1KYIA

Hsluv (h. influenzae)-nlvs vinyl sulfone inhibitor complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
443
structure length
321
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVDSIIRDLTDSAMKLVRQQEIAKNAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent hsl protease ATP-binding subunit hslU
publication title Crystal Structure of HslUV Complexed with a Vinyl Sulfone Inhibitor: Corroboration of a Proposed Mechanism of Allosteric Activation of HslV by HslU
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone/hydrolase
total genus 105
structure length 321
sequence length 443
chains with identical sequence B, C, D, E, F, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1kyiA02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1kyiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kyiA01
2FSHA 2B92A 4ESVA 4OHYA 2FX3A 2ZJBA 2UKDA 3L0OA 2F3TA 3UWKA 1TR8A 1FFHA 2IYYA 1TQ2A 3I72A 3QXJA 4LBWA 4Q4JA 1UADA 4UXIA 4E09A 1O87A 2NIPA 4DEYA 5C2JB 2CHGA 2DFLA 3NG1A 4Q1CA 2W0MA 1XX6A 5HE9A 3KUCA 1KO5A 2QAGC 4Q00A 3UKDA 3P20A 4H1VA 4RZ3A 1I2MA 1J99A 5H8WA 4B3FX 2ODEA 3TW4A 1KO1A 5JI3E 2XNDD 3UK6A 4FN5A 3BB3A 3OEEA 4DWJA 2WAYA 4PPGA 2PLFA 5CIWA 1GL6A 1MOZA 5JJLA 2JLVA 3GCGA 2JP7A 2QMOA 3WYFA 4TTRA 4A0RA 2EYUA 2WZQA 3C7KA 3QUSA 3CZQA 1M74A 4A1FA 1ZBDA 5KDDA 2UZIR 4PC2A 3QEJA 2XITA 3QBTA 2ZTCA 1KK1A 1U0JA 2AL7A 1PUIA 3MG9A 5AJVB 2GRJA 2X2FA 1R0ZA 3QKSB 1QZEA 2ZSAA 4LI0A 1V43A 1CBUA 3PFIA 2EVWX 2A5FA 3L0PA 1L4UA 4A2PA 4OK3A 4QBHA 1NN1A 2I1VB 1JEEA 3MWLA 3R7WB 3B85A 3RS7A 4XTCS 5EE1A 2DWPA 1E9BA 1L2TA 4M1YA 4RZUA 4P4TA 2IEYA 2RH5A 3V4FA 4HLUC 1Q1ZA 3RRMA 3EZ7A 2NO7A 4LJ9A 2RGAA 5LDDC 3GJ6A 2GTPA 3L43A 2YWFA 3NHBA 4MDEA 4R2IA 2QORA 2DZOB 4HAUA 4B3XA 4MH0R 5CITA 1C1YA 5FTLA 1FL9A 1NN5A 1U0HC 2ASEA 3NC1C 3KQUA 2ZEJA 3T06B 3B6EA 1N0WA 1XEWX 1YR6A 3RAPR 4JLPA 4AY2A 2B21A 3B9QA 2BMFA 2WSSD 2QP3A 3WYAA 3UMFA 5DI3A 4CIDA 3Q5DA 3AF2A 3GEHA 3RWOA 4IDHA 2WJHA 3VR5A 2H5XA 2CCJA 1ONBA 1YKSA 1G20E 1Z0KA 4ZCIA 4NYMQ 4V03A 3NDBB 1NLYA 3SBDA 4QGGA 1XB2A 2W2TA 3K0EA 2CCKA 3DPUA 2WJVA 3O8DA 2WKQA 2MSCB 3B82A 2VP9A 1R2QA 3UG7A 1TEXA 5J4VA 3T1QA 2ZJYA 1CKEA 1QBKC 4QG7A 4D4JA 5IHPA 5DLQC 2IYTA 1D6JA 5L3QA 5BW8A 1FOEB 1Z6XA 4JBXA 4ILEA 1XTRA 3PUXA 1ZMVA 2XEXA 2ERXA 2DBYA 3EARA 4HB0A 4BFVA 1UBFA 2GESA 3GP8A 1F2UA 2VIIA 1T9HA 1YR7A 1E2QA 3DL0A 1MV5A 2F3RA 5FOUA 2X77A 4PAQA 4HZIA 4F92B 2D7DA 3E5HA 2ZVPX 1GM5A 4M1MA 4KU4A 4DBGB 4URWR 2ZYVX 5IT5A 3AUXA 1VG0B 1WB9A 2A5YB 1ZM4A 1GWNA 1FP7A 3PCRB 1CU1A 3M4YA 5JWHA 3IO5A 3U6KA 1CJUC 1XMVA 2NMVA 1KAGA 4WA7A 2J0UB 1GKUB 1X86B 5CJ2A 4JBYA 4F4JA 2GA8A 1XDBA 2BBWA 3TQCA 4M0LA 3C15C 4B3CA 5C4MA 3FRIA 4C0QC 3THWB 2ZANA 1ZRHA 2VP4A 2LKDA 4ZDWA 3W6OA 4BECA 2EYQA 1T3HA 2FG5A 2ZSBA 1K6MA 2ZREA 2ZR0A 4EPVA 3OE7A 5J4KA 3SU8A 3B9PA 1U9IA 4LBZA 3AB3A 5AK0A 1UEIA 3WXMA 3QF4A 1E2PA 3KKOA 1W36C 4EJSB 3A1TA 3RDPA 3HU1A 4KV9A 2DCUA 1NMYA 1XTKA 4NL4H 1XCPA 2GXQA 3SHWA 2BJWA 3SJBA 4LPSA 1OIXA 4IW3B 4LRWA 5DH9A 3P32A 1E0AA 5FUVA 2XTZA 2V4ZA 4DCUA 4PC6A 4A2WA 4CT5A 5E7MA 5CLLA 1KJYA 2VP5A 5D3MA 2Q0HA 1XZQA 4GOJA 2I1QA 4PZZA 2G6BA 3K0FA 1KI1A 3TSWA 4ASUD 1UKEA 5CDFE 3A6PC 2GCOB 1NVUQ 4A3VB 4LHVA 4IJMA 2GBLA 1XTIA 2QE7D 2K0BX 1YE8A 3B1ZA 2JCSA 2FE4A 4TWZA 4XH9B 2FU5C 4X8HA 2QPOA 2WM9B 5FTMA 4EIWA 4F93B 3VR6A 1Z63A 4NCIA 1M6NA 3LWNA 3FGNA 4QBGB 2JDID 4I1SA 2PZEA 1GRQA 1R0WA 4Q47A 2A2ZA 2EWWA 1X6VA 4XVRA 4MKHA 1KGDA 4Q9LA 3B7GA 1UEJA 4ZKDA 3KJGA 4GL2A 1XEXB 4URUR 5JHGB 2OV2A 1CR2A 1KI8A 1GVNB 2JNHA 1NL3A 3A8TA 1GRNA 4QXAA 3VU9B 1WBDA 4BEJA 2IS6A 5CB6A 1JXMA 4HAZA 3KQKA 1W0JD 2QGNA 2F9LA 1W5TA 2WSMA 2ZI4A 3IHLA 2BBTA 1IM2A 2VBCA 2HWJA 2OEPA 2J7KA 5AJZA 4R71A 4IOLA 4RJLA 4ASUA 1OH5A 4TYNA 5EP2A 4GI7A 4FWGA 1ZCBA 2B6HA 3UXMA 1QDEA 1KI9A 4D4KA 4YMWA 2F55A 2IXFA 4RZXA 3CNNA 3FMFA 2AWOA 1I4LD 1P2SA 1R5NA 2IYWA 1VIYA 2BWBA 1KSHA 5TVKA 4BRWA 5K8LA 1Q12A 1ZUNB 2G77B 1NNEA 1G291 1GL9B 5EP1A 3UWOA 3AVYA 2HF9A 1XD2B 1E32A 3PUZA 4IVPA 1W4CA 4JLJA 4BLQA 5K8TA 1S0UA 2WWHA 5J5CA 4M53A 1AGRA 3LAWA 4ZIRA 1Z07A 2JIZA 2GK6A 3ZLJA 1KY3A 3GFPA 1MN3A 4HUTA 1KYIA 1SGWA 2BWEA 5CB8A 3B1WA 4L4UA 1R0YA 4N0DA 1XJQA 1J70A 3WRYC 1IJEA 2CHQA 1NI3A 2FFQA 2N46A 2PEZA 1KI2A 3RLFA 4CEHB 4GMDA 1G6HA 1GUAA 4NKRA 1XBTA 4FMCF 1BKDR 2IF2A 4M4SA 5SZIA 3THOA 2P0EA 2QPTA 1JBKA 3BE4A 1IOZA 4JVLA 4L5BA 3X1ZA 1ZIOA 2ZM5A 1HEIA 3U3KA 1KK2A 3ECCA 1L4YA 2A5JA 3LQQA 1X1RA 1AZSC 1Q57A 5JRJA 1QHXA 4V02A 1N6NA 4IFEA 3T5GA 2AX4A 3CO5A 5CDFA 2P67A 4UQOA 2REBA 3B2EA 2ORIA 2FNAA 3IIJA 5F98A 5TARA 4AYXA 4MKIA 2EW1A 5CM9C 3SOPA 4C0SA 3KUDA 4HATA 4BRUA 1ZMXA 2HCJB 2J1LA 5DYIA 2FJUA 5FFMA 1YZKA 1N3BA 4V0LA 2IXEA 5G3YA 2IUUA 2QSFX 2REXB 2DFKB 5HZKA 4OI4A 4WXRA 3AEZA 3KKPA 1NKTA 1FQKA 1GIAA 3C4JA 1XMSA 4BWYA 3B60A 2XJ9A 4AYTA 1GFIA 3K09C 2IYXA 3K0SA 1CUKA 2DAKA 4GT1A 4KSCA 1W1WA 2XJ4A 1MO3A 2HT6A 3PEYA 3CR7A 5FL3A 2GVZC 4I4LA 2ZRGA 3HDTA 4P32A 2ZUDA 5JI2E 4W5JA 1JAHA 4C0HA 3R9WA 3PV0A 4KXFB 2NOAA 2FPLA 1JR6A 1N5KA 3ADKA 4IFBA 4OQLA 2W2VA 2VLIA 3SNHA 5CK5A 3OF5A 3BWDD 4FMCB 1JI0A 4NHOA 3FTQA 1G3RA 2E87A 2GJAA 1EFRA 1J8MF 1FQJA 1KI7A 1Q44A 3B13B 5C46F 1NV8A 1QG4A 1Q20A 3VR2A 3QKRA 1KZ7B 4DXAA 2QRNA 1PLJA 3HR7A 1G16A 1XJ0A 2DAGA 3AVTA 4TZ6A 3IEUA 4Q4AB 3FFBA 2ZRMA 3QKSA 1E99A 3CRRA 3X1XA 1VMAA 2WWIA 4B48A 3TK1A 1YLAA 3PXGA 4X8MA 4EPYA 4GZLA 2QMHA 1DOAA 2IEZA 3CLVA 2NO9A 4K46A 3R7WA 4W5HA 1ZNXA 2GXSA 2IWRA 4XD7D 2CWBA 2PCLA 1AIPA 4F91B 2WWGA 1ZU5A 3MD0A 2QNJA 5JECA 2DWQA 1UKZA 2DFNA 1Z6AA 4RD3A 1EK0A 3BFXA 2R6GA 1EFUB 4HUQB 2JLRA 3W90A 5JSZB 1P5ZB 1XF9A 2QU8A 3KFVA 4JLDA 4LDJA 1ZMWA 4TN1A 2ZRAA 3A36A 1YZLA 1US8A 4G1UC 1QZXA 3PENA 1KMQA 1Y8GA 2CNWD 2DZLA 4JLNA 1G6OA 4YMTA 1KDRA 1GZSA 4QHYA 3UMSA 1SHKA 4Q1DA 3OAAA 2C77A 1IXZA 1NVMA 2IS2A 3AGPA 3FKQA 3KL4A 4HI0E 4B71A 2F1IA 4OQMA 4LYFA 4TLDA 3QVVA 2OBNA 2D74A 5KYKA 2BM1A 5LB4A 1UDXA 5SZJA 3LVQE 3UG6A 1D9XA 1W36B 4PSKA 4A92A 5B30A 4X8OA 5CYPA 2W58A 5TV2A 4BLTA 3CPJB 3E2IA 2L4EA 1YZGA 4JLBA 2IBMA 4B35A 5JEDA 3AVVA 3SR0A 2GEUA 2BOVA 2XTNA 3K0CA 4PQYA 3WP0A 4D25A 2AXPA 1F5NA 2B8TA 4FMDF 5EP3A 4LCBA 2ZJZA 2O8DA 5KSPA 2ZYUX 4CEJA 5AWFC 3A4MA 1HQCA 4QRHA 4BGDA 2OLKA 1PGYA 1R8SA 2FSIA 2OBLA 3I1FA 5DGXA 1Q3HA 2DWZB 2WJGA 4BFUA 1S8FA 1E4VA 1KNXA 2X8AA 1D2MA 3WP1B 1H65A 2FSFA 2DI0A 1QVAA 4OL0A 1GG2A 2O5VA 4DCSA 1XCGB 1XNJA 2LVAA 4B6EA 1M7GA 1MO4A 2MMCA 4EAQA 1VCMA 1P60A 2CNWA 3NBFA 5GJBA 4IDOA 4KCGA 2H17A 4TL9A 5KPDA 3QG1A 2SHKA 2CLCX 2J0UA 5DISB 4B75A 5JJKA 3BFVA 3TUJC 4HSEA 2BMEA 3RNLA 1XD9A 3WMGA 4A8JB 2BVNA 2CE2X 2FSGA 4WAUA 3ZDQA 3I62A 4M2LA 4RY2A 1DS6A 2CL6X 2G1JA 1VDZA 2WIAA 4RKFA 4A82A 3EAQA 3WNCA 2ZI6A 2XZOA 2CP8A 4QGAA 2CE7A 2YHSA 2YZ2A 1X1SA 4L9WA 2JEOA 4EJSA 1KDPA 5HKKA 5C18A 3A1VA 5DI9A 1WGLA 4D2IA 1Z28A 3ONWA 2OAP1 4C0BA 1BOFA 1ESNA 1P3JA 2O8EA 1LTQA 3JZAA 1VG8A 3BERA 2GDJA 3W8NA 2QENA 3LLMA 3PG5A 3QENA 4TL6A 1GNQA 3SHFA 4DUGA 4LC0A 5SZHB 2JY5A 2IHBA 4YDSA 2GCOA 4B76A 1YRBA 3KFXA 1KTVA 4F38A 4HLCA 4FW9A 5E4FA 3VKWA 2AKYA 3KXLA 1KI6B 4IHQA 4M1KA 1PZNA 4LYAA 1P2UA 4HYYA 4B2PA 5E3HA 3CPHA 3AVWA 1P3QQ 3GLIE 2GKSA 4JJKA 2IXGA 1EFTA 5JBQA 1E79A 3FKSD 2XAUA 1AS0A 1XPRA 1G5TA 1KI4A 3IUYA 1ZYUA 3EZFA 1Z2AA 2O8CB 1P73A 3AKCA 5FL7D 1E9EA 3QKTA 1Z08A 4LJ8A 1XEXA 1YJ5A 4B3GA 2WV9A 1KJWA 3X1WA 4A0HA 2VPPA 4AI6A 4Q21A 3VU9A 2LWIA 2LVQD 2WZJA 1TAGA 4AYWA 1YZNA 3GFTA 2RGDA 3THYA 2VP0A 4RZ2A 1MH1A 2O8FB 2HAKA 4B32A 3VKGA 1HT1E 2JLSA 1P9NA 1CF4A 2RGNC 3FFAA 4WOPA 4DSTA 3K9HA 4Q4HB 1Z0IA 2H8KA 1S9HA 5FTNA 421PA 1S96A 3LCVB 3NXSA 2WOJA 4Y0VA 2FWRA 3C5HA 1E2KA 4IDNA 5HTKA 1AM4D 4YXWD 1FW6A 4JLOA 2C8VA 4IVQA 3VNUA 2BBSA 3BGWA 3GJXC 4AC9A 2BCJQ 5KNDA 2FGJA 4UKDA 1XD2A 3BAFA 1CR0A 2CVFA 2HJGA 2IK8A 2JLUA 3PIRA 4CVNA 4PPNA 5FPHA 3D3QA 2QAGA 1G8GA 3H1TA 2QP4A 2BWJA 3NH6A 2O8BA 2J7PA 4URXR 2D3WA 3IPXA 1T0HB 2QN6A 4BZPA 4D4MA 1ZNZA 3R20A 5KNCA 4NCKA 5FL7A 2QMUA 4MKFA 3Q85A 3RS0A 4HZUA 4IOMA 1G64A 1BO6A 2ZYWX 4K81B 2OFXA 2W2XA 1KI3A 3W34A 3HPQA 3WBKA 3ZD7A 1SHZA 4ZCMA 4OHZA 4CEHA 3BH7A 4QC2A 4II7A 3U6BA 3W6PA 4BLSA 2R8RA 3B78A 1BS1A 3ZVMA 1CRQA 3KX2A 2QI9C 4TTPA 4GEWA 3WHLA 4MRPA 2BM0A 4F4CA 2C78A 4NCJA 3AVUA 3SYNA 1FPMA 4KITB 2KE5A 1UKYA 1KZGB 5J4HA 3CW2A 1N5LA 2MMGA 1TUEA 4YMVA 4DSUA 1D5CA 1TX4B 4CT4B 4L9SA 3AVPA 4Q5IA 1Z47A 1Z3IX 1FZQA 3QPVA 2OE2A 3CF0A 2FA9A 2HCBA 3CRQA 3FYHA 4RD1A 2JASA 2R6FA 2UVQA 4Z51A 2BIFA 2Z43A 4IDQA 4LJYA 1JQJC 4BEBA 3U7HB 3GLIA 3H86A 2B8WA 4CGZA 3WMEA 2J46A 4L8GA 1VG1A 3DHWC 2CLDX 4R7ZA 3K8YA 5CIQA 1G5PA 2WKPA 5G3ZA 2E9SA 5IK2D 4GBMA 2CHVA 4KYUA 2VRWA 4AG6A 1YRAA 3CX6A 1RC8A 1GNPA 1NBME 3C16C 3I4LA 3TLXA 4DLVA 3GFOA 2D06A 4GPTA 1YVDA 3RC3A 2GJSA 5EZ6B 1AK2A 4UJ5A 4YLGA 3IHWA 5F2EA 2JA1A 3WBJA 1Z0AA 4RVCA 5G41A 3BD9A 4B3BA 3KXKA 5EE0A 3U3MA 2D2EA 2BKUA 4MGIR 4JT2A 4XWOA 4XJXA 5J4LA 3KXIA 4NYJR 3H4MA 2NZ8A 3WNBA 2W6ID 3HU3A 1RJ9A 1T6NA 2IYVA 2F43B 2AK2A 1T91A 4FWIB 5JRZA 3OHMA 3U3OA 3EPJA 4DJTA 1P2VA 2WVJA 1W36D 1I4DD 1BMFD 4O3MA 3V4RA 2PJRA 4Z8YA 3GLHA 1E9CA 1ZUHA 3IDQA 5H68A 1P61B 3MRSA 621PA 3MWKA 1GITA 4MITA 5FOSA 3CX7A 4QHSA 4PHGA 4A0GA 2ZRKA 3MWYW 3LFUA 4TMXA 3ZYCA 3FPAA 1FX0B 2GWHA 5C4GB 5JHHB 1T3SA 3FWYA 4EUNA 3H84A 1HYQA 1TEVA 4BFYA 1W48A 3GEIA 4IRUB 3SBEA 5JMTA 3GJ8A 1T0JB 4PQFA 5JSZA 1N6LA 3SN6A 2XXAA 3QIAA 2XNDA 4US0R 2QRZA 2ZE6A 3WHKA 2P5TB 2ZRNA 3KJEA 4D0GA 1XXHB 1AS2A 4OJQA 4E5UA 3KQHA 4WIAA 3DZDA 1NBMD 2FGKA 2F7SA 3DMDA 2WMOB 2GEDA 2Z6VA 2G0TA 4FXPA 3NKVA 4Q4LA 2QMEA 1IN8A 3HWSA 2NPIA 3CNLA 3AVXA 2WPDD 1TQ4A 3L8ZA 1KK3A 3F0TA 2D7CA 2BMJA 3LV8A 2ZS7A 4M1TA 5LB2A 1OXSC 4HLQB 2XZPA 4V0NA 3WMFA 1D8TA 4Q1AA 2EFDB 1F60A 5KNBA 4BLOA 2C5LA 4NYJQ 3SJAA 3SYLA 2C95A 1RYFA 1G8YA 2YC4C 2HT1A 1RVDA 2V7QD 4MDFA 3CRVA 2JLZA 1N6HA 1NIJA 2JGNA 5EXSA 2KBFA 1OFUX 4WW0A 2Q9AA 4LJ5A 1QHYA 2QGZA 5DIFA 5FOTA 5FOXA 2LKCA 3CR8A 1NY5A 4DCNA 4LV8B 1IBRA 4P4SB 2ZRCA 2QM8A 1A7JA 1GNRA 1OFIA 3ZD6A 1JQLB 3ZJYA 2EFHB 4DCTA 1RRCA 2FEMA 3KKNA 4AK9A 1U8AA 2QPAA 4OHXA 1ZU4A 1W2HA 3FE3A 1S9DA 1NBMA 2NG1A 3NDPA 3TH5A 3P26A 4ACBA 2WSSA 3IILA 4LJ4A 2ZRDA 4KLNA 1WP9A 3H2YA 5AJYA 2WPDA 1HTWA 1E98A 1G9XA 1CS4C 1KMHB 3VTKA 2CL7X 3LVRE 1FUKA 4WP2A 1N25A 4RD4A 3EPHA 4QBFA 1TF7A 3DO6A 4Q9KA 5FPTA 5P21A 3REFA 4DLSA 3TUZC 4OQNA 1E2FA 4HAWA 2K9DA 1TQDA 2W0SA 4PXAA 2ZRHA 2W83A 4RKEA 3U44B 2R9VA 3MAAC 2PH1A 1SKQA 5BYJA 4EFLA 1P4SA 4Q7LA 1T43A 2RAPA 1JEDA 4KFRA 3T12A 1N0VC 3CKLA 4JSTA 4LHZA 3RSOA 2DFTA 1VECA 4EQ6A 4WZBE 5JLJA 4DC9A 1MT0A 2WJYA 1NF3A 2QL6A 3GLGB 2QQ0A 5JJIA 5CM8B 3SZRA 1G3MA 2C9YA 4TLEA 2ZU0C 5D3QA 2GZDA 3P27A 3ADBA 1RRPA 3WYGA 2WTUA 1WDTA 1KO8A 4UJ3A 4XSHA 2TMKA 1COWD 2VH5R 4RFSA 1C9KA 2C03A 5LD2C 1G8FA 1VCIA 3OEHD 2IT1A 4D26A 1XJCA 1N6RA 1OKSA 1II9A 5FPSA 2ZPTX 2DAIA 2VA8A 2ZJAA 4GMXA 2R0IA 4Q48A 4HEOA 1KI6A 2CJWA 4IOKA 1OKKD 2DY1A 1C1KA 1X8KA 2P2LA 5JS7A 1D2EA 1II0A 2JJ2D 4BLPA 5CK4A 4CEIA 3QPUA 2A78A 3L82B 4TLAA 5FUWA 1NLZA 1GKYA 2P65A 4IEEA 4GRAA 4A15A 1G8PA 1PUJA 2YVUA 1IY1A 1NVXQ 2WOOA 3PUVA 3W9YA 1JPJA 2O8CA 2AHOA 3KJHA 4GOKA 1QVRA 3DEFA 1WA5A 1WXQA 3B8HA 3KB2A 1GSIA 2JJ1D 4A8JC 5JWRA 2DB3A 2GNOA 2OSBA 3K0AA 3S1AB 1CJMA 4WVFA 2OCBA 1MO6A 2R65A 5E95A 2AXNA 2P6UA 3ND8A 4AKHA 3PUYA 1KDOA 4LHXA 5L3SB 5CLQA 2NPFA 4RFVA 2WICA 5FUXA 1VEGA 1C4OA 1KDTA 3G5UA 5FBWB 3DKVA 4Q18A 5AUNB 3OEHA 4PO9A 2GETA 3TSZA 4NONA 4MQBA 2F1RA 1PLLA 4TYQA 1TPZA 4PO1A 4N1AA 2DWOA 2OCPA 3EZ6A 3LA6A 3OIYA 4PHFA 4C30A 3U3RA 1A1VA 1G41A 4EKDA 3RRYA 3H4JA 1OKKA 1D9ZA 2QAJA 1V92A 1ZM3A 2OESA 3VKHA 1XTSA 2JJ2A 2JLWA 1Z6YA 2QE7A 3O47A 1RIFA 2IW3A 3ND9A 1IXSA 4AKGA 1E9DA 1IHUA 3K09A 1OT3A 2KB0A 4Q7MB 5EUMA 4S35A 3W8RA 2JDIA 1TU4A 4GZMA 2REOA 3MGCA 1M1YE 1NG9A 1G8HA 3ASYA 1GAJA 2DZNB 3HYRA 1ZC4A 2JJ1A 2A30A 3E1SA 4ARZB 1M2OB 3KDSE 1G7RA 3CX8A 5FH9A 3FHTA 1Q02A 3G82C 2ODWA 1R7RA 2PL3A 3SJZA 5JZVA 4KI0A 1EFCA 2O0JA 3HP1A 4LJ6A 1E69A 4IVRA 2WHXA 2JZ0A 1VQ1A 4NYIR 3K1JA 4OYHA 4HAVA 4FWTA 4POAA 1W0JA 2HLDD 1S2MA 1XMIA 1ZM7A 4WZAE 3HU2A 1UF9A 4CZ2A 1IN5A 2YOHA 1CJVC 3I3SR 3QOFA 4JLMA 1PV4A 4TLBA 5DHFA 1Q1EA 2MGWA 1K5DA 1W46A 5B57C 2OO7A 2VQSA 5KDOA 5GVRA 1XFAA 1WRBA 2BEJA 2QQEA 2EFCB 5FR1A 2ANBA 2GK7A 2B7CA 3RANA 5DNYB 3NHAA 5EJEA 2XB2A 2X2EA 4D80A 1FP6A 3PR1A 2YINC 1A2KC 1RE0A 2V6IA 4I1VA 1P9WA 1R5BA 3VFDA 1OXUA 1EWQA 2FPMA 4D6PA 1H8HD 4F4IA 3M0EA 2J0VA 3Q9LA 1CEEA 1CP2A 4FCWA 5DN6D 4EFMA 4A6PA 5E7JA 1QF9A 1VCOA 2A5GA 3W3AA 3EC1A 2C96A 5DO9A 1NMXA 4ZCLA 4A4DA 2DNAA 1ZIPA 4MRSA 2VSFA 2B3TA 1Z29A 2BEKA 3TSOA 3AGQA 3U7FB 3CUEF 5DE3A 2FZLA 4AURA 4BFWA 3I92A 5J40A 4C7OB 4H1UA 1N6KA 2IUSA 4M1WA 4RD0A 2QBYB 4ZDIA 1XTQA 2HLDA 3ZGXA 2ONKA 2GF9A 3AKYA 3N5CA 1VPLA 1ZM2A 4NCHA 2OOAA 2ZTSA 2PLRA 5HCIA 2JY6B 4US2R 3GJ4A 5EE3A 3RHFA 4X8LA 3T6PA 4NYIQ 1IN4A 2V8OA 4Z1MD 2F43A 5JS8A 3BXZA 2WMNB 2ZITA 2PZFA 4M9QA 4JVSB 4YC7A 4EFNA 4CDGA 4B44A 2FF7A 2KI5A 3E70C 1G3UA 4PHTA 4G01B 3UATA 4EPTA 1JR3E 3C14C 1OW3B 2FFHA 1F3OA 1S3GA 1VYVA 3VX3A 1H8HA 4DT1B 3GLGE 2KWIA 2QUZA 3EPKA 1W2GA 1E0KA 1OYWA 1OIVA 4Q9HA 1GTVA 1JAIA 4OQFA 3LCUA 3RS2A 2ZI7A 2ZYTX 4OK6A 4GNKA 3GJ5A 1JPNA 4G3XA 1C7YA 221PA 3G0HA 4LOAA 4UNPA 5KTYA 3AUYA 3AKEA 3LX8A 4U02A 2C98A 2G9NA 4DIEA 3LY5A 2IYZA 4LJ7A 4AIIA 1YHNA 4OBEA 1M7BA 3TJZA 1U98A 4G5SA 1GRRA 1NG1A 1Y3AA 4W5WA 2BBOA 5M04A 3D31A 4O2RA 5GJCA 3O8RA 4C0JA 1NRJB 1Z0FA 1IY2A 1E9AA 4JVNA 2DVWB 4R2HA 4KVAA 1G4AE 4AG5A 4TMKA 2JAQA 3LBIA 6Q21A 1E1RD 1QHNA 3OIVA 1W5SA 4KFSA 1IN6A 1E96A 3RSLA 1KHTA 4MYUA 5TDHA 3IGFA 4OHVA 4BPBA 1Z8FA 2HUPA 1CR4A 2V9PA 4MKGA 1WF3A 2Z4RA 4P3YA 3CH4B 5A4JA 3TAHA 1UBEA 5K8IA 4LSGA 4C4PA 2ZUBA 2LBCA 1LS1A 3QEOA 1EXMA 1SVSA 2CCGA 2HXYA 3MCAA 1JR3D 1F48A 4QNRA 4B74A 1OYYA 3CWZA 4MGKR 4XD7A 1F6BA 4BFTA 1G18A 3U3JA 3LLUA 5LD2B 2ZR9A 3W5JA 4J0QA 5SZKB 5TY0A 4KO8A 1OPXA 2E1RA 1N0UA 2CBZA 1E2DA 4B2LA 1XB2B 1G21E 2HYDA 3KQLA 2C9OA 3DM5A 3SJCA 2D4HA 4DSOA 4ZO4A 3VMFA 5JFGA 2LVNC 2PX0A 4XOIA 1X8JA 2IYRA 2GILA 1HQYE 1XMJA 1E6CA 1LW7A 3MJRA 4QOSA 3GMTA 3TNFA 5L3QB 1OFHA 3FMPB 3T34A 3I8XA 1NN0A 4GOXA 5JEEA 2FPKA 4FD2A 3KKMA 2G3YA 4Y0AA 4FIDA 3TR5A 2OXRA 1KNQA 1ZINA 1KY2A 3CPEA 3OFND 5EE5B 1K5GA 1P7CA 2NQ2C 3ZVRA 4NZYA 2V6JA 3DOFA 5EUQB 4EDHA 1DAHA 4GFDA 3THWA 2EQBA 4HB2A 3IO3A 4MYHA 4NMMA 2CL0X 5KUTA 4XSGA 4NTZA 4JLAA 3I5YA 1JR3A 3LD9A 1G3QA 3Q7QA 1ZNYA 1WR1B 1DAEA 2XSZD 5EXXA 4DVGA 4JVMA 5ELXA 5EP4A 3SFZA 1E2EA 3KZ1E 1R4AA 2FFBA 4MRRA 4BLRA 1II8B 1QZMA 3K70C 4GITA 1TF5A 3DM9B 1T8TA 2DYKA 4IXNA 3RRNA 4Z54A 2ZJOA 1AA9A 1KAOA 2IC5A 1RRGA 1BH2A 4GDFA 4DLUA 3C41J 3B89A 3SE0A 2JZ1A 2IA5A 1EG7A 4XVQA 1ODFA 1Z6TA 1XEWY 2NTYC 2JLYA 2C2HA 4G5OA 4C9BA 2ZTDA 1SQ5A 4DDWA 2QROA 2AFHE 4QJ5A 4JLKA 1HY3A 1EX6A 2WWYA 4BUJA 4ERNA 2L0XA 1AZTA 4M22A 2ZETA 1T3LA 1SVWA 3QXCA 2AD1A 3QF4B 1E9RA 1EESA 2IYQA 4P4UA 2ERYA 1TQ6A 3OFNA 3RS5A 4HEJA 3NBXX 1CR1A 1GL7A 1LVGA 5K8UA 2RKOA 2FOLA 1QHGA 2ZRIA 2XZLA 3NWJA 1BVSA 2YJTD 1E0JA 2AKAB 5F9FA 3ZIAD 1G7SA 3SYKA 3X1YA 4UNRA 5D3MB 1A5TA 4TMWA 3HR8A 1RFLA 3LXXA 3K0FB 1H8ED 3E46A 2XSZA 3FDIA 3JVVA 5GJVC 5JCPA 2ZE7A 4R98A 5FBLB 1Q1QA 4LWZA 2AN9A 3IHPA 3EIHA 3EWSA 1TMKA 5B2ZA 2R6CA 2Z5FA 3KW6A 4FMBB 3DDCA 1VIAA 1HJPA 1S1CA 4MUAA 1J2JA 3VR1A 3VHXA 4XWKA 1IXRC 5F9HA 2OFOA 4LGMA 2PX3A 2VHQA 3KKQA 3AM1A 3D6TB 3D7MA 2KBEA 4B3DA 2LTUA 3U5ZB 2MSDB 2PT5A 1RRFA 1G3IA 4RCYA 2G83A 3A1SA 2QY9A 3TUIC 2QHOB 3IIMA 2QSZA 3SI7A 3LXRA 1WCV1 1Y63A 1XEFA 3A37A 1QG2A 4JS0A 4F2LA 3O8CA 3HPRA 3EPLA 4KAXA 3UANA 1DE0A 1U8ZA 1HUQA 8OHMA 1OH6A 2HXSA 2VTKA 5HZHA 1N6PA 3ZIAA 2WWWA 5DFLA 3FKSA 3LO5A 4JSYA 3TE6A 721PA 3LW8A 5KSOA 2R62A 3AVQA 2QP9X 4Q01A 1Q22A 2JLQA 4U5XA 1OH8A 1E9SA 3VR4A 4DLYA 2PCJA 1DEKA 3MFYA 5FR2A 3MUFA 4A36A 2P6NA 4PPQA 1QRAA 1JJVA 2PMKA 4V0KA 4I81A 3BH6A 2YOFA 2YWEA 5FTJA 1FNMA 2OCYC 2DAEA 3L0SA 3K9PA 1U94A 4Q19A 4R9UC 5BQ5A 1L7VC 2IWHA 3QXXA 2OT3B 2A3RA 2J5XA 5CYOA 1SKYB 4B47A 2G0NA 2NO6A 2L2DA 1L8QA 1CULC 2QEQA 2ZR7A 3PITA 3RS4A 4AD8A 4DLZA 2IX3A 3GJ3A 2Q9CA 4LZZA 5EXPA 4MYTA 4Q03A 4A6XA 4BFZA 1VEKA 1NP6A 4BASA 4ZIRB 4ABYA 2VP2A 1FMJA 3VQTA 2ZVQX 1WHCA 5GVSA 2ZRFA 4URZR 3WNDA 1VCNA 3M1IA 4YMUA 4NPHA 2ZS9A 2GJ9A 3T1VA 2NO0A 1WGNA 4IDPA 1SULA 4YXWA 2X19A 4FCVA 1R0XA 5KDLA 1G19A 2OFWA 2CVHA 1UDWA 1OFTA 2VYFA 1VTKA 2EKFA 2ZUCA 3A1UA 2RGBA 3QG5A 3V9PA 2Y8EA 1NKSA 3AVOA 4HLUA 5DHAA 2R6AA 1VYTA 1HE1C 3EZ9A 1LF0A 2KSQA 3JVUA 4Q66C 3CH5A 3I73A 4M1SA 3OEED 5UKDA 3O8BA 4CF7A 2J0SA 3QY0A 2QTHA 4URVR 4DDTA 2OCAA 3U61B 3V00A 1ZM9A 5KPJA 1XRJA 5AUQA 1RKBA 1W47A 4ESHA 1Z0DA 2V54A 1HA3A 1KOFA 1OH7A 5CJPA 3EIQA 4B34A 3IEVA 4KYIB 2D62A 4JBWA 2CXXA 4PR0A 2L4FA 4LV6A 3TW8B 2KNVA 1EWRA 4W7SA 4GSYA 1IFYA 3FHOA 5A0FA 3EA0A 2DENA 2EWVA 3IIKA 1RW4A 2GAAA 4UXJA 4XWAA 1QHHB 5B64A 3T1TA 1AKEA 4WZ6A 5C1BA 2QTFA 4HAYA 1FNNA 2RMKA 5H70A 3LQRA 1BYUA 2QNRA 2K5UA 2WAXA 3L2OB 4Q4AA 4TTQA 1A2BA 4WBSA 1P6XA 1DG1G 3IQWA 4DT1A 2R6DA 1Z6GA 2BV3A 3CONA 1DAGA 4NYMR 2H5EA 1LFDB 2MJ5B 1ZC3A 2HJVA 4C0AC 1HH4A 3LW7A 1DAKA 4RSGA 5FPYA 4PX9A 3FRHA 3IKJA 4MYCA 1X8LA 2Q6TA 4MRVA 1KO7A 3UIEA 1F2TB 1UJ2A 3W6NA 1DO0A 1GP2A 5IK2A 4OI0A 2EFGA 2XX3A 2A9KA 3NIBA 1DVRA 3QKRB 1R10A 2ZQ5A 1HT2E 1BIFA 1NVVR 4DEXA 1EFUA 4HUQA 1WIVA 5AJXA 2OBMA 1VDLA 1LY1A 5TB5A 2FZ4A 2KNZA 4KHZA 1KK0A 3HYTA 3NH9A 4GP7A 4AWXA 4CW7A 2JLXA 2FDCA 1P62B 3F92A 4EPWA 1OLOA 1SXJC 3TIFA 3U4QB 3RC8A 3DOEA 3NC0C 2JY8A 3A4LA 1UBCA 1MABB 3ZZ0A 3BB1A 4ZKEA 2CMKA 4LC1A 2I4IA 2GZHA 1MR3F 3WRXC 2ZS8A 2W6IA 5GADl 3TVTA 4TL7A 5BXQC 5FI1B 1NY6A 3ASZA 2ZRBA 4LBYA 3Q5EA 4TZ0A 1LNZA 1BMFA 1E2MA 3FOZA 2F1HA 4ACAA 3ETLA 3K70B 1CTQA 3Q8XB 4QNMA 1J90A 4GP6A 4JL5A 1N5IA 4L15A 2V55B 4YDHB 1US8B 3CF2A 2BC9A 1AQUA 3OZXA 1TF2A 5KU1A 1Q0UA 5G40A 3HJNA 2IS4A 4FCTA 2A5DA 4RD2A 1WJ7A 3A58B 4DLWA 4TMTA 1SVOA 2KNAA 3QNUA 5L3RA 2RRUA 5DYGA 2R2AA 2ORVA 1A4RA 3NTUA 3RVBA 3TAUA 1R8QA 2Z4SA 2WWFA 3GLFB 3EZ2A 3ZVNA 1KSFX 5FI0B 5JCZA 1ZW6A 1BYIA 2ATVA 3LX5A 3NVAA 3QE0A 4JT4A 2MROB 1S3SA 4PQRA 1ZD1A 1FUUA 1YR9A 3K9NA 3AF1A 2I3BA 3QVUA 1P72A 1NVVQ 3AP3A 1VEJA 4EPRA 2J0QA 3OE7D 2ZI5A 5BYKA 4FWDA 4E07A 5TXGA 2O8DB 1ZAKA 2PBRA 5KOYA 4CEJB 1ZJ6A 1NVWQ 3ICEA 1WBBA 3SS8A 3F8TA 2V1XA 3C5CA 3K9GA 1IAQA 3H0KA 5FOVA 4A8JA 3W5IA 2XB4A 3TR0A 2D2FA 4DSNA 4BZQA 3SEAA 1UKVY 3K53A 4HDOB 4KJZA 4QM6A 2GEVA 1VG5A 2RGXA 4LV5B 2V7QA 3BC1A 5KO2A 2H1LA 4TT3D 2N1BA 3QXSA 1E2LA 4IKEA 1VYUA 4A0FA 2JJ8A 2WJIA 2B7BA 1SKYE 3LNCA 2IF0A 1CRPA 1II8A 4LY6A 2BHRA 4NDZA 4F1IA 1G1MA 1X3SA 4Q7KA 4TQUS 4HAXA 2G88A 4KLZA 1U99A 2LCFA 3QQ5A 2H7VA 3FE2A 3I32A 4JN6A 1WMSA 1T4GA 4ITRC 2RCNA 2YWGA 4PC7A 1G7CA 2YC2C 1QHSA 1QHIA 3U2QA 4BQSA 4C0KA 2FN4A 2GAOA 4Q9JA 4JZKA 1OB2A 1HE8B 1E2GA 4PC3A 2GJKA 1X37A 2F6RA 3ZS8A 1T6OA 5E7IA 1OXXK 1S1MA 4YMSA 3F3YA 2YWHA 4TSFD 4B33A 3CIOA 1YZTA 2G1KA 4QGFA 2O0KA 1HURA 3VR3A 4BE7B 2BKEA 4NH0A 2V1UA 3NEYA 5G53C 1OTRA 4ZV4A 1HV8A 4PAOA 1EFHA 3BBPA 3EASA 4G5QA 3REGA 2WJJA 1DO2A 3QI2A 1LB1B 3GD7A 4OKSA 2OILA 2O8EB 2J9RA 1E94E 3I61A 2J87A 4TT3A 3T15A 2BCGY 821PA 1WE2A 1KO4A 3Q7PA 2CK3D 2VO1A 4D81A 2Z83A 1OQYA 1TU3A 1OAIA 2XGJA 2ZRJA 1Q1BA 1DBSA 4D82A 4WXPA 2ORWA 2ZSFA 3R8CA 1PJRA 2RHMA 3R9IA 3ZVLA 2OUKA 4HB4A 1W4BA 1DADA 3MWJA 4QGHA 1UFZA 1COWA 1ESMA 2PJZA 4C2UA 2O8FA 1XCMA 2OXCA 2IYSA 3JZMA 2EJSA 2OO9A 1DELA 3ZQ6A 3RWMB 2JIZD 1B0UA 4PZLA 4Q7JB 1SVMA 4Q4HA 4A9AA 3AP2A 3K9OA 3ADCA 1ZVQA 4TSFA 4B73A 4QFMA 2ECKA 2O0HA 3MHVC 2PMDA 3GJ0A 3R8FA 3M6AA 4AKIA 3PUWA 3EA5A 3QKUA 3BS4A 2XNSA 1ETUA 4N3NA 3ZZUA 1DAFA 4KBFA 3SDZA 5BN5A 2LVPC 3B1VA 2XTMA 3X2SA 4G5RA 2OLJA 1NMZA 3A1WA 4NCNA 3Q3JB 2FH5B 4DLXA 3THYB 1YZUA 1TADA 1U9IC 4AKEA 1M34E 2NO1A 4MRNA 4PTLA 4TL8A 2CK3A 5A5GA 4NU0A 1W0KD 4KSBA 4BZXA 1KSJA 4KFUA 3PJRA 2QTVB 4P31A 1U90A 2ZSDA 521PA 3UPUA 4TQAA 1XXHE 3FHCB 2ZJ5A 4XVUA 2HDNB 4V0OA 4EPXA 3TRFA 2UZ3A 5BWMA 5AR1A 2ZAOA 4HDCA 3EG5A 4HB3A 3LBHA 4ZDJA 5HPYB 2AD5A 3AQ4A 1NJFA 2FV8A 5HCNA 3EW9A 2RHDA 1A82A 2QAGB 4G5GA 1N2CE 4PSAA 2VSXA 2O8BB 4RCZA 3T5DA 2GBLC 3NBYC 3X1DA 1Z5ZA 3LBNA 2IL1A 2Q9BA 4HZUB 3UMRA 1UM8A 2A7QA 4PPFA 5IRCD 1XPOA 3FVQA 4D0NA 3BFKA 1TTTA 1Q21A 1AKYA 4IEIA 3CWQA 3QJYA 3IPYA 4DRZA 4QJ3A 4LBVA 2JATA 3THXB 1D2NA 4KBGA 2OG2A 1FTNA 2ZI9A 3OIWA 2X1VA 3N70A 3QF7A 1N6OA 2Q3MA 3ZS9A 4YQFA 3KTAB 1YZQA 4V0ME 1DARA 1W0KA 4P0TA 4D4LA 3GLFE 3SC3A 1G4UR 3BB4A 3FMIA 5J47A 5IDVA 3NEJA 4XIGS 1EFRD 1IN7A 1SXJB 3AP1A 2ONJA 4ZDKA 2C9CA 1JECA 4I99A 5AJWA 4LPKA 4DBLC 2Q3FA 5JWOA 2EKKA 1IQPA 2JUJA 3CB4A 1TTEA 2ZJ8A 3PEVA 1SVLA 4LK2A 1GDDA 1S4QA 3EIEA 1E2HA 3SQXA 3BK7A 3OIUA 1XU4A 2WBLC 1KKLA 5EZ5A 4PO8A 4KODA 1E2IA 1QHHA 2VSOA 3ZQJA 5H1YA 2QSYA 4TMZA 3CBQA 5LBIA 3GLIB 3B5JA 1Z83A 4IXMA 4TMVA 2ATXA 4CRWB 3K9LA 1CLUA 4HDQB 1PVOA 4Q4JB 4QM7A 1GO5A 1DV0A 3MMPA 2O52A 1AN0A 2ZE5A 4JJZA 1EX7A 1YQTA 4QBIA 5F3WB 1Q3TA 2YOGA 4LHWA 2DHYA 2GHIA 2WIBA 3K70D 4U7DA 2J45A 1OE0A 4KFTA 3DVLA 1AS3A 3I8SA 1VHLA 4M21A 1WQ1R 4DCVA 4MUBA 1MRNA 1T8UA 3AF4A 1SVIA 1FX0A 2GZAA 5DN6A 4JKIA 2GCPA 5FBQB 4JYBA 3CRMA 4E22A 1F2TA 3WY9A 5FBVB 1MO5A 3OAAD 2VHUA 2GF0A 1CXZA 4JLVA 1RJ9B 4Q1BA 3RS3A 4OQXA 4Q02A 5FBRB 2NZJA 5DSZA 2WKRA 2MR9A 2VL7A 1ZD8A 3LDAA 4FINA 3KB1A 1VG9B 4NE2A 5LPNA 3P1JA 4OHWA 1MKYA 4NBSA 4LJAA 4UN2B 1G17A 1Z06A 1XXHA 3U4QA 3GLHB 3VNVA 4PHHA 5KSYA 2P5SA 2IYUA 4D0LB 2KHHA 1MABA 2EU8A 4QKQA 2GVDC 4DKXA 1KJZA 2HV8A 1I4TD 3AKDA 3MJHA 1YU9A 4U00A 4DLTA 3PEUA 1JXOA 4Z1MA 1ZNWA 2KRKA 2J41A 5J4YA 3ZH9B 1DPFA 1W4RA 1XD8A 3P4XA 4XTRA 3T1OA 4FI3C 4MGYR 4JYCA 2W6JD 2XXAB 3GPLA 2QA5A 2C04A 2WWXA 2O25A 2VP6A 3MLEA 4LHYA 1DTSA 1T5LA 4JKYA 1O3YA 3QSYA 2F9MA 2G3QA 1SVKA 1RZ3A 3VLFB 5DI3B 1N6IA 2ZU6A 1OIWA 4ZPXA 4P4SA 1KSGA 1FMLA 4DLRA 4TYYA 2OOBA 2H16A 4V0MA 1SZPA 4K8OA 3GLFA 3CF6R 1E3MA 2H18A 1E2NA 4ZI3A 1UAAA 4JL8A 4I1UA 1OXTA 4PFSA 1LF5A 2QG6A 3DMNA 3QPWA 3MSXA 1VKJA 2EFEB 3SFVA 4B2IA 2DAMA 2C99A 3P4YA 1P2TA 3TQFA 1NN3A 2AK3A 1JB1A 2RGEA 5BN4A 4I1OA 4M9ZA 1GKIA 4O0MA 2LVOC 3SQWA 1KMHA 2VHJA 3FB4A 2W00A 1OSNA 2ZRPA 1E1RA 2NGRA 1XZPA 2IHYA 5HKKD 4UNNA 5FOWA 2ZROA 2VEDA 2PT7A 4FWHA 1NV9A 3E21A 3BJIC 3FMOB 4S2EA 3AJIB 4DIDA 3QXHA 2DHRA 5FTKA 3AV0B 2W6JA 1NSFA 1OB5A 3U44A 1F2UB 1GILA 2XOKD 2ZSEA 4US1R 3RYTC 2CDNA 2ODBA 1AIPC 2V6ZM 3IBGA 1LV7A 3F5FA 4TLCA 4N0EA 4LYHA 4DUGD 1IY0A 1EGAA 2RGCA 1ELOA 5HE8A 3IECA 3N2IA 5BN3A 5EXTA 3NBZC 3GLGA 2QT0A 1KKMA 3I5XA 2YYZA 2RGNA 2P6RA 2BJVA 2Q3HA 3TVDA 1GOTA 2ZE8A 4OI2A 4DB4A 4B6FA 1ANKA 1W4AA 1OV4A 1TL7C 5ANRB 1Z2CA 3PVSA 4C0LA 1ZCAA 3W3ZB 1E79D 1MRSA 1OHHD 1OF1A 2ZJ2A 3AH8A 3TBKA 4M9SA 5KSZA 3LH5A 3CRW1 2MSEB 5EE9A 4B43A 2AFIE 2R44A 4NP6A 1R5OA 3B1XA 1JNYA 4TYWA 4EQ6B 1ZP6A 3CM0A 2ZXUA 2HYIC 1OJLA 1R4GA 3N2EA 4ZI2A 3TKLA 3BIFA 4L16A 4UNSA 3T61A 2BDTA 1DG3A 2H92A 3KJIA 4KVGA 4FMDB 121PA 1CIPA 3BORA 3BRWD 2XOKA 4ON9A 1JALA 5TMPA 1E0SA 2FEOA 1U0LA 3K0CC 4DZZA 2V3CC 3Q72A 4RFSB 4F7WA 1SXJE 3EC2A 2F1JA 1N5JA 3OESA 4E03A 1PLKA 2QM7A 1NLFA 1VHTA 3CNOA 4DHEA 1RPZA 4DB2A 4QL3A 3U7GA 4LUCA 4TYPA 2GCNA 3BOSA 4LRTA 3S1AA 3PQCA 5KHOC 2CJWB 3AF3A 4M8NE 1TUIA 2FFAA 5HR5A 2JY7A 4CEIB 3EXAA 5L3SA 2ZI3A 4UNQA 3RABA 1OHHA 4BFXA 3AF0A 1JJ7A 2IS1A 4Z8XA 1TNDA 4Q7JA 1F4IA 1IJFA 2J7PD 5AUPB 5GJWC 1P75A 4RD6A 4C3ZA 1J7KA 4QJ4A 2OZEA 2KJQA 2IYLD 3DKPA 4UXHA 1R6BX 4O2LA 3K0AB 3ZZTA 4PAMA 2PZGA 3VX4A 4JMPA 1AQYA 2AR7A 4DDVA 1UBGA 1KIMA 2IUTA 4OK5A 2ANCA 1W44A 1K8RA 1AGPA 1Z0JA 4BFSA 4W9MC 4M1OA 2AWNA 2VF7A 4O25A 3VAAA 1T5IA 4EJSC 1UPTA 4JL6A 4PANA 1IONA 1ZUIA 1H8EA 2PEYA 1U8YA 2VHCA 1OXVA 2HEIA 2VF8A 4DDUA 4OI1A 5B58C 1XPUA 4ARZA 4LYJA 2HF8A 1DAIA 3IBYA 1SXJD 3U7EB 1ZD9A 4G0NA 2QT1A 2ZIAA 3GLHE 3GEEA 1DAMA 1W49A 2OM2A 1AJEA 2DKLA 1XP8A 1J8YF 1Z22A 1NIPA 4Q1FA 1ZMUA 4MA4A 4P33A 1E9FA 3T35A 4A2QA 3GQBA 1G7TA 2CEAA 1IXSB 2RGGA 2ODNA 2DR3A 3DZ8A 5L3VA 3D8BA 2ZRLA 3BBZA 3L0IB 2CLSA 2P3SA 2N42A 1U81A 1UFQA 4URYR 4YONB 4PZYA 1I2DA 1ZV1A 1E1QD 3IQXA 5FUYA 4JIMA 5AUOB 1YR8A 1E2JA 1RYHA 2Z0MA 4G3OA 3U60B 2BMDA 2J3EA 4LX0A 4OJKA 2YNMA 3RRZA 3VHLB 1NJGA 4H9GA 1U2RA 2Q21A 3EX7C 1XTJA 3L8YA 5L8VA 3EWAA 1B23P 3TGPA 1LS6A 3PEWA 3THXA 2GXAA 1SG9A 3QBVA 3GJ7A 4PC1A 4QHTA 1W7AA 2YKGA 4C2TA 4MGZR 1NSTA 3KTAA 2DPXA 1CJKC 3B1YA 2OHFA 1SXJA 1E4YA 4M9XA 3C8UA 1XWIA 1M7HA 4HLDA 3KQNA 3A4NA 2ZAMA 4CYMA 4TQ9A 3J81k 2OAQ1 3CZPA 1P9RA 5FPKA 4LRSA 3ADDA 4C7OA 1V5WA 4IOJA 1G5RA 1CJTC 2GXUA 5EQTA 2RB4A 3BH0A 1FTSA 4Q9IA 2QBYA 3TMKA 3ICQB 5IF9A 2QZ4A 4PSVA 2VHTA 1M8PA 4Q1EA 3R9XA 2GJ8A 2YV5A 2H57A 2FMXA 1E1QA 2J59A 3LRPA
chains in the Genus database with same CATH superfamily
5IFKA 1GJTA 4BATA 2D8AA 4OHMA 5C2JB 3NG1A 4Q1CA 1XX6A 1E1CA 4RZ3A 2QY6A 5CB4B 2A9JA 16PKA 1HSZA 1GL6A 2WD7A 1ZBDA 3TXXA 5KDDA 2PGNA 5IJ0B 3AR5A 4IS2A 4JC4A 5KTOA 3EGWA 1NNJA 2RH5A 1X7HA 5F2OA 3GJ6A 4R3NA 2ZEJA 3B6EA 4C6RA 3H2GA 4ZCIA 2D4AA 4A10A 1LU9A 4WFKA 4FGZA 1YZ3A 3T99A 2MSCB 3B82A 3DBRB 3GRYA 3T1QA 1LPAB 3GNQA 1D6JA 5BW8A 3TGWA 5AKGA 2JBAB 2P27A 2PJDA 4XPIA 1K6IA 1HFKA 1T9HA 1SCAA 2NTJA 1MV5A 2JARA 4XYLA 2FW9A 3CE6A 4M1MA 2G1UA 2O2DA 4DBGB 4URWR 1VG0B 1MX1A 4P7GA 1EXDA 1L5NA 1CJUC 2H85A 1YDMA 4MGEA 1RKQA 5DKFA 5LZ7A 4C0QC 1ZRHA 2IDJA 1SC3A 3W8FA 1EYZA 3B9PA 1H2XA 2WYWA 3KR0A 4KGVA 3HU1A 4LYGA 2VDPB 1GEEA 2XQVA 4HNUA 1IHXA 3LGSA 2DP4E 3M5PA 4W9RA 4AKSA 1TVCA 2QOEA 3W05A 1YE8A 1SB9A 4YJGB 3WYEA 2FE4A 4TWZA 2DWLA 4MWBA 3N74A 1ISMA 1NXPA 1SBHA 4Q47A 1N1DA 1U5BB 3RYCB 3JQAA 3SC6A 2JNHA 4N6OA 1JA0A 3O0TA 4E3ZA 2HWJA 3EH2A 3NTOA 2DSTA 1OH5A 4WCFB 5KYXA 2B6HA 1L4NA 1U0TA 2IYWA 1P2SA 1JFTA 4N6GA 4KGXA 3AVYA 4EKNB 1MAUA 2RC6A 4HUTA 4MO9A 1I1OA 5F78A 1R0YA 3B3FA 5BNZA 3S55A 1NTRA 2CUKA 3UXHA 3KV1A 3DEYX 1KBZA 4IHKA 3CEJA 3RIMA 3U5TA 4XAQA 2Z5LA 5ALGA 3A46A 2AFHB 2R00A 1D5WA 2AX4A 4W9NC 4OQ4A 2IYOA 3D6FA 4D3SA 1GCIA 3B51X 4YLYA 2IXEA 2BI8A 4WDRA 1FQKA 3RQIA 2O54A 2QG4A 4CIWA 5BOVA 1GPBA 4QUAA 4C0HA 1ABEA 5CFRA 1T5BA 5AI5A 3QFSA 3OF5A 4OA5A 1JI0A 2E87A 3IT1A 1EFRA 4KQ2A 4YUYA 3HBAA 3DKIA 2Q0XA 4DXAA 3HR7A 1QUTA 1A9OA 3G5TA 1X0XA 4FUQA 4B48A 3OTIA 4J90A 4N76A 5L3ZA 4N6NA 1ACMA 1YC2A 3SBJA 3R5FA 5EWMA 4EYOA 3KJZA 1OIZA 2NWQA 1AX9A 4I08A 4FS3A 3QOXA 2VTEA 1Y8GA 2UXDM 2RGUA 3T4EA 4BV3A 1AHIA 1JVNA 2OC4A 3FKQA 1W85B 4OQMA 4PZPA 5SZJA 3LWBA 2P9JA 1ZCFA 2AZDA 1N2IA 4L57A 2IOHA 2Q3BA 3N2KA 4BLUA 1YE5A 2O8DA 2Y92A 1HQCA 5KYYA 3ABZA 4RTSA 3G1UA 3C7AA 2FSFA 3D0RA 1XNJA 1A8UA 4NNJA 3DEZA 1YJBA 4KCGA 2SHKA 4H7DA 1EDBA 2XWQA 5IF3A 2RG1A 4PCLA 3WMGA 5C8YA 4TRNA 4I4CA 1KS2A 4MQLA 2A84A 3PQ5A 2CE7A 5AOBA 2BEVA 4WLNA 3O26A 3AW8A 2RGOA 1CY6A 2CF5A 2OAEA 5A6VA 3GG9A 3RW9A 3AJRA 4DUGA 3HXTA 3KXLA 3ZWVA 1PZNA 4OFWA 4YAKA 4JJKA 1CLEA 5DXFA 4BP9A 1KI4A 2O8CB 2Q3JA 2WZJA 4H3VA 2VP0A 2OBYA 2BLLA 1MH1A 2Y3IA 2RGNC 1Z0IA 3N86A 3VOSA 5KSWB 3I4VA 1FP4A 5HIIA 2VDMB 3C5HA 3TO5A 1LNQA 1Y98A 1AM4D 4CLRB 4FOOA 3EEBA 3DYBA 2JD2A 4MROA 4G8BA 3PD7A 2Z2YA 3R20A 3FNQA 1A27A 3W3AH 1PNQA 1V7QA 1BO6A 5F1PA 4II7A 2XQKA 3OQIB 2X15A 4I5IA 4TTPA 2VXCA 4EX7A 3MTEA 3MRTA 3GQ5A 1T9CA 3AJDA 4WOCA 2H65A 1JEOA 4CT4B 4F60A 4RENA 3AVPA 3MIIA 2PX2A 1ZIYA 2HCBA 3AR9A 3EOAI 1R88A 1XGKA 3JWEA 3WNVA 4Z7JA 2B8WA 4EG6A 1B6SA 4KL8S 4P22A 2GSWA 3Q3VA 5G3ZA 3JYPA 5ALLA 1DCFA 3GFOA 1JFRA 4IXDA 4YLGA 2FPOA 1V47A 3NBQA 1F8XA 1EJ6A 3D3WB 1YJQA 4JT2A 2R66A 1K6XA 5MGBA 4U7WA 1XNRM 2IGTA 1ZR2A 3OA0A 1BMFD 4U7FA 2BFBA 1H1DA 2HX1A 3FDZB 2ISCA 3G5MA 1Y8RB 4B6SA 1A9ZA 4KXWA 3CTPA 1B8NA 2P30A 1L6RA 3N8KA 2XNDA 4D0GA 3GN2A 1NBMD 1IQ0A 2ENUA 1JG6A 1AQLA 2AN4A 1DV1A 3H1EA 3LUAA 1NA5A 4WKBA 4Z6KA 3UJ9A 3R4CA 2QUIA 5JAQA 3KQTA 3HDGA 3CRVA 3I37X 4FGWA 1SN7A 4CIYA 4DCNA 4KQWA 2R6JA 3G2KA 2E18A 3ZD6A 4RVOA 2V65A 5F52A 2QUBA 4L95C 4PFQA 5AJYA 2JI6A 1TF7A 1KC3A 1NVBA 4KLRA 2NYAA 1TQDA 5JTUA 1ZQ9A 1H94A 3VBEA 5BPFA 4CKYA 5LZ4A 3CKLA 4D8WA 4RYDA 3GLGB 3UHAA 4G0QA 5JNVA 5JJIA 5CM8B 3SZRA 3W6UA 4TLEA 3FCEA 2DVMA 2JWSA 2QJRA 2CJFA 4LFAM 3BTUA 5ADVA 5JCXA 4OO3A 5IXSA 3CS3A 1GSAA 2PX6A 4NU5A 2FDRA 4IOKA 2C4KA 4EK9A 3LOPA 3DH0A 2R1UA 4DANA 3BHIA 4I50B 4RJTA 2XA1A 4NZMA 4BHTA 3FLMA 3WOHA 4ZN6A 5LYYA 3R7BA 2AXNA 1UFRA 2XT9A 4YCSA 3AXTA 1XUOA 3IBSA 2IEAA 1TPZA 3AHHA 4MGHA 2W6NA 2JRLA 4DRYA 2GH1A 2JLWA 3E3NA 2QE7A 2SKDA 1IXSA 2V74B 4GP9A 5KWSA 4CKZA 1J7JA 1P91A 3K09A 2W2OA 1KYQA 3RTAA 1RMYA 2VYVA 4PTZA 4J2HA 1QX3A 1ZC4A 2CJYA 1YCHA 1Q02A 4LJ6A 1QFZA 1TVEA 3Q40A 1A71A 1NR1A 5D85A 2YS7A 3A3PA 1P33A 1SPXA 3T1NA 2RKBA 2G5GX 4BNKA 3UAOA 4NF2A 3SSMA 5TPWA 2X2EA 2CDAA 5KVSA 1EXWA 3WDKA 4H6PA 2XT0A 4X93A 2VP3A 4UAUA 3UGKA 1QH8B 1UFVA 3T1HB 2NU7A 3BRSA 4F2DA 4X85A 1O96A 2GF9A 1ZM2A 1E3JA 3LCMA 3RHFA 4IIYA 2PH7A 1I2AA 1T6ZA 2ZITA 3I64A 4RTQA 2FFHA 3GLQA 1EXNA 1S3GA 1ULHA 2HLNA 1IZZA 1R6VA 3AFHA 3H65A 4Q12A 4TUYF 3R7AA 5KTYA 1QX4A 4U02A 2G5CA 1NNUC 4EEZA 1Z0FA 3WNQA 2PV7A 1E9AA 2E21A 1LC0A 3SP1A 3DHYA 3AOEC 2PK3A 3VA7A 4GVLA 1PW5A 2JGKA 4BNLA 1HE5A 4BIIA 3CF4A 4A03A 4NPCA 2B94A 2YRXA 1M6EX 1V8BA 5JVDB 1T0IA 1Z26A 5MN5A 5LLTA 4ABTA 3WHIA 3OZTA 4PSDA 1SXQA 1X8JA 4FYMA 3GEDA 4YH1A 4I55F 1Y8QA 4HTFA 2ZM6B 5JDCC 3GPPA 4QUGA 4B3TB 5TPZD 2NSDA 3VZDA 3Q7QA 4IO0A 1GO2A 1DAEA 1DC6A 3U7QB 4MRRA 4FEEA 5HTOA 3RUCA 1DWOA 1F5SA 1R6DA 1SQ5A 2R68A 2VUSA 4ZI7B 1VRWA 4DM7A 4XOUA 2WT4A 5F9FA 3ZIAD 4KMRA 4PZCA 5C0OE 3G2OA 4PYKA 3FDIA 1D0VA 5G0VA 4QPNA 2Z5FA 2FPPB 1HNZB 4BTVA 4GI1A 3HGQA 3VDPA 3Q8LA 3D7MA 4JJ8A 3COJA 1XMQM 1G21A 2Z9CA 5IXYA 1WCV1 4C4TA 1SUEA 1WLSA 4MI9A 3AVQA 5I7UA 4L2IA 3MFYA 1U7HA 4N7JA 2YOFA 4LW8A 5FTJA 3PI6A 3K9PA 4XUEA 1EINA 1X14A 4CLOB 2HHJA 1XZIA 4GKKB 4U2GA 2DHEA 3E9RA 2AOTA 3FWNA 1GG9A 2OFWA 1OFTA 2OOSA 3A1UA 1KZYC 5DHAA 3R5SA 4HH3C 3A6ZA 2DGDA 4EJ2A 2JANA 2QTHA 2IYPA 1N8NA 2PANA 2UZAA 2CMDA 3FDFA 3EIQA 2JFOA 4KYIB 4L50A 4DY6A 3KQOA 2KNVA 3GJZA 2D2IA 1EA7A 3IXLA 2ZYRA 2EUCA 1QGYA 1P1RA 3O73A 2EATA 2PGLA 4ZU6X 2IDKA 1AKVA 2WAXA 1KYXA 1NZDA 4IG9A 2ORYA 2X5XA 4L8LA 4KFCA 4N3AA 5IH3A 2R85A 3OX3A 3GNLA 4MJ7A 3ILHA 2FP4B 1FRQA 3UIEA 1DVRA 2VDBB 1EFUA 1MGOA 1WIVA 2FZ4A 2MH8A 3JZDA 3KBBA 3LGXA 2WF8A 3VVBA 4I4TF 5LLDA 1J5EB 1FVOA 2GZHA 4AY4A 4FNMA 4KMSA 3FFWA 1D8AA 3D1VA 3A4IA 4HFJA 4LBYA 4DLLA 1CE8B 1WEHA 2AN1A 3H16A 3C6KA 1J90A 2Q2EB 2BC9A 4FCTA 2HPVA 2OQIA 3NOQA 3QNUA 5HCUA 1LLDA 3DONA 5ECWA 3KAPA 3GLFB 2ATVA 1USVA 2OYSA 2MROB 2CWWA 2GERA 1I4EB 3T7DA 1NVVQ 5H59A 4FWDA 1WPXA 1DINA 1ODLA 3GQVA 4YYZA 3RRXA 1YB7A 4LXYA 2ZAGA 1MJ5A 5KQPA 3M4XA 1ECCA 3F5QA 1VP9A 2NU8A 3QH4A 1PJTA 5EKXA 2WNHA 4ZXPA 3P4UA 3TFQA 4PC7A 2OGUA 2UAGA 4M54A 1Y3DE 3LSYA 4FZ3A 2O0KA 3F6YA 3B9RA 2V1UA 4PAOA 3OPYI 2O8EB 4MR9A 1WXFA 2IOFA 821PA 3W06A 3H9CA 1PZEA 1TU3A 3AIOA 5JMOA 2I33A 3ZVLA 4GYKA 1LZLA 3UOGA 2OXCA 4H7HA 4OGWA 3ASUA 3RRFA 3I6ZA 4R8KA 1ICIA 3FNFA 2P9GA 2I2WA 3MHVC 5KB3A 4A26A 2HK8A 2J3KA 7GPBA 4ZZ3A 1THZA 3HCEA 1TADA 4YV7A 3TPCA 4Q6BA 1GKLA 2LDBA 4Y6RA 4AT1A 3HKEB 3PJRA 1U90A 3UPUA 1A3CA 4OL9A 3UEOA 4JGIA 1BWSA 2AHMA 4TS1A 4Z9BA 3P9KA 5LMNM 1NPYA 1VJGA 3CN9A 2A3NA 2VSXA 1VJRA 3NALA 2CV1A 4AJEA 3TINA 2Q9BA 3UMRA 1V16B 2AFIB 3IT0A 3LW5F 3NUQA 1QM5A 2Z4TA 1REQA 1O58A 2VCEA 1WSWA 3CW9A 3FDXA 5A0VA 4MQ5A 1RBQA 3BX1A 4FYYA 3FVTA 2UXCM 4ITVA 4W6ZA 1S4QA 3BXPA 3SQXA 3BK7A 3PHGA 2YBDA 2YRFA 2ZYIA 1DGFA 3ZQJA 1MJFA 2QSYA 4TMZA 3B5JA 1DEOA 3F5MA 5K6RA 4OP3A 3K9LA 1T13A 2G4LA 2J08A 4RMJA 5F3WB 4LHWA 3CV3A 4R6XA 1AS3A 1FB5A 1YK1A 2X6RA 2GZAA 3R7SA 2H11A 4O4LF 4L9AA 1RQ2A 1R16A 2VPXA 3E7XA 1ZD8A 2XEPA 3IA2A 4K6KA 2C0PA 1WOMA 1HDEA 1I4WA 3PNYA 4QKQA 1UXIA 3VSCA 1I4TD 4ZO8A 3C6YA 3ORRA 3KOWE 2RBGA 2VDLB 4JYCA 2O25A 2BN4A 4DA6A 4PG5A 3WZMA 3A2MA 3ENNA 3BDIA 5K0GA 3PRYA 4AICA 3HA5A 1UAAA 3LQKA 1H1LA 3DDNA 3MSXA 5JASA 2FUG6 3WL8A 3SXUA 3L0CA 3MHPA 4KB5A 4HN9A 3AV0B 1ZX1A 5IVDA 1NI5A 4DLAA 4TXLA 4JI7B 1ORWA 3AWIA 3BEOA 2GD0A 1CJSA 4MVCA 4XGKA 4Y2RA 1FTQA 1PYOA 4JI0B 1NPDA 3MS7A 1OF1A 1SIOA 1UMBB 2MSEB 3VU3A 1EP9A 1QV7A 5CNJA 4FMDB 3K0CC 3EC2A 3HGIA 1GPNA 3NVDA 4UBNA 1N8TA 2FW7A 4M8NE 4DR6B 2O2JA 3VV3A 2H1RA 3V1LA 4BQRA 1ZHOA 3RHZA 1JKMA 4XJVA 4ZOBA 4QJ4A 2KJQA 3VX4A 2V97A 4OK5A 2VHWA 4WCDA 3S29A 2PA0A 1U8YA 4H6XA 3O6VA 3OZIA 2QTVA 2VQ3A 1W4LA 4EBFA 1J0AA 4OU7A 1J8YF 1MQSA 1NIPA 4U7JA 4CL2A 4D5EA 1UC4B 2J8ZA 2ZRLA 3L0IB 1ZFNA 1IBCA 3EZYA 4PZYA 5EPOA 3NCHA 2OWDA 3WYNA 3S2ZA 2Q21A 5DZSA 1JG3A 4PWZA 5KTSA 3OEYA 1EZ1A 3T3EA 4YRMA 3H3JA 4DYDA 4PTYA 4OV6B 3WWZA 1BOOA 2FSHA 4MV3A 1LRJA 1TKCA 1AGXA 5JI3E 4EKIA 3BB3A 3JY6A 5KPTA 4WE3A 1MOZA 2HDWA 3TLKA 3CZQA 1WETA 2ZT6A 5DM1A 5EJ2A 1PJSA 4DR7B 3P0RA 1CBUA 1C7JA 4KH1A 4BMPB 2P5UA 3I04A 4LMRA 2I1VB 3KZKA 2WSLA 1E9BA 3LX4A 4AN1A 2B1RA 2NO7A 4H59A 3COSA 4HAUA 1RS0A 5COQA 4Q16A 2O0LA 1XEWX 4AY2A 2QP3A 2NZ2A 3Q5DA 1Y3CE 5TQ2B 4WZAB 4ID3A 4X1YB 4DCOA 1SRRA 3WXBA 1IVYA 2W2TA 3OM1A 4G8CA 3HHYA 4YROA 1JQAA 5I7HA 3E05A 1PQUA 3FAZA 2M6SA 4UBIA 1AA6A 2WR8A 2VIIA 5A1JA 4UOQA 2QNBA 2OPFA 1UH5A 2W4QA 3S8YA 1WS6A 2Q07A 2WD8A 3DEAA 3LBFA 1NASA 3LL7A 1I13A 4F3CA 2WDZA 4NAHA 2YXPX 2ZBKB 2NMVA 4JI3M 4JBYA 1A50B 1G2IA 3LL4A 4ZYVA 3VZSA 3THWB 2ZANA 5DGCA 2P9FA 1WOYA 2ZREA 3AB3A 1E2PA 3QM1A 3RQSA 3EFOA 2R86A 3P32A 2R48A 3F2IA 3MIZA 4A7PA 3MQ2A 4YJDA 4GOJA 4CIVA 2G6BA 4F56A 1L9XA 3QUTA 2GBLA 2V59A 2QVZX 4FOLA 3P2EA 5IAOA 4FMPA 3SAWA 5L7TA 1KGDA 1XMOB 1U8CB 3KOYA 1W93A 1P19A 1ENZA 4ZO6A 5LOVA 5IUNC 1WKBA 1VLJA 4NSOB 1KERA 3L1IA 4YMWA 2IXFA 2OHIA 1D6NA 5GAJA 1VIYA 3SLGA 4C04A 4KX5A 4ND7A 5HKOA 1W35A 4JLJA 3K2QA 4C43A 4M53A 1UPAA 3HHXA 1U7OA 3UV7A 4Y2YA 4MJXA 2HU5A 1Z4PX 2XV1A 4K9KA 1BEUB 1NONA 1O0CA 5JMPA 4KPUA 5A3SA 4UQOA 3QMPA 2ORIA 3TW8A 4N7BA 1F17A 5LR6A 1H2EA 3U16A 4Y6OA 4UHBA 2DAKA 3HUTA 2DOKA 4I4LA 5JI2E 5BQPA 3ADKA 4Z49A 3U4MA 5B37A 1TPYA 3QKRA 2WB2A 1R1DA 4RK5A 2ZRMA 2XNJA 2D7JA 4K46A 5BN1A 3KJXA 3WS7A 1MVOA 3MD0A 1Z7WA 4RD3A 3TW0A 1L5WA 4J0HA 3KFVA 3B3JA 5CXQA 5F3DA 1NKVA 1YU6A 5JZ9A 5JXGA 2H2DA 1OC2A 1Z35A 5ICSA 4QHYA 4DS3A 4JJIA 3STHA 5EZYA 1AMOA 2BGIA 3IDZA 5ARCA 3VNBA 2D5IA 2A59A 2ZB7A 4KQGA 4UAVA 4HY3A 5AW9A 5MF6A 3OE5A 2DWZB 1I2CA 4KMOA 4GPIB 3WK6A 1XDWA 3GH1A 4REOA 3B9BA 4IDOA 3QG1A 1RPAA 4JU9A 4AJ1A 5FAKA 1KWKA 4KQKA 1QMGA 5GGXA 3DV0A 4P5DA 4G23A 3CCFA 5J63A 2ZTVA 4YRSA 3B74A 2G1JA 2J9FB 3GPCA 4A82A 2Y0QA 2QV0A 1NF2A 2X41A 4QVGA 4DNXA 3HB5X 2EF0A 4JI8M 1QQWA 2XEDA 2RB5A 1V1RA 3SSOA 1ESNA 1E64A 2CXUA 3LLMA 1U7TA 4BJ1A 1XYYA 4OHOA 5T64A 4F38A 4Q3DA 3GGDA 2RBKA 1M0EA 1A9RA 2B99A 2A94A 4HG2A 1EFTA 5JBQA 4CGYA 3GAMA 3HP4A 3VR4D 2E1PA 1SZCA 1MJGM 3AEKB 1A4XA 2OZKA 2PYZA 2LVQD 4KR0A 4HRXA 4N3CA 1Y4UA 1YZNA 1ZOSA 3S5UA 3NWLA 2VRCA 3EEFA 4DSTA 3J27B 3L7DA 2BCEA 1DC5A 4K9SA 5TEVA 3BGWA 4NK4A 1GN9A 2AEMA 5HBRA 4CF6A 5FPHA 1QH1B 3IPXA 4D4MA 4D9GA 4HZUA 1P29A 5DNDA 2FF5A 4IJ5A 3PR3A 3PL1A 3LMKA 3DAPA 4OHZA 3RODA 3NASA 4MVJE 2R8RA 5I4KA 3DKKA 4OLAA 5EJGA 6REQB 1ULZA 3TOSA 3FCCA 1Z3IX 2QS9A 3LKZA 5CRIA 4LJYA 4WH0A 3WMEA 3ILVA 1EVIA 3NOXA 4AO7A 2PT9A 3EDMA 4YJ3F 3SKVA 2D2EA 3PPIA 4BO6A 1JH9A 1Z12A 4LF5M 4KLAA 4J7XA 3KP1A 2WK1A 4IBJA 3V4RA 4PIVA 3D4OA 3GJQA 5D86A 5ALMA 1EVEA 1BGXT 4JU8A 3VPAA 1C1DB 3ZK8A 1G6KA 5I7OA 4BFYA 2C2KA 1UANA 1O54A 3R3ZA 1S2LA 2EKPA 1N5DA 4LQDA 2NXEA 4DM4A 4JB0A 4TM8A 5F7OA 1DOHA 3E4DA 4HAIA 3TDNA 2NPIA 2AA3A 1TQ4A 3DVAA 5TE9A 5DVZA 2PXAA 3BHJA 4OLBA 4UMFA 3R0JA 1PHPA 1F60A 5LJIA 2C5LA 3FTEA 3QBEA 3B53X 1V1MB 2JJMA 4DUZB 2P0AA 4C1BA 1E9VA 2FG6C 4YRRA 3OU6A 4OXYA 5K6AA 2XUOA 3FZNA 2HHAA 3PC8C 4F96A 1TDHA 2Z04A 3LVRE 4ARSA 4I0WB 3RYIB 2CNOA 3TUZC 5JH7A 4ERXA 4OQNA 3ISTA 5KU7A 4F3NA 1DLIA 2AE1A 3T12A 4LHZA 2VJYA 5DDIP 3HKDA 3T3GA 3R0ZA 1NF3A 1SHUX 4TLMB 2A4MA 2V8BA 1RRPA 4TM7A 4Y8VA 1N6RA 3ELWA 3R7FA 3CJTA 3E22B 4IRXA 5HUQA 1OKKD 2W2KB 2A78A 1HG0A 3WWEA 2D2VA 4P2BA 3CZMA 4GRAA 2P4EA 1JLLB 1PUJA 4ZYLA 1XVVA 1CQIB 3GARA 3KB2A 3KT8A 3V6LA 4A8JC 3S1AB 1M1NA 5HSGA 1C7FA 2IPLA 4RFVA 4DV1B 5JCOC 3A4YA 3G5UA 4S1VA 4B6PA 2YHUA 2GETA 5EZQA 2R4TA 1KGSA 2EA0A 5H3HA 3QVGB 5HILA 4Q7MB 3RUIA 1LLCA 4NDAA 1TU0A 4RNAA 1GAJA 4MB7A 1PKEA 3R76A 2P3QA 1DKQA 3G82C 2BONA 3NAGA 3SJZA 4BNGA 4UHJA 3VPXA 3SQNA 3DL4A 3ZDCA 1ECFA 2C5HA 2NVWA 3MJEA 1S2MA 5CFMA 1ZM7A 3CLRC 4RMHA 3SBOA 4YEDA 2O7SA 1K5DA 1JYSA 2QQEA 3AHJA 5EJEA 1DC8A 2XF3A 1RE0A 1HYHA 3NRCA 2I4TA 3URMA 2C2ZA 4RTOA 3T3OA 4BWGA 2J0VA 1CP2A 2Q6VA 4ZCLA 1N2HA 4FBMA 3TSOA 3GMIA 4A27A 3F5DA 1KAHA 3OOWA 1U1CA 5BRNA 1IHOA 4KBYA 1HE3A 1JQ5A 1GKKA 1UBSB 3WWCA 1DBQA 2WMNB 4LZLA 3TG8A 1AUOA 4BV9A 3UATA 2YY6A 1H9BA 1F3OA 2G08A 1P1KA 1C3VA 1G0NA 5DX8A 1JAIA 3DD5A 3GCDA 4GNKA 4UFOA 4YRCA 4RTRA 3QUAA 5EIHA 4CJXA 1QC5A 2Q9UA 3O8RA 5GJCA 4C0JA 4JVNA 3UJ6A 1SCJA 2FXVA 1T2DA 4TMKA 2GK3A 3KQYA 1E60A 1DKMA 5F9MA 5TF0A 1ZKMA 2CXPA 2HMTA 4Z0HO 1F48A 4B74A 2KW0A 3TI9A 1U0NA 4JA2A 2CBZA 4PGHA 2HYDA 4BNHA 5JFGA 4QYIB 2EIXA 4GNRA 1PM5A 4EUSA 5LXTB 2EDAA 3V7FA 3BIJA 2TECE 4B7AA 3IKLA 2NQ2C 3T5TA 2PUJA 4GFDA 4NMMA 3I9KA 5KUTA 2QJFA 4JLAA 3EXEA 1JR3A 4G5FA 4PSUA 1II8B 1QZUA 1FEZA 2CB9A 2PYIA 2DYKA 2GN9A 2I4LA 2CN1A 3L0YA 5ENVA 5C7IO 2P9TA 1T9KA 2Z95A 2HTEA 1TIBA 2KW5A 3DDSA 3BA6A 2HJWA 3G59A 1AZTA 5ICMA 4K9DA 4M22A 2PX5A 4UOZA 2CGEA 2XMQA 3OM9A 1BVSA 3CSDA 1G7SA 2FH0A 4QGSA 3E46A 1LBQA 4MQFB 5GJVC 1H3EA 3LM8A 4B6GA 3L4KA 1BXRA 3VR1A 5JFOA 5F9HA 4BX0A 3AK4A 3I3OA 3W7VA 2AYYA 3ZI0A 4UPVA 4G4SP 4PYIA 5IMBA 4H4DA 4JSYA 2PUFA 5WRFA 1TQHA 3UFBA 5INTA 4BO0A 3T7CA 4HP8A 1DEKA 4A36A 2X7HA 2RK4A 1WBBA 4G0YA 2OQ2A 4J7AA 2D5LA 1ARZA 1YVUA 4GQBA 1ZZGA 4RL4A 1XQ9A 3T1VA 2X19A 4KXLA 5C80A 3KLBA 1JB9A 3C74A 4B5KA 1R2YA 4ND5A 4YCDA 4YP9A 3U61B 1E6WA 4TUWA 4MXDA 1J07A 4KOEC 4UUPA 1B1CA 5FNZA 3ZW8A 1LJLA 4LV6A 1D6SA 4MS3B 2EGHA 3TZQA 4RS3A 3LUFA 4TZTA 1OBCA 4MDYA 2RMKA 5H70A 3UJ3X 2IH2A 2N47A 4IX1A 5GKNA 4PLVA 4KHPM 4OQDA 2HSEA 3W2HA 3QA9A 4BU1A 5ALIA 1VYHA 1KO7A 4S24A 1DX9A 3CUUA 1YV9A 1VDLA 1JF8A 4ER0A 5FWYB 4KHZA 1WW8A 2IQIA 4CW7A 1VLLA 4RTLA 3TIFA 3GF4A 3WHPA 3JW8A 4UPEA 3FOAA 3EXIB 3SVLA 3GP1A 2J3JA 1CTQA 2KA6B 5CD1A 1O94C 3HZHA 4PLPA 4E70A 2A5DA 1PZMA 1NNI1 4DDHA 4PZAA 1PTJA 3SGLA 4XWGA 1PP4A 1Z16A 3BL6A 1QAMA 3TAUA 1ZW6A 1YSCA 1D2RA 3PK0A 1ZVJA 1JPVA 4DARA 4DIOA 4UU8A 1VEJA 4TXNA 1N33B 1WTCA 3R5JA 2XKKA 1RKXA 3WFIA 3V2UA 3WYCA 2WSYB 3HEBA 5DEOA 2GPWA 3O8QA 4DSNA 1U4SA 3K53A 4DWOA 2XQGA 4AMYA 5GM2A 4A0FA 1K8ZB 2GZ2A 4NDZA 4DV5M 4TWRA 3OA2A 5TX7A 3ZEIA 1ZAEA 3LU1A 4ZCPA 1QHSA 4JWTA 2WSIA 2WU8A 1PFGA 3A28A 1NWCA 1YZTA 4BTEA 3A1FA 3RAJA 2QRVA 1HURA 1PNOA 1OWNA 2GM3A 1G38A 5EWJB 2C3PA 2AI1A 2PZBA 3GDWA 2J9RA 4REQB 1M6WA 3PT5A 4RZHA 4F7DA 3ZHRA 4LZJA 3I2JA 3MWJA 1P6UA 4N8SA 2WNSA 2PJZA 3UT6A 4PAWA 4Q4HA 3AP2A 1JQBA 2HLPA 3WR5A 2O0HA 3M6AA 4F85A 3ZZUA 1L4LA 3G8BA 4NPAA 3SF8A 4D4GA 2NP6A 4C0WA 4BJ6A 1KEEA 3QTBA 4NEGA 2CK3A 1QGZA 3L6EA 4KSBA 3IHKA 3LOUA 3W67A 3S5JA 521PA 2ZSDA 3C7CB 1QWOA 1BEZA 4J29A 4YAOA 1Q0HA 1WVIA 4HPJB 4GWKA 3NYIA 1A4IA 5AR1A 3EG5A 4U63A 4ZDJA 2FV8A 3NEPX 4W8HA 1Y3HA 1G9SA 5A1TA 3GVHA 3QJYA 2P7IA 3VK7A 3QEMA 2YVKA 1YS1X 4KACA 1L4HA 1G4UR 3PHHA 1YHZA 2EKKA 2HHHB 5KKCA 4EJ6A 4LK2A 3EIEA 3L6RA 3W5HA 1IMJA 1KKLA 4HDRB 1ODCA 4G1CA 3WZLA 5L6MB 4TMVA 4F8EA 4FDVA 2C82A 3O93A 3MTIA 2ZE5A 4QDJA 4O4IB 4TTVA 4KFTA 1DX4A 5ALUA 3LQFA 5LN1A 2R60A 2G06A 3WB1A 1QVZA 5FBVB 2AUNA 3BF7A 4L8VA 2VL7A 3IA7A 2FUG1 4NC6A 2O1WA 1XXHA 2ZR8A 1RACA 1Q19A 3K16A 3E8MA 2XLBA 3EEQA 2GUGA 3GVXA 3INNA 1J1IA 3JQ9C 2B69A 4GHWA 3STYA 4HDNA 3OZBA 4IV5A 4RWEA 3WKEA 2VDQB 2GYVA 4KIUA 2W6CX 1YQXA 4TTAA 2AK3A 4FYPA 4DJAA 4N0PA 5HKKD 1IUOA 1HLDA 4JI6B 1ZOOA 4D9MA 2BAGA 2L6OA 4DIDA 3QXHA 4Z0PA 5TC4A 3AU9A 5HE8A 2I99A 3VAZA 2QT9A 2EZTA 4KV7A 2XDQA 4EW3A 2YRWA 1E79D 4DLNA 2QN1A 4JJAA 2G5TA 1E1KA 4B43A 2DHCA 3L1KA 5LU8A 2ZK7A 4I6JA 121PA 4ON9A 3U6OA 4AF7A 1PLKA 4NATA 3MGAA 4LUCA 8GPBA 2SCUB 2VK4A 1A9XB 5D5QA 2HB6A 2IVFA 3LQYA 2IS1A 1G1AA 4Q7JA 4EARA 1P75A 3TOVA 1HG1A 2YR0A 5FO1A 4MV6A 1AUXA 1U1GA 1ORTA 4O1HA 3VAAA 4CE6A 3VSDA 1UPTA 2VHCA 1WLYA 1A5AB 4AJJA 5K0TA 4LNUA 5BSKA 4QA9A 1DAIA 3FTNA 5DASA 3Q0IA 4GM0A 4DMRA 1DL5A 3T6KA 2HZBA 4D9KA 4UMEA 4JIMA 1B0ZA 4OJKA 1GGMA 3OF3A 5AXAA 2UUOA 1D3AA 1YZFA 2N9UA 3SYRA 3TGPA 4CMIB 2IYEA 4M37A 4PG8A 2VH2A 1SXJA 5CDHA 3PDIB 1JZQA 1ZK3A 4MRMA 1O7JA 4OD0A 3NP9A 5G1OA 2GEKA 5IVIA 3BH0A 1Z6QA 1XNHA 2GPJA 1P0FA 2B92A 3FM9A 2VT2A 1SKAA 4Q4JA 1CUDA 4FSDA 4LBWA 2ZYAA 3UQZA 2CLKB 2H29A 2JFQA 4TTRA 1XTUA 4N7MA 3HJFA 1K66A 3JQFC 3MG9A 4F4UA 4J49A 4NI5A 1XR3A 3KEOA 5FWXB 3CLHA 1WXDA 1DG9A 3MWLA 4XTCS 1DGQA 4P4TA 3BGSA 3RVRA 3L43A 2HA5A 4CM9A 3KBOA 4IQGA 3B9QA 1GCGA 3T9EA 3D7SA 4X44A 5K3DA 1YKSA 2WU4A 5DF1A 2XH8A 2PIDA 2A33A 1XB2A 4OAPA 2D0OB 4NJEB 1GSHA 2JFXA 1TB4A 3HU5A 3DGEC 1QZZA 1ND6A 1L3IA 3H5IA 3IUSA 3IPAA 2MYTA 2AHRA 4KE6A 1NRIA 3K0BA 4F9TA 4CM4B 1W25A 1WB9A 3BXWA 4EUKA 2PGAA 2H8GA 4M76B 5BWBA 5ALVA 2H4JA 1UZUA 3HY6A 3ZHBA 3QW4B 5CUQA 2EW8A 2XGNA 3T0FA 4RQAA 4KV9A 3DAFA 3BGDA 1UKBA 2OA0A 2CSXA 3GHYA 2WV7A 2QZJA 5IBPA 1WUTA 1KI1A 3RVSA 5TIIA 2H0QA 3HDHA 1O4WA 1TT5B 4AXBA 1M6NA 3U5ZA 3GUYA 3IJRA 4CM1A 1BC5A 1E4EB 4KLCA 3S7ZA 1X6VA 3GIDA 5TRTA 1XEXB 4BUCA 2H7CA 3BZWA 3VU9B 2FR8A 1HSOA 4D3DA 4JEUA 3O5AA 3QMMA 3C5VA 1QDEA 3V1YA 3FMFA 1R5NA 3PB3A 2D59A 1KSHA 3EXHA 4YRNA 2HF9A 5DWDA 3PUZA 4IVPA 4BLQA 2PAFA 3GVPA 1TJPB 1Z07A 2XECA 5G02A 3N07A 3AJ9A 1KYIA 1I94M 4FEAA 1B8PA 1J70A 5T41A 3ZJVA 2UYQA 4A23A 1XKTA 3IEXA 1JILA 2ZM5A 4LWOA 3ECCA 4HRAA 3B2EA 5CR9A 5CM9C 3I76A 3IOMA 4V0LA 4RH3A 5G3YA 5HZKA 3AEZA 2AS0A 5CJJA 3DCIA 4ANRA 3OP1A 4V1CI 5COBA 3R8XA 4G4RA 4LFCM 1OGYA 3M5WA 4W5JA 5KQGA 1JR6A 4E2YA 5CK5A 1SXPA 1J21A 4IUYA 5T57A 4PBTA