1KYIA

Hsluv (h. influenzae)-nlvs vinyl sulfone inhibitor complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
443
structure length
321
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVDSIIRDLTDSAMKLVRQQEIAKNAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent hsl protease ATP-binding subunit hslU
publication title Crystal Structure of HslUV Complexed with a Vinyl Sulfone Inhibitor: Corroboration of a Proposed Mechanism of Allosteric Activation of HslV by HslU
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone/hydrolase
total genus 105
structure length 321
sequence length 443
chains with identical sequence B, C, D, E, F, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1kyiA02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1kyiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kyiA01
2JJ1A 3K0FA 1KKMA 2IYYA 3UG6A 2JGNA 3T12A 2V8OA 3B5JA 3OESA 4TL8A 1T5LA 4B35A 5B58C 2HCJB 5JWOA 3FVQA 4CT4B 3HU1A 2Q9BA 2F3TA 1ZC3A 3SI7A 2CCGA 3I1FA 3TR5A 3RS3A 4BLPA 2PBRA 4Q7MB 5FUYA 5F2EA 1M1YE 2MSCB 2OAQ1 2WWFA 3IHWA 4TT3A 4I1SA 1Q1QA 2V6ZM 4FCVA 5JI2E 2JLYA 3VQTA 2ORWA 5EP1A 1WGNA 1T9HA 2FA9A 3WYFA 4DT1B 5F98A 3CPHA 3U7EB 1Z29A 3T61A 2V7QA 2KNAA 1KI6A 4IXNA 1GKIA 2OCPA 4GFDA 3X1DA 2ZR0A 1XPOA 1GILA 1BMFA 5HKKD 2LVAA 1YJ5A 1FZQA 2OCBA 3KTAB 3CZPA 4BPBA 4O3MA 1AA9A 5GADl 1G8GA 1N5KA 1YVDA 1W2HA 3HDTA 3UIEA 2HEIA 2GCOB 5FTKA 1R5NA 4PC2A 2GCPA 1SXJE 2VP4A 3I4LA 3LDAA 6Q21A 2JIZA 5CLLA 4V0MA 3CH4B 1T3LA 2IF0A 4KFUA 2O8CA 2REOA 5CIQA 3UMSA 3O8CA 4HZIA 1UKEA 4Z51A 3LA6A 1GM5A 5BWMA 1VG5A 4IRUB 2DCUA 1E69A 3U61B 3K70D 1YR8A 2J59A 4RCZA 2XJ4A 2ZITA 1IBRA 3GEHA 4N0DA 4PAQA 2PZGA 1X37A 3Q72A 2UKDA 3QXXA 1X8KA 3F5FA 1HUQA 3CX6A 4NPHA 1U81A 1R4GA 3QF7A 5L3RA 4JVLA 4C2UA 1X1SA 2OLKA 2P3SA 2FEOA 4RJLA 3WP1B 4MDFA 3FMIA 2ZAMA 4ERNA 5L8VA 4TYWA 3BD9A 3I5XA 1OFIA 3A58B 1ELOA 4BZQA 1XEXA 2PMKA 3DHWC 4RZUA 1E2GA 3SYKA 1AM4D 2H18A 4U02A 2GEUA 5TMPA 2QUZA 1ZM2A 4URYR 2JY6B 2GEVA 3VR3A 1XZQA 4B43A 3GJ3A 3NG1A 1QDEA 3U3RA 721PA 2C98A 4DLRA 5AJWA 3V9PA 1XJQA 2BCJQ 1VPLA 1U8AA 1ZCBA 3IILA 4B2PA 3T1QA 4TN1A 2EVWX 4HAVA 1YR7A 2QPAA 3U3OA 1KNXA 1W0JA 3KQKA 2H8KA 4OI1A 4POAA 1KMHB 4RZ2A 2ZRFA 1SVOA 1OJLA 4MUAA 4IKEA 3RS2A 3IEVA 5L3SB 1F2TB 4WXRA 4OHXA 2HYDA 4JBWA 3GEIA 1TNDA 2FMXA 3B78A 3TAHA 3WYGA 3NBFA 1IQPA 4LWZA 1FQJA 4JVSB 2WTUA 3B1YA 3SJZA 1UEJA 4F91B 2ZS9A 5HKKA 4TMXA 4TMZA 5FPHA 2N42A 2C8VA 4QGAA 4D0LB 2NIPA 4U7DA 4LJ5A 5FBRB 1MH1A 2ZU0C 2IUTA 4GMXA 3K0EA 1WP9A 4C0AC 3RDPA 4V03A 1TQ2A 1AQUA 3PEYA 3QPWA 1F2UB 4TL6A 2ZRAA 1F48A 1G7TA 4ARZB 1XEWX 3MJHA 5GVRA 1G5TA 4JLJA 1OPXA 1JECA 1DOAA 3FE3A 2LWIA 1WCV1 1HE1C 2WZQA 1R8SA 3B7GA 4LI0A 1LVGA 1G3QA 1D6JA 1XEFA 4CVNA 1O3YA 3K9NA 5AJZA 1G4AE 4HI0E 2EW1A 1CJVC 2G6BA 4HB0A 1XBTA 2GNOA 3H84A 5KNCA 3QVVA 2F1JA 4IW3B 3WNBA 4LBZA 1GNRA 1COWD 2ZJ8A 5P21A 1E2JA 3HU2A 3A4LA 1V5WA 3M6AA 4QXAA 2VSOA 3V4FA 3FFBA 2FSGA 3IBGA 3CZQA 4TYPA 1QHYA 2OUKA 3RHFA 1AZTA 3LH5A 1YZGA 2NMVA 1ZYUA 2RRUA 2WAXA 3R20A 4QFMA 4D0NA 2XNDA 1VCNA 1KK3A 3DKVA 1X8JA 3IECA 4NP6A 3VR1A 5EJEA 4CF7A 2BJVA 4NZYA 421PA 2F9LA 4C7OA 3A36A 2WBLC 2YKGA 5L3QA 3BFVA 2H17A 3K0FB 1OFUX 4AYWA 1KDTA 3C5CA 4X8HA 4M9SA 1Q21A 1IOZA 3TKLA 1IN4A 4B6FA 4II7A 2YOGA 1CJTC 1MABA 4W5WA 2CHQA 1SVSA 4D4JA 4JSTA 4UXIA 2ATXA 2DAMA 3PCRB 4F38A 2OBNA 1Z22A 2D74A 3H2YA 4QRHA 2BEKA 5DN6A 4A0GA 4U00A 2GDJA 1KI6B 2D3WA 1TAGA 2WIAA 3AF3A 3DOEA 3KW6A 4GDFA 2GF9A 4MUBA 3HYRA 2ZU6A 3HWSA 1G3UA 5C2JB 3TK1A 2QQEA 4IJMA 3ZJYA 2CK3D 4A36A 1YE8A 5JI3E 4OI4A 1VEKA 1S0UA 1HE8B 5HZKA 4HATA 4HZUA 4DDTA 4OQLA 3R8FA 3BWDD 4DEXA 1Z0AA 4QJ5A 3TVDA 4A4DA 2CJWB 4ZO4A 3QPVA 2FFBA 3CM0A 5KSZA 1WA5A 4FCTA 1E79D 1N5JA 1UDWA 4NCHA 3MJRA 5H8WA 2OXCA 1G8FA 4G5GA 2IYVA 1RFLA 4TYYA 2YC4C 4MKHA 4FWGA 4XSGA 4XTCS 4RKFA 3WP0A 3TE6A 3EZ6A 3ADCA 4LJ4A 4LRTA 4OQFA 4QC2A 1DAKA 3BB1A 1E9EA 2VTKA 2KHHA 1TQ4A 2ODBA 2ZRKA 3P4XA 4Q02A 4A2QA 4CEIB 1JR3E 1MT0A 1E0SA 4MRRA 3TSWA 1VYTA 4E09A 1QZMA 4BECA 1KGDA 2YWGA 4PC6A 4TMVA 3IO5A 5LB4A 4RFVA 4A82A 4M53A 4OHZA 4CRWB 3AF4A 1DEKA 2P65A 4ILEA 2EYQA 3QIAA 2CBZA 2ZRLA 1WIVA 3JZMA 4IOJA 5EP4A 1YR6A 3GFPA 4ITRC 4L8GA 4UNSA 1CJUC 2CHVA 1XEXB 5CK5A 3IKJA 4IDPA 1QVRA 1TTTA 3F92A 4JN6A 1Z5ZA 3NBYC 2D2FA 3UMRA 4BLTA 5JJLA 1P2SA 3BIFA 2EFDB 4KBFA 2IEZA 4JLAA 3ETLA 4BEBA 4URWR 2F1IA 1P75A 3MRSA 3Q5EA 4B2LA 1H8HA 1IXSA 2VPPA 3NHBA 2ZXUA 3LD9A 4JVMA 2BBOA 2QE7D 1EXMA 1VYVA 4NYJR 1XCMA 3M4YA 3KKNA 1N6RA 1UBGA 1P2VA 1TUIA 5A5GA 4DLWA 1EFHA 1DV0A 3ADKA 2O8EA 4ZDKA 2GHIA 3QE0A 1FUKA 4MYHA 3TUZC 2EWWA 1OB5A 3ZQJA 4LBYA 2WPDA 4I1OA 4MGIR 3SHFA 2YZ2A 5DSZA 4MRVA 3VR2A 1TU4A 3SBEA 4OQNA 2CVFA 3UANA 1FFHA 1GKYA 1SVLA 1ZD9A 2DFTA 4DLYA 1M7BA 1EESA 1OXTA 1IM2A 4IVRA 4H1UA 1RW4A 4IOLA 2O8DA 2YV5A 1VCIA 4Z1MD 2MR9A 2FX3A 4X8MA 5FI0B 4YMVA 2WWIA 2F43B 1E2QA 2JAQA 3HR7A 4B3BA 5TV2A 4A15A 2QENA 3H0KA 2VQSA 2CK3A 3CNNA 3D8BA 4TQAA 3RSLA 2V54A 1IN7A 3A4NA 1P61B 1X3SA 2KRKA 4ZPXA 3AUYA 4H9GA 4ACBA 4TZ6A 2ZI6A 1W48A 4P32A 3A8TA 4JL5A 3LFUA 2BBSA 1ZM7A 5KOYA 3HJNA 4NBSA 4ACAA 3HP1A 5E7JA 4ZI2A 1W49A 2QP9X 1SVWA 5JJKA 4CEHB 3THXA 2DAEA 3ONWA 5C4GB 2ZJ2A 2ZRBA 3ZZTA 1JI0A 4LHVA 4AWXA 5DYGA 3KXLA 1W4BA 4W5HA 1Q57A 3CR8A 4DJTA 5CM8B 3OAAD 3PQCA 2AN9A 4M1OA 1BVSA 5KDLA 1JPJA 3MWYW 4V0OA 1NVVQ 2CL6X 2VEDA 4PHFA 4YQFA 2IYLD 5K8UA 1NLZA 2IXFA 2QMOA 3BFXA 3LX5A 3GLHE 2JJ2D 1OIWA 2J0SA 1E9DA 4OHVA 3A1SA 1R6BX 5E7MA 2VSXA 3OE7A 3U60B 2GETA 4NYIQ 1NL3A 3VHLB 3FKSD 5DNYB 5L3QB 4JBXA 2GA8A 2P6RA 4NKRA 4FWTA 4G3OA 1AJEA 1HJPA 1K6MA 3SJAA 2ZM5A 2QEQA 2XEXA 3TH5A 1AS0A 1UDXA 2WSMA 2IWRA 1I2DA 2O25A 1E98A 1DARA 2FSIA 1E6CA 1N3BA 2QE7A 2VHTA 3RS4A 3LCVB 2RGNC 1N0WA 2EWVA 5FBWB 1DAFA 4PQYA 4EPVA 2NQ2C 2Q9AA 4MYTA 1G7SA 2ZVPX 3ZVNA 5J4LA 1OYYA 1A4RA 2XZLA 3SFZA 4TMTA 3NH9A 2HF9A 3QXHA 3RVBA 2QBYB 1VCOA 2F1RA 1OH8A 2HWJA 1IY1A 4MKIA 2WVJA 3VKGA 3CRW1 1KOFA 2G3YA 4WXPA 1ZCAA 4NYMQ 3LRPA 1JQLB 2IXEA 1ZD8A 2WIBA 5HZHA 2B7CA 2J7KA 2EFHB 2VYFA 4JLDA 4Z1MA 1W47A 2PZEA 4YONB 4EDHA 4A3VB 1ZD1A 1W44A 1CP2A 3ZLJA 2DENA 3CR7A 3FE2A 2NZJA 1X8LA 2BCGY 3R9IA 3IO3A 1OE0A 1WE2A 4NTZA 4PZYA 3MFYA 3OF5A 3FYHA 3CF2A 3IEUA 4C4PA 1R0ZA 4PXAA 1QG2A 2J0UA 3L8ZA 2G1JA 4OK3A 4Q9HA 2CCJA 5F3WB 1QHIA 4Q4HB 1N2CE 2OHFA 3ZS9A 5HPYB 1WBDA 3ZDQA 3E1SA 1PGYA 2XZOA 4FIDA 1F60A 3THYA 4HAYA 1W1WA 4GT1A 1U98A 1UBFA 5J5CA 1CR4A 2B6HA 3B13B 5H70A 3QQ5A 3H4JA 1J99A 2HDNB 3BXZA 4G5OA 3CIOA 4WZAE 5EZ5A 2ZAOA 1PLJA 3SU8A 4M1SA 4JS0A 1OKSA 4I99A 4FINA 3W6OA 1Z2CA 3I92A 2JLUA 5AUPB 2DPXA 1EGAA 1KZGB 3OAAA 1AZSC 4A8JC 2F6RA 1E4YA 4UKDA 4PFSA 4C9BA 1E2NA 2DWZB 4A6XA 1CIPA 2QPTA 1RYHA 5C1BA 1KZ7B 1HT1E 2JJ2A 1OFHA 2ZJ5A 1K8RA 1EFRA 3WBJA 5JHHB 1WQ1R 3CF0A 4HLUC 3FKSA 4DLUA 2QMUA 1QZXA 2DHRA 2QP3A 1Y8GA 5FL3A 3A1WA 4NMMA 4YMSA 2OBLA 3BS4A 4HYYA 4IHQA 2DZNB 4NL4H 3L2OB 3NDBB 4JLPA 4DDVA 3GLGA 4B47A 3QJYA 1S3GA 1SKQA 1XMSA 1UADA 4LUCA 3DM9B 3IIMA 3QNUA 5EE5B 3OHMA 4EFLA 2BC9A 3EPJA 1ZNYA 3NKVA 1ZUHA 4W7SA 4A92A 2IYTA 1NMXA 1KI8A 3LBIA 1G6HA 3SQXA 3TIFA 2BMJA 3PXGA 5JWRA 5KTYA 1YZQA 3W8NA 3I8XA 3HU3A 1D9XA 2O8DB 2VO1A 2KNVA 2GBLA 1MRSA 4FI3C 1G3IA 1W4RA 2XXAB 2D2EA 2AWOA 2J7PD 2Z5FA 2DKLA 1QHXA 4QOSA 2GVZC 4P4SB 4BLRA 1NP6A 3T5DA 1UPTA 5AJVB 3U2QA 1DO2A 1HURA 2R6CA 3FTQA 3TW8B 3A1UA 2BKUA 2QTVB 4UNRA 2V4ZA 2W6ID 3B82A 1OKKD 5FL7D 3TVTA 4BZPA 1TU3A 3ZH9B 4QM7A 2YOHA 4ZI3A 3B1ZA 3TMKA 3W9YA 2F1HA 1U9IC 4DZZA 2G77B 1BYUA 3VHXA 3U4QB 8OHMA 2UZIR 1CR2A 2IL1A 5CJPA 1QBKC 2QGNA 1O87A 4GOXA 1E1QD 1W5SA 3FRIA 3MAAC 4NU0A 4OK6A 2QQ0A 5LD2B 3GD7A 2DZOB 4TQ9A 4PR0A 1OQYA 3WBKA 5JEDA 3AQ4A 4Q21A 4UJ3A 1GZSA 1E94E 2K5UA 1Z6AA 2XB4A 2AX4A 3U7FB 4Q1AA 2HT6A 1G5RA 2FSHA 3CBQA 1NKTA 2I4IA 1V92A 4M9QA 3FPAA 4JMPA 2WAYA 3H1TA 2DBYA 2NZ8A 2JLZA 3OEHA 1E96A 4AIIA 5CDFE 2W6JD 1Z08A 4JLMA 1EFCA 5DI9A 2A30A 4E03A 3P20A 1RPZA 4OHWA 1IN6A 1KY2A 2DHYA 1RIFA 2EFCB 4Q00A 4M1YA 3AF0A 4YXWD 2QAGB 3GFTA 1HA3A 1N6LA 1B0UA 3JVVA 1UM8A 1R2QA 2REXB 4BFTA 4Q19A 4LHZA 3L0IB 1KK0A 2CNWA 2W2VA 5EQTA 4Q66C 1TEXA 4Z8YA 4BFVA 2ZE7A 1OTRA 3ZVMA 1I4TD 4Q7JA 1T3HA 1FQKA 1N25A 1VG1A 3ZD7A 1MO4A 2ODWA 4G3XA 1AQYA 4GI7A 3VR4A 1TL7C 2GF0A 4QJ3A 3NWJA 3PITA 5TB5A 1FTSA 2NO1A 3ZVRA 3CWQA 3L43A 3CKLA 3LAWA 2OAP1 3FOZA 3U7GA 5JJIA 1PUJA 4BLOA 3S1AA 1BH2A 2D7DA 3FGNA 1MRNA 4ASUA 1KSHA 3K09A 3QI2A 2QMHA 4O25A 1NN3A 2ORIA 5TDHA 2DAKA 2DZLA 5SZKB 1RYFA 1R0WA 3AVVA 2DAIA 3AVYA 2JJ8A 4FD2A 3JVUA 3PG5A 3CX7A 3LY5A 1C9KA 3EPLA 2J7PA 4Q4AA 3NXSA 2XOKD 3TAUA 4XWOA 2B8WA 2XAUA 3TR0A 4B3GA 1KNQA 4Q47A 2J0UB 4B71A 2ZTDA 4BFXA 3DZ8A 4LK2A 4NDZA 5EE0A 2GCNA 3AP1A 3RRNA 3PEVA 2WV9A 4TSFD 1U99A 4US0R 4KO8A 5FL7A 4V0ME 2CLSA 2VF8A 4IOMA 3T06B 1FNNA 3THYB 2F7SA 2XJ9A 1SULA 4DHEA 1E2KA 1IJFA 3NEJA 1Q1ZA 1HYQA 1IY0A 2YINC 2FEMA 3UPUA 3AP2A 4LY6A 2WMNB 1NMZA 3U3JA 1E2IA 2IYXA 1VG0B 2AXPA 3QXJA 1E9CA 4MQBA 3C14C 3ZS8A 4ESVA 4IDQA 2A3RA 4LZZA 2AL7A 3QPUA 4HAWA 2HAKA 1OSNA 2DVWB 1Z28A 5HR5A 1ZJ6A 2W2TA 1SXJD 1WDTA 1IJEA 2ZE6A 1XEWY 2Q9CA 2ZYVX 2FGJA 2FGKA 3X1XA 1PLLA 1OXXK 3R8CA 1L2TA 5UKDA 4Q4LA 2ZSEA 1GSIA 2NG1A 2WJVA 1II9A 3BOSA 1MO6A 2W6JA 4FMDB 4XSHA 3AVQA 1Z6GA 2X1VA 2QHOB 3EG5A 2J87A 5SZJA 3LLUA 3CB4A 3C5HA 2R44A 3CH5A 3C15C 1VYUA 1HH4A 4GRAA 4LV6A 4XVRA 1IFYA 3CX8A 3LV8A 2B21A 3CF6R 2I1QA 3GLGB 3P26A 4PC3A 1KSGA 2IX3A 4CZ2A 4TL9A 1ZBDA 1MR3F 3QEJA 2PCLA 3DO6A 3PUVA 3IHLA 1A7JA 2W58A 4AURA 1RRCA 2YVUA 3PV0A 4NHOA 1AKYA 4EJSA 3HPQA 3QKSB 3T1VA 2QZ4A 2GJAA 1XB2A 2WOOA 4NCIA 1CRPA 1K5GA 2Q3MA 2AFHE 3B2EA 4R7ZA 1LFDB 1UJ2A 1YQTA 4P4UA 4P0TA 2RMKA 3ADDA 4F1IA 3EPHA 5DYIA 3IDQA 3DDCA 2RGGA 3MWKA 1VQ1A 1XTRA 2CEAA 1EWRA 5B30A 3VU9A 1CR1A 3GJ4A 3KXIA 4LJAA 3BE4A 5CM9C 1XPUA 1J7KA 1CF4A 2W00A 5HCNA 4TSFA 1NSFA 2ERYA 2DFLA 3AF1A 2IXGA 4PPFA 1IHUA 5FBQB 2EFGA 3PENA 1JXMA 2C96A 1CTQA 2B92A 3L0OA 3N70A 1VEJA 5B64A 4IEEA 5CYOA 1NVUQ 4L4UA 1NIJA 4LSGA 1G41A 3K0CA 2Z6VA 3RC3A 2BKEA 4JYBA 1JALA 2MJ5B 1TTEA 1II8A 2CL0X 2PL3A 3E70C 4FMDF 1YZUA 2ZI9A 3TSZA 1W36B 4GEWA 4ZCMA 1YHNA 2AKYA 2QN6A 2HJGA 4X8LA 1WHCA 5FI1B 1ZNZA 3MG9A 4B3FX 1OLOA 2ZEJA 4ZCIA 3BH0A 1YZLA 5J40A 2JLXA 4HEOA 4ESHA 3FDIA 1DELA 5J4VA 1CJMA 1XTQA 2QSZA 2D7CA 1WGLA 2WSSD 4FWDA 4LJ6A 2YWFA 1GL6A 4DBGB 3V4RA 1EFUA 4EPRA 1DG3A 4B3DA 5CB6A 4B73A 2W0MA 3BAFA 1T43A 3PUWA 4TYQA 1P9WA 4PTLA 5FUVA 3TW4A 1XD2A 4B2IA 4Q4JA 1ZU5A 3SNHA 2HT1A 1G291 1H8ED 3DPUA 3PIRA 4QNRA 3K0AA 2R9VA 4NE2A 4P31A 1KHTA 4UJ5A 3B1VA 4GP6A 4JL8A 1SG9A 3LX8A 1SVIA 4P33A 3E5HA 3BERA 4JJKA 3UK6A 1U0JA 1KAGA 2QAGC 5H68A 4N1AA 1WF3A 4Q4AB 4ZDIA 521PA 1KI3A 2O8BB 2P2LA 3AGPA 3TRFA 3GJ6A 1NG1A 2XITA 4BRUA 4FMBB 3I8SA 4BQSA 3LLMA 1N6OA 4OI0A 2WZJA 2QTHA 1K5DA 3DMNA 3FMOB 2LBCA 2E1RA 4AY2A 3CUEF 2WKQA 4RY2A 4JYCA 3RS0A 1W0KD 4B3XA 3KKOA 4QHYA 3THWA 2VIIA 1ZUIA 1G21E 3SR0A 2ZJOA 4BEJA 4RKEA 4F7WA 1ZC4A 5EZ6B 3D3QA 2ZETA 4EQ6A 5GJWC 3EZ7A 1X1RA 5FOXA 5FBLB 4CEJA 1G4UR 2OM2A 4D4MA 2F3RA 2IWHA 3I3SR 3AV0B 1KJZA 3L0SA 5E4FA 3VKWA 3BB4A 1RVDA 2GRJA 5G41A 5KDOA 1VDLA 1NN5A 4C2TA 2XNSA 4TLAA 3K9GA 3UKDA 1Z07A 3EA5A 4QHTA 3G82C 3LQRA 4GPTA 4WOPA 4XVQA 5SZIA 4BUJA 5FOUA 2V1UA 2XSZD 1SHZA 2QPOA 3IPYA 5AUOB 1TEVA 3CNLA 1US8A 1XXHA 3R7WA 1C1KA 2ZROA 1E9AA 4KSBA 1YLAA 4W5JA 4R9UC 3ZD6A 1ZIOA 3OFND 1B23P 5FOWA 1GO5A 1G16A 3Q85A 4MH0R 3LW7A 4KFRA 4MYUA 1GTVA 1P60A 2QORA 4TTRA 1NLFA 2IS6A 1X6VA 4B6EA 2ZRCA 1G20E 4XVUA 1ONBA 3LVQE 3AJIB 4Q1BA 1OIXA 2BMDA 1W4AA 5DHFA 4N3NA 3B1XA 1E1RD 4R98A 4JLNA 2O8CB 2KE5A 1E2PA 4RZ3A 1GUAA 3OIVA 4BFYA 1W7AA 2F9MA 4GSYA 2HV8A 3QXCA 1TR8A 1RC8A 1JBKA 2JATA 1JEEA 1KMQA 4EJSB 2OO9A 4MKFA 2Z43A 4WIAA 2PEZA 3C7KA 4G5RA 1OHHD 2ZQ5A 4PQRA 1TF5A 3P32A 1Z0DA 1QG4A 1C1YA 1XTSA 3QY0A 2O52A 3C8UA 1CKEA 2Z83A 3B1WA 3BJIC 2ORVA 4M22A 4Z8XA 2BMEA 4Q9LA 2IHYA 1ZMVA 1WMSA 3EZ2A 4DWJA 1NBMD 4NCNA 2JLSA 1COWA 5J47A 3UXMA 2OSBA 1KK2A 1ZINA 4KU4A 1VIYA 2WMOB 2ZE5A 4MKGA 5KU1A 4JIMA 1G6OA 1FUUA 1DAHA 3RANA 2G1KA 2ZE8A 4JJZA 2ZRPA 4UNNA 2C5LA 4M21A 2ANBA 2IYUA 3X1WA 3TBKA 4BLSA 2IS2A 3K53A 1Q3HA 2QRNA 1W0KA 2A5FA 4LPSA 4C3ZA 1BO6A 4MRSA 4U5XA 4DDUA 2ZUDA 4JT4A 3FMPB 4J0QA 2A9KA 1VEGA 2H5XA 2RHMA 4WVFA 4DBLC 2DI0A 2GEDA 1N6NA 2VHCA 3MUFA 1JQJC 5AJYA 2XZPA 4CT5A 1ESNA 2FZLA 4X8OA 3ICEA 2CWBA 4M1WA 1JEDA 5GJBA 1Q3TA 2W83A 4HB2A 621PA 1KAOA 2AR7A 3EZFA 4WA7A 3P27A 3A1VA 4BFWA 1U8YA 4E07A 5KSPA 3SJCA 4QJ4A 4YMUA 5KSYA 3EIHA 4KITB 2DNAA 1ZM3A 1JAIA 3VLFB 5H1YA 2C03A 1N0VC 1P9NA 3KJIA 3SE0A 3MCAA 5FPTA 4IXMA 4FMCB 2V6JA 3WRXC 1KI7A 2WKPA 2NPFA 3FMFA 1E9SA 2H7VA 3DMDA 2IYZA 4XJXA 4HUTA 1RJ9A 2ATVA 1L8QA 2P6NA 3W6PA 3QG1A 3AVUA 2DAGA 2ZPTX 2ZYTX 2CP8A 3GP8A 2IYQA 1G3MA 5E7IA 2A5YB 4Q9JA 4AD8A 5CB8A 2DWPA 5CLQA 2V9PA 4O2LA 1E79A 3BFKA 1GNPA 3AF2A 3EZ9A 4GOKA 3OIUA 2JLWA 1NKSA 1W36C 4Q4JB 2WJIA 4DLSA 1L4YA 2ZANA 4GZLA 2BWBA 2DY1A 2QM7A 4PHHA 3AVOA 4PHGA 1GRQA 1E2MA 4C0QC 3K0AB 3K70B 1OHHA 2ZR9A 1GAJA 2GK7A 1M2OB 2KBFA 2NTYC 3FHOA 1LY1A 1NVXQ 4QBGB 5JS8A 1N0UA 4CW7A 3U44A 3MLEA 3GLFA 1JJVA 2LTUA 5IT5A 2O8FA 3V00A 1NBMA 2OE2A 3VR5A 3EC2A 5JRZA 2Q21A 5IHPA 2H92A 2AKAB 5EE1A 2CCKA 4KLZA 1QHNA 2XGJA 4PANA 4I1UA 1EX7A 4ZIRA 5TY0A 1S1CA 3KKQA 2PLFA 3TJZA 2V1XA 3W34A 3LNCA 1XD8A 1GFIA 1KO1A 4A6PA 4C7OB 1E2LA 5AJXA 3THWB 4V02A 2L0XA 5B57C 4W9MC 4TMWA 1ZUNB 3SZRA 3KQHA 2J9RA 3IGFA 4CEJB 3AVXA 3FFAA 1MABB 3RWMB 2Q3FA 4OQXA 2FWRA 4PHTA 5FBVB 3RYTC 4ZDJA 5K8TA 5CIWA 1HTWA 4IVQA 4RD3A 1M74A 1UKYA 4Z54A 4M8NE 1KO7A 2J5XA 4FMCF 1XDBA 3IHPA 1AGRA 4LYFA 3FKQA 4DLVA 1US8B 4DDWA 4B3CA 2J1LA 1G17A 4LJ7A 2EKKA 2P5SA 1KI4A 4QGFA 5ELXA 3VNVA 1M8PA 4B33A 2RB4A 2BBWA 4F92B 1DAIA 1JNYA 2GJ8A 3GLIA 3LQQA 3PUYA 4US2R 3UG7A 3QBTA 1NN1A 3N2IA 4HZUB 2PH1A 2RGEA 3BC1A 3GJ0A 3QF4A 1DVRA 4MGKR 4KXFB 4Q9IA 3DEFA 3I72A 5B2ZA 2ZI7A 2IBMA 3F0TA 1S4QA 3PEUA 2GXUA 4TLEA 221PA 4KJZA 2FZ4A 3AP3A 3AM1A 2R65A 3J81k 5G40A 4WZBE 2X8AA 2A2ZA 2FFQA 3O8BA 4KYIB 4Q7KA 3GLGE 1ZM9A 5BN5A 4FWIB 1Z83A 1BKDR 1YR9A 2BIFA 2K0BX 2GAOA 4Q1EA 3ICQB 2QAJA 1W5TA 5JMTA 2D06A 2NO7A 1ZMWA 4MRPA 1T0HB 1D8TA 3NH6A 2K9DA 2QROA 2HCBA 2FSFA 3HR8A 4MGYR 1YZNA 4OHYA 1Z6XA 3ZZUA 2YWEA 2QI9C 3CRQA 3AEZA 2OBMA 2MROB 1KDRA 3KQNA 1CJKC 2C78A 5EXPA 1U0LA 1Z2AA 4JT2A 4C0SA 1WXQA 5DIFA 4FXPA 5F9HA 2YJTD 5HE9A 3A4MA 2REBA 2Y8EA 3UWKA 2ZJBA 2X2EA 1KI9A 3UWOA 2ZI4A 1RE0A 3BH6A 3MWJA 3R9XA 3WXMA 1IXSB 1FL9A 3W5IA 4EJSC 2KI5A 4EIWA 3O47A 2CE2X 4FCWA 2PT5A 4KLNA 2LVOC 3WHLA 1LF5A 3L82B 4B48A 1XMIA 4LYHA 1WR1B 1Q12A 1A2KC 1JB1A 3NBXX 3SQWA 2Z4RA 4G0NA 4R71A 2O8EB 2OFWA 3TSOA 2H1LA 1T6NA 4DT1A 3LXXA 3RNLA 1NN0A 3VNUA 2J41A 2VP5A 2JLVA 2VHUA 5CJ2A 3RRYA 4E22A 3AUXA 3EW9A 3BK7A 2R2AA 3TUJC 3ZQ6A 2G0NA 3IBYA 4Q18A 2V55B 3Q8XB 3WNDA 4LOAA 4V0LA 5KPJA 4V0NA 5IK2D 2BMFA 2XB2A 1Z47A 4IEIA 4GZMA 2VRWA 4IVPA 4QM6A 2YWHA 4OKSA 1XPRA 1DAGA 2IT1A 5BYKA 2ZRMA 2IC5A 4YDSA 1SVMA 5K8IA 1R5OA 3LBNA 5JRJA 2ZR7A 3RSOA 2KWIA 1EWQA 3K9OA 1W46A 2QL6A 3MGCA 1GOTA 3QKRA 2O5VA 1DBSA 2GJSA 2ANCA 1OFTA 1ANKA 4LRWA 4CGZA 1JJ7A 3PJRA 1NVMA 4K46A 5FPKA 4Q9KA 3WY9A 3DOFA 3ZGXA 5IF9A 4IDNA 4ON9A 5DI3A 2QMEA 1OW3B 5EXTA 1NSTA 2QP4A 2VP9A 3THXB 1Q20A 1GRNA 1W4CA 2J46A 3VAAA 1CUKA 3NBZC 3KDSE 1Y3AA 2Q0HA 4HLQB 4YLGA 3WNCA 2BVNA 3FRHA 2L4EA 3CRMA 5TVKA 1BIFA 1OB2A 5GVSA 3CPEA 1FMLA 1E9RA 5J4YA 4DSNA 1CRQA 4LX0A 1QHHA 4L9WA 2CVHA 4QG7A 2ONJA 4ZIRB 4URXR 3AVPA 4UNPA 3PR1A 4EKDA 5CITA 4QKQA 1LS6A 5KPDA 2JY5A 4DCVA 1Q1EA 1SKYB 2WWXA 4DLXA 1DE0A 1AK2A 3W3AA 1R0YA 4OJQA 2O0JA 1ZW6A 2FNAA 1CBUA 2GKSA 1XWIA 3O8DA 4XOIA 3SBDA 4PAMA 1P6XA 4KI0A 4TT3D 4GOJA 2BBTA 1YKSA 3K70C 4G01B 1LTQA 2ZVQX 3ASYA 2EQBA 3JZAA 2UVQA 1M6NA 5EUMA 4DXAA 4KHZA 3DVLA 4TLBA 4D4KA 4PSVA 4F4JA 1ZMXA 1Z63A 2IK8A 4D81A 2IUUA 3U6BA 2JASA 5AR1A 2V7QD 4MDEA 2QG6A 1ZMUA 5L3SA 1F2TA 1A1VA 1H65A 1XMJA 1GWNA 3PEWA 1D5CA 3B85A 3T1OA 4PSKA 3I5YA 1KDPA 1Z0JA 2E9SA 5C46F 3NHAA 1IXZA 1WRBA 4A0FA 2W2XA 5BN4A 1HV8A 3Q7QA 3TNFA 3Q9LA 2JIZD 5FOVA 3K0SA 3GLIB 5FUWA 1SGWA 4TYNA 5JBQA 1ZAKA 4PPGA 5FR1A 4AKHA 2WKRA 2EFEB 1F2UA 1XJCA 3QF4B 1JR6A 1GDDA 4ARZA 4DSTA 2TMKA 1NVVR 1P72A 2CE7A 4PO9A 5EE3A 5BN3A 2B7BA 3ECCA 4Y0AA 2IW3A 3BRWD 4A2WA 1D2MA 4KVAA 2WJGA 2KNZA 4LGMA 2R6FA 2WWWA 1XTKA 4OL0A 2W6IA 4PPQA 4EPTA 2R6DA 3VMFA 1OKKA 4DLTA 3PVSA 2GESA 3AKCA 3BH7A 4NYIR 4AG5A 3KFVA 1GG2A 2RGNA 1Q44A 3GQBA 4KAXA 5FPSA 5DHAA 1VMAA 4Q5IA 4B34A 1NRJB 2GAAA 4AC9A 2W0SA 3GMTA 3RABA 2BHRA 1E1QA 3Q7PA 1T91A 2AD1A 1TQDA 2PJRA 3SS8A 4Q01A 4I81A 4NCJA 3KZ1E 2VHJA 1YRAA 2J3EA 1F3OA 2IYSA 1XCGB 1ZRHA 4IOKA 4LRSA 3WMEA 1AIPA 3P1JA 2WWGA 5JCZA 1G5PA 3LXRA 2HYIC 4XD7D 1XD9A 4XWAA 5DFLA 5JSZA 4D26A 1N6HA 1XU4A 3GJ8A 3K8YA 3IUYA 1OH5A 1FW6A 4NYMR 5M04A 3CPJB 4G5SA 1MOZA 3X1ZA 1G7CA 3AKEA 2AK2A 1WB9A 1FP6A 4RFSA 1W0JD 3B6EA 5BW8A 2DFNA 4QBHA 2BWEA 1VDZA 1TMKA 2OCYC 2FFAA 4YXWA 4JSYA 1XTJA 3REGA 3EX7C 2C9YA 1VCMA 2RGDA 4GNKA 1XTIA 2ZSFA 2JEOA 3E2IA 4AYTA 2PT7A 1ZV1A 1OT3A 1UBEA 5KYKA 1NVWQ 1ZNWA 2FPLA 4MYCA 2WOJA 3WRYC 2JY8A 2IUSA 2DB3A 2LKDA 5KSOA 2Q6TA 3NC1C 2O0KA 1T5IA 1UBCA 1U8ZA 3KL4A 2EJSA 3MD0A 3K1JA 4RSGA 5EXSA 4LJ9A 4DKXA 1DTSA 2OLJA 1N6KA 1KY3A 1LNZA 2C77A 2XX3A 4NYJQ 4P4TA 5KUTA 2J0QA 2KBEA 4JZKA 2JLQA 2QU8A 2XTNA 1OYWA 3O8RA 3W3ZB 1MO3A 4A8JA 4YC7A 2FFHA 1UFZA 2CJWA 3KQLA 3U3KA 2AFIE 2GZDA 1DO0A 3CRVA 3LW8A 5LDDC 5C18A 1XMVA 3EIEA 4GBMA 4XTRA 5IDVA 1JAHA 3QVUA 2XOKA 4HLUA 2GJKA 2OG2A 2WJHA 3QKRB 3T15A 3IPXA 4LYAA 1S96A 4CEIA 1QF9A 2VHQA 1OAIA 2DR3A 2ZRIA 4Q7LA 2ZS8A 4DC9A 1CULC 1RRFA 4D4LA 3EWSA 3X1YA 1IN5A 4OK5A 3T1TA 5DI3B 3FWYA 3BORA 3SFVA 2RCNA 4XH9B 4HLDA 2HJVA 5FTJA 1C4OA 1Y63A 2XNDD 4BFZA 1CLUA 3C16C 1E99A 4Q48A 3WMFA 3K9PA 2IHBA 2ZUCA 1T0JB 2OO7A 1FPMA 1E2DA 3GFOA 4AG6A 3BB3A 5FH9A 3R9WA 2ZRDA 1TX4B 1QHHB 4XWKA 4DCSA 1N5IA 1ZVQA 1VECA 1SXJA 4HDCA 5G3ZA 1IONA 3SJBA 4C0HA 2P0EA 5FOTA 3IQWA 1NY6A 3QENA 4QBIA 1LV7A 3U3MA 2OCAA 4GL2A 1PVOA 2NO6A 4CYMA 1IY2A 1G9XA 4XD7A 3BBZA 3VX3A 3EXAA 3QXSA 3D6TB 4UN2B 2FJUA 2LKCA 3FHTA 3N2EA 5C4MA 1E0JA 1NJGA 4BASA 5JS7A 2RGXA 4BZXA 5LD2C 4KVGA 4A9AA 4Q7JB 5DN6D 1U9IA 2G0TA 5CYPA 1R7RA 1SQ5A 4JKIA 3D31A 1Z0IA 1ESMA 4PO1A 4DSOA 4TLDA 1NG9A 2NGRA 3IQXA 1KDOA 3GEEA 1XCPA 2R6GA 4KSCA 1KJYA 1L4UA 3SN6A 2VF7A 2LCFA 4HAXA 3S1AB 1NNEA 2PX3A 4AKGA 2F43A 4M4SA 4NCKA 4TTQA 1S1MA 4A0HA 1T8TA 3AB3A 2C9OA 5DISB 1XXHE 2MSEB 1J8YF 1I4LD 1OXSC 2NPIA 3KJHA 1Z8FA 1GKUB 1S3SA 2G88A 2J45A 5GJCA 2QA5A 4DCNA 2PZFA 5HTKA 4QNMA 4HDQB 1R5BA 1FMJA 1OXVA 3SEAA 1NV9A 2RGAA 2IF2A 4HB3A 2OXRA 1AN0A 2VLIA 5KNDA 2ZIAA 3KX2A 4O2RA 1D2EA 3VX4A 4S2EA 1LB1B 4CEHA 2QGZA 2ZJAA 3NIBA 4ZCLA 4L16A 4JKYA 3K9HA 2UZ3A 3CRRA 5DLQC 5GJVC 4HAZA 4M9XA 1QZEA 1GNQA 1P4SA 2FDCA 2ERXA 2OT3B 1TQ6A 2VL7A 1QVAA 1DG1G 2P5TB 2VA8A 3HPRA 3HYTA 5HE8A 2GXSA 1NIPA 4DB4A 1YZTA 1NV8A 4TZ0A 2R8RA 2L2DA 3RAPR 2XTMA 1BOFA 3VTKA 2YYZA 5DO9A 2R6AA 3ZIAD 4LPKA 1H8HD 4KYUA 1VHLA 1Q22A 3MWLA 3T6PA 1NI3A 2MGWA 2QNJA 1GRRA 4O0MA 3RRMA 4FW9A 3LVRE 3SHWA 3ZZ0A 4D6PA 4YMTA 5JSZB 1E2HA 3L0PA 2ZSDA 1F4IA 1LS1A 5J4KA 3SYLA 4FWHA 2R62A 5A0FA 4UNQA 2AK3A 2EU8A 3RS7A 4MGZR 4BRWA 1EK0A 4RFSB 3LCUA 2CLDX 2WWYA 2CLCX 2PMDA 2WPDD 5TXGA 1DS6A 1JR3D 2ZYWX 3ASZA 1WJ7A 1NY5A 2ZSBA 3D7MA 2A7QA 2X2FA 5DH9A 1C7YA 1L7VC 3AKDA 3VFDA 5JWHA 4TLCA 1R8QA 4I4LA 4TL7A 2WSSA 3OEED 2AHOA 3E46A 4F2LA 2XTZA 2QBYA 3RLFA 3H86A 1G3RA 2OOBA 1RZ3A 2N1BA 3A37A 4IFEA 1G19A 4PPNA 1YZKA 2RGCA 4TQUS 1Z0KA 2ODEA 1XB2B 2C95A 5DGXA 2WJYA 1DADA 1BS1A 1ZP6A 1H8EA 2CXXA 5DE3A 3AH8A 4A8JB 5KO2A 1XRJA 3E21A 1AGPA 2DFKB 4BGDA 4M0LA 4KODA 1UEIA 1EX6A 4RD4A 5EXXA 1SZPA 2J0VA 2ZRHA 3L8YA 1Q1BA 1Q0UA 2CL7X 1OH6A 3KKMA 3SYNA 4PC1A 1A2BA 3CO5A 1P9RA 4Q4HA 4TMKA 2BM0A 2GXAA 4EFNA 4D2IA 2VSFA 1AS3A 4HAUA 1XF9A 3VU9B 3B9PA 3NC0C 3QKUA 1JXOA 4LC0A 2CMKA 2IS4A 2HXSA 1F6BA 4I1VA 4RD1A 3X2SA 3KJGA 4WAUA 2A5DA 5SZHB 2LVNC 1EFTA 3KFXA 3P4YA 1G8YA 2ECKA 5CK4A 1G7RA 2H57A 1PJRA 1ZIPA 2DWQA 4RVCA 5FTNA 2KB0A 4TTPA 4R2HA 2GBLC 4HUQA 4Q1FA 4LJYA 4C0LA 4JLKA 3I61A 2D4HA 3THOA 5JHGB 1II8B 3OE7D 3KJEA 5JLJA 1W2GA 1N5LA 4PZLA 3DKPA 1M7HA 3I32A 1FOEB 4DCTA 1UF9A 1XJ0A 3ZIAA 1SXJB 3GLFE 2PCJA 4PSAA 2HLDD 3EIQA 2XSZA 2QT0A 5EE9A 1NBME 1TPZA 1E9BA 2WWHA 3F8TA 5AUQA 4L15A 1NJFA 4LC1A 2FPMA 1TUEA 1Q02A 2D62A 1QRAA 3OFNA 4LCBA 4LV5B 5LPNA 3MMPA 3QOFA 4Q1CA 2C99A 4NH0A 4Q1DA 4C0KA 4EUNA 4JLOA 1FNMA 1YRBA 2C9CA 4US1R 1SKYE 4LHWA 1JR3A 2WM9B 1EFUB 4C30A 5L3VA 4LBVA 4N0EA 5G3YA 3AVTA 1PV4A 1E1RA 2YNMA 4KV9A 4URVR 2GILA 2ONKA 3OEEA 4K8OA 1P5ZB 3QEOA 4BFUA 4UXHA 5D3MA 4S35A 1KJWA 2FG5A 2JCSA 2HUPA 4DIDA 1XD2B 3B60A 2ZJZA 2PX0A 2P67A 2BM1A 2ZSAA 1U94A 3C4JA 2XXAA 1OXUA 4IDHA 1N6IA 1KKLA 5FTMA 1FX0A 4R2IA 4M1MA 1IN8A 4P4SA 121PA 1V43A 2JZ1A 3EC1A 4EFMA 4URZR 3ADBA 3OIWA 1VKJA 4M1TA 5G53C 2L4FA 3EPKA 4AYXA 2AXNA 3NEYA 2P6UA 3TQCA 1KTVA 3DM5A 3RRZA 3GLIE 1X86B 2OOAA 4EAQA 5A4JA 1NF3A 4JLVA 1R10A 4LHXA 5JECA 3QSYA 4JLBA 3PFIA 2WHXA 2BEJA 4DB2A 3U4QA 1J2JA 2Z4SA 1KK1A 2JDID 3A6PC 1E0AA 4L9SA 4M9ZA 4JBYA 4AI6A 1P2UA 1S8FA 2A5JA 2JP7A 2ZJYA 4HDOB 3T34A 3VR6A 2ODNA 5E3HA 3AVWA 4WBSA 3W8RA 5KDDA 3U5ZB 1HQYE 4QL3A 3UATA 4EQ6B 2VP6A 2I1VB 5AWFC 4RZXA 3K09C 5FPYA 2FOLA 2ZUBA 2WJJA 4OI2A 2QT1A 4B75A 2ZTSA 1SVKA 2JY7A 2YHSA 1OH7A 3ZYCA 2RGBA 2IYWA 2LVQD 1CR0A 3KB2A 2G3QA 4PAOA 4B32A 1E0KA 3H4MA 1EFRD 1KSFX 1E3MA 3B9QA 3DL0A 3FB4A 1Z3IX 4PC7A 5FFMA 1XXHB 3R7WB 4ZKDA 4LYJA 1ODFA 1CXZA 1N6PA 2HLDA 2QAGA 2OFOA 4GP7A 4F93B 1YU9A 2B3TA 1ZNXA 2OFXA 2G83A 5EUQB 2O8BA 1PUIA 2FPKA 1UKZA 4M2LA 1GVNB 1KO5A 3KQUA 1CEEA 1XZPA 3LWNA 5LB2A 4B44A 4DLZA 4OBEA 4PZZA 2QNRA 1RKBA 3QUSA 3RC8A 4D82A 1MN3A 2JNHA 1IXRC 2PJZA 5BYJA 2IEYA 4RD6A 3IIKA 3T5GA 1T6OA 5JZVA 2H16A 4HEJA 3CW2A 2FH5B 4IFBA 4RCYA 3QBVA 4BFSA 5BXQC 1G18A 3I73A 3G5UA 2HF8A 2GZHA 4PQFA 4L5BA 2PEYA 1ZM4A 1AIPC 3SOPA 1QHGA 1VG8A 5FR2A 1KYIA 2ZRJA 4D0GA 3WMGA 4WP2A 2R0IA 1UKVY 1G64A 1XX6A 2RKOA 2N46A 3GLHA 4E5UA 2VP2A 4DEYA 3SC3A 2CHGA 2ZRGA 1HQCA 4F4IA 1G1MA 2LVPC 2RH5A 1E2FA 3KXKA 3N5CA 1Z06A 1MO5A 2EKFA 1CU1A 3GJ7A 3EASA 4A2PA 2Z0MA 4BE7B 4DVGA 2OV2A 2JLRA 4PO8A 1IAQA 1FTNA 5JEEA 1KO8A 1EG7A 2C2HA 4GMDA 4MA4A 4AKEA 4JL6A 4QBFA 2RHDA 1AS2A 3TGPA 2X77A 2JDIA 1A82A 3WYAA 4D25A 1DPFA 2BJWA 5TARA 2WICA 1E9FA 2VBCA 3BBPA 1CS4C 3UMFA 5AK0A 4C0JA 2HXYA 3LO5A 3IIJA 2BDTA 2QM8A 2FN4A 3RS5A 1W36D 1XP8A 2I3BA 1UFQA 4HUQB 2RAPA 1QHSA 3OEHD 3ND9A 3W6NA 3BGWA 3FHCB 4MRNA 4YMWA 5AUNB 5BQ5A 1TF7A 3NVAA 1P2TA 3VKHA 1GITA 3QG5A 3TQFA 2ZREA 4LBWA 2YC2C 3G0HA 4OJKA 1SHKA 1PLKA 5J4HA 4HB4A 2GVDC 4G5QA 4ABYA 5IRCD 2X19A 3KTAA 4V0KA 2SHKA 3NDPA 1S9DA 3C41J 3Q5DA 2CNWD 3K9LA 4B74A 3AKYA 4QGGA 4HSEA 4ZKEA 1KSJA 2ZYUX 3QKTA 2GCOA 1G8HA 2ASEA 1LF0A 2YOFA 1RJ9B 2C04A 2QSFX 4EPWA 1KIMA 2JZ0A 2V6IA 4LJ8A 3PUXA 1HY3A 2A5GA 4KCGA 1NMYA 2AD5A 2MMGA 5KNBA 4DRZA 3AGQA 2F55A 1DAEA 2KJQA 1I4DD 1TADA 2CDNA 1KI2A 3K0CC 5HCIA 3QKSA 4ASUD 2PLRA 1R0XA 2IYRA 5D3MB 4EPYA 4BWYA 4M1KA 3W90A 3CONA 4LV8B 1ETUA 2H5EA 1KI1A 1SXJC 4DSUA 4D80A 1M34E 1D9ZA 3M0EA 3U7HB 1FX0B 5F9FA 1S9HA 2BWJA 3Q3JB 4A1FA 1M7GA 1OV4A 2QTFA 4WZ6A 5D3QA 2GK6A 3U44B 4LDJA 2GWHA 3GJXC 3GLFB 1G8PA 1P73A 2G9NA 2O8FB 3CWZA 4KFTA 1LW7A 1XNJA 3TUIC 2BOVA 4Y0VA 2MMCA 4DUGD 4ZV4A 2JJ1D 2NO0A 2ZTCA 3B89A 5LBIA 2GXQA 4G1UC 1II0A 2OZEA 4OQMA 1MV5A 5FOSA 1J70A 4AKIA 2NOAA 4K81B 3W5JA 1T3SA 2JUJA 1T4GA 2VH5R 3REFA 3M1IA 4LHYA 1KO4A 1D2NA 2NO9A 3EARA 4PX9A 2AWNA 3KUDA 5ANRB 4NONA 3EAQA 1FP7A 5JFGA 5EP3A 2QSYA 821PA 1KMHA 2ZS7A 1OIVA 4XIGS 2VP0A 3DZDA 1GL7A 2MSDB 4FN5A 2DYKA 3GCGA 3U6KA 2FF7A 4CDGA 1E4VA 1GL9B 2A78A 2GJ9A 4H1VA 2OILA 1BMFD 1HT2E 1DAMA 4C0BA 1VG9B 2Q3HA 4EPXA 3I62A 4ZDWA 4F4CA 1RRGA 4URUR 2OESA 4KFSA 4P3YA 1BYIA 2GZAA 3GPLA 1U2RA 1TF2A 1HEIA 2DWOA 1VTKA 2O0HA 4KBGA 4MITA 1VHTA 3EWAA 2GTPA 1U90A 1ZU4A 3F3YA 4HLCA 2OEPA 3MSXA 5IK2A 4CIDA 1T8UA 4RD2A 1Z6TA 1E32A 2ZI3A 3GJ5A 5E95A 1RRPA 1NLYA 1P7CA 4IDOA 4Q03A 3PUZA 1S2MA 1MKYA 3B8HA 4A0RA 2V3CC 3NTUA 1J8MF 3TLXA 1JPNA 1AKEA 5FTLA 5KHOC 4RD0A 3MHVC 1PZNA 2JA1A 3ND8A 3KB1A 4DIEA 4B76A 4DCUA 4JVNA 2EYUA 3KUCA 3RWOA 2QY9A 2ZI5A 3EA0A 1J90A 1U0HC 2IS1A 3LBHA 4QGHA 4WW0A 4BLQA 1P3JA 2QRZA 3KKPA 5JCPA 4AK9A 3CLVA 2FV8A 1R4AA 3OZXA 2FE4A 3GLHB 5CDFA 4TWZA 4YDHB 3SDZA 3WHKA 1GIAA 1I2MA 1XFAA 2KSQA 2BV3A 1E2EA 5K8LA 4GITA 5EP2A 4OYHA 4UQOA 1Z6YA 5FUXA 3A1TA 3OIYA 1OF1A 1VIAA 1A5TA 2ZRNA 1UAAA 2FU5C 1P62B 1P3QQ 2E87A 4UXJA 1F5NA 3T35A 1GP2A 4QHSA 2B8TA 2IA5A 1Z0FA 3ZVLA 3CNOA 4DUGA 1WBBA
chains in the Genus database with same CATH superfamily
2Z1NA 1L7MA 3HSSA 1RXVA 3QKIA 4IBFA 5JWOA 2XGGA 5KTKA 2PBRA 2JFPA 4L4SA 3KC2A 5AVTA 3DZJA 4I1SA 2R8BA 3ENWA 3K1YA 5DXJA 4Y3UA 2QQGA 3LDGA 4MEAA 3W2TA 2V7QA 1KBZA 3ZOKA 5LYJB 2ZUWA 4MUMA 5FTKA 3IA2A 3P2YA 1NQAO 2O07A 2JD0A 2DR0A 2C2OA 4IRUB 3E1KA 2QYHA 2FDXA 3KFUG 4F3NA 1QQ7A 3F5FA 4RJLA 1Z6ZA 4L27A 2I54A 3ETEA 4DV7B 4ZRMA 4PRYA 4W1QA 4UW9A 3IERA 1LDYA 3HVJA 1U5AA 1JPUA 5J2TF 1XWFA 3NG1A 3T1QA 4BMOB 2RHBA 3EXIA 4O0LA 5KKNB 5I7VA 1D0MA 4JT9A 3B78A 3DZKA 4ICIA 1DIRA 2XXBA 3WL4A 3PNMA 3IV6A 4C07A 4OP1A 4X0EA 2X58A 4LJ5A 3OPXA 2II6A 3TD6A 3M9XA 1AQUA 5AHXA 2P4SA 3JQRA 1C1XB 4UDXX 3AF5A 1XEWX 3FPGA 1CF2O 4JDUA 2FLWA 1CJVC 3B48A 1E5TA 3NOOA 4Z9BA 3U3ZA 3RHFA 3PGMA 3L1VA 5LMNB 4WCFB 3FSJX 4Y2XA 5J1TB 1CQJB 2BGKA 3U60A 2BFMA 4C7OA 1Y9DA 1WHTA 1KDTA 4X8HA 1Q21A 1V1JA 3TKLA 1PJ4A 1IN4A 3C6ZA 1KF0A 4F45A 4RACA 1JEYA 4JI6M 1ZJWA 3EGWA 1ZVJA 3VUEA 3HJSA 1JHYA 3C48A 4MIYA 1CS0B 4XOUA 3IUSA 3NMUF 2WIAA 4EG5A 5HZGA 1GLVA 5HZKA 1UPAA 3SXJA 2CJWB 4ZO4A 5IUJC 5H8WA 1E92A 1RFLA 2D2VA 4LF5B 2YC4C 1TYCA 1BQ4A 3M5WA 3AHFA 3ZI4A 3CEHA 5JSQA 1E0SA 2BL4A 2YVLA 4UTZA 4OHZA 3GQ3A 3WRYA 1OWPA 3OJXA 4E5VA 1ZS9A 5AVJA 2CHEA 1L7EA 1QVRA 1IPFA 2IEZA 3DMYA 3HL4A 3Q5EA 2FZ5A 3AB7A 1I7NA 3MQ4A 3DTVB 5AMXA 2R7AA 1USVA 1J24A 4MYHA 3EOZA 4MGIR 2BF4A 2I7DA 3C3AA 2BH9A 5AQEA 3C3BA 4IF6A 5CMLA 3OHSX 4L75A 2XRFA 1YQ9A 3LGSA 4IOLA 2YN4A 1VCIA 3BXEA 1PBNA 5TV2A 3E0QA 4XRRA 3WLTA 5E6UB 1IN7A 3GFQA 3E3MA 4N9WA 4BKPA 5I9LA 4TZ6A 4YJFB 3CS3A 1PZFA 3HJNA 1MO2A 3G9ZA 1SVWA 2ZRBA 3VNQA 5DYYA 1CETA 2WF9A 3MWYW 2F8MA 3KAKA 4PHFA 2ZAYA 4KDRA 2JJ2D 4W8OA 3VBEA 3WRVA 1NL3A 2UYGA 2GYWA 5DNYB 4JBXA 1M2EA 3JQGB 4TWRA 3JQQA 1JG7A 3RS4A 2YVKA 5BSWA 3OEWA 1M33A 4TV9A 3PI6A 2QX6A 2QBYB 1C3EA 3I1YA 4B7FA 2ADFA 1ZJZA 3LUKA 5B58T 5KQMA 4I5SA 4QTXA 5CD9A 3MFYA 2VR1A 5JZ9A 4Q9HA 2CCJA 2HWUA 1N2CE 1I80A 1JH8A 2ZBUA 2X5XA 2WKWA 1EFLA 5J5CA 3PFGA 1I7PA 3RV3A 2BHSA 4YP6A 3TZ6A 1PYDA 1CEQA 4HDSB 4O1IA 5H0IA 3RJTA 2D0IA 1YS2X 2VDRB 4MQEB 3BMCA 2R85A 2QMUA 3AONB 2I4OA 1UC4B 2HA7A 5B1EA 3KQYA 1E3TA 3R7BA 3GLGA 1SKQA 4UVIA 4I4CA 2D1FA 1D9XA 3HCWA 3PCXA 5DTMA 2DUUA 2ZBQA 3W5AA 2HGSA 4L2IB 1NP6A 4CGYA 2D5CA 2ZTHA 3FTQA 3I2HA 4DCCA 3CE9A 5K0CA 5F52A 5CX1A 5CFQA 1T6BY 1RWKA 1QBKC 4CCYA 1EWVA 4ZI7A 4Q3EA 1RPAA 2JFXA 4C20A 1DJLA 4QSHA 3IAFA 1RRVA 2O1EA 5CDSA 3NWLA 1HOTA 1DLIA 3PGA1 3F4BA 3FNHA 1NJSA 4Q66C 4Z8YA 4DDKA 1A7KA 1SUAA 4YI3A 3NDRA 4NESA 4NWIA 1P18A 2OXTA 4N3CA 1U2GA 1P9OA 1NN3A 5K0GA 2JLCA 1IXKA 1XALA 3CX7A 4KQJA 3MPOA 5CDTA 1XO1A 3GVHA 3JU3A 5DNWA 2E4UA 4O2BB 2X2OA 4WK4B 5H16A 1TAUA 4J0KA 4W82A 3HUDA 3NEJA 2WV7A 2GAFA 3MUNA 2G1PA 1HO3A 3REQA 1KWKA 4CFSA 2OPBA 1GAXA 2A3RA 4LZZA 4XRGA 3JAWA 3PYXA 3ER9A 3X1XA 1L2TA 2G8NA 4Q4LA 1WKVA 1Z7EA 2W6JA 1RJWA 5HDQA 2H51A 3ZC7B 4DEVA 1U3WA 3FSEA 2YRWA 4DR1B 1EP2B 5ECGC 1YMQA 2QQ5A 5BMVB 2VH2A 4G84A 5JS2A 4ZOLF 5JZSA 5B53A 1QUTA 3FNGA 2QDXA 3TLGB 3LC1O 2XADA 4BNMA 3IBSA 1UMBB 3HA5A 1WPQA 2J0EA 3AY3A 2B35A 3MGKA 1PKXA 4IXTA 1JXMA 1VEJA 5B64A 1SC4A 2Z3VA 3LUBA 3I9JA 4KOEC 2BTQB 2QT9A 2ZM6B 4X8LA 1WHCA 3MBOA 1OBCA 2G1AA 1YS7A 1ABFA 5EEGA 1PNQA 4AJIA 1NP3A 4IIEA 2MHCA 4MB0A 5LQJA 5A7HA 1U2EA 2EKLA 4FC7A 1AB5A 1E58A 4F6LA 2I7CA 1JAXA 1JBQA 1RQRA 2FPGA 5LNK1 1U7DA 5EOVA 1EEHA 1SVIA 2H11A 5ER6A 1Y33E 3EOBI 3IJEB 3TRFA 2VS1A 1I51A 5EJIA 3QW2A 4CKEB 4UHFA 1WPRA 3OPNA 1U2SA 4RA6B 1O89A 1GZHB 2GZ2A 3ZNQA 3U4HA 5KEIA 3ZD6A 3EZYA 3FCSB 1U6KA 2JIDA 1YS9A 4NJEA 5TEWA 5TQ2A 3PBKA 2I9KA 1BQ3A 1FRVA 1SU4A 1W4AA 4F4DA 4IQ8A 3ZV7A 3ZXIA 4F2PA 2R79A 4ZMSA 2F9MA 3AR9A 3AM3A 4HXEB 2XQIA 1TF5A 3HKBB 4IG9A 4JC8A 4U2EA 1CKEA 4RFLA 1ZMVA 4F56A 1T5TA 2UUCM 2RIPA 1C2YA 3VV3A 4MW5A 4QBKA 1DAHA 4AY5A 4UNNA 3C7DB 2YW9A 2IQIA 3P2OA 1MH9A 5C35A 2BHTA 4DCGA 4WVFA 3T1YM 2XNHA 3IDZA 4X8OA 4N5IX 4BYGA 2QZJA 2C7RA 3D6AA 2LV8A 3UB2A 5BORA 3SE0A 3MCAA 1R66A 2PN1A 5E1MA 4YP5A 3N9IA 4P80A 2ATVA 4OFBA 3U4GA 2W82A 2Y1WA 1Q6YA 4M54A 4C21A 5A9SA 4L3VA 5EL0A 4Y6QA 2C97A 3BQNB 3G5MA 3ZWBA 2WT8A 4NLLA 4QPCA 3K70B 3OE4A 1DHTA 2GK7A 1P77A 2WJWA 5LM3A 3OJEA 1JJVA 5IDWA 5JRZA 3PLRA 1MVOA 1Q7RA 5LOVA 1S1CA 1Z16A 5HJEA 1EDEA 5AW8A 1BCSA 4BPRA 1MORA 1TVEA 3PDUA 4ZAVA 4OV6B 1X7ZB 3KSRA 3U7IA 3BVPA 2M9MA 1UINA 3EB9A 4UC0A 4US2R 1CUDA 3QWFA 1UJMA 4JXJA 4B8YA 1B15A 2CB0A 4FIZA 3JR7A 4XM2A 4ZZ1A 4JFAA 1NP7A 1GQQA 1R8JA 2X0RA 4K3VA 4FWIB 4GF5A 1C1HA 4JV5B 1YACA 1ZMWA 1REQA 4OHYA 4FEAA 2FDRA 2W2NA 5TNXA 1VL8A 2YFHA 2YMPA 5E8RA 2D8MA 4MS3B 4MV6A 3W3AD 4HVAA 3L5OA 5IX8A 1XMIA 4B6OA 4RL6A 4QDXA 4Q3OA 3W5HA 2WUGA 5EMMA 3VOSA 1GT6A 4X6UA 3D8TA 1RM5A 1G2PA 1UBJS 3WNDA 1WJGA 5FWYA 3R3SA 1Z35A 2GO1A 4DNPA 5K8IA 3NB0A 4L57A 1OC4A 2AR0A 1W46A 1C9MA 2QRPA 5HQ3A 4R0VA 5DWDA 2HU7A 1OTXA 3WY9A 1RXWA 1MJGM 4MV1A 2QMEA 5MN5A 4JYPA 3OJWA 3OY2A 5ISMA 3CRMA 5GVSA 3CPEA 3LPLA 1NR5A 4WNIA 2OB2A 4UNPA 5ALFA 3Q6NA 1DE0A 4XOIA 4TT3D 4DCJA 3K70C 3JZAA 4KHZA 4TLBA 3VM6A 3S3TA 3U6BA 3QYAA 2FUG1 1LD3A 2Z5GA 3T1OA 1DZIA 4RMJA 1X74A 4OVKA 4CM5A 5BUQA 1KFJB 3QOWA 3QU4A 3ZNNA 5T4HA 2CFRA 2GESA 5CA0F 3KWJA 4Q5IA 3LU1A 1T91A 1I0ZA 1JVNA 2REQB 3I12A 3CCBA 3KNZA 3P9RA 5H4HA 1F3OA 2X1LA 3CUVA 2G72A 1CUBA 1G4HA 2EL9A 3TSAA 4RQTA 2PZJA 2PKWA 4KPFC 4F5WA 3FJ1A 4MRMA 3KR9A 3B6EA 1OU4A 4Q7EA 4WBXC 4OA5A 2C9YA 2CXTA 4GX0A 2DUJA 2JEOA 1OT3A 5KYKA 2OENG 1YRLA 1DJPA 4EO9A 3KL4A 1GUDA 3KQOA 5KUTA 4PX3A 2XX3A 2KBEA 3HO6A 4DM7A 3OKAA 2O3JA 2PAAA 2DXIA 4UQLA 1WVGA 1JFSA 2WVAA 1DO0A 5LDDC 3NKLA 4UTPA 5HKOA 5EIWA 2XOKA 3QKRB 4BV9A 5JH7B 4JVOA 5IAAA 3BRWA 3RSCA 2CKMA 3MTIA 2EX4A 1Z75A 1VJ0A 5AICA 4HLDA 5EIXA 3M33A 1GPWB 5DM0A 4Q48A 3OMLA 4WLUA 2DECA 4U9HS 3K9PA 2VNJA 2ZUCA 3GFOA 3A2MA 4GE0A 1ZVQA 1F5SA 1J42A 2OCAA 5HF8A 4JYMA 2DWCA 1Y7LA 2G6TA 2X8LA 5HJ2A 1NNUC 1J0DA 2NV6A 2B5WA 4MP3A 2CNOA 3RTEA 2B5OA 1YS4A 3GJQA 3LVWA 2VTDA 5GKNA 4AKGA 4DUZM 3I04M 4A0HA 4PZEA 4U3JA 1VBMA 4D9NA 5ERGB 3Q7RA 4DCNA 5HTKA 2I55A 1E6WA 1WQ4A 4OLFA 1U1CA 1OLUA 3GFGA 3S8YA 3PUJA 2LWXA 4NEQA 1BVYF 5FWXB 4HEHA 4UBJA 3HUFA 4TRRA 3GLUA 3HPRA 3RVJA 3FG9A 4HTAA 4I9FA 5C8XA 1FLAA 1JSCA 3UV7A 2BGTA 1AY0A 3LQKA 1A95A 4QULA 2MGWA 1FLDA 3LVRE 4D6PA 3S70A 4Y7CA 1T9GR 1JGTA 2JCBA 5A0FA 4KRFA 2JFOA 4MGZR 4K87A 2NSHA 2ZYWX 1WJ7A 1ADYA 3PXDA 4XB1A 4IIBA 4YI5A 4BWGA 1SC1A 1MA3A 4GIBA 4PPNA 1DUVG 3AUKA 3WI7A 1D8AA 4D6XA 1CB7A 4PTZA 3K5PA 4BGDA 4YRDA 2J0VA 3SYNA 2CC2A 4EVIA 3AJEA 1HE2A 4CMIA 4UHJA 4YXFA 3VR6D 3P4YA 2ECKA 2H65A 4LNUB 3I0MA 4X54A 3QWHA 2A9JA 2A9PA 2QW8A 2I8LA 2ISCA 3IEPA 4A26A 3Q9UA 4CIWA 1T8YA 3ZIAA 4PSAA 1PJIA 2ZBVA 3VGJA 1QS0B 4WTOA 4TV8A 3W5BA 5HRUA 3G85A 1TFUA 5IKEA 2V6BA 1ECBA 2HGZA 2GNAA 4KVFA 3STWA 2ZYIA 2YBEA 2ZQZA 4D8YA 1H2BA 3P0FA 3SMVA 3VDRA 3H2SA 5ALDA 5LDGA 1DJNA 2OCIA 5L95A 2HB6A 2FMTA 1Z7GA 1NW3A 3DG9A 1EDZA 2WHXA 2OBBA 1K8YB 4L9SA 4WBSA 4CIBA 5ALZA 2PSEA 2WJJA 1YUNA 2ECOA 1Z2NX 4LQ4A 3RIEA 4P83A 3C2QA 4F0JA 1U2DA 4CMGA 5EWMA 4M8KA 5SICE 3LF1A 1TIPA 2IPXA 2OFOA 5A4FS 1ZNXA 5JSKA 1LPMA 2PVSA 3KTDA 5LWHA 3TIVA 3ZXUB 1UKZA 3DLIA 3A9VA 4RMIA 2C9BA 4D82A 2PYDA 3T5GA 4RD6A 5EUCA 5ALQA 1PZXA 4JHLA 4PQFA 4BN4A 1NU8A 5IT9A 1FU8A 1XX6A 5DHTA 3SC3A 2J3IA 3GNLA 1QRRA 3UY4A 2QRJA 5E4JA 2OOKA 1Y98A 1JWLA 2JLRA 3RIMA 3SM9A 3I6QA 3PUIA 2IV3A 4MA4A 3PLAE 1J5XA 1AS2A 1T9CA 4I6GA 4AJEA 3P2KA 5D85A 3AJ9A 2N35A 4ALJA 3KJQA 1L4BA 5IJ9B 2EXXA 3LUAA 3H9EO 3TQFA 1KJIA 1WUYA 4M0FA 1W85B 4AJHA 1MN6A 5F78A 4ZKEA 2WP8J 1NURA 1KIMA 3EY4A 3AHEA 1L5WA 5KMGA 1EIZA 1KVRA 3DT6A 5CD1A 4L9RA 5JD4A 4R3WA 4U2FA 3WO1A 1H0HA 3VO2A 1DZ3A 3IMCA 4RGVA 3TUIC 2BOVA 2ZTCA 1Y5LA 4OQMA 4GX5A 2ETVA 2LXNA 3E5NA 2GM4A 3R3VA 1GTMA 4AX4A 3D5EA 821PA 3GFBA 3UUEA 3GCGA 2A78A 1GGJA 4AROA 4KFSA 3INGA 2O0HA 4LOKA 5BQFA 2ZWOA 1QG0A 2HMWA 3RWOA 1R2ZA 2OCXA 1J90A 3WE7A 3KTOA 4RF3A 1NUHA 5BSTA 2FE4A 1XSEA 1TYEB 4ZYLA 2BV3A 2I67A 1PNVA 4GKKB 4HV4A 2NU8B 1ENPA 4YVFA 3W78A 3R3XA 4B3MB 3HP7A 1Y6FA 1QIFA 1KPGA 5JSHA 3AV0A 3VU1A 2H0AA 1M1YE 2YXDA 2WWFA 1SD1A 2V6ZM 4OSPA 5KJ6A 3V6MA 3EGXA 1XPOA 2OCPA 1BHSA 1YJ5A 4KR2A 4EYEA 5E26A 4EUSA 2D1RA 5IBPA 4JLSA 1BSVA 3UTCA 4BBAA 4GKJB 2RFLA 1HFWA 2OO3A 4Z7JA 5EGNA 5AVWA 2IZOA 2CZQA 5ITQA 1XU7A 1R4GA 2RONA 5ESRA 2XGOA 3C8HA 1U7WA 5JMPA 1L2BA 4QICA 4TYWA 3I5XA 1EPUA 4ZHQB 1OFIA 1EVLA 3UJDA 3UMJA 3CRZA 3SYKA 4OBBA 2JY6B 2RHTA 4LHEA 1UOEA 4G97A 4ZCQA 1MGPA 4IKEA 4H1TA 1P4RA 1TNDA 4E94A 1Y9ZA 1ES9A 4JAVC 1ND5A 4F91B 3MHTA 3MTGA 3SBJA 3TQRA 1NZFA 4FZVA 2Z3ZA 3SR3A 2DR2A 3TLJA 1L7DA 5EGSA 1K8XB 4H3SA 3TRHA 4CM6A 4INZA 1TW3A 1RLUA 1TJPB 3IBGA 3F78A 2OUKA 2B4YA 2WAXA 1VCNA 4GLOA 1X8JA 1N2XA 4HGZA 4HN2A 4M3NA 4AYWA 4N54A 1RJDA 4D0SA 1R9MA 4F85A 4W5WA 2XCUA 4RJTA 3QEKA 4GS5A 4XIJA 4GDMA 3MMZA 2HOQA 4PQGA 2IPLA 1H0KA 4HL4A 1L5OA 4GDFA 4Q9NA 2XMRA 2YL2A 1M1XB 1PT6A 5EJCA 1WPGA 4IJMA 1MG0A 1NBHA 3TK1A 1HT0A 1YE8A 2NVOA 4DDTA 1QVZA 4FT4A 3OP4A 3CM0A 4FCTA 2QMYA 4DPLA 5ARDA 3WLOA 1Q92A 3CN9A 4F3RA 3FF4A 2IIPA 4DG8A 1DKQA 4PC6A 3TQOA 1FYVA 1E59A 1LDBA 1XLUA 1B7GO 3QIAA 2W37A 2OCDA 5CBPB 4RNAA 1TT5A 3S99A 4URWR 3GFVA 2ZXUA 1L4FA 4NYJR 4DIFA 1R9NA 2QUIA 5EYPA 5L45A 1TF0B 1EFHA 3C6KA 1Y8CA 2X1HA 2C5EA 4YUAA 4Z4IA 3BK1A 2NUTA 4R8SA 3EISA 2DFTA 1NAHA 3F3MA 2P77A 1P1HA 2ZJ1A 3ZLTA 3H0KA 3ZD8A 4QQFA 4AJPA 2WYVA 1QPZA 4L50A 3DDNA 3GMIA 1WNFA 3A6FA 4DJTA 1WDLA 4MVJF 4AN1A 1BS9A 1RFGE 3RGGA 4IFTA 4YQFA 1DX6A 2PGLA 1DC5A 5KVVA 4ZVLA 3G7NA 1R6BX 3GOHA 5T8KA 1QAQA 1DCTA 3GCXA 1GCUA 4HYEA 1O6ZA 3IG8A 4RE5A 2IWRA 2YASA 1SCNE 5GIPE 1DARA 4V39A 2VHTA 2RGNC 1N0WA 2AOTB 3F98A 3N8DA 4PQYA 1NXWA 1L9XA 3SIWA 1VP3A 4RESA 4MR7A 3ME5A 5JDIC 4TVBA 2C3YA 3F7OA 1K7FB 2QVBA 1I2ZA 1AB6A 2J7KA 4NBRA 4BQRA 2G9UA 4KO3S 2ZCVA 1YB2A 1ZKDA 2JGDA 2YMMA 1U98A 1UBFA 5H70A 2RG7A 1J99A 3HLKA 5B7PA 1HDXA 4RIGA 4WZAE 2VDPB 4I99A 1ZCFA 3PQ7A 3A70A 3LHIA 3HBLA 3A6EA 1CIPA 4FLEA 1YMVA 1T4CB 2QL7A 1EFRA 5KYNA 4DIUA 4CHGA 1A77A 3BS4A 3SC4A 4B3SM 1SCJA 4X6LA 2DZNB 3NDBB 2W4IA 4B9AA 1H9AA 4LUCA 1MJGA 4AZFA 4JY7A 3L0ZA 2O3SA 1JLRA 2CW5A 4NC6A 3KOZE 4NEHB 1BC5A 2Z5FA 3KVVA 4AAYA 4IUDS 2BH2A 2HJWA 1PDWA 1OKKD 2IJGX 2G36A 1EFKA 1GCOA 4QDOA 4Y9RA 1U9IC 2C7PA 3SLKA 3UJ9A 2XQKA 1AN9A 1W5SA 4GVPA 2W4MA 5LD2B 4NU0A 2CZGA 3A28A 1OQYA 2WNIA 5JEDA 4Q21A 2ZIWB 1YDWA 2FJPA 2K5UA 2NZVG 5D01A 4NXNB 4U5QA 1PTJC 3Q8GA 3OLZA 2IXBA 4E03A 5GZ3A 4RTJA 3PX7A 4I4TB 2DHYA 4Q19A 1PL0A 3ZVMA 4Q3BA 4GYJA 3KT0A 3ROMA 1A04A 1JV2B 1P4JA 2PUGA 4CKXA 3ZVRA 2PH7A 3OZSA 1FNDA 1DC6A 2PSDA 2XBMA 3KELA 4HVTA 3EFOA 3GHYA 5H4GA 1FRFS 1YKFA 4FD2A 1PRYA 3LY5A 2B8WA 3MTQA 3TR0A 4W4TA 1IULA 4A1OA 1CWUA 2NO5A 4EHFA 4O4HB 3QJ5A 1IJBA 4W6QA 4YACA 2ZUTA 2FEMA 3QRWA 2PT9A 1NMZA 1D1TA 5HR5A 3TFWA 1ZN2A 5AYVA 3ZGZA 4ZYVA 2QJFA 1T6YA 4JSRA 1YVEI 1XQVA 2FP4B 1JQ3A 3U31A 1HH4A 2BGJA 1DRJA 3LLVA 3L6RA 4GD3Q 3FDJA 1I1QB 3DO6A 4GYKA 1E3WA 4KQ1A 1VGQA 1QM5A 1R64A 3E7DA 2OCKA 2XQGA 4Y6OA 3C6BA 5EHGA 1K5GA 3B2EA 1QP8A 3ROGA 5K8VA 2BTEA 3CMCO 5FEMA 3GJYA 2DBRA 3R0QA 3MWKA 5B30A 2R60A 1VDDA 1EX1A 4TSFA 2ABWA 3GA0A 3CT4A 2G06A 3JR4A 1JJFA 1JZQA 2EFGA 1AGYA 3O38A 1UBTS 1QANA 5H3LA 3Q41A 5BXYA 4FP9A 4WUTA 4BZZA 1II8A 2MJ5B 2ZPUA 3I9MA 1YZUA 5CCEA 1YHNA 3I04A 1RNLA 4ARSA 4F5DA 3CG4A 4F21A 2QSZA 3LG2A 4BY9E 4BNDB 2G28A 3T3MB 3BAFA 2JGEA 4C7KA 5T64A 1PQPA 3PPXA 4MI1A 3U80A 5CB4F 2QQFA 3NV9A 3KALA 3KBOA 4UUBA 3I5MA 1EFPB 2BFPA 5FB3A 4F86A 4MV4A 1ZHHA 3IDAA 4B3XA 4F7WA 1EJBA 9LDTA 1QX3A 4C2TA 3HXMA 3HJHA 2JFBA 4CL3A 1KEWA 1TYAE 4WEOA 3IPYA 4RKQA 4J16C 4X6XA 4EB3A 4RSHA 2FW1A 2UXBB 2BUAA 2R6HA 2ZRCA 4HNSA 4GMGA 5JALA 2BMDA 2EP8A 3SWWA 1NPYA 5BSFA 1U9CA 4IHKA 1Z38A 3SYTA 2KE5A 4JK3A 5D51S 1GUAA 3I4VA 2FPPA 3WFJA 1V7PC 4BNIA 1KQPA 4PQRA 2O52A 1KPIA 3A9TA 1WMSA 3PHBE 4DWJA 4EG3A 2MYUA 3DUFA 2L09A 4RTLA 1IHDA 1PJ3A 2JBHA 4PRKA 2QY6A 1L6RA 2JW5A 3X1WA 5LXTA 1Q3HA 3NOQA 1KQNA 2A9KA 2XLJA 4M1WA 2I8CA 3USCS 1HETA 1B8VA 1HE5A 3ICVA 3STUA 4HDNB 1KI7A 2XYRA 5JBIA 4HUTA 5EIBC 2DAGA 1PL6A 2G1UA 1SUWA 2IYQA 1G3MA 3B5IA 1JAYA 3BXHA 5ETJA 1E79A 1T1RA 4WASA 4PNHA 1EGVB 3R3HA 4ZU1X 2JFHA 3UMMA 4PZUA 4E33A 1KYXA 1TE2A 2NTYC 1NVXQ 1A72A 2QTWB 1Z8NA 2JI7A 4EO4A 5JNLA 1NVFA 3L8EA 3EC2A 2H92A 4G0OA 1QR2A 1QFMA 1E6MA 3W34A 3FPJA 4IL5A 3C1UA 4DCMA 4TMWA 2PUHA 3KQHA 2SCUB 2J6BA 5EJ6A 4KREA 5DLYA 5EWJA 1MABB 4JGIA 5CIWA 3FTFA 3FTPA 1UT6A 4OM8A 3CZ5A 1PNRA 3HHWA 3L4BA 2A0XA 2PSSA 5HS4A 4LJ7A 2H1CA 1YNOA 4I14A 4AIRA 4WKPA 3HV2A 4ZK2A 3NETA 5T3UA 3AO0B 5JVDA 2X8AA 3N2KA 3B6KA 5FNVF 3RKSA 1L4HA 1T0PA 4DLLA 4EX7A 3MAJA 3E3NA 1QO0D 2G08A 4KAJA 1N7IA 4NNJA 3UT5B 3BHNA 2PM8A 3CRQA 3H42B 2VT7A 1J2YA 1IEWA 4B3TM 3NU1A 4C0SA 5EIBD 4YCNA 3DQQA 5TPWA 2VYCA 5LLTA 3D0OA 3L2AA 1QDUA 3BREA 2FB9A 2CDCA 2M1ZA 1A2KC 3M70A 3HLYA 4DT1A 1NVKA 4BQIA 4OU7A 1JSLA 5HIJA 1V11B 1PL7A 4GNRA 3AB8A 1YK0A 2G0NA 2HMVA 3H75A 3KUUA 3GD5A 3BWCA 4YDSA 3C9PA 2EWMA 2VQFB 3R3YA 2Q5FA 2W70A 1OBFO 4FFRA 3LT0A 5T41A 1ND6A 4YO7A 1J39A 3N0XA 5EXTA 1NSTA 2B0CA 1GNVA 4QAJA 3SEFA 5C3UA 4QDJA 3UTDA 1OB2A 1CUWA 1MD9A 4GQIA 7YASA 3M49A 3MTBA 1P8JA 4NZPA 3AUJB 2O0JA 4Q93A 2FNAA 2A9VA 1T2FA 5CNMA 4G01B 3RT1A 2Y1DA 5EUBA 1Z13A 5L3SA 2WHPA 3G2LA 4TZKA 4IJ5A 4L8RC 4IQ4A 1GNLA 1XOIA 1K9VF 3HB9A 2YYYA 5HRAA 1HLDA 5AHOA 1F6WA 2Y0PA 1SGWA 4MPJA 3IKLA 2V98A 2B7BA 1E18A 3F5SA 5JV5A 1O0CA 2W6IA 2R6DA 3FAKA 3BH7A 3VNRA 2FPRA 1OFVA 3LYLA 1Z5BA 1Y4SA 4U7PB 1OXBB 3KZ1E 2VHJA 1G5PA 3H9UA 3O3CA 3B7NA 3O8NA 3K8YA 1OH5A 2H08A 1G7CA 1X80B 5IZCA 3PKZA 3RVPA 1TH3A 3WYNA 4IMJB 1SQFA 3DBLA 3AUUA 1XRQA 1NVWQ 4L8WB 1BX3A 5B2FA 1TW2A 2Y0DA 3MD0A 1SU6A 1KY3A 1JHZA 2X49A 5JO9A 4IJWA 4YC7A 1PX0A 1PWZA 1DTWA 2R3SA 1G8JA 3GT3A 3KJZA 4KW7A 5AKZA 2ZRQA 4DZTA 5TF4A 4LYAA 1S96A 2AXEA 4S24A 2GJ4A 1F7VA 4DV6M 1WTAA 4DC9A 1RRFA 4DQ0A 3CQ9A 4JD5A 4BLUA 4HR7A 2J3JA 5KWSA 2OO7A 5FH9A 4CR6A 3V1UA 4EENA 1T5SA 3IQWA 4F9FA 1ULTA 4ZQFA 3ML1A 3EVFA 3CLKA 1EIJA 2E4YA 4UBOA 1EBBA 3H5OA 4NV1A 4XUCA 3MELA 1RU3A 3EXG2 3QAUA 4GI5A 4DMMA 4OB6A 2AXQA 1XYVA 4LXUA 4KR7A 2Q07A 3AB3A 1XZLA 5FHRA 5MFPA 1Z8FA 3H65A 3DQZA 4KTVE 2G88A 3K1TA 1G5IA 2PZFA 1CR6A 5KCZA 3W4JA 1AN0A 1L1ZA 4U8HA 3KVRA 2Z6AA 2IHVA 3B6JA 2VL7A 1ZWKA 4UE3S 1UDAA 3SPXA 2C4MA 3D4BA 2BM9A 5TT1A 1MTZA 1H6UA 4DA7A 4IY1A 3T5BA 3MMNA 1F4IA 1Y3CE 3LCUA 2CLDX 4I4LA 3FCEA 2WSSA 5ILOA 4PF1A 3WGIA 2JHPA 1Q1AA 5JFOA 3LM8A 1GPBA 4OLHA 1UXOA 2RGCA 3LVVA 3OZUA 4W1RA 3SXUB 5DE3A 5KO2A 3ZX5A 1DGQA 4BNFA 2BSQA 5HW0A 4S1WA 3CO5A 1P9RA 1ZD2P 4BQFA 2GYUA 4MP6A 3ZWNA 3PWTA 4DY6A 4LWOA 4L4ZA 1PK7A 4MR9B 4WAUA 2H57A 3T7TA 2RHWA 2VDJA 5FTNA 4TTPA 5FT9A 1NUTA 2Q2QA 3EJWA 4C0LA 1SOVA 4H7FA 1N5LA 3UK1A 3CCCA 4TGLA 1XJ0A 4GI3A 1J8QA 2XSZA 4K6FA 4E7OA 4KZPA 4EF4A 1E9BA 2KX7A 1TTPB 4C0KA 1Y8AA 3A04A 4C4TA 2VJLA 3MTJA 2LTAA 5L3VA 4LBVA 4NG5A 5EJ5A 2DMRA 4DCPA 3HRHA 2PX0A 5CTJA 3HY6A 4IDHA 3T7JA 5K8CA 4P4SA 4KXXA 3ZDZB 3JD3A 1SURA 4IBEA 1PEDA 4O8CA 5HM6A 4AW9A 4JLVA 3PFIA 4OMUA 4CQMA 4G86A 5ILQA 2NUAB 2WIKA 5LWQA 4IJQA 4IIXA 4MQFB 1VL1A 3MWFA 4KOAA 5E3HA 3W8RA 3ICWA 4R1UA 5AWFC 1ZY2A 3PPIA 5EI5A 3TQSA 1R5LA 2ZUFA 3PXEA 5DTRA 4XJSA 2AG0A 4MOWA 1JEQB 1YBHA 4IYJA 2B3TA 3AZQA 3OOYA 3N2GA 2O8BA 3VC3A 3D2CA 4D74A 2QN3A 3LWNA 3B12A 3QUSA 2E4ZA 1NXXA 2ZCUA 3IIKA 2M6KA 5DT2A 2WFLB 1D0VA 4D9HA 2EBHX 3WWEA 3BULA 5IN4A 5HUQA 1QKJA 4GX2A 2Z0MA 3KS4A 5HJ5A 3PYLA 2P4QA 4NULA 2X77A 4XVCA 2H4XA 2PXCA 4C7JA 1QZTA 3EBLA 2P2DA 2WICA 2Y1OA 3SOZA 5BV8A 2AX3A 5BQ5A 2VAXA 1PJSA 2R5FA 1RI1A 2YC2C 3M6MD 3TF5A 2I65A 3C41J 5F9MA 4CKBB 1FU7A 4B74A 5D6OA 2GCOA 4J3JA 3DLBA 2Q1TA 2JZ0A 1SCDA 3FTDA 2A35A 1TK2A 1UIRA 4XCVA 1P44A 3KZKA 5D3MB 3WLPA 1HNXB 3K5WA 4C0XA 5C8YB 2VNIA 5C7OO 2HK6A 3EUAA 2BMWA 3AERA 4P3KA 1N2GA 4LDJA 3I4CA 3CWZA 4PYNA 3QVGA 2HSWA 3IIIA 4UMEA 2MMCA 2I2WA 4WX2B 4IFIA 2NOAA 1M72A 2G4LA 2QXYA 3L92A 5C1IA 4NONA 2XYVA 2ZS7A 2XZTA 1FP2A 3JWHA 4K40A 4HPXB 1JHAA 1E5DA 3ZY2A 4EB0A 4UBMA 1CNFA 1W88A 2C8LA 3L3BA 3VDPA 3F3YA 3C3MA 3JYPA 1P7PA 3FBWA 1YVUA 4D8VA 4JKOA 1AKEA 3HB7A 5FTLA 2PZBA 4LTMA 2HX1A 3PTLA 1ICEA 1EZZA 4QATA 3TZEA 3R5JA 4WNAB 1FU4A 2Z3WA 1LJ8A 3PQ4A 2NVUB 3Q15C 1KJ8A 1VIAA 2ZRNA 2Z58A 2E87A 1F5NA 4KQMA 2A9FA 3ZN2A 4KMMA 3ZHCA 3GFRA 1J20A 4IQ0A 4CETA 2OMKA 4N0QA 2RDMA 4FFDA 3F47A 4N03A 3V4SA 2FYTA 3NYIA 4S2UA 1EFAA 1GKIA 1XZJA 1RWOA 2F8SA 4BPBA 1T29A 3F7TA 4N18A 4RJ2A 2UUBB 3CH4B 3F4KA 4KFUA 3OZBA 2NSDA 4KPYA 4HLNA 3FSGA 1XT6A 2PZGA 4E2ZA 2UKDA 3HVKA 3N0TA 3MOIA 3E8MA 2JANA 4EB8A 3RF6A 1AA6A 2QVGA 3PF9A 3IBFA 2HWXA 4URYR 1ZOPA 2O3UA 4DR5M 1P7YA 4YHBA 2C3UA 5IFLA 4WNCA 5I7AA 3AF6A 1E2UA 1DKLA 5DSXA 1ZA1A 4XE5A 1I10A 1KU0A 2R5WA 4MS4A 3MJ5A 5ALRA 5LUBA 1R6DA 2NSJA 2PWZA 2N42A 1OI7A 4JXXA 3UC5A 1Y7PA 2PPLA 1M0SA 4CM8B 4KKVA 3P71T 3RDPA 1LV8A 2WTAA 4DUYM 3OPMA 2X7XA 3TXAA 3CNQS 3FGZA 4HI0E 3H1GA 2G6BA 3MBKA 1FFXB 3WNBA 3JW8A 4YRIA 3QX7A 3HU2A 4QXAA 1T34A 3GQVA 3V4FA 4GXNA 4EKGA 1EWYA 3LH5A 2JEZA 1SG0A 4HQLA 1RQPA 3QFSA 4XPIA 2L19A