1KYOD

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 66
structure length 245
sequence length 245
chains with identical sequence O
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kyoD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kyoD01
4MU8A 1MG2D 5CIHB 3PLNA 155CA 4N0KA 2CE0A 3C2CA 1CRGA 2V08A 2MHMA 5KAIV 4PWAA 1L9BC 1CSVA 3PXWA 2VHDA 2N9IA 1SQQD 2DVHA 1YCCA 2C8SA 1NNOA 4AANA 2L4DA 1FI9A 4WQAA 4K3IA 1F1CA 1CRJA 1ETPA 4RJTA 4FA4A 1ZZHA 451CA 2RMZA 1QL3A 3SJLA 4DY9A 2CXBA 2ZBOA 1NTZD 1K3GA 2N3BA 1C2NA 1GIWA 1RAQA 2C2CA 3TGUD 1PP9D 1SQXD 2OZ1A 3OCDB 1E2RA 1CO6A 1HH7A 1DW2A 1WVEC 1L0ND 1QL4A 3CXHD 1A2SA 3CWBD 5TJHA 1GKSA 1RZ5A 1GJQA 4WQEA 1P84D 1H32B 1KYOD 5CYTR 3A0BV 1A56A 2ZOOA 4Q5PA 1CC5A 2A06D 3L73D 4FA1A 4EIDA 1H9YA 1CHJA 1I8OA 1MG3D 1KX2A 1CHHA 3SXTA 1H31A 5GTHV 2GC7D 1LC1A 3H1ID 5CIGB 1CXCA 3BCCD 1CRYA 3ITKA 1NMLA 2YIUB 3ORVA 1QN2A 5KKZB 4EDFA 4AAOA 1CXAA 1HJ4A 2B10B 2N3YA 2FWLA 1FI3A 3O5CA 5DJQC 3NWVA 2AXTV 2YK3A 1DW0A 1AOFA 1BE3D 351CA 5KAFV 2Y0EA 1KX7A 3HQ6A 1L9JC 1YFCA 1BGYD 1CCRA 4PD4D 1BCCD 2B12B 4AAMA 4LJIA 2B0ZB 3WFEC 3L74D 4Y5RA 1S5LV 1CIEA 1CRIA 3DR0A 1KYOW 2N9JA 3DMIA 1QKSA 4EIEA 2FRCA 3WUIA 2I8FA 1J3SA 3NBTA 1CTYA 1FJ0A 2AI5A 4P4QB 3PXSA 4UB6V 3CU4A 4EIFA 1HCMA 2QG4A 1MZ4A 3VRDA 1M60A 2KNCB 4RSZA 2B11B 1SQPD 1NTMD 5IY51 2BCNB 4NFGB 2N9YB 2RN0A 1W2LA 1N90A 4J20A 3RN1A 2BLFB 3GG2A 3SWSA 4H0JA 3RMZA 2LIRA 1GDVA 1CNOA 3OA8A 2BH4X 4PW9B 1I8PA 2DGEA 1H33B 5CIEB 1IRVA 2CA3B 1YNRA 1NTKD 1YICA 1FOCA 2JWAA 5KLVD 3CX5D 1BL9A 1R0QA 1W5CT 5GTIV 2K9JB 1QYZA 1OAEA 1U74B 2D0SA 3CP5A 4V2KA 3ZBMA 1M6ZA 3NBSA 1CHIA 1CSWA 2C1DA 2JQRA 5E79V 3O1YA 2EXVA 1IZL0 4QAOA 2BH5X 2BCCD 4AX3A 5KLIB 1GU2A 1S6VB 3L70D 2PCCB 2AIUA 1HZUA 1HRCA 3RLMA 1C6SA 3ZOWA 2XTSB 1JDLA 4IL6V 4JCGA 5AURA 2GIWA 4FA9A 1CTZA 3ZOXA 1I5TA 1RAPA 1KB9D 3FWLA 2N18C 1DIIC 1C52A 3PXTA 2C9XB 1HJ5A 1NU1D 5H2FV 1KB0A 2V07A 1DW1A 3A0HV 1CEDA 1H1OA 3SVWA 1DVHA 2QJYB 1ZRTD 2CA4B 4L3HA 3L4MA 3WFCC 1CTJA 2CE1A 1I6DA 3VMAA 4FB1A 1COTA 1LFMA 1B7VA 1FCDC 1HROA 3ZIYA 1FI7A 4WQCA 4WQ7A 2Y0CA 5B66V 3O0RC 4GYDA 1C75A 3CXHW 1IQCA 2KS1A 3GW6A 2PCBB 3OA8B 1H32A 3PH2B 5DF5A 5TISV 1SQVD 3H1JD 5CICB 3HQ8A 2BPBB 3ZOOA 1E29A 3JBTB 2FYUD 4XXLA 1FHBA 1GQ1A 4L3GA 2BGVX 4UB8V 5DFSA 1I6EA 1IRWA 2OZ1B 1AYGA 1C6RA 2LITA 5B5EV 4FA5A 1WEJF 4AALA 2GC4D 3MK7C 2GB8B 1CRCA 4WQDA 1KV9A 4WQ8A 1IO3A 3VYMA 1YEAA 1CIFA 2ORLA 3ZOYA 5CIFB 3VNWA 2YCCA 4A7PA 1H31B 3M97X 2IBZD 2QJKB 5EXQA 1CORA 2FYNB 4GEDB 1H9XA 3TDKA 2N18B 3WFBC 3L71D 3RN0A 3A9FA 3L75D 5DJQB 1CIHA 2MTAC 4U3FD 5B6QA 4YE1A 5C0ZA 1YTCA 2B4ZA 1VYDA 3L4OA 1F1FA 1C6OA 1CSUA 1YIQA 3WFDC 1LC2A 4FAVA 1YEBA 1C2RA 1CYCA 1EB7A 1CCHA 3X39A 3O20A 1I55A 1U75B 3WC8A 1CIGA 2ZZS1 2YQBA 3CYTI 3HQ7A 1A8CA 4O1QA 3SLEA 4PJ0V 5C9MA 3H1HD 1CRHA 1AOQA 1RZ6A 2HV4A 3KHUA 3WU2V 3MK7B 1EZVD 4D6TD 1HJ3A 4L1QA 2QJPB 1DIQC 3TYIA 1H33A 2Y0DA 1CSXA 3PTZA 1K3HA 2C1VA 5CIBB 3H1LD 1LMSA 3OCDA 1M70A 2D0WA 1PPJD 2ZXYA 1SQBD 1C7MA 1HZVA 1NMIA 4WQ9A 3CX5W 1N15A 1DW3A 3H1KD 4XYDB 1N50A 4WQBA 3HQ9A 3PRJA 1E8EA 1OCDA 4FANA 1CYJA 2JTIB 2Q3EA 4H0KA 1DVVA 2O3JA 4O1WA 1CYIA 4EICA 1LS9A 2L91A 2C1UA 3DP5A 4KMGA 3L72D 1L0LD 5CIDB 3PHLA 1NIRA 3ZCFA 1DT1A 2ZONG 1AKKA 2C1DB 2PACA 1KIBA 1N9CA 3KZIV 3TF5A 1I54A
chains in the Genus database with same CATH superfamily
1RY3A 2Y9ZA 3H1KE 5CIHB 3RBXA 3PLNA 155CA 1NAYA 3P8CE 3C2CA 1CRGA 3CCQP 5KJ7A 3VMYA 3MGNA 1SQPJ 1L9BC 2KB7P 3PXWA 3H25A 1TU3F 2VHDA 1NTKK 1NNOA 4AANA 1FI9A 1WMKA 4ZMDA 2C0WA 2FFDC 2P2UA 2WITA 4FA4A 1ZZHA 4W7ZA 2V4HA 2H89C 2JKVA 5AW6B 3L72E 4GKGA 1K3GA 3VOPA 2ZBOA 3M0AA 2N3BA 1C2NA 3VTPC 2OYIC 1CSBA 1VQLP 3WUUA 3L71J 1E2RA 3V2QA 1WVEC 1L4AB 1A2SA 3CWBD 3CWBG 3WU2E 1RZ5A 3MHVA 2G8YA 4H44B 2XNDH 1H32B 2R5BA 4NPDA 4K3AA 5APVA 5AW4B 2ZOOA 4H0LB 1HGZA 1WRGA 2B88A 2KYVA 1I8OA 1NU1K 2E75C 4BRYB 3AE9C 3HE4A 3AEFC 1CHHA 3SXTA 4N6JA 5GTHV 2WSCJ 1EZVG 4D6TG 2GC7D 2P58A 4IL6X 2M5AA 2HR3A 3RK2D 2YIUB 2I1JA 5KKZB 3H1LG 4AAOA 1YBKA 1JEKA 3HUSC 2FWLA 5AVSB 3O5CA 5CMZA 1KILA 2Z4EA 1SQVK 3PH0A 2E5YA 5BU5A 2FYUK 3KDPB 1BGYD 4PD4D 1HGVA 1BCCD 3L73E 2XZRA 3RL0g 4HJGH 2R3SA 1SQBJ 3V2PA 1GW3A 1NO4A 1FZCA 2RH0A 1CIEA 1A02J 5CJ4A 1MKMA 4Y99C 3C1LA 3DMIA 3WUIA 1JY2N 2XDJA 3M91A 1CTYA 1FJ0A 3JSVC 2AI5A 1FZGA 1FAVA 2QG4A 1SQPD 1W2LA 2NPSA 1N90A 2YO3A 2BLFB 1GW4A 1GL2C 3SWSA 3CXHH 4H0JA 3RMZA 1GDVA 2O01J 1M57D 1XTGB 3WMM0 1P84H 3OA8A 2BH4X 2P10A 1I8PA 1KYOH 3L74E 1JTHB 1H33B 3V2NA 1T3UA 3TNUB 1K73Q 3AE3C 2D2CB 2IPPA 2CA3B 2IYPA 2HFED 1HUCA 1W2EA 1CI6B 1BL9A 2FXPA 4W80A 2C0XA 5GTIV 2FBWC 1PFIA 1OAEA 2OTJP 1U74B 3P7KA 1K9MQ 1NTME 3CP5A 1HTLC 1LP1B 2JWDA 1M6ZA 3Q5SA 2JQRA 1KORA 2E75D 2K88A 5KLIB 2M3BA 2QA4P 1DH3A 5AVZB 1GK4A 2AXTE 1L0NJ 2CK3H 3H1IG 1HRCA 4JCGA 1IK7A 2E74B 2GIWA 2AEMA 1E5WA 1KB9D 1C52A 1FJKA 1LNQA 5APXA 3B4SA 2OYHB 1NTKE 4JPZB 5H2FV 1KB0A 1RH5B 1DW1A 3L73J 3CX5E 3SVWA 1DVHA 1ZRTD 1LWUA 3L4MA 3M9QA 1I6DA 5TISE 4FB1A 1VQ6P 3USSA 1FCDC 1HROA 3ZIYA 5B66V 3O0RC 2J58A 2N1TB 4UB8E 2BCCE 1GK6A 4UB6E 3GW6A 2IYOA 5CCGA 3OA8B 3PH2B 1LJ2A 2XU6A 2IX7C 3E7KA 4IFFA 4R4LA 2JO1A 4O9BA 1E29A 1VQ7P 1GQ1A 4L3GA 5DFSA 1IRWA 2KIKA 1AYGA 1H88A 4JF7A 1NU1E 1C6RA 2Q5UA 5B5EV 1WEJF 1S5LX 3Q2YA 2GC4D 1WT6A 3MK7C 4EIJA 2ZXXA 1KILE 2QJPC 3NMDA 3IR9A 4PD4I 2UWJE 3L74J 2ZVNB 3AE8C 4WQ8A 1N73B 2K1AA 1GL2D 2KSEA 1W2BO 3G9RA 2R3CA 1K04A 3B5ND 3ZOYA 5CIFB 1VF5B 1LTJC 4WY4C 2FKWB 3IN6A 2OYOA 1GDTA 4IOIH 1KMIZ 2FYNB 5AW1B 4GEDB 1NTMJ 1SQVE 2IFNA 4L75A 3RGUA 3M06A 1N7SA 3A9FA 2FYUE 5DJQB 1CIHA 1SQQJ 5APSA 3BRVB 2V7QH 2OYIA 1IO4A 2E42A 1C6OA 2RKLA 4FAVA 2QEXP 1YEBA 1CCHA 4OWFA 3OW2O 3O20A 1I55A 2K37A 3VMZA 2Q7CA 1NTKJ 1EQ7A 4C7NA 1LGHB 1CIGA 1OZHA 3VP8A 3CYTI 4RO0A 2P7JA 5AVYB 1MZ9A 4WWIA 2JP3A 2P67A 2ZYDA 1HH0A 2C9LY 1S2EA 3AECC 4L1QA 5E79H 1NGMB 1OVVA 3HUSA 1X9VA 4XE5B 1RE3C 1M70A 4DZOA 1PPJD 1PPJG 3RK3C 1N15A 2K9JA 1JOCA 2WSSH 1NU1J 3NXSA 4IL6H 3HQ9A 1NAFA 3PRJA 3CCJP 3A5TA 1X8YA 5L8RJ 2HPCA 1KB9I 2JTIB 2QM8A 4JYCA 3PJSK 4L74A 2HYNA 1QVFO 2O3JA 4O1WA 1LS9A 3QH9A 1AVYA 3AEDC 3DP5A 1SFCD 1EZVE 1SVFA 4D6TE 2AEJA 1UIIA 3PHLA 1DT1A 4R4MA 2C1DB 1SQVJ 1U7MA 3H1LE 1RE4C 2HODB 3H6PA 3UIAA 1KIBA 3S9OA 2FYUJ 2QSIA 1Q7YQ 3AE2C 4WY4D 2CE0A 2DW3A 1KQFB 1QX8A 3LW5H 1GL2A 3ZDMA 3S4RA 2N9IA 1SQQD 3B5NA 4NPFX 1YCCA 3CMEP 3L75G 1AFOA 1F1CA 2IFMA 2N1TC 4L76A 1LTIC 1ZLLA 2BEZF 2KLVA 4GOFA 3FGAD 4NPEA 2CPSA 1NTZD 2B87A 1PGPA 3FXEA 3M9HA 3AEAC 1PP9D 1PP9G 1SQXD 1H89A 2KNCA 2KS1B 1GJQA 1URQB 1M1JB 2PP6A 3M9BA 5CYTR 3A0BV 1R5LA 1XTCC 3M0DC 1S4XA 2YNYA 3H1HG 5EFWB 2A06D 1YJWP 4EIDA 1RF0C 2LR2A 1DEBA 1Q82Q 1IFDA 1CXCA 1IFIA 3ITKA 2PRRA 4OVNF 4EDFA 1CXAA 1HJ4A 3TGUE 2N3YA 3RK3D 1FI3A 3B8EB 3Q1MA 5DJQC 3NWVA 3CXHE 1KQLA 1KD1Q 3A0BH 4ASWA 1AOFA 1J1EB 1MFTA 1P84E 4N78E 4ZNCA 1KYOE 5KAFV 4PV1B 1L9JC 1VQPP 1YFCA 3H1LJ 2L5GB 4LJIA 2B0ZB 1BDCA 1HBWA 3WFEC 1JCDA 1S5LV 3H1IE 1CRIA 1JMMA 1N8RQ 3IAOA 3HD7B 4EIEA 1DD3A 2FRCA 3JCUH 1J3SA 1R5SA 1SFCA 4I1LA 3PXSA 4DJGA 2POHA 4EIFA 1HCMA 1MZ4A 2KNCB 5AW2B 2BCNB 4NFGB 1BE3E 1M7LA 3V2RA 2KLUA 2YMKA 1YTZT 3AEBC 1Q90D 4WY4A 1S5LH 3NTNA 4TT3H 1G1IA 2Q9IA 4U7JA 3VMXA 1DIPA 1MUUA 3KYQA 1YQ3C 3A2AA 4I6MC 3EFFK 5KLVD 1T2KC 4U3FJ 1S1CX 2D0SA 2B9BA 2M3EA 1CHIA 3O1YA 1RF1A 2MKVA 2EXVA 4XA4A 1JY2P 3TGUJ 2YMYA 3V4WA 4JYBA 3L70D 3L70G 2AIUA 1HZUA 3PP5A 2XTSB 3L4FA 4IFMA 3W67A 1S9KE 3VP9A 5AW5B 5AURA 3GHGC 4PD4H 1I5TA 2N18C 1DIIC 4GT1A 2YKPA 3A0HV 4JBZA 1CEDA 2QJYB 1FC2C 2CA4B 2M8RA 1FDIA 1CTJA 1FS0E 1N86A 3H1IJ 3VMAA 3BCCJ 1J1DB 2FY8A 1FI7A 4WQCA 3AE4C 1BGYG 5GTHH 1BCCG 4GYDA 1NH4A 4ZKPA 1IQCA 4YPCA 3U1CA 3H1KJ 1GMJA 1L0LK 5APYA 5CICB 2BEQD 3HQ8A 2BPBB 1FBMA 1URQC 5APWA 1M1JC 5AW8B 1BE3J 1MV8A 4XXLA 1I6EA 4WVZA 4FA5A 3D0WA 1SQPG 1PZQA 2R44A 4MN4C 1HJBA 4WQDA 3L72J 3D70A 1OX3A 5AW0B 1AVOA 4HH2A 3Q3DA 3P8MC 2ORLA 1OW8A 3N4XA 3HE4B 1H8AA 4RKUJ 2IBZD 2IBZG 2IDBA 2QJKB 5EXQA 2I1KA 2M5AB 2ZFCA 4WBAA 1CORA 5APTA 4BXLA 3CPWO 1T8ZA 1H9XA 3TDKA 3H1JE 1J1EC 2HLOA 3L71D 2WVRA 5E79E 4OGQB 2E76B 1LT9C 1AQTA 4U3FD 1Y47A 5CBNA 1T2KD 2ZVOB 4HB1A 1KILB 3BASA 2B4ZA 2ZT9B 1VYDA 4IL6E 1YIQA 4LLHA 3WFDC 1KB9H 5AVRB 3X39A 2WPVB 1EC5A 1LTAC 4DCKA 1M90Q 3CC4P 3WC8A 1KFMA 4I2LC 3CD6P 1FZCB 1KN7A 3IF4A 2I8DA 3E1RA 1A8CA 3R4YA 2WSEH 1ZR4A 1GD2E 4PJ0V 5C9MA 1AOQA 1OW6A 3AEEC 3L75E 5GTIH 3WU2V 1OVRA 1HJ3A 1RHZB 1FZFA 2NPSB 3AE5C 1G2CA 1CSXA 1YITP 1K3HA 2WPQA 1LMSA 3U59A 2ZXYA 4H13B 2YXQB 1SQBD 1SQBG 1NMIA 3H1KD 1NKZB 2Q1KA 3FWNA 1L4AC 3P8CD 2XV5A 2JJLA 1CYJA 4PJ0H 4H44C 4HYTB 2O01H 1DVVA 1M56D 1ZOYC 5H2FH 3H1HE 1CYIA 4EICA 4H0LC 5APQA 3CLQA 3L72D 1FZEA 2GUVA 3R2PA 1H0TA 1NIRA 3ZCFA 1LTSC 2ZONG 5B66H 3CCMP 2PACA 2WZ7A 3H1JJ 2YIUC 5KKZC 3TF5A 3O6QA 2Q3EA 1BSHA 2XKMA 2MHMA 2O1KA 3II6A 1DEEG 1OMIA 5KJ7C 5APUA 2FFDA 5B5EH 4WQAA 1NJIQ 4K3IA 1PL5A 1CRJA 1MFZA 1S3JA 2NRGA 2RMZA 1QL3A 3CCVP 1LWUB 1OFCX 1L0LE 3A0BE 3MD0A 1G2CB 3SJLA 1RAQA 2C2CA 1FZAA 1ZR2A 2OZ1A 2KSJA 5AW9B 1DW2A 2IBZI 1L0ND 1L0NG 3LIEA 2Q6QA 2OGUA 3I55P 5TJHA 3L75J 4DOJA 3TSIA 1UIXA 3NFQA 3CCRP 2AEFA 4BWNA 1A56A 3HTKA 1NKNA 4HKZH 2FYZA 1CC5A 3L73D 3L73G 1CHJA 2W90A 3JCUE 1MG3D 4YXWH 2C9NY 1H31A 2BCCJ 5CIGB 3GHGA 1BSNA 1NMLA 3ORVA 4EI2A 4I7ZB 2D2CC 1VDFA 4OGQC 2B10B 1KZUB 2E76C 1AJYA 3H1HJ 3BVHA 3O6QB 3CWBE 3L37A 1L4AD 2AXTV 1D7MA 2YK3A 3MIWA 1KV4A 1S5LE 1KILC 4H44D 351CA 2ZT9C 1OW7A 1KX7A 3HQ6A 1N7SB 4H0LD 2B12B 4AAMA 2N9BA 1PV3A 5KLIC 1FOSF 3L74D 3L74G 4ASVA 3DR0A 3A7OA 1KYOW 1NYHA 1G1JA 3I5CA 2OYIB 1FZCC 1QKSA 2I8FA 2E74C 4P4QB 1JO5A 2OYHC 4UB6V 3CU4A 1JB0J 3VRDA 4C7NB 1HWTC 1T3JA 4RSZA 3CCEP 2B11B 1NTMD 5IY51 1NTMG 1QLED 4RESB 3EQ2A 2RN0A 4J20A 3F5HA 5CHXA 3RN1A 1GU5A 3GG2A 2NZ2A 1L0LJ 3HTKB 1SQQG 2E75B 2WTYA 1BGYE 4PD4E 1FOSE 3RBZA 1BCCE 2ZJSE 1JUNA 1Y9BA 3A3YB 2DGEA 4AUWA 5CIEB 1LT9A 1K8AQ 1IRVA 1NTZG 3HUSB 1YNRA 2HG5D 1NTKD 1NTKG 1SQXG 1FOCA 2JWAA 3SFEC 3CX5D 1R0QA 5GTHE 1W5CT 2BASA 2K9JB 3CMAP 1QYZA 1SQPE 2Z5HA 4N3YB 2HPCB 1IFPA 3NBSA 1SLQA 3K5BA 3AE6C 3GF3A 2A06G 1N73C 2BCCD 3AE1C 1GU2A 3EWKA 2W8ZA 3RLMA 1C6SA 1VF5C 2Z5IA 4Y99B 3CWBJ 2QIWA 2QRXA 4FA9A 2K3RA 2FYNC 1RAPA 2D2CD 3FWLA 3PXTA 4OGQD 4TLFA 1NU1D 1NU1G 2WSFH 1H1OA 1QGKB 1Q2NA 2W6JH 5BU8B 1QL1A 3V6IA 4B86A 1KILD 3WFCC 1GU4A 1FE6A 1KQSO 4D6TJ 3TK1A 3RL0B 1LWUC 1LFMA 1GL2B 1B7VA 3SWYA 1IFJA 3L35A 2LXCB 4WQ7A 4YTPC 3B5NB 2Y0CA 1U57A 3GLMA 1L4AA 1C75A 3W68A 3VN0A 2G3AA 5DJTB 2A45G 1H32A 1PGQA 1CW5A 3H32A 5DF5A 1SQVD 5CCGC 1LT1A 3FXDA 1A02F 3AE7C 5CBOA 1U7JA 3JBTB 2E74D 2B87B 2FYUD 1FHBA 1KB9E 4BRYA 1LTGC 3CCLP 3S1KA 1PIXA 2P1JA 1ZRTE 5KAFH 1IJDB 3SWKA 3LIDA 3JC22 1CRCA 1N2DC 1ZMEC 1KV9A 3MZWB 1HVVA 1LTJA 2JDIH 2QM7A 4W7YA 2N1TD 3VNWA 1W5CE 4XFJA 4A7PA 5GTIE 2KP8A 2KK7A 1NTZK 3MP7B 3IFMA 4DT0A 2ITAA 3RN0A 1X79B 1SQXK 2Y9YA 5KLVG 1N7SC 3G4SP 2ZYAA 3F89A 2WQYC 3OA7A 2B89A 5C0ZA 3C9IA 1VQNP 1YTCA 3MUDC 1Z56A 2H8PD 3MTUE 3L4OA 1F1FA 1CSUA 4PJ0E 2IZ0A 1CYCA 5H2FE 3BATA 5AVUB 1VF5D 3ABVC 2YKOA 3KQGA 1EDIA 3H32B 4O1QA 1SS1A 3CX5I 1L2PA 5B66E 1IC2A 5C39A 1RZ6A 1Q81Q 2HV4A 2K9YA 1SFCB 2Q3IA 3MK7B 1EZVD 4D6TD 4M3LA 2QJPB 3TYIA 1JTHA 1H33A 3TNUA 3PTZA 3Q5PA 1RE3A 5CIBB 2ZXEB 4C7RA 4K35A 3H1LD 1EDJA 1YHQP 3OCDA 3V5BA 2D0WA 1LTJB 1CI6A 1HZVA 4WY4B 4WQ9A 3CX5W 1L0NE 2FXOA 5B5EE 4XYDB 2H88C 4WQBA 4FANA 1LP1A 5CCGD 1VQ5P 4H0KA 3A0HH 3SSUA 5AW3B 2WSEJ 2L91A 4EOTA 2IZ1A 1SP4A 4Z1MH 1JM0A 5CIDB 1RE4A 1AQ5A 2OYHA 3WUTA 1USEA 1RF1B 1OVUA 1LTTC 1N9CA 3KZIV 1PPJE 2A45I 1RQVA 2O1JA 2H7HA 1I54A 1EDKA 4MU8A 3TYYA 1MG2D 2WPSA 2MJZA 1IFMA 3G3ZA 4N0KA 4L73A 2V08A 3WUVA 2OTLP 5KAIV 4PWAA 1CSVA 3L71G 2LKMA 2DVHA 4PV1C 3RL0C 2WSCH 2N1TA 2C8SA 2L4DA 4WB4A 5KLVK 1N7SD 4U3FG 3B5NC 1ETPA 4RJTA 2OARA 451CA 1KQGB 1JY3O 4DY9A 2CXBA 1JCCA 2OTKE 1AV1A 3KZIH 1GIWA 3RK3B 4AQRD 2JR8A 3TGUD 3T97A 5AVWB 3TGUG 3HD7C 3OCDB 1CO6A 1HH7A 1QL4A 3CXHD 2GUSA 3QWOC 1GKSA 3VYIA 3I56P 5KAIH 4WQEA 1M8OB 1VQKP 1P84D 4N78D 3M0DA 1KYOD 1JNMA 1N73A 1RF0A 2GM4A 4Q5PA 1SQQE 4FA1A 1NVOA 1VL2A 1H9YA 1KX2A 3C8VA 1LC1A 3H1ID 1EXIA 3BCCD 3BCCG 4AYCA 2QVAA 1CRYA 2V7QJ 1NTZE 1QN2A 1PP9E 1SQXE 2GA1A 2PGDA 2KUBA 4KJMA 3H1KG 3D6ZA 2QE7H 2KI7B 2W6AA 1DW0A 1BE3D 1BE3G 1URQD 2Y0EA 4GDOA 1YJ9P 2W83C 1J2JB 5BVZA 1DX7A 3V4QA 1FZBA 2CPBA 2O01N 3AEGC 1CCRA 4QMAA 1EZVI 3WU2H 2A06E 2OQQA 1R8EA 4LGDE 1ZV8A 1SQPK 4Y5RA 3L72G 3BRTB 2YO2A 1DD4A 2N9JA 4GOEA 1KTMA 2LXBA 3NBTA 1YI2P 5CCHC 3T97B 3RK3E 4LC1A 1M60A 3SWFA 1SFCC 2E5TA 2N9YB 2QJYC 3CCSP 1EDLA 2VRSA 1ZN5A 4PV1D 3RL0D 1VPCA 1J1DC 3KXDA 2LIRA 2E43A 1HF9A 1VQ8P 1E79H 1CNOA 2W6BA 4PW9B 5AVVB 1S9KD 3RK2B 3CC7P 2ZAEB 1HJ0A 1YIJP 3HD7D 3CCUP 1YICA 3MUDA 5K5GB 3P32A 2KOGA 4V2KA 1M1KQ 3ZBMA 1CSWA 2C1DA 5E79V 2HODA 1IZL0 1NTZJ 2YKQA 3LW5J 4QAOA 3D6YA 2BH5X 1RF1C 4AX3A 1ZXGA 4CPGA 3G71P 1PP9J 1S6VB 1SQXJ 1PGOA 2PCCB 3ZOWA 3Q5RA 2M0BA 1JDLA 3HRNA 3L36A 4IL6V 1S72P 2QJKC 5KAFE 1BDDA 1H0TB 1CTZA 3ZOXA 3CXHI 1X22A 2C9XB 1SQBK 1HJ5A 2V07A 5KLVE 1P84I 2H43A 1KYOI 1JY3P 3O8ZA 4YXDC 4L3HA 2CE1A 1YJNP 1IZNB 2SPZA 1COTA 1PGJA 1T6AA 1X0TA 2FFDB 5AVTB 1FDOA 2R5DA 1IK9A 3CXHW 4GIFA 2KS1A 2PCBB 3L70E 1URQA 1M1JA 1KC8Q 2WWWA 2WT7A 3N7NA 5TISV 3H1JD 3H1JG 3ZOOA 1ZW0A 2PAJA 4Y28J 5CCHD 2BGVX 4UB8V 2OZ1B 2AXTH 1FDMA 2LITA 3HE5A 4AALA 5CJ0A 1JMBA 3OAKA 4EYYQ 2GB8B 2WSFJ 1VQ9P 5AW7B 5KJ7D 1IO3A 2NPSC 1ZP0C 2J59M 4C46A 3VYMA 1YEAA 1NWQA 3D71A 3CX5H 1CIFA 1JY3N 1YYCA 4H13C 2YCCA 1H31B 5TISH 1JY2O 3M97X 1OWAA 4ZKUA 4JQ0D 1FJPA 2ZYGA 1OIPA 1IFNA 2PFXA 3GHGB 2N18B 3WFBC 4UB8H 4UB6H 3L75D 3CI9A 1L0NK 2MTAC 1VQMP 2R32A 5M1BA 5B6QA 1OXZA 4YE1A 3G6EP 4GODA 3FX0A 1GZLA 3CC2P 1K05A 3GF7A 2J5UA 3B71A 3HD7A 5KTBA 1LC2A 3GMAA 1C2RA 1EB7A 2BCCG 1KFNA 3SFDC 1VQOP 3A0HE 1YQ4C 1U75B 5KLVJ 2ZZS1 2YQBA 3HQ7A 2IBZE 4KT0J 2YXRB 2WT7B 3SLEA 2JEEA 1GTWA 3L71E 3H1HD 1CRHA 5DJUB 2XNXA 2E76D 2KZJA 4OH8B 4U3FE 3OJAB 2A45H 1VQ4P 3KHUA 1N7LA 3HE5B 1Y8AA 1DIQC 2Y0DA 3L70J 1FU1A 2ZT9D 2C1VA 3RK2C 1CZQA 5AVXB 2KXPB 1Q86Q 5AVQB 3U1AA 1C7MA 1LTBC 3E1IA 1DW3A 1N50A 1NHLA 1E8EA 1YTZI 1OCDA 1SQVG 3CL3D 1LT9B 1QEXA 2FYUG 3EFGA 2W27A 2FXMA 3KZIE 1BGYJ 1RQUA 2WPRA 3KPEA 1BCCJ 2C1UA 1EXJA 4IFDK 1QVGO 1QL2A 2WMMA 4KMGA 1NTMK 1NOHA 3BCCE 2KZIA 1L0LD 1L0LG 5KAIE 2AXCA 5CCHA 2NPSD 1AKKA 1SQQK 4KHXA 1USDA 4I7ZC 1SQBE 1AA0A 4H13D
chains in the Genus database with same CATH topology
4MU8A 1MG2D 5CIHB 3PLNA 155CA 4N0KA 2CE0A 3C2CA 1CRGA 2V08A 2MHMA 5KAIV 4PWAA 1L9BC 1CSVA 3PXWA 2VHDA 2N9IA 1SQQD 2DVHA 1YCCA 2C8SA 1NNOA 4AANA 2L4DA 1FI9A 4WQAA 4K3IA 1F1CA 1CRJA 1ETPA 4RJTA 4FA4A 1ZZHA 451CA 2RMZA 1QL3A 3SJLA 4DY9A 2CXBA 2ZBOA 1NTZD 1K3GA 2N3BA 1C2NA 1GIWA 1RAQA 2C2CA 3TGUD 1PP9D 1SQXD 2OZ1A 3OCDB 1E2RA 1CO6A 1HH7A 1DW2A 1WVEC 1L0ND 1QL4A 3CXHD 1A2SA 3CWBD 5TJHA 1GKSA 1RZ5A 1GJQA 4WQEA 1P84D 1H32B 1KYOD 5CYTR 3A0BV 1A56A 2ZOOA 4Q5PA 1CC5A 2A06D 3L73D 4FA1A 4EIDA 1H9YA 1CHJA 1I8OA 1MG3D 1KX2A 1CHHA 3SXTA 1H31A 5GTHV 2GC7D 1LC1A 3H1ID 5CIGB 1CXCA 3BCCD 1CRYA 3ITKA 1NMLA 2YIUB 3ORVA 1QN2A 5KKZB 4EDFA 4AAOA 1CXAA 1HJ4A 2B10B 2N3YA 2FWLA 1FI3A 3O5CA 5DJQC 3NWVA 2AXTV 2YK3A 1DW0A 1AOFA 1BE3D 351CA 5KAFV 2Y0EA 1KX7A 3HQ6A 1L9JC 1YFCA 1BGYD 1CCRA 4PD4D 1BCCD 2B12B 4AAMA 4LJIA 2B0ZB 3WFEC 3L74D 4Y5RA 1S5LV 1CIEA 1CRIA 3DR0A 1KYOW 2N9JA 3DMIA 1QKSA 4EIEA 2FRCA 3WUIA 2I8FA 1J3SA 3NBTA 1CTYA 1FJ0A 2AI5A 4P4QB 3PXSA 4UB6V 3CU4A 4EIFA 1HCMA 2QG4A 1MZ4A 3VRDA 1M60A 2KNCB 4RSZA 2B11B 1SQPD 1NTMD 5IY51 2BCNB 4NFGB 2N9YB 2RN0A 1W2LA 1N90A 4J20A 3RN1A 2BLFB 3GG2A 3SWSA 4H0JA 3RMZA 2LIRA 1GDVA 1CNOA 3OA8A 2BH4X 4PW9B 1I8PA 2DGEA 1H33B 5CIEB 1IRVA 2CA3B 1YNRA 1NTKD 1YICA 1FOCA 2JWAA 5KLVD 3CX5D 1BL9A 1R0QA 1W5CT 5GTIV 2K9JB 1QYZA 1OAEA 1U74B 2D0SA 3CP5A 4V2KA 3ZBMA 1M6ZA 3NBSA 1CHIA 1CSWA 2C1DA 2JQRA 5E79V 3O1YA 2EXVA 1IZL0 4QAOA 2BH5X 2BCCD 4AX3A 5KLIB 1GU2A 1S6VB 3L70D 2PCCB 2AIUA 1HZUA 1HRCA 3RLMA 1C6SA 3ZOWA 2XTSB 1JDLA 4IL6V 4JCGA 5AURA 2GIWA 4FA9A 1CTZA 3ZOXA 1I5TA 1RAPA 1KB9D 3FWLA 2N18C 1DIIC 1C52A 3PXTA 2C9XB 1HJ5A 1NU1D 5H2FV 1KB0A 2V07A 1DW1A 3A0HV 1CEDA 1H1OA 3SVWA 1DVHA 2QJYB 1ZRTD 2CA4B 4L3HA 3L4MA 3WFCC 1CTJA 2CE1A 1I6DA 3VMAA 4FB1A 1COTA 1LFMA 1B7VA 1FCDC 1HROA 3ZIYA 1FI7A 4WQCA 4WQ7A 2Y0CA 5B66V 3O0RC 4GYDA 1C75A 3CXHW 1IQCA 2KS1A 3GW6A 2PCBB 3OA8B 1H32A 3PH2B 5DF5A 5TISV 1SQVD 3H1JD 5CICB 3HQ8A 2BPBB 3ZOOA 1E29A 3JBTB 2FYUD 4XXLA 1FHBA 1GQ1A 4L3GA 2BGVX 4UB8V 5DFSA 1I6EA 1IRWA 2OZ1B 1AYGA 1C6RA 2LITA 5B5EV 4FA5A 1WEJF 4AALA 2GC4D 3MK7C 2GB8B 1CRCA 4WQDA 1KV9A 4WQ8A 1IO3A 3VYMA 1YEAA 1CIFA 2ORLA 3ZOYA 5CIFB 3VNWA 2YCCA 4A7PA 1H31B 3M97X 2IBZD 2QJKB 5EXQA 1CORA 2FYNB 4GEDB 1H9XA 3TDKA 2N18B 3WFBC 3L71D 3RN0A 3A9FA 3L75D 5DJQB 1CIHA 2MTAC 4U3FD 5B6QA 4YE1A 5C0ZA 1YTCA 2B4ZA 1VYDA 3L4OA 1F1FA 1C6OA 1CSUA 1YIQA 3WFDC 1LC2A 4FAVA 1YEBA 1C2RA 1CYCA 1EB7A 1CCHA 3X39A 3O20A 1I55A 1U75B 3WC8A 1CIGA 2ZZS1 2YQBA 3CYTI 3HQ7A 1A8CA 4O1QA 3SLEA 4PJ0V 5C9MA 3H1HD 1CRHA 1AOQA 1RZ6A 2HV4A 3KHUA 3WU2V 3MK7B 1EZVD 4D6TD 1HJ3A 4L1QA 2QJPB 1DIQC 3TYIA 1H33A 2Y0DA 1CSXA 3PTZA 1K3HA 2C1VA 5CIBB 3H1LD 1LMSA 3OCDA 1M70A 2D0WA 1PPJD 2ZXYA 1SQBD 1C7MA 1HZVA 1NMIA 4WQ9A 3CX5W 1N15A 1DW3A 3H1KD 4XYDB 1N50A 4WQBA 3HQ9A 3PRJA 1E8EA 1OCDA 4FANA 1CYJA 2JTIB 2Q3EA 4H0KA 1DVVA 2O3JA 4O1WA 1CYIA 4EICA 1LS9A 2L91A 2C1UA 3DP5A 4KMGA 3L72D 1L0LD 5CIDB 3PHLA 1NIRA 3ZCFA 1DT1A 2ZONG 1AKKA 2C1DB 2PACA 1KIBA 1N9CA 3KZIV 3TF5A 1I54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU8 A;  1MG2 D;  5CIH B;  3PLN A;  155C A;  4N0K A;  2CE0 A;  3C2C A;  1CRG A;  2V08 A;  2MHM A;  5KAI V;  4PWA A;  1L9B C;  1CSV A;  3PXW A;  2VHD A;  2N9I A;  1SQQ D;  2DVH A;  1YCC A;  2C8S A;  1NNO A;  4AAN A;  2L4D A;  1FI9 A;  4WQA A;  4K3I A;  1F1C A;  1CRJ A;  1ETP A;  4RJT A;  4FA4 A;  1ZZH A;  451C A;  2RMZ A;  1QL3 A;  3SJL A;  4DY9 A;  2CXB A;  2ZBO A;  1NTZ D;  1K3G A;  2N3B A;  1C2N A;  1GIW A;  1RAQ A;  2C2C A;  3TGU D;  1PP9 D;  1SQX D;  2OZ1 A;  3OCD B;  1E2R A;  1CO6 A;  1HH7 A;  1DW2 A;  1WVE C;  1L0N D;  1QL4 A;  3CXH D;  1A2S A;  3CWB D;  5TJH A;  1GKS A;  1RZ5 A;  1GJQ A;  4WQE A;  1P84 D;  1H32 B;  1KYO D;  5CYT R;  3A0B V;  1A56 A;  2ZOO A;  4Q5P A;  1CC5 A;  2A06 D;  3L73 D;  4FA1 A;  4EID A;  1H9Y A;  1CHJ A;  1I8O A;  1MG3 D;  1KX2 A;  1CHH A;  3SXT A;  1H31 A;  5GTH V;  2GC7 D;  1LC1 A;  3H1I D;  5CIG B;  1CXC A;  3BCC D;  1CRY A;  3ITK A;  1NML A;  2YIU B;  3ORV A;  1QN2 A;  5KKZ B;  4EDF A;  4AAO A;  1CXA A;  1HJ4 A;  2B10 B;  2N3Y A;  2FWL A;  1FI3 A;  3O5C A;  5DJQ C;  3NWV A;  2AXT V;  2YK3 A;  1DW0 A;  1AOF A;  1BE3 D;  351C A;  5KAF V;  2Y0E A;  1KX7 A;  3HQ6 A;  1L9J C;  1YFC A;  1BGY D;  1CCR A;  4PD4 D;  1BCC D;  2B12 B;  4AAM A;  4LJI A;  2B0Z B;  3WFE C;  3L74 D;  4Y5R A;  1S5L V;  1CIE A;  1CRI A;  3DR0 A;  1KYO W;  2N9J A;  3DMI A;  1QKS A;  4EIE A;  2FRC A;  3WUI A;  2I8F A;  1J3S A;  3NBT A;  1CTY A;  1FJ0 A;  2AI5 A;  4P4Q B;  3PXS A;  4UB6 V;  3CU4 A;  4EIF A;  1HCM A;  2QG4 A;  1MZ4 A;  3VRD A;  1M60 A;  2KNC B;  4RSZ A;  2B11 B;  1SQP D;  1NTM D;  5IY5 1;  2BCN B;  4NFG B;  2N9Y B;  2RN0 A;  1W2L A;  1N90 A;  4J20 A;  3RN1 A;  2BLF B;  3GG2 A;  3SWS A;  4H0J A;  3RMZ A;  2LIR A;  1GDV A;  1CNO A;  3OA8 A;  2BH4 X;  4PW9 B;  1I8P A;  2DGE A;  1H33 B;  5CIE B;  1IRV A;  2CA3 B;  1YNR A;  1NTK D;  1YIC A;  1FOC A;  2JWA A;  5KLV D;  3CX5 D;  1BL9 A;  1R0Q A;  1W5C T;  5GTI V;  2K9J B;  1QYZ A;  1OAE A;  1U74 B;  2D0S A;  3CP5 A;  4V2K A;  3ZBM A;  1M6Z A;  3NBS A;  1CHI A;  1CSW A;  2C1D A;  2JQR A;  5E79 V;  3O1Y A;  2EXV A;  1IZL 0;  4QAO A;  2BH5 X;  2BCC D;  4AX3 A;  5KLI B;  1GU2 A;  1S6V B;  3L70 D;  2PCC B;  2AIU A;  1HZU A;  1HRC A;  3RLM A;  1C6S A;  3ZOW A;  2XTS B;  1JDL A;  4IL6 V;  4JCG A;  5AUR A;  2GIW A;  4FA9 A;  1CTZ A;  3ZOX A;  1I5T A;  1RAP A;  1KB9 D;  3FWL A;  2N18 C;  1DII C;  1C52 A;  3PXT A;  2C9X B;  1HJ5 A;  1NU1 D;  5H2F V;  1KB0 A;  2V07 A;  1DW1 A;  3A0H V;  1CED A;  1H1O A;  3SVW A;  1DVH A;  2QJY B;  1ZRT D;  2CA4 B;  4L3H A;  3L4M A;  3WFC C;  1CTJ A;  2CE1 A;  1I6D A;  3VMA A;  4FB1 A;  1COT A;  1LFM A;  1B7V A;  1FCD C;  1HRO A;  3ZIY A;  1FI7 A;  4WQC A;  4WQ7 A;  2Y0C A;  5B66 V;  3O0R C;  4GYD A;  1C75 A;  3CXH W;  1IQC A;  2KS1 A;  3GW6 A;  2PCB B;  3OA8 B;  1H32 A;  3PH2 B;  5DF5 A;  5TIS V;  1SQV D;  3H1J D;  5CIC B;  3HQ8 A;  2BPB B;  3ZOO A;  1E29 A;  3JBT B;  2FYU D;  4XXL A;  1FHB A;  1GQ1 A;  4L3G A;  2BGV X;  4UB8 V;  5DFS A;  1I6E A;  1IRW A;  2OZ1 B;  1AYG A;  1C6R A;  2LIT A;  5B5E V;  4FA5 A;  1WEJ F;  4AAL A;  2GC4 D;  3MK7 C;  2GB8 B;  1CRC A;  4WQD A;  1KV9 A;  4WQ8 A;  1IO3 A;  3VYM A;  1YEA A;  1CIF A;  2ORL A;  3ZOY A;  5CIF B;  3VNW A;  2YCC A;  4A7P A;  1H31 B;  3M97 X;  2IBZ D;  2QJK B;  5EXQ A;  1COR A;  2FYN B;  4GED B;  1H9X A;  3TDK A;  2N18 B;  3WFB C;  3L71 D;  3RN0 A;  3A9F A;  3L75 D;  5DJQ B;  1CIH A;  2MTA C;  4U3F D;  5B6Q A;  4YE1 A;  5C0Z A;  1YTC A;  2B4Z A;  1VYD A;  3L4O A;  1F1F A;  1C6O A;  1CSU A;  1YIQ A;  3WFD C;  1LC2 A;  4FAV A;  1YEB A;  1C2R A;  1CYC A;  1EB7 A;  1CCH A;  3X39 A;  3O20 A;  1I55 A;  1U75 B;  3WC8 A;  1CIG A;  2ZZS 1;  2YQB A;  3CYT I;  3HQ7 A;  1A8C A;  4O1Q A;  3SLE A;  4PJ0 V;  5C9M A;  3H1H D;  1CRH A;  1AOQ A;  1RZ6 A;  2HV4 A;  3KHU A;  3WU2 V;  3MK7 B;  1EZV D;  4D6T D;  1HJ3 A;  4L1Q A;  2QJP B;  1DIQ C;  3TYI A;  1H33 A;  2Y0D A;  1CSX A;  3PTZ A;  1K3H A;  2C1V A;  5CIB B;  3H1L D;  1LMS A;  3OCD A;  1M70 A;  2D0W A;  1PPJ D;  2ZXY A;  1SQB D;  1C7M A;  1HZV A;  1NMI A;  4WQ9 A;  3CX5 W;  1N15 A;  1DW3 A;  3H1K D;  4XYD B;  1N50 A;  4WQB A;  3HQ9 A;  3PRJ A;  1E8E A;  1OCD A;  4FAN A;  1CYJ A;  2JTI B;  2Q3E A;  4H0K A;  1DVV A;  2O3J A;  4O1W A;  1CYI A;  4EIC A;  1LS9 A;  2L91 A;  2C1U A;  3DP5 A;  4KMG A;  3L72 D;  1L0L D;  5CID B;  3PHL A;  1NIR A;  3ZCF A;  1DT1 A;  2ZON G;  1AKK A;  2C1D B;  2PAC A;  1KIB A;  1N9C A;  3KZI V;  3TF5 A;  1I54 A; 
#chains in the Genus database with same CATH topology
 1RY3 A;  2Y9Z A;  3H1K E;  5CIH B;  3RBX A;  3PLN A;  155C A;  1NAY A;  3P8C E;  3C2C A;  1CRG A;  3CCQ P;  5KJ7 A;  3VMY A;  3MGN A;  1SQP J;  1L9B C;  2KB7 P;  3PXW A;  3H25 A;  1TU3 F;  2VHD A;  1NTK K;  1NNO A;  4AAN A;  1FI9 A;  1WMK A;  4ZMD A;  2C0W A;  2FFD C;  2P2U A;  2WIT A;  4FA4 A;  1ZZH A;  4W7Z A;  2V4H A;  2H89 C;  2JKV A;  5AW6 B;  3L72 E;  4GKG A;  1K3G A;  3VOP A;  2ZBO A;  3M0A A;  2N3B A;  1C2N A;  3VTP C;  2OYI C;  1CSB A;  1VQL P;  3WUU A;  3L71 J;  1E2R A;  3V2Q A;  1WVE C;  1L4A B;  1A2S A;  3CWB D;  3CWB G;  3WU2 E;  1RZ5 A;  3MHV A;  2G8Y A;  4H44 B;  2XND H;  1H32 B;  2R5B A;  4NPD A;  4K3A A;  5APV A;  5AW4 B;  2ZOO A;  4H0L B;  1HGZ A;  1WRG A;  2B88 A;  2KYV A;  1I8O A;  1NU1 K;  2E75 C;  4BRY B;  3AE9 C;  3HE4 A;  3AEF C;  1CHH A;  3SXT A;  4N6J A;  5GTH V;  2WSC J;  1EZV G;  4D6T G;  2GC7 D;  2P58 A;  4IL6 X;  2M5A A;  2HR3 A;  3RK2 D;  2YIU B;  2I1J A;  5KKZ B;  3H1L G;  4AAO A;  1YBK A;  1JEK A;  3HUS C;  2FWL A;  5AVS B;  3O5C A;  5CMZ A;  1KIL A;  2Z4E A;  1SQV K;  3PH0 A;  2E5Y A;  5BU5 A;  2FYU K;  3KDP B;  1BGY D;  4PD4 D;  1HGV A;  1BCC D;  3L73 E;  2XZR A;  3RL0 g;  4HJG H;  2R3S A;  1SQB J;  3V2P A;  1GW3 A;  1NO4 A;  1FZC A;  2RH0 A;  1CIE A;  1A02 J;  5CJ4 A;  1MKM A;  4Y99 C;  3C1L A;  3DMI A;  3WUI A;  1JY2 N;  2XDJ A;  3M91 A;  1CTY A;  1FJ0 A;  3JSV C;  2AI5 A;  1FZG A;  1FAV A;  2QG4 A;  1SQP D;  1W2L A;  2NPS A;  1N90 A;  2YO3 A;  2BLF B;  1GW4 A;  1GL2 C;  3SWS A;  3CXH H;  4H0J A;  3RMZ A;  1GDV A;  2O01 J;  1M57 D;  1XTG B;  3WMM 0;  1P84 H;  3OA8 A;  2BH4 X;  2P10 A;  1I8P A;  1KYO H;  3L74 E;  1JTH B;  1H33 B;  3V2N A;  1T3U A;  3TNU B;  1K73 Q;  3AE3 C;  2D2C B;  2IPP A;  2CA3 B;  2IYP A;  2HFE D;  1HUC A;  1W2E A;  1CI6 B;  1BL9 A;  2FXP A;  4W80 A;  2C0X A;  5GTI V;  2FBW C;  1PFI A;  1OAE A;  2OTJ P;  1U74 B;  3P7K A;  1K9M Q;  1NTM E;  3CP5 A;  1HTL C;  1LP1 B;  2JWD A;  1M6Z A;  3Q5S A;  2JQR A;  1KOR A;  2E75 D;  2K88 A;  5KLI B;  2M3B A;  2QA4 P;  1DH3 A;  5AVZ B;  1GK4 A;  2AXT E;  1L0N J;  2CK3 H;  3H1I G;  1HRC A;  4JCG A;  1IK7 A;  2E74 B;  2GIW A;  2AEM A;  1E5W A;  1KB9 D;  1C52 A;  1FJK A;  1LNQ A;  5APX A;  3B4S A;  2OYH B;  1NTK E;  4JPZ B;  5H2F V;  1KB0 A;  1RH5 B;  1DW1 A;  3L73 J;  3CX5 E;  3SVW A;  1DVH A;  1ZRT D;  1LWU A;  3L4M A;  3M9Q A;  1I6D A;  5TIS E;  4FB1 A;  1VQ6 P;  3USS A;  1FCD C;  1HRO A;  3ZIY A;  5B66 V;  3O0R C;  2J58 A;  2N1T B;  4UB8 E;  2BCC E;  1GK6 A;  4UB6 E;  3GW6 A;  2IYO A;  5CCG A;  3OA8 B;  3PH2 B;  1LJ2 A;  2XU6 A;  2IX7 C;  3E7K A;  4IFF A;  4R4L A;  2JO1 A;  4O9B A;  1E29 A;  1VQ7 P;  1GQ1 A;  4L3G A;  5DFS A;  1IRW A;  2KIK A;  1AYG A;  1H88 A;  4JF7 A;  1NU1 E;  1C6R A;  2Q5U A;  5B5E V;  1WEJ F;  1S5L X;  3Q2Y A;  2GC4 D;  1WT6 A;  3MK7 C;  4EIJ A;  2ZXX A;  1KIL E;  2QJP C;  3NMD A;  3IR9 A;  4PD4 I;  2UWJ E;  3L74 J;  2ZVN B;  3AE8 C;  4WQ8 A;  1N73 B;  2K1A A;  1GL2 D;  2KSE A;  1W2B O;  3G9R A;  2R3C A;  1K04 A;  3B5N D;  3ZOY A;  5CIF B;  1VF5 B;  1LTJ C;  4WY4 C;  2FKW B;  3IN6 A;  2OYO A;  1GDT A;  4IOI H;  1KMI Z;  2FYN B;  5AW1 B;  4GED B;  1NTM J;  1SQV E;  2IFN A;  4L75 A;  3RGU A;  3M06 A;  1N7S A;  3A9F A;  2FYU E;  5DJQ B;  1CIH A;  1SQQ J;  5APS A;  3BRV B;  2V7Q H;  2OYI A;  1IO4 A;  2E42 A;  1C6O A;  2RKL A;  4FAV A;  2QEX P;  1YEB A;  1CCH A;  4OWF A;  3OW2 O;  3O20 A;  1I55 A;  2K37 A;  3VMZ A;  2Q7C A;  1NTK J;  1EQ7 A;  4C7N A;  1LGH B;  1CIG A;  1OZH A;  3VP8 A;  3CYT I;  4RO0 A;  2P7J A;  5AVY B;  1MZ9 A;  4WWI A;  2JP3 A;  2P67 A;  2ZYD A;  1HH0 A;  2C9L Y;  1S2E A;  3AEC C;  4L1Q A;  5E79 H;  1NGM B;  1OVV A;  3HUS A;  1X9V A;  4XE5 B;  1RE3 C;  1M70 A;  4DZO A;  1PPJ D;  1PPJ G;  3RK3 C;  1N15 A;  2K9J A;  1JOC A;  2WSS H;  1NU1 J;  3NXS A;  4IL6 H;  3HQ9 A;  1NAF A;  3PRJ A;  3CCJ P;  3A5T A;  1X8Y A;  5L8R J;  2HPC A;  1KB9 I;  2JTI B;  2QM8 A;  4JYC A;  3PJS K;  4L74 A;  2HYN A;  1QVF O;  2O3J A;  4O1W A;  1LS9 A;  3QH9 A;  1AVY A;  3AED C;  3DP5 A;  1SFC D;  1EZV E;  1SVF A;  4D6T E;  2AEJ A;  1UII A;  3PHL A;  1DT1 A;  4R4M A;  2C1D B;  1SQV J;  1U7M A;  3H1L E;  1RE4 C;  2HOD B;  3H6P A;  3UIA A;  1KIB A;  3S9O A;  2FYU J;  2QSI A;  1Q7Y Q;  3AE2 C;  4WY4 D;  2CE0 A;  2DW3 A;  1KQF B;  1QX8 A;  3LW5 H;  1GL2 A;  3ZDM A;  3S4R A;  2N9I A;  1SQQ D;  3B5N A;  4NPF X;  1YCC A;  3CME P;  3L75 G;  1AFO A;  1F1C A;  2IFM A;  2N1T C;  4L76 A;  1LTI C;  1ZLL A;  2BEZ F;  2KLV A;  4GOF A;  3FGA D;  4NPE A;  2CPS A;  1NTZ D;  2B87 A;  1PGP A;  3FXE A;  3M9H A;  3AEA C;  1PP9 D;  1PP9 G;  1SQX D;  1H89 A;  2KNC A;  2KS1 B;  1GJQ A;  1URQ B;  1M1J B;  2PP6 A;  3M9B A;  5CYT R;  3A0B V;  1R5L A;  1XTC C;  3M0D C;  1S4X A;  2YNY A;  3H1H G;  5EFW B;  2A06 D;  1YJW P;  4EID A;  1RF0 C;  2LR2 A;  1DEB A;  1Q82 Q;  1IFD A;  1CXC A;  1IFI A;  3ITK A;  2PRR A;  4OVN F;  4EDF A;  1CXA A;  1HJ4 A;  3TGU E;  2N3Y A;  3RK3 D;  1FI3 A;  3B8E B;  3Q1M A;  5DJQ C;  3NWV A;  3CXH E;  1KQL A;  1KD1 Q;  3A0B H;  4ASW A;  1AOF A;  1J1E B;  1MFT A;  1P84 E;  4N78 E;  4ZNC A;  1KYO E;  5KAF V;  4PV1 B;  1L9J C;  1VQP P;  1YFC A;  3H1L J;  2L5G B;  4LJI A;  2B0Z B;  1BDC A;  1HBW A;  3WFE C;  1JCD A;  1S5L V;  3H1I E;  1CRI A;  1JMM A;  1N8R Q;  3IAO A;  3HD7 B;  4EIE A;  1DD3 A;  2FRC A;  3JCU H;  1J3S A;  1R5S A;  1SFC A;  4I1L A;  3PXS A;  4DJG A;  2POH A;  4EIF A;  1HCM A;  1MZ4 A;  2KNC B;  5AW2 B;  2BCN B;  4NFG B;  1BE3 E;  1M7L A;  3V2R A;  2KLU A;  2YMK A;  1YTZ T;  3AEB C;  1Q90 D;  4WY4 A;  1S5L H;  3NTN A;  4TT3 H;  1G1I A;  2Q9I A;  4U7J A;  3VMX A;  1DIP A;  1MUU A;  3KYQ A;  1YQ3 C;  3A2A A;  4I6M C;  3EFF K;  5KLV D;  1T2K C;  4U3F J;  1S1C X;  2D0S A;  2B9B A;  2M3E A;  1CHI A;  3O1Y A;  1RF1 A;  2MKV A;  2EXV A;  4XA4 A;  1JY2 P;  3TGU J;  2YMY A;  3V4W A;  4JYB A;  3L70 D;  3L70 G;  2AIU A;  1HZU A;  3PP5 A;  2XTS B;  3L4F A;  4IFM A;  3W67 A;  1S9K E;  3VP9 A;  5AW5 B;  5AUR A;  3GHG C;  4PD4 H;  1I5T A;  2N18 C;  1DII C;  4GT1 A;  2YKP A;  3A0H V;  4JBZ A;  1CED A;  2QJY B;  1FC2 C;  2CA4 B;  2M8R A;  1FDI A;  1CTJ A;  1FS0 E;  1N86 A;  3H1I J;  3VMA A;  3BCC J;  1J1D B;  2FY8 A;  1FI7 A;  4WQC A;  3AE4 C;  1BGY G;  5GTH H;  1BCC G;  4GYD A;  1NH4 A;  4ZKP A;  1IQC A;  4YPC A;  3U1C A;  3H1K J;  1GMJ A;  1L0L K;  5APY A;  5CIC B;  2BEQ D;  3HQ8 A;  2BPB B;  1FBM A;  1URQ C;  5APW A;  1M1J C;  5AW8 B;  1BE3 J;  1MV8 A;  4XXL A;  1I6E A;  4WVZ A;  4FA5 A;  3D0W A;  1SQP G;  1PZQ A;  2R44 A;  4MN4 C;  1HJB A;  4WQD A;  3L72 J;  3D70 A;  1OX3 A;  5AW0 B;  1AVO A;  4HH2 A;  3Q3D A;  3P8M C;  2ORL A;  1OW8 A;  3N4X A;  3HE4 B;  1H8A A;  4RKU J;  2IBZ D;  2IBZ G;  2IDB A;  2QJK B;  5EXQ A;  2I1K A;  2M5A B;  2ZFC A;  4WBA A;  1COR A;  5APT A;  4BXL A;  3CPW O;  1T8Z A;  1H9X A;  3TDK A;  3H1J E;  1J1E C;  2HLO A;  3L71 D;  2WVR A;  5E79 E;  4OGQ B;  2E76 B;  1LT9 C;  1AQT A;  4U3F D;  1Y47 A;  5CBN A;  1T2K D;  2ZVO B;  4HB1 A;  1KIL B;  3BAS A;  2B4Z A;  2ZT9 B;  1VYD A;  4IL6 E;  1YIQ A;  4LLH A;  3WFD C;  1KB9 H;  5AVR B;  3X39 A;  2WPV B;  1EC5 A;  1LTA C;  4DCK A;  1M90 Q;  3CC4 P;  3WC8 A;  1KFM A;  4I2L C;  3CD6 P;  1FZC B;  1KN7 A;  3IF4 A;  2I8D A;  3E1R A;  1A8C A;  3R4Y A;  2WSE H;  1ZR4 A;  1GD2 E;  4PJ0 V;  5C9M A;  1AOQ A;  1OW6 A;  3AEE C;  3L75 E;  5GTI H;  3WU2 V;  1OVR A;  1HJ3 A;  1RHZ B;  1FZF A;  2NPS B;  3AE5 C;  1G2C A;  1CSX A;  1YIT P;  1K3H A;  2WPQ A;  1LMS A;  3U59 A;  2ZXY A;  4H13 B;  2YXQ B;  1SQB D;  1SQB G;  1NMI A;  3H1K D;  1NKZ B;  2Q1K A;  3FWN A;  1L4A C;  3P8C D;  2XV5 A;  2JJL A;  1CYJ A;  4PJ0 H;  4H44 C;  4HYT B;  2O01 H;  1DVV A;  1M56 D;  1ZOY C;  5H2F H;  3H1H E;  1CYI A;  4EIC A;  4H0L C;  5APQ A;  3CLQ A;  3L72 D;  1FZE A;  2GUV A;  3R2P A;  1H0T A;  1NIR A;  3ZCF A;  1LTS C;  2ZON G;  5B66 H;  3CCM P;  2PAC A;  2WZ7 A;  3H1J J;  2YIU C;  5KKZ C;  3TF5 A;  3O6Q A;  2Q3E A;  1BSH A;  2XKM A;  2MHM A;  2O1K A;  3II6 A;  1DEE G;  1OMI A;  5KJ7 C;  5APU A;  2FFD A;  5B5E H;  4WQA A;  1NJI Q;  4K3I A;  1PL5 A;  1CRJ A;  1MFZ A;  1S3J A;  2NRG A;  2RMZ A;  1QL3 A;  3CCV P;  1LWU B;  1OFC X;  1L0L E;  3A0B E;  3MD0 A;  1G2C B;  3SJL A;  1RAQ A;  2C2C A;  1FZA A;  1ZR2 A;  2OZ1 A;  2KSJ A;  5AW9 B;  1DW2 A;  2IBZ I;  1L0N D;  1L0N G;  3LIE A;  2Q6Q A;  2OGU A;  3I55 P;  5TJH A;  3L75 J;  4DOJ A;  3TSI A;  1UIX A;  3NFQ A;  3CCR P;  2AEF A;  4BWN A;  1A56 A;  3HTK A;  1NKN A;  4HKZ H;  2FYZ A;  1CC5 A;  3L73 D;  3L73 G;  1CHJ A;  2W90 A;  3JCU E;  1MG3 D;  4YXW H;  2C9N Y;  1H31 A;  2BCC J;  5CIG B;  3GHG A;  1BSN A;  1NML A;  3ORV A;  4EI2 A;  4I7Z B;  2D2C C;  1VDF A;  4OGQ C;  2B10 B;  1KZU B;  2E76 C;  1AJY A;  3H1H J;  3BVH A;  3O6Q B;  3CWB E;  3L37 A;  1L4A D;  2AXT V;  1D7M A;  2YK3 A;  3MIW A;  1KV4 A;  1S5L E;  1KIL C;  4H44 D;  351C A;  2ZT9 C;  1OW7 A;  1KX7 A;  3HQ6 A;  1N7S B;  4H0L D;  2B12 B;  4AAM A;  2N9B A;  1PV3 A;  5KLI C;  1FOS F;  3L74 D;  3L74 G;  4ASV A;  3DR0 A;  3A7O A;  1KYO W;  1NYH A;  1G1J A;  3I5C A;  2OYI B;  1FZC C;  1QKS A;  2I8F A;  2E74 C;  4P4Q B;  1JO5 A;  2OYH C;  4UB6 V;  3CU4 A;  1JB0 J;  3VRD A;  4C7N B;  1HWT C;  1T3J A;  4RSZ A;  3CCE P;  2B11 B;  1NTM D;  5IY5 1;  1NTM G;  1QLE D;  4RES B;  3EQ2 A;  2RN0 A;  4J20 A;  3F5H A;  5CHX A;  3RN1 A;  1GU5 A;  3GG2 A;  2NZ2 A;  1L0L J;  3HTK B;  1SQQ G;  2E75 B;  2WTY A;  1BGY E;  4PD4 E;  1FOS E;  3RBZ A;  1BCC E;  2ZJS E;  1JUN A;  1Y9B A;  3A3Y B;  2DGE A;  4AUW A;  5CIE B;  1LT9 A;  1K8A Q;  1IRV A;  1NTZ G;  3HUS B;  1YNR A;  2HG5 D;  1NTK D;  1NTK G;  1SQX G;  1FOC A;  2JWA A;  3SFE C;  3CX5 D;  1R0Q A;  5GTH E;  1W5C T;  2BAS A;  2K9J B;  3CMA P;  1QYZ A;  1SQP E;  2Z5H A;  4N3Y B;  2HPC B;  1IFP A;  3NBS A;  1SLQ A;  3K5B A;  3AE6 C;  3GF3 A;  2A06 G;  1N73 C;  2BCC D;  3AE1 C;  1GU2 A;  3EWK A;  2W8Z A;  3RLM A;  1C6S A;  1VF5 C;  2Z5I A;  4Y99 B;  3CWB J;  2QIW A;  2QRX A;  4FA9 A;  2K3R A;  2FYN C;  1RAP A;  2D2C D;  3FWL A;  3PXT A;  4OGQ D;  4TLF A;  1NU1 D;  1NU1 G;  2WSF H;  1H1O A;  1QGK B;  1Q2N A;  2W6J H;  5BU8 B;  1QL1 A;  3V6I A;  4B86 A;  1KIL D;  3WFC C;  1GU4 A;  1FE6 A;  1KQS O;  4D6T J;  3TK1 A;  3RL0 B;  1LWU C;  1LFM A;  1GL2 B;  1B7V A;  3SWY A;  1IFJ A;  3L35 A;  2LXC B;  4WQ7 A;  4YTP C;  3B5N B;  2Y0C A;  1U57 A;  3GLM A;  1L4A A;  1C75 A;  3W68 A;  3VN0 A;  2G3A A;  5DJT B;  2A45 G;  1H32 A;  1PGQ A;  1CW5 A;  3H32 A;  5DF5 A;  1SQV D;  5CCG C;  1LT1 A;  3FXD A;  1A02 F;  3AE7 C;  5CBO A;  1U7J A;  3JBT B;  2E74 D;  2B87 B;  2FYU D;  1FHB A;  1KB9 E;  4BRY A;  1LTG C;  3CCL P;  3S1K A;  1PIX A;  2P1J A;  1ZRT E;  5KAF H;  1IJD B;  3SWK A;  3LID A;  3JC2 2;  1CRC A;  1N2D C;  1ZME C;  1KV9 A;  3MZW B;  1HVV A;  1LTJ A;  2JDI H;  2QM7 A;  4W7Y A;  2N1T D;  3VNW A;  1W5C E;  4XFJ A;  4A7P A;  5GTI E;  2KP8 A;  2KK7 A;  1NTZ K;  3MP7 B;  3IFM A;  4DT0 A;  2ITA A;  3RN0 A;  1X79 B;  1SQX K;  2Y9Y A;  5KLV G;  1N7S C;  3G4S P;  2ZYA A;  3F89 A;  2WQY C;  3OA7 A;  2B89 A;  5C0Z A;  3C9I A;  1VQN P;  1YTC A;  3MUD C;  1Z56 A;  2H8P D;  3MTU E;  3L4O A;  1F1F A;  1CSU A;  4PJ0 E;  2IZ0 A;  1CYC A;  5H2F E;  3BAT A;  5AVU B;  1VF5 D;  3ABV C;  2YKO A;  3KQG A;  1EDI A;  3H32 B;  4O1Q A;  1SS1 A;  3CX5 I;  1L2P A;  5B66 E;  1IC2 A;  5C39 A;  1RZ6 A;  1Q81 Q;  2HV4 A;  2K9Y A;  1SFC B;  2Q3I A;  3MK7 B;  1EZV D;  4D6T D;  4M3L A;  2QJP B;  3TYI A;  1JTH A;  1H33 A;  3TNU A;  3PTZ A;  3Q5P A;  1RE3 A;  5CIB B;  2ZXE B;  4C7R A;  4K35 A;  3H1L D;  1EDJ A;  1YHQ P;  3OCD A;  3V5B A;  2D0W A;  1LTJ B;  1CI6 A;  1HZV A;  4WY4 B;  4WQ9 A;  3CX5 W;  1L0N E;  2FXO A;  5B5E E;  4XYD B;  2H88 C;  4WQB A;  4FAN A;  1LP1 A;  5CCG D;  1VQ5 P;  4H0K A;  3A0H H;  3SSU A;  5AW3 B;  2WSE J;  2L91 A;  4EOT A;  2IZ1 A;  1SP4 A;  4Z1M H;  1JM0 A;  5CID B;  1RE4 A;  1AQ5 A;  2OYH A;  3WUT A;  1USE A;  1RF1 B;  1OVU A;  1LTT C;  1N9C A;  3KZI V;  1PPJ E;  2A45 I;  1RQV A;  2O1J A;  2H7H A;  1I54 A;  1EDK A;  4MU8 A;  3TYY A;  1MG2 D;  2WPS A;  2MJZ A;  1IFM A;  3G3Z A;  4N0K A;  4L73 A;  2V08 A;  3WUV A;  2OTL P;  5KAI V;  4PWA A;  1CSV A;  3L71 G;  2LKM A;  2DVH A;  4PV1 C;  3RL0 C;  2WSC H;  2N1T A;  2C8S A;  2L4D A;  4WB4 A;  5KLV K;  1N7S D;  4U3F G;  3B5N C;  1ETP A;  4RJT A;  2OAR A;  451C A;  1KQG B;  1JY3 O;  4DY9 A;  2CXB A;  1JCC A;  2OTK E;  1AV1 A;  3KZI H;  1GIW A;  3RK3 B;  4AQR D;  2JR8 A;  3TGU D;  3T97 A;  5AVW B;  3TGU G;  3HD7 C;  3OCD B;  1CO6 A;  1HH7 A;  1QL4 A;  3CXH D;  2GUS A;  3QWO C;  1GKS A;  3VYI A;  3I56 P;  5KAI H;  4WQE A;  1M8O B;  1VQK P;  1P84 D;  4N78 D;  3M0D A;  1KYO D;  1JNM A;  1N73 A;  1RF0 A;  2GM4 A;  4Q5P A;  1SQQ E;  4FA1 A;  1NVO A;  1VL2 A;  1H9Y A;  1KX2 A;  3C8V A;  1LC1 A;  3H1I D;  1EXI A;  3BCC D;  3BCC G;  4AYC A;  2QVA A;  1CRY A;  2V7Q J;  1NTZ E;  1QN2 A;  1PP9 E;  1SQX E;  2GA1 A;  2PGD A;  2KUB A;  4KJM A;  3H1K G;  3D6Z A;  2QE7 H;  2KI7 B;  2W6A A;  1DW0 A;  1BE3 D;  1BE3 G;  1URQ D;  2Y0E A;  4GDO A;  1YJ9 P;  2W83 C;  1J2J B;  5BVZ A;  1DX7 A;  3V4Q A;  1FZB A;  2CPB A;  2O01 N;  3AEG C;  1CCR A;  4QMA A;  1EZV I;  3WU2 H;  2A06 E;  2OQQ A;  1R8E A;  4LGD E;  1ZV8 A;  1SQP K;  4Y5R A;  3L72 G;  3BRT B;  2YO2 A;  1DD4 A;  2N9J A;  4GOE A;  1KTM A;  2LXB A;  3NBT A;  1YI2 P;  5CCH C;  3T97 B;  3RK3 E;  4LC1 A;  1M60 A;  3SWF A;  1SFC C;  2E5T A;  2N9Y B;  2QJY C;  3CCS P;  1EDL A;  2VRS A;  1ZN5 A;  4PV1 D;  3RL0 D;  1VPC A;  1J1D C;  3KXD A;  2LIR A;  2E43 A;  1HF9 A;  1VQ8 P;  1E79 H;  1CNO A;  2W6B A;  4PW9 B;  5AVV B;  1S9K D;  3RK2 B;  3CC7 P;  2ZAE B;  1HJ0 A;  1YIJ P;  3HD7 D;  3CCU P;  1YIC A;  3MUD A;  5K5G B;  3P32 A;  2KOG A;  4V2K A;  1M1K Q;  3ZBM A;  1CSW A;  2C1D A;  5E79 V;  2HOD A;  1IZL 0;  1NTZ J;  2YKQ A;  3LW5 J;  4QAO A;  3D6Y A;  2BH5 X;  1RF1 C;  4AX3 A;  1ZXG A;  4CPG A;  3G71 P;  1PP9 J;  1S6V B;  1SQX J;  1PGO A;  2PCC B;  3ZOW A;  3Q5R A;  2M0B A;  1JDL A;  3HRN A;  3L36 A;  4IL6 V;  1S72 P;  2QJK C;  5KAF E;  1BDD A;  1H0T B;  1CTZ A;  3ZOX A;  3CXH I;  1X22 A;  2C9X B;  1SQB K;  1HJ5 A;  2V07 A;  5KLV E;  1P84 I;  2H43 A;  1KYO I;  1JY3 P;  3O8Z A;  4YXD C;  4L3H A;  2CE1 A;  1YJN P;  1IZN B;  2SPZ A;  1COT A;  1PGJ A;  1T6A A;  1X0T A;  2FFD B;  5AVT B;  1FDO A;  2R5D A;  1IK9 A;  3CXH W;  4GIF A;  2KS1 A;  2PCB B;  3L70 E;  1URQ A;  1M1J A;  1KC8 Q;  2WWW A;  2WT7 A;  3N7N A;  5TIS V;  3H1J D;  3H1J G;  3ZOO A;  1ZW0 A;  2PAJ A;  4Y28 J;  5CCH D;  2BGV X;  4UB8 V;  2OZ1 B;  2AXT H;  1FDM A;  2LIT A;  3HE5 A;  4AAL A;  5CJ0 A;  1JMB A;  3OAK A;  4EYY Q;  2GB8 B;  2WSF J;  1VQ9 P;  5AW7 B;  5KJ7 D;  1IO3 A;  2NPS C;  1ZP0 C;  2J59 M;  4C46 A;  3VYM A;  1YEA A;  1NWQ A;  3D71 A;  3CX5 H;  1CIF A;  1JY3 N;  1YYC A;  4H13 C;  2YCC A;  1H31 B;  5TIS H;  1JY2 O;  3M97 X;  1OWA A;  4ZKU A;  4JQ0 D;  1FJP A;  2ZYG A;  1OIP A;  1IFN A;  2PFX A;  3GHG B;  2N18 B;  3WFB C;  4UB8 H;  4UB6 H;  3L75 D;  3CI9 A;  1L0N K;  2MTA C;  1VQM P;  2R32 A;  5M1B A;  5B6Q A;  1OXZ A;  4YE1 A;  3G6E P;  4GOD A;  3FX0 A;  1GZL A;  3CC2 P;  1K05 A;  3GF7 A;  2J5U A;  3B71 A;  3HD7 A;  5KTB A;  1LC2 A;  3GMA A;  1C2R A;  1EB7 A;  2BCC G;  1KFN A;  3SFD C;  1VQO P;  3A0H E;  1YQ4 C;  1U75 B;  5KLV J;  2ZZS 1;  2YQB A;  3HQ7 A;  2IBZ E;  4KT0 J;  2YXR B;  2WT7 B;  3SLE A;  2JEE A;  1GTW A;  3L71 E;  3H1H D;  1CRH A;  5DJU B;  2XNX A;  2E76 D;  2KZJ A;  4OH8 B;  4U3F E;  3OJA B;  2A45 H;  1VQ4 P;  3KHU A;  1N7L A;  3HE5 B;  1Y8A A;  1DIQ C;  2Y0D A;  3L70 J;  1FU1 A;  2ZT9 D;  2C1V A;  3RK2 C;  1CZQ A;  5AVX B;  2KXP B;  1Q86 Q;  5AVQ B;  3U1A A;  1C7M A;  1LTB C;  3E1I A;  1DW3 A;  1N50 A;  1NHL A;  1E8E A;  1YTZ I;  1OCD A;  1SQV G;  3CL3 D;  1LT9 B;  1QEX A;  2FYU G;  3EFG A;  2W27 A;  2FXM A;  3KZI E;  1BGY J;  1RQU A;  2WPR A;  3KPE A;  1BCC J;  2C1U A;  1EXJ A;  4IFD K;  1QVG O;  1QL2 A;  2WMM A;  4KMG A;  1NTM K;  1NOH A;  3BCC E;  2KZI A;  1L0L D;  1L0L G;  5KAI E;  2AXC A;  5CCH A;  2NPS D;  1AKK A;  1SQQ K;  4KHX A;  1USD A;  4I7Z C;  1SQB E;  1AA0 A;  4H13 D; 
#chains in the Genus database with same CATH homology
 4MU8 A;  1MG2 D;  5CIH B;  3PLN A;  155C A;  4N0K A;  2CE0 A;  3C2C A;  1CRG A;  2V08 A;  2MHM A;  5KAI V;  4PWA A;  1L9B C;  1CSV A;  3PXW A;  2VHD A;  2N9I A;  1SQQ D;  2DVH A;  1YCC A;  2C8S A;  1NNO A;  4AAN A;  2L4D A;  1FI9 A;  4WQA A;  4K3I A;  1F1C A;  1CRJ A;  1ETP A;  4RJT A;  4FA4 A;  1ZZH A;  451C A;  2RMZ A;  1QL3 A;  3SJL A;  4DY9 A;  2CXB A;  2ZBO A;  1NTZ D;  1K3G A;  2N3B A;  1C2N A;  1GIW A;  1RAQ A;  2C2C A;  3TGU D;  1PP9 D;  1SQX D;  2OZ1 A;  3OCD B;  1E2R A;  1CO6 A;  1HH7 A;  1DW2 A;  1WVE C;  1L0N D;  1QL4 A;  3CXH D;  1A2S A;  3CWB D;  5TJH A;  1GKS A;  1RZ5 A;  1GJQ A;  4WQE A;  1P84 D;  1H32 B;  1KYO D;  5CYT R;  3A0B V;  1A56 A;  2ZOO A;  4Q5P A;  1CC5 A;  2A06 D;  3L73 D;  4FA1 A;  4EID A;  1H9Y A;  1CHJ A;  1I8O A;  1MG3 D;  1KX2 A;  1CHH A;  3SXT A;  1H31 A;  5GTH V;  2GC7 D;  1LC1 A;  3H1I D;  5CIG B;  1CXC A;  3BCC D;  1CRY A;  3ITK A;  1NML A;  2YIU B;  3ORV A;  1QN2 A;  5KKZ B;  4EDF A;  4AAO A;  1CXA A;  1HJ4 A;  2B10 B;  2N3Y A;  2FWL A;  1FI3 A;  3O5C A;  5DJQ C;  3NWV A;  2AXT V;  2YK3 A;  1DW0 A;  1AOF A;  1BE3 D;  351C A;  5KAF V;  2Y0E A;  1KX7 A;  3HQ6 A;  1L9J C;  1YFC A;  1BGY D;  1CCR A;  4PD4 D;  1BCC D;  2B12 B;  4AAM A;  4LJI A;  2B0Z B;  3WFE C;  3L74 D;  4Y5R A;  1S5L V;  1CIE A;  1CRI A;  3DR0 A;  1KYO W;  2N9J A;  3DMI A;  1QKS A;  4EIE A;  2FRC A;  3WUI A;  2I8F A;  1J3S A;  3NBT A;  1CTY A;  1FJ0 A;  2AI5 A;  4P4Q B;  3PXS A;  4UB6 V;  3CU4 A;  4EIF A;  1HCM A;  2QG4 A;  1MZ4 A;  3VRD A;  1M60 A;  2KNC B;  4RSZ A;  2B11 B;  1SQP D;  1NTM D;  5IY5 1;  2BCN B;  4NFG B;  2N9Y B;  2RN0 A;  1W2L A;  1N90 A;  4J20 A;  3RN1 A;  2BLF B;  3GG2 A;  3SWS A;  4H0J A;  3RMZ A;  2LIR A;  1GDV A;  1CNO A;  3OA8 A;  2BH4 X;  4PW9 B;  1I8P A;  2DGE A;  1H33 B;  5CIE B;  1IRV A;  2CA3 B;  1YNR A;  1NTK D;  1YIC A;  1FOC A;  2JWA A;  5KLV D;  3CX5 D;  1BL9 A;  1R0Q A;  1W5C T;  5GTI V;  2K9J B;  1QYZ A;  1OAE A;  1U74 B;  2D0S A;  3CP5 A;  4V2K A;  3ZBM A;  1M6Z A;  3NBS A;  1CHI A;  1CSW A;  2C1D A;  2JQR A;  5E79 V;  3O1Y A;  2EXV A;  1IZL 0;  4QAO A;  2BH5 X;  2BCC D;  4AX3 A;  5KLI B;  1GU2 A;  1S6V B;  3L70 D;  2PCC B;  2AIU A;  1HZU A;  1HRC A;  3RLM A;  1C6S A;  3ZOW A;  2XTS B;  1JDL A;  4IL6 V;  4JCG A;  5AUR A;  2GIW A;  4FA9 A;  1CTZ A;  3ZOX A;  1I5T A;  1RAP A;  1KB9 D;  3FWL A;  2N18 C;  1DII C;  1C52 A;  3PXT A;  2C9X B;  1HJ5 A;  1NU1 D;  5H2F V;  1KB0 A;  2V07 A;  1DW1 A;  3A0H V;  1CED A;  1H1O A;  3SVW A;  1DVH A;  2QJY B;  1ZRT D;  2CA4 B;  4L3H A;  3L4M A;  3WFC C;  1CTJ A;  2CE1 A;  1I6D A;  3VMA A;  4FB1 A;  1COT A;  1LFM A;  1B7V A;  1FCD C;  1HRO A;  3ZIY A;  1FI7 A;  4WQC A;  4WQ7 A;  2Y0C A;  5B66 V;  3O0R C;  4GYD A;  1C75 A;  3CXH W;  1IQC A;  2KS1 A;  3GW6 A;  2PCB B;  3OA8 B;  1H32 A;  3PH2 B;  5DF5 A;  5TIS V;  1SQV D;  3H1J D;  5CIC B;  3HQ8 A;  2BPB B;  3ZOO A;  1E29 A;  3JBT B;  2FYU D;  4XXL A;  1FHB A;  1GQ1 A;  4L3G A;  2BGV X;  4UB8 V;  5DFS A;  1I6E A;  1IRW A;  2OZ1 B;  1AYG A;  1C6R A;  2LIT A;  5B5E V;  4FA5 A;  1WEJ F;  4AAL A;  2GC4 D;  3MK7 C;  2GB8 B;  1CRC A;  4WQD A;  1KV9 A;  4WQ8 A;  1IO3 A;  3VYM A;  1YEA A;  1CIF A;  2ORL A;  3ZOY A;  5CIF B;  3VNW A;  2YCC A;  4A7P A;  1H31 B;  3M97 X;  2IBZ D;  2QJK B;  5EXQ A;  1COR A;  2FYN B;  4GED B;  1H9X A;  3TDK A;  2N18 B;  3WFB C;  3L71 D;  3RN0 A;  3A9F A;  3L75 D;  5DJQ B;  1CIH A;  2MTA C;  4U3F D;  5B6Q A;  4YE1 A;  5C0Z A;  1YTC A;  2B4Z A;  1VYD A;  3L4O A;  1F1F A;  1C6O A;  1CSU A;  1YIQ A;  3WFD C;  1LC2 A;  4FAV A;  1YEB A;  1C2R A;  1CYC A;  1EB7 A;  1CCH A;  3X39 A;  3O20 A;  1I55 A;  1U75 B;  3WC8 A;  1CIG A;  2ZZS 1;  2YQB A;  3CYT I;  3HQ7 A;  1A8C A;  4O1Q A;  3SLE A;  4PJ0 V;  5C9M A;  3H1H D;  1CRH A;  1AOQ A;  1RZ6 A;  2HV4 A;  3KHU A;  3WU2 V;  3MK7 B;  1EZV D;  4D6T D;  1HJ3 A;  4L1Q A;  2QJP B;  1DIQ C;  3TYI A;  1H33 A;  2Y0D A;  1CSX A;  3PTZ A;  1K3H A;  2C1V A;  5CIB B;  3H1L D;  1LMS A;  3OCD A;  1M70 A;  2D0W A;  1PPJ D;  2ZXY A;  1SQB D;  1C7M A;  1HZV A;  1NMI A;  4WQ9 A;  3CX5 W;  1N15 A;  1DW3 A;  3H1K D;  4XYD B;  1N50 A;  4WQB A;  3HQ9 A;  3PRJ A;  1E8E A;  1OCD A;  4FAN A;  1CYJ A;  2JTI B;  2Q3E A;  4H0K A;  1DVV A;  2O3J A;  4O1W A;  1CYI A;  4EIC A;  1LS9 A;  2L91 A;  2C1U A;  3DP5 A;  4KMG A;  3L72 D;  1L0L D;  5CID B;  3PHL A;  1NIR A;  3ZCF A;  1DT1 A;  2ZON G;  1AKK A;  2C1D B;  2PAC A;  1KIB A;  1N9C A;  3KZI V;  3TF5 A;  1I54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...