA 3J8F7 1R3HB 3MRGA 1U91B 1IGIH 4N9GB 2FD6H 4GSRA 1LJMA 3N1GC 3Q6GH 3EUDA 4OGYH 3PAYA 1ZV9A 1JGEB 4WI0B 5JDSB 5HYFA 3SJVA 3N1FC 3C08H 1FDLL 1F13A 3D85D 3QZPA 3L1OH 3SE8H 2JI3A 4NQVA 5I2IB 4H20L 5J3HD 4XVUD 4F7MB 1CDIA 2DQJH 3LPWA 1MQKH 1UT2A 1TQSA 1JI2A 3DUUA 1MELA 3BZFA 3EAKA 3MCYA 3MROA 4JLRA 4EUPA 5CUSH 1WZ1L 3IXTA 4LLDA 12E8L 1NAMB 2GFBA 3QUXC 4F5CA 1NBVL 1J8HE 1RUKL 4G9FA 4KROC 5FO9B 4DGUA 4HDIB 1HHKB 2OMXB 2Q7NA 3PXJA 4LLYA 2XIBA 4CFFA 1PZ5B 3ULSB 5HI3C 1NLDL 1PYWA 2EC9T 4M48L 3DYPA 5C0CD 4LHQB 4BK4A 3A4DA 4HXBH 4ACTA 5AB2A 2YSTA 1BMZA 4LBEA 1CBJA 3LNIA 1PJWA 2NX5A 1FC1A 2D3VA 4LCCA 4ESKA 5E08H 2EIJB 4OTXH 4PLJD 3VWJD 3BWAA 3V0FA 1CR9L 3MLRH 2APBA 3HS8A 2EEBA 2VZ3A 1U8MB 4A7GF 4E0RA 4AVHA 5C08A 2UY7A 2Z0FA 1M9WA 5SX4H 1QN3A 4Y16B 4V1DD 4PJIF 1ZK9A 2NZ9D 4KO6A 4Z78A 4HPYH 4ONFH 2Q76A 3H7BA 1A4AA 2QHRH 4GAJH 3OWRA 1C12B 1KJ2A 5A1AA 3U0PA 2DLTA 4L2LA 5BXFA 1S7SA 2PTVA 3MUGA 3NAAL 5HY9A 1B90A 5LDUA 3JZYA 2CZNA 3P77B 4UB0L 2QRDA 3EJJX 4PJFB 2Z34A 3L16A 5JA8B 3QIWB 1C08B 1G0XA 1NCDH 1IQWH 3EGDB 4XX1E 1A66A 1TZIB 1QVOA 4PP1C 3BP4A 5IZ7A 1MCOH 3TPUA 4P2RA 4LPXA 4RAVA 1ROWA 2JB6B 3WTYA 1ROCA 4HJEA 1IZJA 2X4PB 3HI1A 2WCPA 2Y8LA 4M1GH 3VCLB 5AL8A 3BGMA 3IDYB 5JIKA 2AI0L 3D9AH 4GIOA 1DJYA 1S7QB 4K7FB 2CNZA 4BGLA 4EN3A 2C4FT 3ZE1B 1T03H 1VKXA 3V0IA 1TGHA 1E3ZA 5DSCB 2H1PL 4WI8A 1G0DA 1QPPA 3PGDB 1KFAH 2KPWA 4XNUH 4UUJB 1ZT4A 4KZCA 5HI5D 2VERA 3JZ7A 2V9RA 4HUWB 5D5ME 2VMEA 4I0KA 4O58L 2W92A 1KXVA 5IROA 1HDMB 2ICWI 3RGVB 3FB8B 2VQ4A 4XMLL 1T4WA 3FB6B 4X98B 4PLNC 4Y19E 1ZJBA 3FQWA 5GGVH 4OIIH 4XAWL 4QHMB 4WX8A 4JKNA 1TETL 4JO3L 1SXAA 4MJ2A 4NUGH 5K9QI 4MB1A 2XNAB 1TTFA 2NW3A 5GRWA 4P4KC 3WO4C 2Y7SA 3PABA 2WINA 2IPTH 5FDWA 5IVZB 4KK6C 2VN4A 2OLDA 4U6VH 3KPNA 4U1NA 4ZMYA 2QSCL 5LGJB 4YX2L 4UNUA 4F2ME 1UGNA 2D7QA 3OGOE 2NOEA 2AEIT 5CEYA 3C6EA 1QFWI 4NXKA 4ZW7A 3MU3A 4XCEB 4X0KB 4PY7B 5C97A 1QBAA 2IPUG 3GXTA 3PWJB 4DERA 2WLLB 2W65B 4DGYH 2DWXA 4FQIL 2W0FA 3IPBA 4FHKA 3U7YL 4FKKA 1RK1A 2ADGB 1T0NB 4Y4KD 2WD0A 5TPWL 4ORGB 4XXWC 2IWFA 4HS8H 4KRPB 5GRJH 3ML8A 4LSUH 1I8IA 4X99B 2X4RB 2WWMD 2EDRA 2YEVB 5C0BA 2X41A 3MGTB 3JWOH 1JVKA 1ASOA 2VDOL 4BXSV 2DQ6A 3MA7A 4X7DC 3LQAL 5J7CC 1K5NA 2OX5B 3S37L 4LLWA 1CL7H 3FCUB 3PDGA 3RGBA 4KDVA 1U3YA 3NN8B 2ARWA 2PNDA 3KPPA 3OKDB 5H37G 4PJFF 3WELA 5E8OB 1AYRA 5AW3B 2FLBT 3WYRA 1S46A 1PZDA 1XH3B 3GNMH 4P5KA 5GS3A 3SDAA 4ZPTA 1HJCA 4M6AA 2VC2B 3WHXA 5E8DL 2BWIA 3FQTA 3QGVA 5I66A 3F10A 4P5MB 2Z4QA 4OCWH 1V7ML 4ZD3H 2QDWA 2BP0A 4P57B 1GYCA 5GSRB 3RNKA 2UXGA 3RUGE 1IBFA 4TQ8A 4DEPC 3PY9A 3G08A 2XTLA 1U8JA 3UABA 3N9GH 2WSDA 3OAYH 3VM5A 2GY5A 1G9MH 1OLZA 4PHZA 4YSTA 4GI8A 2OMWA 3QG6B 1PG7L 3ARED 5DFAA 1JZ3A 3KPSE 5HHOA 3MFFA 3FBKA 3B3IA 1JF6A 4I0CC 4XPGL 2WXNA 3K0YA 1IC7L 1QYGL 4MS8D 2A9NL 3V5HA 4QKXB 1E90A 1PJ9A 1V3JA 2XWXA 1ZEAH 8PAZA 2G3XA 1D5BB 3QCUH 4HJHA 4OGXL 3QIUB 2BX5A 3H3BC 1BXVA 2BFGA 3MV8E 4Y2DB 1QRND 4KK5D 3R7RA 5GGSA 4LAJH 4CC0A 1N39A 5JLZB 3H4HA 1HINL 2R0WL 5KSBA 4OJEH 4GRLB 3UC0H 4FNTA 5IV2A 1FVEB 1KEMH 1XAKA 3H42H 7TAAA 1KO9A 3UIZA 4G8IA 3B1UA 1JZ8A 4FYQA 5BO1L 1M7DA 2GAZA 3O0LA 3VMOA 3GBNH 1XL4A 1PW3A 2W59A 3WLWC 2NYZA 2ZWLT 4J8RB 2DQHL 2X6VA 3BPCB 4OZFG 5IB5A 4OD3H 3KE0A 4WENB 1KIPA 5TK4A 3F6LA 3OMAB 3GZKA 5EOTB 2D0GA 3F04A 5A16A 5C7XH 2JKJA 4PV8A 1GKOA 2OL3L 4QOKD 3RWFA 3PQYA 1B2WL 1AIZA 2H8PA 4H1LB 4HV8A 4DN3H 5A2CA 5KSUB 3IT8D 3VFNA 2NQCA 1B6UA 5BZWA 4CN1A 3ARFA 1MPAH 1JZ6A 1WIUA 3MRCB 3L3IA 1RKRA 4F80A 1FL3A 5DVNA 3U1SH 4AQ1A 3L95B 2R69H 4I4WA 2PCFB 3NJXA 2ARJQ 5J13B 2IQAB 4OZIF 2PXYC 1T1ZB 3U1PA 4HF5H 1XXDC 4WLCA 3KHQA 2IDTA 4XP4L 4KZDH 1FFNB 4P5TB 4ZMNA 1MREH 1EFXB 1FAIH 1X5MA 2QADB 2Y07H 1KCWA 3ROLB 1U8NB 3ZRSA 5TFSL 1UG9A 2BINA 3LS4L 4WK2B 3L4WA 4R4FL 4L8CA 3SGDI 1Y0LB 4OLYH 5E24E 5LCVL 3NP3A 1G7HA 2D7PA 5DURD 2AHIA 4Z76B 4U1SA 5EU7E 2NY3C 1PLCA 5BJTB 5C3TA 2UZIL 3TO4B 2E6JA 1LLAA 3QEUB 2WZPA 1QSEB 3GDBA 1A0QH 3HZKA 5DUPL 5EA0H 5C70A 5KJRH 4LQ1A 5ISZE 3CWUA 4IBVA 1MVUA 3I9IA 4TPRH 1VKLA 5KS9A 3UBHA 3GT6A 3WEXA 3FFCA 3LRSB 1U41A 2CRMA 3LQZA 4PTUB 4AK1A 1HSAB 4P3CL 5DTFB 5CZVL 3HZMA 4S1QL 1KXQE 3W81A 4G43A 1LEGB 5E5MA 4ZFQA 5TDNB 4JN2B 3V5KB 1UXWA 1G4MA 1KBBA 1YYLH 4HPOH 1HQRA 3UAEA 2D8KA 3U0WL 3K6SA 3O4OC 4JRYA 1V27A 4K23H 1ETB1 4N2EA 2LU5A 5I8OH 2G5UA 1RAMA 3CU1A 2PW1B 2D03L 5DJ2B 5MERB 4LMQI 5I18H 3RJQB 3ZLQC 2OMVA 3N1QC 1Q8MA 5CEXA 5E9DD 3TCTA 2X4OA 2WLHA 1NMBH 1A6PA 1FNSL 4ODBD 1JVLA 5DC0A 5CLZA 4XBPA 1K3ZA 3LNGA 4EEEA 4NPYB 5HDOA 3SKJH 4YHNA 5BMFL 3TF4A 1OAYH 1TYJA 3LPGA 4ODXB 3LH2H 3KPOA 1BEYL 2FTAA 5L0QC 3MRDB 3QZOA 4NC2B 5T3XE 1N12A 1BVOA 4BZ2H 5DD1L 1T6BX 2VDNB 3B56A 3GO1L 5EO0A 1LK2B 4AV5A 2JV6A 3RFRA 4PS8A 1QTSA 1YN6B 5JIIA 1RVFL 5FKAA 3QWOB 3QI9D 2A9AA 2BHYA 2N56A 3TNNA 3FU3A 4PV1C 1I7TB 4JN1H 5B7MA 1E4XI 3KGRA 5EU7C 1UD8A 2AJ3A 2QR1A 2EXWC 2AZAA 3AG3B 1UD5A 4FG0A 2R2EA 1P4UA 4GMSL 3VQMA 1MVYA 4JL2A 4LU5H 3QHFL 3CHRA 4ODHL 2O72A 4FLSA 1IEBA 2ZKYA 1JCVA 2H41A 2IG2L 3QEGH 5H35A 5CJBA 3GMNB 4NWTL 4I3SL 3KXFD 4NZTH 1A9EB 3ARUA 1C8QA 3F00A 3KPMA 4NDMB 3HMXA 2F5AH 4B7IA 4NKOA 3QUZA 4PUBL 3IU4H 3TBWA 4GP8B 4WW2C 2YKLH 2H3NA 1J9RA 5AW0B 5JA9A 3UZEC 2FSDA 4K55A 1DQKA 2L7QA 2L7JA 3T1FA 1TZGL 2J88L 4NENB 4K07A 5K93A 1IAIH 3RIFF 5F7FA 1YC7A 4YH6A 1PQZB 3Q8EA 3O0RL 2A5UA 3ARDB 1KPVA 1F1GA 3CFCL 4WDIB 1RCYA 2QQLH 2ATPA 2NCMA 2TAAA 5D7KE 3TWCH 5JQIB 3H53A 2ERJC 3B9KC 4U6HB 5JHAA 2VJ8A 4W9ZA 4OY9A 2NLJA 1R47A 4NX0A 4KTEL 1NANH 3SYOA 3V0VA 1UEMA 2YEZB 4S1SL 4DKTA 3N2JA 1T21A 3S48A 4M93C 1KTCA 5C0JA 2Z31A 1L6ZA 3IFNL 4J6RL 2QLYA 3P02A 3W0WD 4CVZA 1XVSA 2QTVA 3CZNA 4AEHL 4NZ8A 3D0AA 4PRHE 5D70L 4ZS7L 4X9GA 5DYFA 5SWSB 3PV7A 3DX8B 4DH2A 1G84A 4PJ8B 4JO4H 5D7JC 1RIHL 1XT5A 1SY6L 1AD0B 3LMJL 4POUB 5LGYA 1KGXA 2X4SB 4LSTL 2BP8B 4HEME 3QDMA 1OCZB 1E5ZA 3IVKB 4KK8C 1UQSB 3EDDA 4ZSOE 1S7UB 2OP4H 3KR3H 1LK3L 2BH0A 5AKRA 4BWWA 1XF4A 4ZODA 3HG2A 3T6XA 3ABKB 3NTCH 3PWNB 4UAOC 4Z95L 1H6FA 2YJLA 6TAAA 5L4MA 3P4LA 3WTTA 2FX8L 2DF3A 2XFXA 4MZIA 3P0YL 3QEQD 3V6OA 3WBDA 3ZO0A 2MCG1 3TASA 4FZEL 3FL7A 1E6OL 3T0ED 2VWEE 1TZHA 1I3RA 1Z9SB 1KTLB 3CSYB 2J7LA 2NT1A 3FQUA 1NCCL 3G7TA 4P2OD 2A74A 4FLOA 1YNLH 7FABL 1F3DH 3MZGB 4WGVB 3ZE0B 1DDHB 2K7QA 2NUTB 4IDLA 1NGQH 4WY7L 4HQQL 5BV7L 5IP4A 3WL9A 2C1OA 2DM7A 3CK0L 2Y1YA 1FZJA 2JJTC 4PMFA 2JQZA 1RUAH 3S0PA 1XEDA 3GHPA 4U6XA 1E5CA 1FVCB 1I9IH 1L7IL 1UXSB 3SYAA 2HKHL 3IDIB 1W80A 4MZRA 1NGZA 3EGXB 2ICEC 3TIEA 5I6PA 1OQOA 3LZPA 4ZOAA 4LSRH 1ADQL 4OJFL 3IMVA 3K2MC 2ADFH 1LDPL 4W6WB 4TOYL 1ZGLP 3V7AE 3MRGB 3SDCA 2VRQA 4EMZA 5CZXC 1S7RA 3QPXL 4OLXL 1DQJB 1RJYA 2QPFA 1U8PA 2OI9C 3EYOA 2CO3A 4FQQA 4AV0A 5DD0L 1PCXA 3SJVB 1YPZE 5I0VA 5IVXE 3RZCC 3UP1A 3O6FD 4CN4A 5DXWA 2HG0A 2X2IA 5GZND 3D4ZA 4WV1A 5GGTL 4DOHE 4NQVB 3HG3A 3ULVL 3WS6A 5PAZA 5JOEA 3ULVD 4HS6B 4MD5A 5HGDA 1FYTE 1V5SA 4Y9FA 2OMTA 3CMOL 5KYUA 1U8OA 1E5YA 3DUUB 1DO5A 5ETUA 4I18C 2BIPA 3MROB 4JLRB 4NLAA 4PJ9A 4AEIL 4EUPB 4AGOA 5ANMA 4LLDB 3AROA 4LVHC 2VDLL 4GUQA 5CEZD 1YMHA 4G9DA 4G9FB 1GJUA 3T4AC 2AC0A 4DKEH 5L8JB 4LLYB 3MRBA 4F15B 4I2XE 3RIFK 2WB1A 3BLBA 4ZAKD 3HBZA 4LBEB 4KHXL 3HUJE 1TJGL 2NX5B 3UBXA 1F3RB 3F0ZA 4LCCB 2RAMA 1BBDL 3M7OA 3QUGA 3W39A 3BWAB 1XR8B 3ARVA 1GIGH 4QR7A 2B0SL 4ODWB 1N0XL 1AKJA 5C08B 4I48A 1HNYA 1F6LL 2NR6D 3TLRA 3ZE0F 3PHSA 3VUAA 1F97A 3QIBB 3HS0C 4Z78B 3N5AA 5F6IB 3H7BB 1EDYA 3FUMA 1QSZA 5JHDD 4ZT1A 1KJ2B 1NSNL 1RUQH 3U0PB 4EQ2A 2MJ7A 3FYEB 5BXFB 1AZRA 2N1KA 4YPJA 5HY9B 5D1QE 4K2UL 2FECL 5KTEH 1F2XK 4OT1L 1QBBA 4FA8A 3DX2A 4PRPA 1QVOB 9PCYA 4YFLF 1A3ZA 3WHE1 3TPUB 2W38A 4P2RB 4RAVB 1QW9A 3FTSA 5BO0D 2HFFA 1MZZA 5FA3B 3HI1B 2VM9A 5L2JB 1ULVA 4BSJA 2JJSA 5CJ5A 1G5AA 1IC5H 3L3KA 1T5WA 2ZYIA 1H3UA 1NVPA 3QRLA 3ARTA 4OCRH 4EN3B 3FH7A 4ELKA 1VKXB 4N0UE 5KN5A 1PY9A 2AANA 1VADA 1LD9A 1KB9K 3HI6L 1FORH 1OT4A 4LESA 4H88L 1ZT4B 2YEQA 4RGMC 4UM9D 5I82A 5DWUL 4GQRA 2JLLA 4KNTA 1TMCB 1I1AC 2PLTA 4UAHA 3KJ6L 4UINL 3CDYA 2XKUA 1LP9A 3LH9A 5DRXA 1E4JA 2ISDA 2JCCA 3HI5L 5D7EA 1KBKA 4X8CA 3X13A 1B0RA 4Y16D 4J8QA 2VW4A 4C4KO 2H32H 2EAEA 4LQFL 3AT0A 1LXTA 4TULH 3ECBA 2JKTM 1H8NA 5JIQA 4OSUH 5I8KH 1CICA 4BZ2A 4M6NH 2NW3B 2IOIA 4YAQB 2WINB 5FDWB 1E8WA 1O5PA 2GJ6B 3KPNB 4U1NB 5DK0A 3MHZA 3M86A 2R29H 1BIHA 2JWYA 4Q6IC 3HC2A 4PGEA 5CEYB 2XTJE 2A2QT 3GXPA 4M1DH 2N7SA 1BXXA 4ZW8A 3QFJE 2W0FB 4XH2A 3TN0C 2ARJA 2VH5H 3FHAA 1RK1B 4FHJA 2IH1A 4N3UA 5MENA 3FXIC 3CUPB 1UC6A 2UZYA 1OD7A 5F8QC 5C0BB 4RESB 2NOIA 1OAXL 5I71B 3MA7B 1GZPA 4HT1L 4FAAB 2OCFD 1QR1A 1K5NB 4QLRA 2VT0A 3OR7A 2IAMD 4GKOA 4UQDA 4X7FC 5EU5A 2DYRB 4L18A 4LLWB 1DZ0A 3CZFA 4NB7A 1HHJA 3P30H 5E56A 3QFDB 3T04D 3KPPB 4GT7A 2CXGA 4GOSA 3STBA 1QNZH 3SDAB 4P5KB 4ZPTB 4MKTA 3OB0K 3WHXB 1QLFA 3HS9A 4MXVF 5I66B 3PFUA 3K4DA 2Z4QB 2BP0B 3RNKB 4AOFA 2ZUWA 3G08B 2OA9A 1U8JB 5ANHA 4IGBC 1ACYH 1PCSA 4HK0B 1OK0A 3LNHA 1OAUL 4MAZA 1MHEA 2OMWB 2C9AA 3EO9L 1I75A 4TNWF 3VQ2C 1YNKL 5HHOB 1J8HA 3B3IB 4OCYH 3ZR5A 2CO2A 2P5WD 3DDGA 1K8DA 4NJ9L 4N2MA 4KZEH 3ESPA 4MNQB 4HBQA 3V5HB 1CDBA 4AXWA 4KKLD 4QGYA 1DTUA 3T71A 3WU1A 3ESNA 5GGSB 1DBJL 3WNPA 4Z1PA 3MRPB 2I9LA 5KSBB 2FQFA 2Y24A 3SQOL 1CD0A 5IV2B 4UNTA 2FEDC 5T3XH 2E75C 4G8IB 1J0YA 3NJIA 2VXUL 2YXWA 1M7DB 2GAZB 2KLSA 4P4KA 3BGFB 1UENA 2PPDA 5FYLL 4JFFE 5J89A 4X50A 5FYLD 1HL5A 5EOCJ 5B1BB 5KOVC 2P8PB 4YK4C 5IB5B 4N2DA 3VXNA 1NGXA 1KIPB 3D0VA 1WHPA 3P1VA 1FA4A 4BK5C 4WFEE 2QFRA 3EO1A 5GRVL 5A16B 3SDYH 4AUYA 4DAGH 4ZXBD 2X38A 4PV8B 3RWFB 5J4MA 3PQYB 4HV8B 3VFNB 1S9WB 4LL1A 2CMRL 4YR6A 5LAPA 5BZWB 5A3IC 1AY1L 1IAOA 3MCLH 5C9JA 3ARFB 5AYUL 4XGZA 3IFLH 5JW4R 2CIIA 1VLXA 1J1OH 3CVIL 5IOPA 3L3IB 2VXVH 4XBGA 4XNZC 1KIRB 4XNXL 1FL3B 1K9TA 2ENSA 2NY5H 5GQBA 4AQ1B 1RULL 2E7LC 4HWUA 4I4WB 5CR1A 5CHNA 1MCEA 3H9HA 1FGNH 4OLZL 1KYFA 4TSBH 4GKNA 5DUJA 3KNBA 4HOWA 3BPOC 2IWEA 3QIUD 2HT2C 3DPUA 1XEUA 1VENA 4HJUA 2IGFL 4V11A 1PY0A 5D5MA 1CQKA 2WXPA 3CDCA 1IVLA 4L8CB 1RZPA 5CNHA 2WQWA 5CJOL 3CLEH 4Y19A 2Y0SA 4LCIL 4NUQA 4EAJA 4U1SB 1RZFL 4L3FA 3RX9A 2BW5A 5SWQA 4OI7A 3U9PH 5CINH 4WAFA 4AE0A 3HZKB 4GKSA 1RSYA 2DZEA 2BOLA 4I85A 3FQNA 1V5JA 4XCCL 5FYJE 2DRUA 3ULUF 3Q8BA 1D7FA 5HDQH 3TZVD 1WWCA 5KS9B 3WEXB 5HJ3A 1QLEL 2BSDA 1ZVSA 3LQZB 4F2MA 4Z7QB 4LXFA 4UV4H 3HZMB 4KI5D 4G43B 3GBLA 5E5MB 4X9FA 5KANG 1U6AL 1F3JA 1LMIA 1UXWB 3VGAB 4GG8A 2K3HA 5JXEC 1HQRB 5KSBF 5IB3A 3NA9L 5AYTA 5C86A 3K6SB 3BN3B 4JRYB 4OD1L 1HZLA 4A55A 1XIWA 1IILE 4R83A 2OYKA 3OD3A 1IBBA 4D7BA 3LNFA 4JCMA 1F4YH 2IAND 4N85A 2OMVB 5CWSA 5CEXB 2X4OB 4J3BA 4P5TD 4XBPB 1RU9H 1T7YA 1UJTA 3O11A 2ZPKH 2VERN 3BH8B 4YHNB 1G7QB 2QPSA 4ES8A 3HAEH 2P5PA 2FO4A 3KPOB 4JHWL 5F7LB 5T5NG 4AIOA 3DURA 2UXFA 2FE0A 1N7MH 3PWPE 5J56B 1RZ8A 2NXYB 2Y1VA 3AM8C 4XCFH 2DQUL 4XNYH 5JNYA 2Z0BA 2I07A 1IJ9A 1DUZA 4BKTC 4JJ5A 1QSED 4TNWK 3VFMA 4EIZC 2NZIA 4YDVB 4JG5A 5CBEA 1WZKA 2AJ3B 1AHKA 4R84A 1N5YL 2NY6C 1Z0MA 4LT7A 4Z7VE 3AMLA 2R2EB 1EXGA 4UV7L 4KKZA 3NCCB 4FXGC 3BLPX 4M43H 4JY6A 3UROR 1CQYA 1IEBB 4WUUE 2PYEE 3FONA 4OFYA 1DSFL 3KPSA 4M8UA 3MJWA 1A6UH 2YGNA 4HGKC 3E9UA 2ZUTA 5EUOE 1NGWB 4OIBA 2QKSA 2DJUA 2D2OA 2DB8A 3MODL 4LEBA 3KPMB 1ESOA 3DV6A 3PXLA 3IFPA 1JGLL 1MH5B 4X2UA 1EZLA 1PLAA 3APFA 4MVBC 4NKOB 5DO8A 3FMGL 3QUZB 2DI7A 3HNSL 4QRPD 2YD0A 3GMMA 3TBWB 4NO0A 4HOXA 1HK6A 1IQDA 1YECH 2H3NB 2QSTA 4AKPA 2WLZA 4E2OA 1YEFH 3T1FB 1QW8A 5JOPE 3FOMA 4JKKA 5IKCA 5GZOA 1J3MA 3D4YA 2X4TB 1JGDB 5F71A 4UT9A 5BVPH 3PP4L 5I75B 4NUJA 4L0YA 1L6XA 1D9KB 5KS9F 2OCJA 2JKRM 2OJZH 3WXVH 2KBGA 3I85A 2ATPB 1MP9A 4N90D 4DPRA 4CKVX 4Z7QF 1H9DA 5E1HB 1GZHA 2JLPA 2NLJB 3O8XA 4JFWA 1TENA 1T21B 2FX7H 4YSSA 5C0JB 2Z31B 2HT3C 4CC1A 2A7BA 4GG6A 4CVZB 3IKCA 5DR5H 1NGMA 2B1AH 5TF0A 2YMXL 1BFVH 1XSOA 2HMIC 2R29A 4S1RL 4CC4C 5IUSA 3VH8G 1A7RH 4QF1A 3TJHD 1LHZA 4RAUA 4P9HC 1YQRA 3QDMB 4WTZA 4AMKH 3QYCA 4IIZA 5BOPA 3GYRA 2GPZA 1JNLH 3ZU8A 1CG9A 1KCKA 4RRPA 5ITBH 4QPEA 3HN8A 1F8TH 1OAKH 1BJ8A 1YEEL 1F45A 5D1XC 3ZKMC 5IW6A 3QZMA 1UOVA 1B4JL 1S78D 3EJQA 3N43F 1LO2L 4G8AC 3X1BA 3GB7A 2XFXB 3RIKA 1NLBH 1UACL 3GSRA 4G7VH 4WNSA 1I9RH 3FUIA 3UTPE 3S9DB 4ODSL 3DVNA 4BSVB 3B3BA 1YYML 3BUYA 1TZHB 4OQTH 1I3RB 3FQUB 3DTDA 5J12C 2EXYD 5EC1A 5ISZA 2A74B 4A67A 1SYSB 2BSEA 1CGTA 4MX7A 3CZGA 3L5XL 3SDDD 4F9PC 2WXHA 4YHLL 3SE4A 4YQXL 1EANA 2ZONA 1H3PL 1F1AA 1VFAA 1UT4A 2Y3AA 3B1TA 4QTHB 2VITA 1KXQA 3WL9B 1CU4H 1SEBA 4X6CA 1OCOB 3GRWA 1FZJB 3WJJC 3MBXL 2QV2A 4CADA 4PBDA 2OMBA 2PO6A 4U6XB 4KOBA 3UZEA 4OB5H 3VRIA 4P2QD 2A9DA 5E1AB 2R51A 3BD4A 4JQIH 1NGZB 1X7TA 2F7IA 2Y5EA 4RNRA 1Q9KA 1TLKA 5EU3A 4TKWA 5DJ6A 1VZHA 4TM9A 3VNYA 1SHWA 4LARL 3BIKB 4N2CA 4N0YH 3G9AB 4AYBA 5FW7A 1MCWW 4DUWA 3C60B 5ACMA 1AZUA 1BM3H 1IGCH 1A9BB 2D0FA 2DWDA 4PG2A 1IL1A 1S7RB 3BI9X 1X9QA 3SGEI 1U8PB 5E9NA 3TS8A 1OCWL 3EYOB 2VLJA 3CVCA 4FQQB 4PJCA 3E6HA 3CZSA 3O4LA 1WZAA 5FGCE 5EC2A 3BAEL 4RSYA 3RDTA 3PL6A 1U92B 1MY7A 4JHZA 3OQ3B 3LZNA 1XCXA 4WV1B 3IETA 4ES9A 4JO1H 4QHUA 1X9LA 3FCSA 4K9EH 3A6OA 5HGDB 3G6AA 5AVRB 1KTJA 2OMTB 4NQUA 5KYUB 1U8OB 4CA4A 2OJ1A 2UVEA 5ETUB 2Y1AA 5KBPA 3US0A 4PJ9B 3V4VA 5ANMB 3VFVA 2DIJA 2OMNA 1GGBL 5EU6E 3FPYA 1J5HA 1FFPA 1QA9B 3MLYL 2OXHA 1YMHB 5DHVH 4G9DB 4UQ3A 3PDOA 3IU3A 5TF1L 2YAMA 4TNFA 3OKLB 3LXBA 5KVEE 3MRBB 2DJSA 4K94C 4K5LA 5AAMA 3IDJA 1XGYH 2Y5TA 1CPUA 5DRZA 2GSMB 5LG6A 4N6RA 3UBXB 3OLDA 2YBGA 5ID0B 3QCVH 3CWTA 3W39B 5JQHC 2LLLA 4G42A 2FJFA 4AVIA 5EWIH 2NY7H 4FQPA 1AKJB 4G70B 4I48B 3H55A 1TG8A 2CJUH 1EJ6A 1EO5A 4FQXD 3ZRFC 1A3RH 2FGZA 4RGND 3S35X 1HHGA 2HJFA 3DHJA 3HR5A 4XP6L 2O93L 1YJDC 1Y18A 2FWOA 5BRZE 3VACA 3VQ1C 3RTLA 5FM5O 4TSCH 1S6NA 3B6SA 3CTTA 3EDFA 4Z7IA 1Z9MA 5B8CA 3RVUD 4JRXB 2FYYA 1CN4A 2FLMA 2J2ZB 4PRPB 3I2CL 4LSVH 5KBMA 2HFFB 2D7TL 5EEWA 2OZ4H 4D9RE 4PRHA 4GQQA 5AW9B 2X12A 2TRYA 4QRTA 3L3KB 3WUWA 1JE6A 1TTUA 4FZ8L 1M3HA 1QLRA 3VU2A 4ELKB 2ZWZA 4BFEA 3VFOA 5KN5B 1VADB 4M29A 1LD9B 3ZL4H 4PRNA 4MAYA 3HN3A 2H0EA 3PCYA 2GUOA 5F7NC 1LO3L 3A6CL 4Y88A 2VXTL 3P69A 2ZCHH 3NDZE 4QNPF 5D9SA 1IBZA 1HJBC 4F92B 1JK8A 2IQ9H 1THAA 3RJDA 1LP9B 3LEVL 5DRXB 3UMTA 2JCCB 4QXVA 2VDKL 2CBMA 3X13B 1GGIL 1B0RB 3T3MF 4QRSB 3L2MA 4OIAA 3C8KA 3MJ7A 3HAEA 4GJTB 2PP7A 3ECBB 4FXKA 1CICB 4LAQL 1CDCA 1HFUA 3T4AA 4LIQE 5JW3L 1P7BA 1JMZA 2BNUA 5DK0B 5B7EA 2I60H 1DUYA 4F33B 4PGEB 4D9QE 3QG7H 4NZUH 4ZUSA 4LEOA 1HNFA 1S7XA 3QDJD 4X80H 1U95A 2Y1ZA 4Y4FD 2FH6A 2IV9A 1I7ZA 4HIJB 3BDBA 1ID5I 1FSKB 2H47C 3BSGA 4HX1A 4MS6A 1J5DA 3OH9A 2BWDA 2V17L 4MRCA 1HS6A 4XH2B 5E0QA 2F1AA 4DKFL 2ARJB 1U3ZA 1JPTH 2YD9A 3OHXA 1U3JA 2CWRA 4O2CA 1FO0H 5MENB 1G7PA 4BGDA 1F6AA 2UZYB 1PZUB 3H85A 3QJVB 2VABA 4XPBL 3ZY7A 2Z7ZA 5IJKC 4JE4B 2WJ7A 1GZPB 1W0YT 5DK3A 3OR7B 1MNNA 1KOAA 5EU5B 1HOCB 3CZFB 1NBYB 3ESVF 3CLFH 4FD0A 5IROD 4FFVD 4WEMB 4PJ5A 1Z7JA 5F44A 5FYJH 4TMPA 3STLA 5IVXA 4L1HA 3A47A 3VB9A 5HVHC 1P5VA 3BAWA 3IAPA 4MDIA 3QULA 3GLDA 4F7TA 1QLFB 2WMPA 2DYSB 1FYTA 5E23A 5ADOH 4KITB 4U1LA 2KZWA 3GJFH 1XF1A 2P5EE 3F64A 5T8IA 2HVBA 3TM6A 4G1MA 2WXGA 5DO2C 1MHEB 1YY9C 4FNSA 5INDB 4GKLA 2MWCA 3CDGA 4UILL 5B4MD 2F53E 1BZQK 1J8HB 5EOQL 2R8SL 3WGVB 4ROEB 3WENA 2VDRL 1K8DB 4KZ0A 5AVUB 4FP8L 1D5MB 2ADIA 5D4QA 5CD3A 4AXWB 2ZG1A 4I2XA 5D1ZC 1I1AA 5FGRA 3U36A 4JMXA 4WZ9A 2BOBA 1PZSA 4U2ZA 1SOSA 1UOKA 2WQXA 4KQ3L 5JZ7D 5JHLA 3HUJA 3K2UH 3CFUA 3QZNA 1LP9F 2HL8A 2I9LB 2JCCF 5I19H 3NFSH 4TRPH 2J1KA 5FGBA 4I3GA 1RD6A 1OAJA 4WJG3 1L9MA 3GLEA 4X7EC 3QJFA 3MV9D 4X5QA 5C0BD 1A1MA 3L4ZA 5HHPA 1SJXA 4I7ZC 5GRXG 1JTOA 5HDBE 2VDQL 3WO4B 4HUUA 4P4KB 2Z8WC 2MSPA 4C4BA 4MMXA 3GSNA 3L3JA 2R0LH 3GMOA 3NESA 3ZPDA 3GSVA 3UAFA 4XCNA 2Q20A 2A4EA 3VXNB 3TT3L 1NGXB 5F0MB 3PHQA 5IGXH 3RKDD 4P9HH 5D1QA 2CD0A 2WOBA 1JZFA 4AYSA 1YQVL 2JIXD 4OQTA 2P1YA 4YE4H 4YR6B 4BD4A 3GS7A 4IRJC 5C9JB 1IAOB 4OLUH 4W9FC 5E99H 1UZ6F 3TN0A 3NFPA 5E5UB 4XGZB 3TCLA 1KPUA 5IOPB 2NY4B 1TKWA 4JPQA 1SDDA 1KGWA 1NKGA 2P45B 3ULUD 2E7MA 2WB7A 4FCAA 4M7KH 4JDTH 2NOYA 3H9HB 5E7BA 1T83C 2JHNA 4GKNB 1UA6H 3KNBB 1UD3A 5HHVH 4APQC 1NCHA 3ZJAA 2Y23A 3VM7A 4G11A 4J6IA 4JQIA 2V5MA 5D5MB 4ELDA 3J27A 4YEEA 2X4UA 3UJIH 3IMRA 4U1GB 4GXVL 4GT0A 4Y19B 5EO1A 3REWB 3X11A 1P7QA 3KRMA 2DD8L 2G0KA 1RMFH 2OM5A 2N3JA 1U42A 5SWQB 2A6KA 1W8OA 3TWYA 3QE5A 1ND0A 4CKQA 3BSZL 4GKSB 1DQQA 5T1KA 3ZR6A 4PS4H 4D94A 3FQNB 2XIDA 5BOZG 3MZTA 2OR9H 3SE6A 3V4UH 4RGOL 1PFCA 2VXQH 3ASOB 1MHCA 1R5IA 1QX1A 5HJ3B 5C0CE 4F2MB 4BXVA 2OSXA 2LAEA 2IFFH 4FMFA 3F65A 1G7IB 3FU6A 4TQIA 3QUYD 4FQ2L 1AZVA 1F3JB 1WCBA 3BVNA 4GG8B 2ZXGA 3M8OL 4K5NA 3RL2B 5IB3B 2KT6A 1MNUH 3LKNA 3BX7C 3VE0A 2JPIA 3ARBD 1IC4L 1NC2A 5DHVA 4V1DE 2HUHA 2XPYA 5HXMA 3QXTA 3ALXA 1HYSD 1K6QL 1D2PA 1UXLA 3RLSA 3RWJB 3VXUA 3BVWA 3O11B 1FBIH 4JVWA 5GGQL 2FO4B 5E9AA 1SHXA 4P06A 3DURB 1HWGB 1OLLA 1EMTL 1RZ7L 3NPSC 3QXWA 2AJZB 4J3OF 5LWYH 2V9QA 1RZ8B 3G6DL 2OK0H 5J3HC 1X44A 5JNYB 2RIKA 2I07B 1DUZB 3SO3B 4JL1A 4PG9B 4P46D 3VFMB 4K94H 3A22A 3SBRA 5AVSB 3RUGB 4EI0A 2XKNA 5CBEB 5KBNC 3CX5J 3RB5A 5FOJA 2WAQA 3VXQA 3CN0A 2CKBL 4GBXA 1L4IA 3FFCD 3M6DA 4KPHH 2P3YA 3FONB 3KPSB 1S4IA 4MXWH 2QEJA 1IKNA 4HKZA 3HOGA 3WEMA 1K35A 4OW6A 5EORL 1T6WA 2FB4H 1HXYA 5D5MF 2HX9A 2AXWA 2B77A 3C5SA 3DV6B 3OXSB 3IFPB 4HAGA 4QRRD 2OZ4A 3MV8B 4J5VA 1G9NL 3IMUA 2VZSA 4QHLA 4XBEH 5H8DA 4MZ3A 3GMMB 4HH9A 3INUL 4NO0B 4N2KA 4PLJC 1IQDB 3D08A 3S8GB 4AG4L 3FUNA 1EXHA 1USQA 2ZT9C 2LU7A 3ZIMA 2D4FA 3FOMB 2J55A 2QDVA 4TSAL 3QUML 5A2BA 1FVDA 5HTSA 5IKCB 4NBXB 3V52H 2X3BA 1F5WA 1MIEH 2YAHA 1RIVH 4NUJB 4JFFA 3GSUA 5EBGA 1BG1A 2RA1A 3BWUC 2WUCH 4IMKC 1Q90A 2EE2A 3K6NA 3D39D 4AMWA 4GRWE 5M94B 1T6AA 2W80C 2CGZA 3NABH 3K71A 3REVA 1D6VL 3N0AA 1L3NA 3O8XB 4LEEA 2H32B 1PSKH 2OMUA 5FIEA 3VXPA 2A83A 3O4OB 2IALA 1CE1L 4M8VA 1RZGA 1OPGL 5MEQB 5C07D 1JBJA 2QT6A 2VR7A 5G55A 3IKCB 1HZKA 2HFGL 4XXCC 2BVYA 1N8ZA 2RMNA 2YD7A 3NYKA 4JFYA 1IRAY 1KN2L 1ZWIA 3WY2A 3D51A 4LLQA 1ZLUH 4QF1B 4D9LL 2M26A 2EADA 4RAUB 3WDIA 5AAWC 2H6PB 1RUPH 2DM4A 1X5XA 2LLGA 3L3OC 4PLKC 4BINA 2H45A 3BAJA 5HI5C 3CFNA 1PL3A 5DQDL 5ID1A 2C4XA 3MJ9L 3IJ9A 1CG9B 1EA9C 1ZLWH 4MJID 3WIIL 1OB0A 4TUOA 2DMGA 5K1JA 2VNCA 2CHXA 3HZYA 5C6TL 1VAHA 1FO0A 3GSQA 3WSQH 5IW6B 2BRRH 1FFTB 1HSBA 3QORD 3AXLB 3GB7B 4HD9A 4NNPL 3GHEH 2V2WA 4WWKD 4H8VA 3DVNB 3BUYB 3CCHA 1KWGA 4JGUA 3OKNA 1TFHA 5EC1B 1BLNA 5ISZB 4ZYKB 1WAEA 2AQ3A 3QS3A 3QW9A 3X3GL 4MX7B 1N3NA 3FTVA 2XWJB 5E2WL 4E5XG 3NCYS 3ZMNA 1S8DA 4E41D 1QI5A 2VITB 1QRNE 1SEBB 2UXTA 3EDEA 2RCSL 4JG1L 25C8H 4LRNH 4CADB 4X4ZA 2BJMH 4YZFF 2PO6B 4ZRGA 1X5IA 3GJFA 2VN7A 3D0LA 5I76B 4MHHI 3LKSA 3VRIB 4EVNA 2YR3A 4M8RA 3NK4A 4JFOA 5J6HA 1OGSA 1A3QA 4RNRB 5GHWH 1Q9KB 5F1IA 1MPGA 2NNFA 4WSJA 5DJ6B 4EZMA 3WY4A 1L7TL 4PGZA 1E9OA 1EDHA 1ZVNA 4MA1C 3WIAA 4TL5A 1E5BA 3TH2T 1HXKA 4XTRD 3BO8A 2DQEH 1N26A 3TONA 2C3HA 1JFHA 1U4EA 3WN6A 2DLFL 3VGEA 2DWDB 1ZKAA 4QOKE 4KQ4L 1UZ8A 5JHBA 3BVUA 2G3NA 3SPHA 2VLJB 4G8EA 1BPVA 3JUZA 3PWPA 5JW5A 1F58H 3E6HB 4DT2A 2XV3A 4FG6C 4M93B 2J20A 5EC2B 4LIQH 3M07A 3WXWH 3EJUA 3RDTB 2EILB 3PL6B 1FFQA 3ATBA 4Y5YC 3HNVL 4GG6F 3IETB 2APWA 1DYZA 4QHUB 3FCSB 3P0VL 5FYKL 4O9HL 3G6AB 4WRLA 2ORBL 4Z7VA 1AZCA 1CXFA 5D7JB 2CJTA 4KKCC 3AT9A 4YN3A 3KLSA 3EYVA 4EAEA 4WUUA 1PGRB 2PYEA 5AYQA 3V4VB 3VFVB 3KDPB 1OCCB 4EOWH 1XBRA 1FFPB 2EUZA 5EUOA 2OXHB 3SOBL 3R18A 4FNUA 1VRSA 3PDOB 2DI9A 3QAQA 4QXTA 4Y9GA 3HE7D 3NCMA 2NY0D 3BT2H 1TJIH 3OB8A 4OJYA 1FNFA 4KK5C 4OI9A 5AZ2H 1UXMA 4UAOB 3IDJB 2CJSA 3L3DA 1BD2D 3WN5A 1T2QH 2MCPH 3K2KA 1T7VA 4JR9L 5DRZB 4HJ0C 4N6RB 1KB9J 4ZZFA 3B9VA 3P4NB 3D1MC 4YS4A 3CWSA 1UD2A 2YD4A 1WVZA 4G42B 1PZ3A 4ILDA 4KJWD 2HG5A 4R7LA 4E9QA 5B3NA 2F5BL 2HH0H 3SDCD 1ZLVH 4ZQTA 2CO6B 3PDKA 2CK2A 4PM1A 1HHGB 1SLXA 5LVEA 2HJFB 3NJVA 3ABGA 1PEWA 3HR5B 1C9SA 3OC3C 3HB3B 4X6CF 3BUDA 4JHAH 4QGTA 2FECI 3ILQD 2F58H 5AVXB 1AFVH 3B6SB 2WN3A 3VD3A 5GS0L 2Z8UA 1AGCA 4YDIL 5B8CB 5GS0D 3ETBF 1JCKA 2FYYB 4FTVA 2R15A 2VRAA 5A43C 2NDGA 1XD0A 3BP7A 2ICEB 3LNEA 2VXQA 4PJ9D 3Q5OA 3TO2B 5E9DE 1P1ZA 2LVCA 4PRHB 3VFGH 3EF7A 4KX8A 2Z8RA 3WUWB 5FHAL 1QLRB 5DJDA 2CLZA 3VFOB 3IJ7A 5BMNA 2NYKA 4ONHA 1OSYA 1G1KA 1JWSA 1IM9A 3GKWL 4PRNB 1B9KA 4MAYB 2OI9B 3WNOA 4KXZH 2VN6A 4DGVL 4ZSOB 1E50A 1MFEL 1BOYA 3FQXA 4XVTH 5D6DA 4NWUL 3DHPA 4PJCF 5G5DA 3RZCB 2ILLA 1HKLH 3T6VA 5EZOH 2CXKA 2L7EA 5D9SB 1AHWA 1SM3L 3OSKA 1JK8B 3O6LH 5CILH 4EI5A 3LNDA 3N6YA 2FBJL 5G4MA 4PAZA 2DL2A 3HG5A 2BOCB 5I73C 5EEYA 2R4RH 2FGWL 3GSWA 4LCVA 2WO4A 1R3IL 3C8KB 3MJ7B 3HAEB 4XPHH 4Y4HA 4FXKB 3C2AL 4KDTC 1HVXA 3WGUB 3KXFE 4PW4A 3SCMC 4IHOA 1N0LA 3T4AB 1MEXL 1Q0EA 3DJ9A 5AOIA 1FGVH 2BNUB 2ZG3A 1MW1A 1F0LA 2QPEB 1DUYB 4M56A 3F7QA 3FYIB 4HUXA 2R39A 3ZYOA 2K4AA 2XUWA 4LEOB 4ZUSB 1S7XB 2R0KL 3RU8L 3QUHA 4L1DA 1U95B 3BKCL 3N50A 1I7ZB 4QJ4B 3SGEH 2O3OA 2WQAA 1KBPA 2UXVA 4B3EA 2JB5L 4HX1B 1UM4L 3KL5A 4F2FA 3PGCA 2NQ3A 3F01A 4QXWA 4JM2D 4X7CC 1FN4A 4O2CB 1BJMA 1G7PB 3UPAA 4XVJL 1F6AB 3MRIA 2XVKA 2A73A 4KKPA 2FQGA 5CM1A 4KMTL 1QBMH 4AIXA 3QZWA 4LHUA 4HYTB 4LFHG 2PCXA 1J1PH 2NY1D 2AF2A 3EHBB 2F8XC 5EF3A 3FUFA 1RUKH 3WUZA 4EIGB 2Z3FA 5AVQB 4FFTA 3STLB 1GOHA 5IVXB 3W0WE 5FO7A 4P3DB 2X5PA 1KIUA 4X4XB 1P5VB 4KNUA 1ZLSL 4MDIB 3UJJL 4DOHB 3QULB 2APVA 2OAAA 5DD3L 4R7XA 4F7TB 3KMDA 1QNEA 4LOFA 4OLEA 4YHOL 4ZMWA 4IU2B 1BQHA 2WMPB 4NZRL 4AZUA 5BRQA 2R5XA 1E40A 1XB8A 3V5DA 3BZEA 3OXRA 1FYTB 5IVNA 1P4IL 4P8QA 3LHPL 3A67H 1OP3H 1P4LB 2V4LA 1OHZA 4KKQA 1MF2L 1M4KA 4G1MB 3KH4A 2J1WA 4GRMA 3CDGB 4I77L 1CXHA 2GSGB 2FIKA 2H4EA 2ADIB 5CD3B 1OY3B 3CZKA 4I2XB 3U36B 1I1AB 1O9VA 4HWZA 4IBZA 4BJLA 2BOBB 2DKSA 5CGTA 3QEQE 1FF5A 3BE1L 2GB2A 2X87A 4TUKH 3W37A 3HUJB 4IKJA 3NAAH 3FUDA 3T0EE 4PN6A 5HBBA 4UB0H 2ZQKA 3E2HB 2E74C 1WAAA 2G5BA 3P2DA 4PP2A 4EI6A 3QJFB 1MFAH 3DMMC 4Q7DA 5HHPB 1A1MB 4ZMOA 5IEHB 4LGRB 1ZDSA 4H8HA 4B0MB 1YO4A 3WD5L 3TURA 5FUZL 1DVSA 1UJ3C 4MMXB 3GSNB 3L3JB 3OF6A 3ZSTA 2AI0H 5EOCH 1KGJA 2ENPA 4GO8A 4WGWB 3W2DH 3GSVB 4XCNB 1WITA 1TQBC 3PHQB 4XC3H 5TJWK 2GBUA 1Z9LA 3ALPA 3MLTA 5D1QB 2B1OA 4R2GD 5EBMB 4AQ8C 1A4KA 3Q2NA 2YC1A 4AKOA 5B7FA 3RFZC 1JZHA 1U2HA 2XZAH 5I1DA 3IN2A 4QWWD 3TN0B 4MJHA 1T66D 3JWDL 2FIRT 4Q2ZA 3NFPB 4S1DD 1EHXA 5D2LF 1KPUB 2F8IA 1A47A 5LDSA 4A38A 1TKWB 1SDDB 3BHBA 1FRGL 3E3QE 4HFUL 3EYSL 1MLBA 1JWUA 2H1XA 3E8VA 4XAWH 1TETH 3VTAA 3MXWL 2DQGH 3CVHA 5GGSY 3EOTL 2DV6A 5E4EC 3VXMD 1NAML 4MLIA 2P9RA 1CZ8L 1CB4A 4IOFC 4QCIA 4WUKH 4UTBL 4XNQA 5DQJA 5GGRA 2E5EA 1SNRA 2KZBA 4WO4A 4UQAA 1LNUA 1SYVA 3STZA 5IFAL 1T89C 3ASMA 5B39G 1C5BL 3II1A 5KYXB 5IVXF 5GJTL 2QSCH 1G9HA 4PGJA 3ULVE 4GRWH 1FHGA 1NFDE 2Y6TE 3X11B 1P7QB 2APXA 3T0EC 3FT3A 3L1GA 5DS1A 2A6KB 4RFOH 1A9VA 4IGBB 1XR9A 2Y7LA 1ND0B 2OMZB 5CEZ