1KYOD

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 66
structure length 245
sequence length 245
chains with identical sequence O
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kyoD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kyoD01
4O1WA 451CA 3A0HV 3TDKA 1A8CA 1CIHA 3PRJA 3WU2V 1CO6A 2RMZA 1RZ6A 1DVVA 2JTIB 3WC8A 1C6RA 2FWLA 3CXHD 3O20A 3OA8B 2C1UA 1BCCD 1FI7A 2N9YB 1F1FA 2N3YA 2K9JB 1ETPA 4L3GA 1CIEA 1HRCA 1JDLA 1KYOW 4FA4A 4WQ9A 5B6QA 1DW1A 1GJQA 2ZONG 1HCMA 1YICA 3WFBC 1C6SA 5IY51 5TISV 1CHJA 2C1DB 2ZZS1 3BCCD 1HJ3A 1S5LV 2PCBB 2ORLA 3ZBMA 3VMAA 4WQEA 1KX7A 1HJ5A 4H0KA 2XTSB 3WFEC 1N9CA 4FA1A 1LFMA 1U74B 3A9FA 1H32B 2ZBOA 2GC4D 2GB8B 1FI3A 1AOQA 1N50A 2BPBB 1CNOA 2N9IA 2C2CA 1C52A 2B11B 1M6ZA 4H0JA 3TGUD 2RN0A 2CA4B 5B66V 1LC1A 3PLNA 4GYDA 4D6TD 1CYIA 1AKKA 3RLMA 3ORVA 4L1QA 2D0WA 1ZRTD 4AANA 1CSVA 2QJYB 4PJ0V 3OA8A 4A7PA 4IL6V 4EIDA 2LIRA 2OZ1B 3SVWA 1CRJA 3ZOOA 2FRCA 5DJQB 1CSUA 1SQPD 1S6VB 3SWSA 1MG3D 4Y5RA 1GKSA 4N0KA 5C0ZA 2CA3B 1HJ4A 1CCRA 1AOFA 1I6DA 2C1DA 4NFGB 351CA 4PWAA 1SQQD 1EZVD 1SQBD 2FYNB 1CCHA 5DFSA 1CEDA 2O3JA 2GC7D 1CHIA 3ZIYA 2Y0DA 2VHDA 5H2FV 1L9JC 4KMGA 3PH2B 2AIUA 2L91A 3CP5A 1A56A 2QJKB 5TJHA 5E79V 1H1OA 1N15A 2ZXYA 4PD4D 5KAIV 1H32A 1IRWA 3DMIA 5KKZB 2D0SA 1CC5A 1QYZA 1MG2D 1NMLA 1I8OA 4XXLA 4EIEA 3O0RC 1KB9D 2HV4A 3L73D 1CXCA 1HROA 3KZIV 1SQXD 2FYUD 3RN0A 1I55A 3VYMA 4XYDB 1L0LD 2PCCB 5DF5A 1WVEC 1K3GA 5EXQA 1DW0A 1YFCA 2MHMA 1YEBA 1AYGA 1RAPA 3L74D 3ZOYA 1NMIA 2OZ1A 4Q5PA 4O1QA 3NBSA 3GW6A 4JCGA 3SXTA 3ZOXA 1L9BC 3TF5A 2Y0EA 2YCCA 1HZVA 3OCDB 3TYIA 1R0QA 3CX5W 2JWAA 1SQVD 5KLVD 1FI9A 4DY9A 5CIGB 1NNOA 1KIBA 1EB7A 4MU8A 3L70D 4WQAA 1E29A 2N3BA 4WQDA 3HQ8A 3O1YA 3SLEA 3A0BV 1H33B 1I54A 5B5EV 1CSWA 3PTZA 1H9XA 3PXWA 2DGEA 1W2LA 5GTIV 1RZ5A 3PHLA 1J3SA 2B4ZA 1BL9A 1QKSA 3VRDA 2LITA 4LJIA 155CA 1H31B 1LMSA 5CIHB 1OCDA 1VYDA 3CXHW 2B0ZB 1CTJA 3WFDC 1KV9A 2Y0CA 1CXAA 1YCCA 5KAFV 2YQBA 2PACA 4J20A 1NTKD 1IO3A 2BLFB 4FANA 3CYTI 1I6EA 1BGYD 1KYOD 1A2SA 3PXSA 4AAOA 3L71D 3X39A 1KB0A 1OAEA 3OCDA 2DVHA 1CRGA 4FA5A 1W5CT 3ZCFA 1GDVA 4K3IA 3O5CA 3VNWA 1I8PA 3L75D 2N9JA 3H1HD 1M60A 1NTZD 3HQ9A 1DIIC 4WQ8A 2JQRA 1H33A 1DIQC 1NIRA 2B12B 1DT1A 1QL3A 3PXTA 3L4MA 3RMZA 2BCCD 4AAMA 3C2CA 2A06D 4GEDB 1U75B 1PPJD 2BH5X 4YE1A 1C6OA 1CHHA 5C9MA 1H31A 1MZ4A 1HZUA 1GU2A 1H9YA 4EIFA 2ZOOA 2C1VA 1CIFA 4FA9A 1C2NA 2MTAC 3MK7B 1QL4A 1DVHA 4EDFA 1IRVA 3WUIA 2KS1A 5CIDB 2CXBA 2IBZD 1FCDC 1CRHA 1YIQA 2C8SA 4P4QB 2N18B 4EICA 4L3HA 1RAQA 3ITKA 2V08A 2EXVA 1C2RA 5GTHV 2AI5A 3H1JD 1LC2A 3RN1A 2QJPB 1LS9A 1L0ND 4AX3A 5DJQC 1FOCA 5AURA 1N90A 1YEAA 3KHUA 1P84D 4FAVA 3CWBD 4RSZA 1YTCA 5CIBB 1BE3D 1K3HA 1CYCA 1CORA 1NU1D 1E2RA 3HQ6A 3FWLA 3H1LD 1C75A 1HH7A 5CICB 1IQCA 1YNRA 4QAOA 2BCNB 1WEJF 1E8EA 4PW9B 2L4DA 4UB8V 1CYJA 1GIWA 2BH4X 3NWVA 1QN2A 2BGVX 2V07A 1CRYA 1C7MA 5KLIB 2B10B 4FB1A 5CYTR 1CRCA 1COTA 4V2KA 4RJTA 2Q3EA 5CIFB 1GQ1A 1CRIA 1B7VA 4WQ7A 1CTZA 4WQBA 3M97X 1DW3A 1I5TA 3GG2A 3CX5D 3H1ID 3HQ7A 2YIUB 1KX2A 3DR0A 3L72D 4AALA 4WQCA 3ZOWA 1CSXA 1PP9D 1DW2A 2GIWA 2YK3A 1FJ0A 1ZZHA 4UB6V 2KNCB 2AXTV 1IZL0 1M70A 1NTMD 3H1KD 3MK7C 3CU4A 3DP5A 3NBTA 3WFCC 5CIEB 1CIGA 2I8FA 2CE1A 2C9XB 1FHBA 1CTYA 4U3FD 2QG4A 2CE0A 3JBTB 3L4OA 1F1CA 3SJLA 2N18C
chains in the Genus database with same CATH superfamily
3VMYA 1L0LE 1L0LG 1SS1A 3TDKA 2AXTE 2OTKE 1NTKK 1EXIA 3WU2V 1CO6A 1KORA 1DVVA 1X0TA 1VQNP 1JCCA 1C6RA 1WRGA 3O20A 1VF5D 2GM4A 1FI7A 2HPCA 3KQGA 2N3YA 4L3GA 1HRCA 4FA4A 3AE8C 5CCHA 4WQ9A 2IBZE 2IBZG 1IFMA 1GJQA 1HCMA 3HD7C 3MUDA 1LTIC 1GL2B 3I5CA 4N6JA 3CCLP 2W83C 5APXA 1S5LV 2ZXXA 2PCBB 3CLQA 5AW5B 2W90A 3ZBMA 1HJ5A 3NMDA 2IFMA 5GTHE 3WFEC 3RK2C 1N9CA 4B86A 1VQ4P 2KP8A 3V4QA 3M0DA 2WMMA 1U74B 4WBAA 3JSVC 2ZBOA 1AOQA 4BRYA 2BPBB 1LT9C 1SP4A 1M6ZA 3TGUD 1QL1A 3ZDMA 2Y9YA 1KQFB 2WWWA 1RE3C 1VL2A 1K73Q 1AKKA 1N7SA 3CX5I 1ZRTD 3A7OA 3CCEP 5AW7B 2KI7B 3SWKA 1FOSE 2JP3A 1EZVI 3Q2YA 3CCSP 1NGMB 1KFNA 3ZOOA 2ZYAA 1CSUA 4Y99B 3VYIA 4NPEA 2KIKA 1N73B 1GKSA 2CA3B 1NU1J 1CCRA 4HKZH 3D6ZA 2N1TC 1A02F 1SQQD 1EZVD 1FAVA 1S72P 2FYNB 3RK2D 3HUSB 2O3JA 3TGUJ 1OW8A 2XV5A 1JUNA 4WB4A 3GHGA 4KMGA 2L91A 2I1JA 5BU8B 4OVNF 3IN6A 1NTMG 1NTME 2Q5UA 2QJKB 5DJTB 2OARA 2AEMA 1VDFA 2ZAEB 1EXJA 3O6QA 1H32A 1IRWA 5KKZB 5KJ7A 1CC5A 3RK3B 1X79B 2QA4P 3L73D 3KZIV 1T3UA 2FYUD 3VTPC 1GL2C 3VYMA 2I1KA 2OYIA 5AW3B 5AW6B 5CJ4A 5AVVB 2WSFJ 1SQQJ 3A0HE 1IFJA 2WPVB 3WU2H 1QEXA 2KXPB 1HWTC 1LT1A 3L74D 1NMIA 4TT3H 1YJWP 4Z1MH 3NBSA 4MN4C 4JCGA 3SXTA 3ZOXA 2N1TD 3V2PA 4ZNCA 1UIXA 3MP7B 1AJYA 2YMKA 3ABVC 1NYHA 2W6AA 3CX5W 1DEEG 4JYCA 3L73J 1JO5A 2DW3A 5CIGB 2AXCA 1DX7A 5TISE 2XDJA 1S5LH 1P84H 4WQAA 1FZGA 4BXLA 1M1JB 1NU1G 1NU1E 3A0BV 2NPSB 2V7QH 1GL2D 4Y99C 3L74J 1FOSF 3PTZA 1H9XA 1N73C 2C9NY 5GTIV 2QM8A 2R32A 1BL9A 3TGUG 4H44B 2WPRA 3TGUE 2LITA 4LJIA 2YXQB 2MJZA 2LXCB 2FYNC 1QLED 1CTJA 4PV1D 1ZRTE 3WUTA 1EDLA 2WITA 3CCUP 2BLFB 2FFDC 2QJKC 1I6EA 1BGYD 3U1AA 1M90Q 4PJ0E 2UWJE 2P2UA 1FZAA 4IL6E 1W5CE 5KKZC 2ZYGA 3RK3C 4L76A 2RH0A 2BASA 2DVHA 1SQQG 1EZVE 4FA5A 1EZVG 1SQQE 1W5CT 4D6TJ 2IZ1A 1EDJA 3PP5A 1BSHA 1E79H 2L5GB 2PGDA 1R5SA 2N9JA 2HFED 1PFIA 2FY8A 3MD0A 1G2CB 2JQRA 1VPCA 4AQRD 3CCJP 2NZ2A 4IFDK 1M56D 1NIRA 1HGZA 1JY3O 3BRTB 1RH5B 2H43A 1DT1A 3M9QA 1VQ7P 3L73E 3L73G 2A06D 4GEDB 1U75B 3CXHH 2V4HA 3M0AA 2FYUE 2FYUG 4W80A 2M5AB 4JPZB 1H31A 1MZ4A 3KZIH 5CHXA 4FA9A 1RF1B 3FGAD 3BRVB 3CC7P 3RK3D 3E7KA 5CIDB 3L74E 3L74G 1KFMA 1M1JC 1IFNA 1R8EA 2NPSC 2A45G 1OW7A 1KQLA 2JWDA 1N7LA 2KOGA 1CSBA 2V08A 2GUSA 5CJ0A 3UIAA 1RE3A 2IFNA 1LC2A 2YXRB 4OGQB 1L0ND 2OGUA 3GF3A 1P84D 1YTCA 5CIBB 1K3HA 3FX0A 1CYCA 1CORA 1EQ7A 1KYOI 1HJBA 3A0BH 5APSA 1JNMA 1C75A 5CICB 5GTIH 1LP1B 1YNRA 4XE5B 2N1TA 1E8EA 1GIWA 1LWUA 2NPSD 2LXBA 1IJDB 3P32A 2ZJSE 3LW5H 1JTHA 5CBOA 1CW5A 1NAYA 2OTLP 4IFFA 4V2KA 1X9VA 1VQ6P 2R44A 5CIFB 4I6MC 3V6IA 2AEFA 5AVRB 3H1ID 3MZWB 4HJGH 3DR0A 2IZ0A 5CCGC 4I1LA 1GMJA 3AEDC 1ZZHA 2CPBA 4UB6V 4ASVA 3DP5A 3AEAC 1RF1C 5CIEB 4OWFA 1CIGA 3S1KA 1FHBA 2CE0A 3P8MC 3BASA 3JBTB 2WPQA 1F1CA 3SJLA 2QE7H 2Q6QA 451CA 2A06G 2A06E 2CK3H 3VOPA 3LIEA 2WSEH 1CIHA 2IPPA 1JOCA 2BEZF 2RMZA 5AVTB 1RZ6A 1FZBA 1YQ4C 3CXHD 2FWLA 2H88C 3OW2O 3OA8B 2N9YB 3BVHA 2K9JB 1JDLA 1KYOW 3K5BA 5B6QA 2ZONG 1YICA 2M8RA 1MKMA 2ZFCA 5IY51 1LTSC 3E1IA 1N73A 2SPZA 2C1DB 1RE4A 1KC8Q 4ZKUA 2IYOA 3BCCD 1FZCB 1IO4A 2KSJA 5AVWB 2E42A 2E5YA 3AEGC 3VMAA 3IF4A 3TK1A 4WQEA 1SQXK 1KX7A 3AEEC 4H0KA 3KDPB 2XTSB 1L0NG 1L0NE 2LR2A 1L0LK 1LTJA 3RL0B 2C0WA 2OQQA 5AW2B 1NKNA 2WTYA 1P84E 2FFDA 2QIWA 2GC4D 2GB8B 1FI3A 2N9IA 3T97A 4H0JA 3C1LA 2CA4B 3RBZA 5B66V 4ZKPA 2JJLA 1LC1A 2KLUA 4GYDA 1CYIA 3RLMA 3ORVA 4L1QA 4JF7A 1NHLA 3BCCJ 2YO2A 1YIJP 3RL0g 4A7PA 3CI9A 4EIDA 1KYOE 3AE4C 5DJQB 4TLFA 4UB8E 4N0KA 1DD3A 4I7ZB 1USEA 1J1EB 3WUVA 3CC2P 3CX5H 1I6DA 2E76B 2JDIH 4JYBA 1YHQP 3IAOA 1SQBD 1CCHA 3H1IE 1CEDA 3G6EP 4GT1A 3ZIYA 2P1JA 2Y0DA 3HE4B 3CD6P 2H7HA 1NAFA 3TYYA 3CCQP 5E79V 3B71A 1CZQA 1N15A 3P8CE 4UB6H 5KAIV 2D0SA 1KMIZ 1N2DC 2HR3A 1URQB 1ZW0A 5AVUB 1I8OA 3O0RC 4O9BA 1KB9D 2ZT9C 2O01N 3RN0A 1I55A 2WPSA 1GU4A 1FZCC 2D2CB 5DF5A 5EXQA 2MHMA 3CXHE 3Q3DA 3HTKA 1AYGA 1NTMJ 2OZ1A 3RL0C 3GW6A 2M3EA 2OTJP 2Y0EA 2Z5IA 1HZVA 2O1KA 3OCDB 3TYIA 2HODB 1NTMK 2PFXA 1NH4A 1FI9A 3BCCG 3BCCE 2WSCH 1NNOA 1KIBA 3L70D 1E29A 1OW6A 3A2AA 3HQ8A 1AVYA 1JY2O 2JR8A 1E5WA 3O1YA 2ZT9D 4K3AA 3EFFK 1Y8AA 1H8AA 1OX3A 5APVA 1PIXA 3AE7C 3PHLA 1IK9A 4I7ZC 1J3SA 2B4ZA 4BWNA 1QKSA 2WZ7A 1J1EC 3VRDA 155CA 2E76C 5B66H 3HD7D 1YI2P 5KAFV 4GOFA 5AVZB 1IO3A 3L70J 1NVOA 1RF1A 1VQPP 1A2SA 3M91A 3A5TA 2O01H 4AAOA 2W27A 2OYOA 1URQC 1S9KD 1YQ3C 1LTAC 2G3AA 1CRGA 1S2EA 1RF0C 5APQA 1SQBE 1SQBG 1NU1K 4Y28J 1GDVA 1J1DB 1BDCA 2D2CC 3O5CA 3VNWA 4H0LB 1K05A 1JMBA 4C46A 1KTMA 2K1AA 3H1HD 2P58A 1M60A 3N7NA 1NTZD 4PD4H 2AEJA 3C9IA 2E5TA 1H33A 1PGPA 1MFTA 5H2FE 1KILB 3I56P 5E79H 5AVQB 4DOJA 1CI6A 4XFJA 1QL3A 2ZVNB 5KAIH 2BCCD 2A45I 1KB9E 3C2CA 1PPJD 3L4FA 4YE1A 1C6OA 5C9MA 2NRGA 5AVSB 1GU2A 2WT7A 1QVFO 4EIFA 2ZOOA 2C1VA 1LP1A 2MTAC 1IFIA 1QL4A 1H0TA 2KS1A 2KYVA 3HE5B 1VQOP 2B9BA 1SQQK 3H1HJ 1YIQA 1EC5A 2C8SA 4P4QB 1NTZJ 3H6PA 1S1CX 1RAQA 1ZN5A 3H32B 1KQSO 3AE1C 4CPGA 2D2CD 3CC4P 2EXVA 2YO3A 1ZXGA 2FYUJ 1C2RA 5GTHV 1K8AQ 2BCCJ 4C7NB 2QRXA 3H1JD 2B87B 5EFWB 1DD4A 5M1BA 1Q2NA 2QJPB 3D70A 1NO4A 2MKVA 1WMKA 3L70G 3L70E 3D71A 1FOCA 2FYUK 4C7RA 1YEAA 3KHUA 3HRNA 1L4AB 3U59A 3JCUE 3FWLA 3H1LD 1H88A 4IL6X 3HUSC 1MUUA 3W67A 5B5EE 4QAOA 3CPWO 3V2NA 1ZR2A 1WEJF 2FXOA 2BH4X 1J1DC 1HTLC 4QMAA 4H0LC 3H1JJ 2V07A 2HPCB 1CRYA 4FB1A 2OYHA 5KAFH 1COTA 4RJTA 1KILC 1RQVA 1CTZA 1S9KE 5APYA 3M97X 1I5TA 2W6BA 2R5BA 3GG2A 4LGDE 3HQ7A 2YIUB 3H1LJ 4WQCA 3ZOWA 1DW2A 3OA7A 3GMAA 3TNUA 1VQ8P 3H1HG 3H1HE 1M70A 3CU4A 3NBTA 1NTZG 1NTZE 1YTZI 2C9XB 1N8RQ 1CTYA 1BGYJ 4U3FD 3HD7A 3MTUE 2H89C 1Q90D 3F5HA 1GW4A 4O1WA 2BCCG 2BCCE 3A0HV 1A8CA 3R2PA 1PPJG 1PPJE 1G1JA 5BVZA 3PRJA 1ZV8A 5AW1B 1IZNB 3SFEC 2JTIB 1SVFA 3WMM0 2C1UA 2QJPC 1KILD 2WSSH 1KN7A 4HYTB 1DW1A 5C39A 1LT9A 1NJIQ 4RO0A 1P84I 1L4AC 4H44C 1HH0A 1PGJA 4U3FJ 5TISV 1CHJA 1KZUB 2POHA 2FXMA 2ZZS1 1HJ3A 1W2BO 1PL5A 3CCRP 3H1JE 3H1JG 5GTHH 3GHGB 1IFDA 2XZRA 1FS0E 2KNCA 3PJSK 2K88A 4KT0J 3KXDA 1LFMA 3FXEA 3A9FA 3O6QB 1H32B 1S3JA 5CCHC 2KLVA 1N50A 1CNOA 3BATA 2C2CA 2B11B 3MUDC 1BDDA 3H1LG 3H1LE 1YYCA 3PLNA 2OYIB 1IC2A 1RY3A 1RF0A 4HH2A 4WY4B 1EDIA 4AANA 2QJYB 4PJ0V 4N3YB 1J2JB 1L0NJ 4IL6V 1OIPA 1BGYE 1BGYG 1L4AD 4GKGA 4H44D 3SVWA 3CCVP 1JY3P 3FWNA 1SQPD 3M0DC 1MG3D 1OVRA 1AOFA 2PP6A 2QVAA 1L0NK 1GL2A 2V7QJ 4PWAA 2E43A 4ASWA 5DFSA 5AW9B 1GK6A 2FYZA 2I8DA 4IOIH 4I2LC 3VN0A 3U1CA 1L9JC 3PH2B 2AIUA 3CP5A 3CXHI 1A56A 2YKPA 3R4YA 3D0WA 5TJHA 5DJUB 1KD1Q 2ZXYA 2KB7P 3DMIA 4U3FE 4U3FG 1FZFA 1QYZA 3Q5RA 4EIEA 1SQPJ 4XXLA 1VF5B 1MV8A 1CXCA 1HROA 1SQXD 2M3BA 3V5BA 4R4LA 1GD2E 3H1IJ 1L0LD 2P67A 5APTA 3A0HH 3IR9A 4OGQC 2PCCB 1K3GA 1DW0A 1YFCA 3RK3E 1LTGC 3L37A 1LTTC 1K04A 3GHGC 4AUWA 1GW3A 1RAPA 2JEEA 3ZOYA 1KILE 2BEQD 2Q1KA 1FC2C 3WU2E 2QM7A 1YTZT 4O1QA 5AVYB 1Q82Q 3TSIA 5CCGD 2K9YA 2JKVA 2ZYDA 2QEXP 4EI2A 1R0QA 3AEBC 1SQVD 3AE3C 5KLVD 1MZ9A 1YITP 1JEKA 5TISH 3HUSA 3V4WA 1G1IA 3D6YA 1EB7A 4WY4C 2N3BA 1OXZA 1ZP0C 2B89A 1S5LE 1LNQA 1I54A 1UIIA 3NTNA 1QGKB 2FKWB 4OGQD 4GIFA 1W2LA 1RZ5A 1KILA 4XA4A 4IFMA 2XNXA 4EYYQ 1FE6A 1H31B 1LMSA 5CIHB 1OCDA 1VYDA 3CXHW 1SQVJ 3CMEP 1KV9A 5KLVJ 1YCCA 3MGNA 2YQBA 2PACA 4J20A 1NTKD 4PJ0H 1PGOA 3RK2B 4FANA 1SQPE 1SQPG 4IL6H 2K37A 4DJGA 1DEBA 1VQ5P 1JM0A 1OWAA 1QVGO 3PXSA 3L71D 3X39A 1KB0A 1OAEA 2WSFH 2J5UA 1QX8A 3H1IG 2GUVA 4WY4D 2KZJA 1M7LA 1KB9I 1QL2A 3ZCFA 1HBWA 1DIPA 1GZLA 3B5NB 2G8YA 1M57D 4YTPC 3HQ9A 2WVRA 4WQ8A 3USSA 4GODA 1M1JA 1R5LA 1DIQC 2NPSA 4M3LA 1NTKJ 3PXTA 3RMZA 1NKZB 1L4AA 1BSNA 1MFZA 1CHHA 1SQBJ 2ZVOB 2C0XA 2N1TB 1H9YA 1C2NA 3KZIE 1LWUB 2XU6A 3MK7B 1ZOYC 5KTBA 4NPDA 1FDMA 1JTHB 1JY3N 1SQBK 1FCDC 3G9RA 1CRHA 2A45H 4LC1A 3H25A 4EICA 3ITKA 3M06A 4WWIA 3JC22 1SQVG 1SQVE 1XTGB 5KLVE 5KLVG 3W68A 2AI5A 5CBNA 3RN1A 1LS9A 2P10A 1SFCB 2WSEJ 1X22A 2E74B 5DJQC 4NPFX 1G2CA 1M8OB 2R3SA 3CWBD 4RSZA 1AA0A 1FU1A 4JBZA 1BE3D 4PV1B 1RHZB 1NU1D 1FZEA 3CL3D 3HQ6A 1NWQA 4KHXA 3AE2C 1Q86Q 3A0BE 3RL0D 1HH7A 2M5AA 2BCNB 5CCGA 5GTIE 2L4DA 4UB8V 1CYJA 3AE9C 2GA1A 3NWVA 4WVZA 3B5NC 4EOTA 3OAKA 1C7MA 5KLIB 3AECC 1NTKE 1NTKG 1CRCA 3L35A 1WT6A 3M9HA 1GDTA 2KZIA 2Q3EA 2LKMA 3L71E 3L71G 1CRIA 1B7VA 4WQ7A 3CWBJ 1DW3A 1BE3J 3CX5D 2K3RA 1L2PA 1HUCA 2WQYC 2YKQA 3L72D 4AALA 1PP9D 3N4XA 1KQGB 1ZR4A 2YK3A 1LWUC 2AXTV 1IZL0 3H1KD 3MK7C 1LTJB 1OMIA 2E76D 3WFCC 2I8FA 2M0BA 4HB1A 2FFDB 3L4OA 1U7JA 3T97B 1EDKA 1T2KC 4LLHA 2XNDH 3KPEA 2CPSA 1VQKP 3B5ND 1YJ9P 3WC8A 1URQD 1FJKA 5AW0B 1JY2P 1AQTA 1BCCD 3L72J 4WY4A 1SFCC 1PP9J 1F1FA 3PH0A 4DT0A 1ETPA 2E74C 1CIEA 1PV3A 3H1KJ 1ZLLA 3L36A 2ZXEB 3WFBC 1C6SA 3II6A 4PV1C 1NTZK 1AVOA 4R4MA 1HF9A 2ORLA 3NFQA 3RGUA 1OVUA 3AE6C 4FA1A 1T2KD 1DH3A 1IK7A 1Q7YQ 5KLIC 1BCCJ 2IDBA 3CWBG 3CWBE 4DCKA 2J59M 2YMYA 1BE3G 1BE3E 2H8PD 1C52A 1M1KQ 2Z4EA 2RN0A 5L8RJ 1D7MA 2HG5D 1X8YA 1RE4C 1U57A 4D6TD 1SFCD 1U7MA 2Y9ZA 5AVXB 2E74D 1ZMEC 2D0WA 4L75A 1CSVA 1KYOH 3SWFA 3OA8A 3HTKB 4UB8H 2N9BA 2LIRA 2OZ1B 2K9JA 4AYCA 2WSCJ 1CRJA 2FRCA 1LTJC 2R5DA 1S6VB 3SWSA 1RQUA 2HLOA 4Y5RA 5APUA 3Q1MA 5C0ZA 1Z56A 1HJ4A 2C1DA 4NFGB 4PD4I 351CA 4RKUJ 3CX5E 1FZCA 4YXWH 3RBXA 2GC7D 3L72E 3L72G 1CHIA 1HVVA 1PP9G 1PP9E 3NXSA 3IFMA 2VHDA 1FDIA 5H2FV 1Y9BA 3H1KE 3H1KG 4BRYB 3EQ2A 1H1OA 3S4RA 4PD4D 2AXTH 2PRRA 1N86A 4UB6E 2E75B 1MG2D 1NMLA 4H0LD 2YKOA 1LJ2A 2HV4A 1YJNP 1N7SB 1T3JA 3Q5PA 4XYDB 2O01J 4OH8B 1WVEC 1YEBA 1W2EA 1BCCG 1BCCE 4Q5PA 4YPCA 4RESB 3F89A 1L9BC 3TF5A 2YCCA 3G71P 2FBWC 1XTCC 2KK7A 2JWAA 3EFGA 1Y47A 2R3CA 4DY9A 1GK4A 3OJAB 3HE4A 4MU8A 4WQDA 2B88A 1AQ5A 2P7JA 3B5NA 5AW8B 2J58A 3SLEA 1H33B 3WUUA 2Q9IA 5B5EV 1CSWA 1URQA 1CI6B 4GDOA 3PXWA 2DGEA 3AEFC 2YIUC 3E1RA 4K35A 2JO1A 4D6TE 4D6TG 1VQLP 2W8ZA 1PGQA 2WT7B 2B0ZB 3WFDC 2Q3IA 1H89A 2Y0CA 4H13B 5B66E 1CXAA 1H0TB 1JY2N 2KS1B 3SWYA 2XKMA 3CYTI 5AW4B 1VQMP 1KYOD 1AFOA 4N78D 4JQ0D 3QH9A 4L73A 1AV1A 1T8ZA 3OCDA 2E75C 2Z5HA 4DZOA 1Q81Q 2HODA 2PAJA 1YBKA 5K5GB 3KYQA 1N7SC 2IX7C 5CCHD 4K3IA 2IYPA 1I8PA 3L75D 4ZMDA 3C8VA 1JB0J 4U7JA 1OVVA 3V2QA 1DIIC 5H2FH 4KJMA 1SFCA 4PD4E 2B12B 1KB9H 3P8CD 3L4MA 5E79E 1S4XA 4AAMA 3B4SA 2IBZI 3VP9A 2RKLA 2BH5X 1PZQA 1IFPA 5KAIE 2QSIA 1LTBC 1K9MQ 1HZUA 1SQPK 4GOEA 1OFCX 4W7YA 3MIWA 1CIFA 1GU5A 1LGHB 3V2RA 2KUBA 3LIDA 3VMXA 1DVHA 4EDFA 1IRVA 3WUIA 2E75D 2OYHB 3L75J 1HGVA 2CXBA 5KJ7C 3VP8A 2IBZD 3GLMA 1USDA 1S5LX 1N7SD 4YXDC 2N18B 5BU5A 1JMMA 4L3HA 1FDOA 1A02J 3A3YB 1OZHA 2OYIC 1SQXJ 3S9OA 2ZT9B 3I55P 2YNYA 3QWOC 1GTWA 4EIJA 1L0LJ 2QJYC 3TNUB 3EWKA 3MHVA 3M9BA 4AX3A 4H13C 1T6AA 5AURA 1N90A 3SFDC 1JCDA 3G4SP 3GF7A 1KV4A 3CMAP 4FAVA 3B8EB 3SSUA 3HD7B 3JCUH 3AE5C 2ITAA 1E2RA 4W7ZA 1FBMA 5B5EH 3CCMP 1IQCA 5CMZA 4PW9B 3G3ZA 5KJ7D 1SLQA 2KSEA 1QN2A 2BGVX 2Q7CA 3HE5A 2B10B 1SQVK 2W6JH 5KLVK 5CYTR 2O1JA 1LT9B 3FXDA 1VF5C 4N78E 5KAFE 2VRSA 1GQ1A 3H32A 4WQBA 4L74A 1NOHA 4H13D 1KX2A 1HJ0A 4C7NA 2B87A 1CSXA 2FXPA 2GIWA 3Q5SA 3L75E 3L75G 1FJ0A 2KNCB 1NTMD 1TU3F 3O8ZA 2C9LY 5APWA 2CE1A 2HYNA 2OYHC 3LW5J 2QG4A 3P7KA 3VMZA 1SQXE 1SQXG 1VQ9P 3L71J 2N18C 1FJPA
chains in the Genus database with same CATH topology
4O1WA 451CA 3A0HV 3TDKA 1A8CA 1CIHA 3PRJA 3WU2V 1CO6A 2RMZA 1RZ6A 1DVVA 2JTIB 3WC8A 1C6RA 2FWLA 3CXHD 3O20A 3OA8B 2C1UA 1BCCD 1FI7A 2N9YB 1F1FA 2N3YA 2K9JB 1ETPA 4L3GA 1CIEA 1HRCA 1JDLA 1KYOW 4FA4A 4WQ9A 5B6QA 1DW1A 1GJQA 2ZONG 1HCMA 1YICA 3WFBC 1C6SA 5IY51 5TISV 1CHJA 2C1DB 2ZZS1 3BCCD 1HJ3A 1S5LV 2PCBB 2ORLA 3ZBMA 3VMAA 4WQEA 1KX7A 1HJ5A 4H0KA 2XTSB 3WFEC 1N9CA 4FA1A 1LFMA 1U74B 3A9FA 1H32B 2ZBOA 2GC4D 2GB8B 1FI3A 1AOQA 1N50A 2BPBB 1CNOA 2N9IA 2C2CA 1C52A 2B11B 1M6ZA 4H0JA 3TGUD 2RN0A 2CA4B 5B66V 1LC1A 3PLNA 4GYDA 4D6TD 1CYIA 1AKKA 3RLMA 3ORVA 4L1QA 2D0WA 1ZRTD 4AANA 1CSVA 2QJYB 4PJ0V 3OA8A 4A7PA 4IL6V 4EIDA 2LIRA 2OZ1B 3SVWA 1CRJA 3ZOOA 2FRCA 5DJQB 1CSUA 1SQPD 1S6VB 3SWSA 1MG3D 4Y5RA 1GKSA 4N0KA 5C0ZA 2CA3B 1HJ4A 1CCRA 1AOFA 1I6DA 2C1DA 4NFGB 351CA 4PWAA 1SQQD 1EZVD 1SQBD 2FYNB 1CCHA 5DFSA 1CEDA 2O3JA 2GC7D 1CHIA 3ZIYA 2Y0DA 2VHDA 5H2FV 1L9JC 4KMGA 3PH2B 2AIUA 2L91A 3CP5A 1A56A 2QJKB 5TJHA 5E79V 1H1OA 1N15A 2ZXYA 4PD4D 5KAIV 1H32A 1IRWA 3DMIA 5KKZB 2D0SA 1CC5A 1QYZA 1MG2D 1NMLA 1I8OA 4XXLA 4EIEA 3O0RC 1KB9D 2HV4A 3L73D 1CXCA 1HROA 3KZIV 1SQXD 2FYUD 3RN0A 1I55A 3VYMA 4XYDB 1L0LD 2PCCB 5DF5A 1WVEC 1K3GA 5EXQA 1DW0A 1YFCA 2MHMA 1YEBA 1AYGA 1RAPA 3L74D 3ZOYA 1NMIA 2OZ1A 4Q5PA 4O1QA 3NBSA 3GW6A 4JCGA 3SXTA 3ZOXA 1L9BC 3TF5A 2Y0EA 2YCCA 1HZVA 3OCDB 3TYIA 1R0QA 3CX5W 2JWAA 1SQVD 5KLVD 1FI9A 4DY9A 5CIGB 1NNOA 1KIBA 1EB7A 4MU8A 3L70D 4WQAA 1E29A 2N3BA 4WQDA 3HQ8A 3O1YA 3SLEA 3A0BV 1H33B 1I54A 5B5EV 1CSWA 3PTZA 1H9XA 3PXWA 2DGEA 1W2LA 5GTIV 1RZ5A 3PHLA 1J3SA 2B4ZA 1BL9A 1QKSA 3VRDA 2LITA 4LJIA 155CA 1H31B 1LMSA 5CIHB 1OCDA 1VYDA 3CXHW 2B0ZB 1CTJA 3WFDC 1KV9A 2Y0CA 1CXAA 1YCCA 5KAFV 2YQBA 2PACA 4J20A 1NTKD 1IO3A 2BLFB 4FANA 3CYTI 1I6EA 1BGYD 1KYOD 1A2SA 3PXSA 4AAOA 3L71D 3X39A 1KB0A 1OAEA 3OCDA 2DVHA 1CRGA 4FA5A 1W5CT 3ZCFA 1GDVA 4K3IA 3O5CA 3VNWA 1I8PA 3L75D 2N9JA 3H1HD 1M60A 1NTZD 3HQ9A 1DIIC 4WQ8A 2JQRA 1H33A 1DIQC 1NIRA 2B12B 1DT1A 1QL3A 3PXTA 3L4MA 3RMZA 2BCCD 4AAMA 3C2CA 2A06D 4GEDB 1U75B 1PPJD 2BH5X 4YE1A 1C6OA 1CHHA 5C9MA 1H31A 1MZ4A 1HZUA 1GU2A 1H9YA 4EIFA 2ZOOA 2C1VA 1CIFA 4FA9A 1C2NA 2MTAC 3MK7B 1QL4A 1DVHA 4EDFA 1IRVA 3WUIA 2KS1A 5CIDB 2CXBA 2IBZD 1FCDC 1CRHA 1YIQA 2C8SA 4P4QB 2N18B 4EICA 4L3HA 1RAQA 3ITKA 2V08A 2EXVA 1C2RA 5GTHV 2AI5A 3H1JD 1LC2A 3RN1A 2QJPB 1LS9A 1L0ND 4AX3A 5DJQC 1FOCA 5AURA 1N90A 1YEAA 3KHUA 1P84D 4FAVA 3CWBD 4RSZA 1YTCA 5CIBB 1BE3D 1K3HA 1CYCA 1CORA 1NU1D 1E2RA 3HQ6A 3FWLA 3H1LD 1C75A 1HH7A 5CICB 1IQCA 1YNRA 4QAOA 2BCNB 1WEJF 1E8EA 4PW9B 2L4DA 4UB8V 1CYJA 1GIWA 2BH4X 3NWVA 1QN2A 2BGVX 2V07A 1CRYA 1C7MA 5KLIB 2B10B 4FB1A 5CYTR 1CRCA 1COTA 4V2KA 4RJTA 2Q3EA 5CIFB 1GQ1A 1CRIA 1B7VA 4WQ7A 1CTZA 4WQBA 3M97X 1DW3A 1I5TA 3GG2A 3CX5D 3H1ID 3HQ7A 2YIUB 1KX2A 3DR0A 3L72D 4AALA 4WQCA 3ZOWA 1CSXA 1PP9D 1DW2A 2GIWA 2YK3A 1FJ0A 1ZZHA 4UB6V 2KNCB 2AXTV 1IZL0 1M70A 1NTMD 3H1KD 3MK7C 3CU4A 3DP5A 3NBTA 3WFCC 5CIEB 1CIGA 2I8FA 2CE1A 2C9XB 1FHBA 1CTYA 4U3FD 2QG4A 2CE0A 3JBTB 3L4OA 1F1CA 3SJLA 2N18C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1W A;  451C A;  3A0H V;  3TDK A;  1A8C A;  1CIH A;  3PRJ A;  3WU2 V;  1CO6 A;  2RMZ A;  1RZ6 A;  1DVV A;  2JTI B;  3WC8 A;  1C6R A;  2FWL A;  3CXH D;  3O20 A;  3OA8 B;  2C1U A;  1BCC D;  1FI7 A;  2N9Y B;  1F1F A;  2N3Y A;  2K9J B;  1ETP A;  4L3G A;  1CIE A;  1HRC A;  1JDL A;  1KYO W;  4FA4 A;  4WQ9 A;  5B6Q A;  1DW1 A;  1GJQ A;  2ZON G;  1HCM A;  1YIC A;  3WFB C;  1C6S A;  5IY5 1;  5TIS V;  1CHJ A;  2C1D B;  2ZZS 1;  3BCC D;  1HJ3 A;  1S5L V;  2PCB B;  2ORL A;  3ZBM A;  3VMA A;  4WQE A;  1KX7 A;  1HJ5 A;  4H0K A;  2XTS B;  3WFE C;  1N9C A;  4FA1 A;  1LFM A;  1U74 B;  3A9F A;  1H32 B;  2ZBO A;  2GC4 D;  2GB8 B;  1FI3 A;  1AOQ A;  1N50 A;  2BPB B;  1CNO A;  2N9I A;  2C2C A;  1C52 A;  2B11 B;  1M6Z A;  4H0J A;  3TGU D;  2RN0 A;  2CA4 B;  5B66 V;  1LC1 A;  3PLN A;  4GYD A;  4D6T D;  1CYI A;  1AKK A;  3RLM A;  3ORV A;  4L1Q A;  2D0W A;  1ZRT D;  4AAN A;  1CSV A;  2QJY B;  4PJ0 V;  3OA8 A;  4A7P A;  4IL6 V;  4EID A;  2LIR A;  2OZ1 B;  3SVW A;  1CRJ A;  3ZOO A;  2FRC A;  5DJQ B;  1CSU A;  1SQP D;  1S6V B;  3SWS A;  1MG3 D;  4Y5R A;  1GKS A;  4N0K A;  5C0Z A;  2CA3 B;  1HJ4 A;  1CCR A;  1AOF A;  1I6D A;  2C1D A;  4NFG B;  351C A;  4PWA A;  1SQQ D;  1EZV D;  1SQB D;  2FYN B;  1CCH A;  5DFS A;  1CED A;  2O3J A;  2GC7 D;  1CHI A;  3ZIY A;  2Y0D A;  2VHD A;  5H2F V;  1L9J C;  4KMG A;  3PH2 B;  2AIU A;  2L91 A;  3CP5 A;  1A56 A;  2QJK B;  5TJH A;  5E79 V;  1H1O A;  1N15 A;  2ZXY A;  4PD4 D;  5KAI V;  1H32 A;  1IRW A;  3DMI A;  5KKZ B;  2D0S A;  1CC5 A;  1QYZ A;  1MG2 D;  1NML A;  1I8O A;  4XXL A;  4EIE A;  3O0R C;  1KB9 D;  2HV4 A;  3L73 D;  1CXC A;  1HRO A;  3KZI V;  1SQX D;  2FYU D;  3RN0 A;  1I55 A;  3VYM A;  4XYD B;  1L0L D;  2PCC B;  5DF5 A;  1WVE C;  1K3G A;  5EXQ A;  1DW0 A;  1YFC A;  2MHM A;  1YEB A;  1AYG A;  1RAP A;  3L74 D;  3ZOY A;  1NMI A;  2OZ1 A;  4Q5P A;  4O1Q A;  3NBS A;  3GW6 A;  4JCG A;  3SXT A;  3ZOX A;  1L9B C;  3TF5 A;  2Y0E A;  2YCC A;  1HZV A;  3OCD B;  3TYI A;  1R0Q A;  3CX5 W;  2JWA A;  1SQV D;  5KLV D;  1FI9 A;  4DY9 A;  5CIG B;  1NNO A;  1KIB A;  1EB7 A;  4MU8 A;  3L70 D;  4WQA A;  1E29 A;  2N3B A;  4WQD A;  3HQ8 A;  3O1Y A;  3SLE A;  3A0B V;  1H33 B;  1I54 A;  5B5E V;  1CSW A;  3PTZ A;  1H9X A;  3PXW A;  2DGE A;  1W2L A;  5GTI V;  1RZ5 A;  3PHL A;  1J3S A;  2B4Z A;  1BL9 A;  1QKS A;  3VRD A;  2LIT A;  4LJI A;  155C A;  1H31 B;  1LMS A;  5CIH B;  1OCD A;  1VYD A;  3CXH W;  2B0Z B;  1CTJ A;  3WFD C;  1KV9 A;  2Y0C A;  1CXA A;  1YCC A;  5KAF V;  2YQB A;  2PAC A;  4J20 A;  1NTK D;  1IO3 A;  2BLF B;  4FAN A;  3CYT I;  1I6E A;  1BGY D;  1KYO D;  1A2S A;  3PXS A;  4AAO A;  3L71 D;  3X39 A;  1KB0 A;  1OAE A;  3OCD A;  2DVH A;  1CRG A;  4FA5 A;  1W5C T;  3ZCF A;  1GDV A;  4K3I A;  3O5C A;  3VNW A;  1I8P A;  3L75 D;  2N9J A;  3H1H D;  1M60 A;  1NTZ D;  3HQ9 A;  1DII C;  4WQ8 A;  2JQR A;  1H33 A;  1DIQ C;  1NIR A;  2B12 B;  1DT1 A;  1QL3 A;  3PXT A;  3L4M A;  3RMZ A;  2BCC D;  4AAM A;  3C2C A;  2A06 D;  4GED B;  1U75 B;  1PPJ D;  2BH5 X;  4YE1 A;  1C6O A;  1CHH A;  5C9M A;  1H31 A;  1MZ4 A;  1HZU A;  1GU2 A;  1H9Y A;  4EIF A;  2ZOO A;  2C1V A;  1CIF A;  4FA9 A;  1C2N A;  2MTA C;  3MK7 B;  1QL4 A;  1DVH A;  4EDF A;  1IRV A;  3WUI A;  2KS1 A;  5CID B;  2CXB A;  2IBZ D;  1FCD C;  1CRH A;  1YIQ A;  2C8S A;  4P4Q B;  2N18 B;  4EIC A;  4L3H A;  1RAQ A;  3ITK A;  2V08 A;  2EXV A;  1C2R A;  5GTH V;  2AI5 A;  3H1J D;  1LC2 A;  3RN1 A;  2QJP B;  1LS9 A;  1L0N D;  4AX3 A;  5DJQ C;  1FOC A;  5AUR A;  1N90 A;  1YEA A;  3KHU A;  1P84 D;  4FAV A;  3CWB D;  4RSZ A;  1YTC A;  5CIB B;  1BE3 D;  1K3H A;  1CYC A;  1COR A;  1NU1 D;  1E2R A;  3HQ6 A;  3FWL A;  3H1L D;  1C75 A;  1HH7 A;  5CIC B;  1IQC A;  1YNR A;  4QAO A;  2BCN B;  1WEJ F;  1E8E A;  4PW9 B;  2L4D A;  4UB8 V;  1CYJ A;  1GIW A;  2BH4 X;  3NWV A;  1QN2 A;  2BGV X;  2V07 A;  1CRY A;  1C7M A;  5KLI B;  2B10 B;  4FB1 A;  5CYT R;  1CRC A;  1COT A;  4V2K A;  4RJT A;  2Q3E A;  5CIF B;  1GQ1 A;  1CRI A;  1B7V A;  4WQ7 A;  1CTZ A;  4WQB A;  3M97 X;  1DW3 A;  1I5T A;  3GG2 A;  3CX5 D;  3H1I D;  3HQ7 A;  2YIU B;  1KX2 A;  3DR0 A;  3L72 D;  4AAL A;  4WQC A;  3ZOW A;  1CSX A;  1PP9 D;  1DW2 A;  2GIW A;  2YK3 A;  1FJ0 A;  1ZZH A;  4UB6 V;  2KNC B;  2AXT V;  1IZL 0;  1M70 A;  1NTM D;  3H1K D;  3MK7 C;  3CU4 A;  3DP5 A;  3NBT A;  3WFC C;  5CIE B;  1CIG A;  2I8F A;  2CE1 A;  2C9X B;  1FHB A;  1CTY A;  4U3F D;  2QG4 A;  2CE0 A;  3JBT B;  3L4O A;  1F1C A;  3SJL A;  2N18 C; 
#chains in the Genus database with same CATH topology
 3VMY A;  1L0L E;  1L0L G;  1SS1 A;  3TDK A;  2AXT E;  2OTK E;  1NTK K;  1EXI A;  3WU2 V;  1CO6 A;  1KOR A;  1DVV A;  1X0T A;  1VQN P;  1JCC A;  1C6R A;  1WRG A;  3O20 A;  1VF5 D;  2GM4 A;  1FI7 A;  2HPC A;  3KQG A;  2N3Y A;  4L3G A;  1HRC A;  4FA4 A;  3AE8 C;  5CCH A;  4WQ9 A;  2IBZ E;  2IBZ G;  1IFM A;  1GJQ A;  1HCM A;  3HD7 C;  3MUD A;  1LTI C;  1GL2 B;  3I5C A;  4N6J A;  3CCL P;  2W83 C;  5APX A;  1S5L V;  2ZXX A;  2PCB B;  3CLQ A;  5AW5 B;  2W90 A;  3ZBM A;  1HJ5 A;  3NMD A;  2IFM A;  5GTH E;  3WFE C;  3RK2 C;  1N9C A;  4B86 A;  1VQ4 P;  2KP8 A;  3V4Q A;  3M0D A;  2WMM A;  1U74 B;  4WBA A;  3JSV C;  2ZBO A;  1AOQ A;  4BRY A;  2BPB B;  1LT9 C;  1SP4 A;  1M6Z A;  3TGU D;  1QL1 A;  3ZDM A;  2Y9Y A;  1KQF B;  2WWW A;  1RE3 C;  1VL2 A;  1K73 Q;  1AKK A;  1N7S A;  3CX5 I;  1ZRT D;  3A7O A;  3CCE P;  5AW7 B;  2KI7 B;  3SWK A;  1FOS E;  2JP3 A;  1EZV I;  3Q2Y A;  3CCS P;  1NGM B;  1KFN A;  3ZOO A;  2ZYA A;  1CSU A;  4Y99 B;  3VYI A;  4NPE A;  2KIK A;  1N73 B;  1GKS A;  2CA3 B;  1NU1 J;  1CCR A;  4HKZ H;  3D6Z A;  2N1T C;  1A02 F;  1SQQ D;  1EZV D;  1FAV A;  1S72 P;  2FYN B;  3RK2 D;  3HUS B;  2O3J A;  3TGU J;  1OW8 A;  2XV5 A;  1JUN A;  4WB4 A;  3GHG A;  4KMG A;  2L91 A;  2I1J A;  5BU8 B;  4OVN F;  3IN6 A;  1NTM G;  1NTM E;  2Q5U A;  2QJK B;  5DJT B;  2OAR A;  2AEM A;  1VDF A;  2ZAE B;  1EXJ A;  3O6Q A;  1H32 A;  1IRW A;  5KKZ B;  5KJ7 A;  1CC5 A;  3RK3 B;  1X79 B;  2QA4 P;  3L73 D;  3KZI V;  1T3U A;  2FYU D;  3VTP C;  1GL2 C;  3VYM A;  2I1K A;  2OYI A;  5AW3 B;  5AW6 B;  5CJ4 A;  5AVV B;  2WSF J;  1SQQ J;  3A0H E;  1IFJ A;  2WPV B;  3WU2 H;  1QEX A;  2KXP B;  1HWT C;  1LT1 A;  3L74 D;  1NMI A;  4TT3 H;  1YJW P;  4Z1M H;  3NBS A;  4MN4 C;  4JCG A;  3SXT A;  3ZOX A;  2N1T D;  3V2P A;  4ZNC A;  1UIX A;  3MP7 B;  1AJY A;  2YMK A;  3ABV C;  1NYH A;  2W6A A;  3CX5 W;  1DEE G;  4JYC A;  3L73 J;  1JO5 A;  2DW3 A;  5CIG B;  2AXC A;  1DX7 A;  5TIS E;  2XDJ A;  1S5L H;  1P84 H;  4WQA A;  1FZG A;  4BXL A;  1M1J B;  1NU1 G;  1NU1 E;  3A0B V;  2NPS B;  2V7Q H;  1GL2 D;  4Y99 C;  3L74 J;  1FOS F;  3PTZ A;  1H9X A;  1N73 C;  2C9N Y;  5GTI V;  2QM8 A;  2R32 A;  1BL9 A;  3TGU G;  4H44 B;  2WPR A;  3TGU E;  2LIT A;  4LJI A;  2YXQ B;  2MJZ A;  2LXC B;  2FYN C;  1QLE D;  1CTJ A;  4PV1 D;  1ZRT E;  3WUT A;  1EDL A;  2WIT A;  3CCU P;  2BLF B;  2FFD C;  2QJK C;  1I6E A;  1BGY D;  3U1A A;  1M90 Q;  4PJ0 E;  2UWJ E;  2P2U A;  1FZA A;  4IL6 E;  1W5C E;  5KKZ C;  2ZYG A;  3RK3 C;  4L76 A;  2RH0 A;  2BAS A;  2DVH A;  1SQQ G;  1EZV E;  4FA5 A;  1EZV G;  1SQQ E;  1W5C T;  4D6T J;  2IZ1 A;  1EDJ A;  3PP5 A;  1BSH A;  1E79 H;  2L5G B;  2PGD A;  1R5S A;  2N9J A;  2HFE D;  1PFI A;  2FY8 A;  3MD0 A;  1G2C B;  2JQR A;  1VPC A;  4AQR D;  3CCJ P;  2NZ2 A;  4IFD K;  1M56 D;  1NIR A;  1HGZ A;  1JY3 O;  3BRT B;  1RH5 B;  2H43 A;  1DT1 A;  3M9Q A;  1VQ7 P;  3L73 E;  3L73 G;  2A06 D;  4GED B;  1U75 B;  3CXH H;  2V4H A;  3M0A A;  2FYU E;  2FYU G;  4W80 A;  2M5A B;  4JPZ B;  1H31 A;  1MZ4 A;  3KZI H;  5CHX A;  4FA9 A;  1RF1 B;  3FGA D;  3BRV B;  3CC7 P;  3RK3 D;  3E7K A;  5CID B;  3L74 E;  3L74 G;  1KFM A;  1M1J C;  1IFN A;  1R8E A;  2NPS C;  2A45 G;  1OW7 A;  1KQL A;  2JWD A;  1N7L A;  2KOG A;  1CSB A;  2V08 A;  2GUS A;  5CJ0 A;  3UIA A;  1RE3 A;  2IFN A;  1LC2 A;  2YXR B;  4OGQ B;  1L0N D;  2OGU A;  3GF3 A;  1P84 D;  1YTC A;  5CIB B;  1K3H A;  3FX0 A;  1CYC A;  1COR A;  1EQ7 A;  1KYO I;  1HJB A;  3A0B H;  5APS A;  1JNM A;  1C75 A;  5CIC B;  5GTI H;  1LP1 B;  1YNR A;  4XE5 B;  2N1T A;  1E8E A;  1GIW A;  1LWU A;  2NPS D;  2LXB A;  1IJD B;  3P32 A;  2ZJS E;  3LW5 H;  1JTH A;  5CBO A;  1CW5 A;  1NAY A;  2OTL P;  4IFF A;  4V2K A;  1X9V A;  1VQ6 P;  2R44 A;  5CIF B;  4I6M C;  3V6I A;  2AEF A;  5AVR B;  3H1I D;  3MZW B;  4HJG H;  3DR0 A;  2IZ0 A;  5CCG C;  4I1L A;  1GMJ A;  3AED C;  1ZZH A;  2CPB A;  4UB6 V;  4ASV A;  3DP5 A;  3AEA C;  1RF1 C;  5CIE B;  4OWF A;  1CIG A;  3S1K A;  1FHB A;  2CE0 A;  3P8M C;  3BAS A;  3JBT B;  2WPQ A;  1F1C A;  3SJL A;  2QE7 H;  2Q6Q A;  451C A;  2A06 G;  2A06 E;  2CK3 H;  3VOP A;  3LIE A;  2WSE H;  1CIH A;  2IPP A;  1JOC A;  2BEZ F;  2RMZ A;  5AVT B;  1RZ6 A;  1FZB A;  1YQ4 C;  3CXH D;  2FWL A;  2H88 C;  3OW2 O;  3OA8 B;  2N9Y B;  3BVH A;  2K9J B;  1JDL A;  1KYO W;  3K5B A;  5B6Q A;  2ZON G;  1YIC A;  2M8R A;  1MKM A;  2ZFC A;  5IY5 1;  1LTS C;  3E1I A;  1N73 A;  2SPZ A;  2C1D B;  1RE4 A;  1KC8 Q;  4ZKU A;  2IYO A;  3BCC D;  1FZC B;  1IO4 A;  2KSJ A;  5AVW B;  2E42 A;  2E5Y A;  3AEG C;  3VMA A;  3IF4 A;  3TK1 A;  4WQE A;  1SQX K;  1KX7 A;  3AEE C;  4H0K A;  3KDP B;  2XTS B;  1L0N G;  1L0N E;  2LR2 A;  1L0L K;  1LTJ A;  3RL0 B;  2C0W A;  2OQQ A;  5AW2 B;  1NKN A;  2WTY A;  1P84 E;  2FFD A;  2QIW A;  2GC4 D;  2GB8 B;  1FI3 A;  2N9I A;  3T97 A;  4H0J A;  3C1L A;  2CA4 B;  3RBZ A;  5B66 V;  4ZKP A;  2JJL A;  1LC1 A;  2KLU A;  4GYD A;  1CYI A;  3RLM A;  3ORV A;  4L1Q A;  4JF7 A;  1NHL A;  3BCC J;  2YO2 A;  1YIJ P;  3RL0 g;  4A7P A;  3CI9 A;  4EID A;  1KYO E;  3AE4 C;  5DJQ B;  4TLF A;  4UB8 E;  4N0K A;  1DD3 A;  4I7Z B;  1USE A;  1J1E B;  3WUV A;  3CC2 P;  3CX5 H;  1I6D A;  2E76 B;  2JDI H;  4JYB A;  1YHQ P;  3IAO A;  1SQB D;  1CCH A;  3H1I E;  1CED A;  3G6E P;  4GT1 A;  3ZIY A;  2P1J A;  2Y0D A;  3HE4 B;  3CD6 P;  2H7H A;  1NAF A;  3TYY A;  3CCQ P;  5E79 V;  3B71 A;  1CZQ A;  1N15 A;  3P8C E;  4UB6 H;  5KAI V;  2D0S A;  1KMI Z;  1N2D C;  2HR3 A;  1URQ B;  1ZW0 A;  5AVU B;  1I8O A;  3O0R C;  4O9B A;  1KB9 D;  2ZT9 C;  2O01 N;  3RN0 A;  1I55 A;  2WPS A;  1GU4 A;  1FZC C;  2D2C B;  5DF5 A;  5EXQ A;  2MHM A;  3CXH E;  3Q3D A;  3HTK A;  1AYG A;  1NTM J;  2OZ1 A;  3RL0 C;  3GW6 A;  2M3E A;  2OTJ P;  2Y0E A;  2Z5I A;  1HZV A;  2O1K A;  3OCD B;  3TYI A;  2HOD B;  1NTM K;  2PFX A;  1NH4 A;  1FI9 A;  3BCC G;  3BCC E;  2WSC H;  1NNO A;  1KIB A;  3L70 D;  1E29 A;  1OW6 A;  3A2A A;  3HQ8 A;  1AVY A;  1JY2 O;  2JR8 A;  1E5W A;  3O1Y A;  2ZT9 D;  4K3A A;  3EFF K;  1Y8A A;  1H8A A;  1OX3 A;  5APV A;  1PIX A;  3AE7 C;  3PHL A;  1IK9 A;  4I7Z C;  1J3S A;  2B4Z A;  4BWN A;  1QKS A;  2WZ7 A;  1J1E C;  3VRD A;  155C A;  2E76 C;  5B66 H;  3HD7 D;  1YI2 P;  5KAF V;  4GOF A;  5AVZ B;  1IO3 A;  3L70 J;  1NVO A;  1RF1 A;  1VQP P;  1A2S A;  3M91 A;  3A5T A;  2O01 H;  4AAO A;  2W27 A;  2OYO A;  1URQ C;  1S9K D;  1YQ3 C;  1LTA C;  2G3A A;  1CRG A;  1S2E A;  1RF0 C;  5APQ A;  1SQB E;  1SQB G;  1NU1 K;  4Y28 J;  1GDV A;  1J1D B;  1BDC A;  2D2C C;  3O5C A;  3VNW A;  4H0L B;  1K05 A;  1JMB A;  4C46 A;  1KTM A;  2K1A A;  3H1H D;  2P58 A;  1M60 A;  3N7N A;  1NTZ D;  4PD4 H;  2AEJ A;  3C9I A;  2E5T A;  1H33 A;  1PGP A;  1MFT A;  5H2F E;  1KIL B;  3I56 P;  5E79 H;  5AVQ B;  4DOJ A;  1CI6 A;  4XFJ A;  1QL3 A;  2ZVN B;  5KAI H;  2BCC D;  2A45 I;  1KB9 E;  3C2C A;  1PPJ D;  3L4F A;  4YE1 A;  1C6O A;  5C9M A;  2NRG A;  5AVS B;  1GU2 A;  2WT7 A;  1QVF O;  4EIF A;  2ZOO A;  2C1V A;  1LP1 A;  2MTA C;  1IFI A;  1QL4 A;  1H0T A;  2KS1 A;  2KYV A;  3HE5 B;  1VQO P;  2B9B A;  1SQQ K;  3H1H J;  1YIQ A;  1EC5 A;  2C8S A;  4P4Q B;  1NTZ J;  3H6P A;  1S1C X;  1RAQ A;  1ZN5 A;  3H32 B;  1KQS O;  3AE1 C;  4CPG A;  2D2C D;  3CC4 P;  2EXV A;  2YO3 A;  1ZXG A;  2FYU J;  1C2R A;  5GTH V;  1K8A Q;  2BCC J;  4C7N B;  2QRX A;  3H1J D;  2B87 B;  5EFW B;  1DD4 A;  5M1B A;  1Q2N A;  2QJP B;  3D70 A;  1NO4 A;  2MKV A;  1WMK A;  3L70 G;  3L70 E;  3D71 A;  1FOC A;  2FYU K;  4C7R A;  1YEA A;  3KHU A;  3HRN A;  1L4A B;  3U59 A;  3JCU E;  3FWL A;  3H1L D;  1H88 A;  4IL6 X;  3HUS C;  1MUU A;  3W67 A;  5B5E E;  4QAO A;  3CPW O;  3V2N A;  1ZR2 A;  1WEJ F;  2FXO A;  2BH4 X;  1J1D C;  1HTL C;  4QMA A;  4H0L C;  3H1J J;  2V07 A;  2HPC B;  1CRY A;  4FB1 A;  2OYH A;  5KAF H;  1COT A;  4RJT A;  1KIL C;  1RQV A;  1CTZ A;  1S9K E;  5APY A;  3M97 X;  1I5T A;  2W6B A;  2R5B A;  3GG2 A;  4LGD E;  3HQ7 A;  2YIU B;  3H1L J;  4WQC A;  3ZOW A;  1DW2 A;  3OA7 A;  3GMA A;  3TNU A;  1VQ8 P;  3H1H G;  3H1H E;  1M70 A;  3CU4 A;  3NBT A;  1NTZ G;  1NTZ E;  1YTZ I;  2C9X B;  1N8R Q;  1CTY A;  1BGY J;  4U3F D;  3HD7 A;  3MTU E;  2H89 C;  1Q90 D;  3F5H A;  1GW4 A;  4O1W A;  2BCC G;  2BCC E;  3A0H V;  1A8C A;  3R2P A;  1PPJ G;  1PPJ E;  1G1J A;  5BVZ A;  3PRJ A;  1ZV8 A;  5AW1 B;  1IZN B;  3SFE C;  2JTI B;  1SVF A;  3WMM 0;  2C1U A;  2QJP C;  1KIL D;  2WSS H;  1KN7 A;  4HYT B;  1DW1 A;  5C39 A;  1LT9 A;  1NJI Q;  4RO0 A;  1P84 I;  1L4A C;  4H44 C;  1HH0 A;  1PGJ A;  4U3F J;  5TIS V;  1CHJ A;  1KZU B;  2POH A;  2FXM A;  2ZZS 1;  1HJ3 A;  1W2B O;  1PL5 A;  3CCR P;  3H1J E;  3H1J G;  5GTH H;  3GHG B;  1IFD A;  2XZR A;  1FS0 E;  2KNC A;  3PJS K;  2K88 A;  4KT0 J;  3KXD A;  1LFM A;  3FXE A;  3A9F A;  3O6Q B;  1H32 B;  1S3J A;  5CCH C;  2KLV A;  1N50 A;  1CNO A;  3BAT A;  2C2C A;  2B11 B;  3MUD C;  1BDD A;  3H1L G;  3H1L E;  1YYC A;  3PLN A;  2OYI B;  1IC2 A;  1RY3 A;  1RF0 A;  4HH2 A;  4WY4 B;  1EDI A;  4AAN A;  2QJY B;  4PJ0 V;  4N3Y B;  1J2J B;  1L0N J;  4IL6 V;  1OIP A;  1BGY E;  1BGY G;  1L4A D;  4GKG A;  4H44 D;  3SVW A;  3CCV P;  1JY3 P;  3FWN A;  1SQP D;  3M0D C;  1MG3 D;  1OVR A;  1AOF A;  2PP6 A;  2QVA A;  1L0N K;  1GL2 A;  2V7Q J;  4PWA A;  2E43 A;  4ASW A;  5DFS A;  5AW9 B;  1GK6 A;  2FYZ A;  2I8D A;  4IOI H;  4I2L C;  3VN0 A;  3U1C A;  1L9J C;  3PH2 B;  2AIU A;  3CP5 A;  3CXH I;  1A56 A;  2YKP A;  3R4Y A;  3D0W A;  5TJH A;  5DJU B;  1KD1 Q;  2ZXY A;  2KB7 P;  3DMI A;  4U3F E;  4U3F G;  1FZF A;  1QYZ A;  3Q5R A;  4EIE A;  1SQP J;  4XXL A;  1VF5 B;  1MV8 A;  1CXC A;  1HRO A;  1SQX D;  2M3B A;  3V5B A;  4R4L A;  1GD2 E;  3H1I J;  1L0L D;  2P67 A;  5APT A;  3A0H H;  3IR9 A;  4OGQ C;  2PCC B;  1K3G A;  1DW0 A;  1YFC A;  3RK3 E;  1LTG C;  3L37 A;  1LTT C;  1K04 A;  3GHG C;  4AUW A;  1GW3 A;  1RAP A;  2JEE A;  3ZOY A;  1KIL E;  2BEQ D;  2Q1K A;  1FC2 C;  3WU2 E;  2QM7 A;  1YTZ T;  4O1Q A;  5AVY B;  1Q82 Q;  3TSI A;  5CCG D;  2K9Y A;  2JKV A;  2ZYD A;  2QEX P;  4EI2 A;  1R0Q A;  3AEB C;  1SQV D;  3AE3 C;  5KLV D;  1MZ9 A;  1YIT P;  1JEK A;  5TIS H;  3HUS A;  3V4W A;  1G1I A;  3D6Y A;  1EB7 A;  4WY4 C;  2N3B A;  1OXZ A;  1ZP0 C;  2B89 A;  1S5L E;  1LNQ A;  1I54 A;  1UII A;  3NTN A;  1QGK B;  2FKW B;  4OGQ D;  4GIF A;  1W2L A;  1RZ5 A;  1KIL A;  4XA4 A;  4IFM A;  2XNX A;  4EYY Q;  1FE6 A;  1H31 B;  1LMS A;  5CIH B;  1OCD A;  1VYD A;  3CXH W;  1SQV J;  3CME P;  1KV9 A;  5KLV J;  1YCC A;  3MGN A;  2YQB A;  2PAC A;  4J20 A;  1NTK D;  4PJ0 H;  1PGO A;  3RK2 B;  4FAN A;  1SQP E;  1SQP G;  4IL6 H;  2K37 A;  4DJG A;  1DEB A;  1VQ5 P;  1JM0 A;  1OWA A;  1QVG O;  3PXS A;  3L71 D;  3X39 A;  1KB0 A;  1OAE A;  2WSF H;  2J5U A;  1QX8 A;  3H1I G;  2GUV A;  4WY4 D;  2KZJ A;  1M7L A;  1KB9 I;  1QL2 A;  3ZCF A;  1HBW A;  1DIP A;  1GZL A;  3B5N B;  2G8Y A;  1M57 D;  4YTP C;  3HQ9 A;  2WVR A;  4WQ8 A;  3USS A;  4GOD A;  1M1J A;  1R5L A;  1DIQ C;  2NPS A;  4M3L A;  1NTK J;  3PXT A;  3RMZ A;  1NKZ B;  1L4A A;  1BSN A;  1MFZ A;  1CHH A;  1SQB J;  2ZVO B;  2C0X A;  2N1T B;  1H9Y A;  1C2N A;  3KZI E;  1LWU B;  2XU6 A;  3MK7 B;  1ZOY C;  5KTB A;  4NPD A;  1FDM A;  1JTH B;  1JY3 N;  1SQB K;  1FCD C;  3G9R A;  1CRH A;  2A45 H;  4LC1 A;  3H25 A;  4EIC A;  3ITK A;  3M06 A;  4WWI A;  3JC2 2;  1SQV G;  1SQV E;  1XTG B;  5KLV E;  5KLV G;  3W68 A;  2AI5 A;  5CBN A;  3RN1 A;  1LS9 A;  2P10 A;  1SFC B;  2WSE J;  1X22 A;  2E74 B;  5DJQ C;  4NPF X;  1G2C A;  1M8O B;  2R3S A;  3CWB D;  4RSZ A;  1AA0 A;  1FU1 A;  4JBZ A;  1BE3 D;  4PV1 B;  1RHZ B;  1NU1 D;  1FZE A;  3CL3 D;  3HQ6 A;  1NWQ A;  4KHX A;  3AE2 C;  1Q86 Q;  3A0B E;  3RL0 D;  1HH7 A;  2M5A A;  2BCN B;  5CCG A;  5GTI E;  2L4D A;  4UB8 V;  1CYJ A;  3AE9 C;  2GA1 A;  3NWV A;  4WVZ A;  3B5N C;  4EOT A;  3OAK A;  1C7M A;  5KLI B;  3AEC C;  1NTK E;  1NTK G;  1CRC A;  3L35 A;  1WT6 A;  3M9H A;  1GDT A;  2KZI A;  2Q3E A;  2LKM A;  3L71 E;  3L71 G;  1CRI A;  1B7V A;  4WQ7 A;  3CWB J;  1DW3 A;  1BE3 J;  3CX5 D;  2K3R A;  1L2P A;  1HUC A;  2WQY C;  2YKQ A;  3L72 D;  4AAL A;  1PP9 D;  3N4X A;  1KQG B;  1ZR4 A;  2YK3 A;  1LWU C;  2AXT V;  1IZL 0;  3H1K D;  3MK7 C;  1LTJ B;  1OMI A;  2E76 D;  3WFC C;  2I8F A;  2M0B A;  4HB1 A;  2FFD B;  3L4O A;  1U7J A;  3T97 B;  1EDK A;  1T2K C;  4LLH A;  2XND H;  3KPE A;  2CPS A;  1VQK P;  3B5N D;  1YJ9 P;  3WC8 A;  1URQ D;  1FJK A;  5AW0 B;  1JY2 P;  1AQT A;  1BCC D;  3L72 J;  4WY4 A;  1SFC C;  1PP9 J;  1F1F A;  3PH0 A;  4DT0 A;  1ETP A;  2E74 C;  1CIE A;  1PV3 A;  3H1K J;  1ZLL A;  3L36 A;  2ZXE B;  3WFB C;  1C6S A;  3II6 A;  4PV1 C;  1NTZ K;  1AVO A;  4R4M A;  1HF9 A;  2ORL A;  3NFQ A;  3RGU A;  1OVU A;  3AE6 C;  4FA1 A;  1T2K D;  1DH3 A;  1IK7 A;  1Q7Y Q;  5KLI C;  1BCC J;  2IDB A;  3CWB G;  3CWB E;  4DCK A;  2J59 M;  2YMY A;  1BE3 G;  1BE3 E;  2H8P D;  1C52 A;  1M1K Q;  2Z4E A;  2RN0 A;  5L8R J;  1D7M A;  2HG5 D;  1X8Y A;  1RE4 C;  1U57 A;  4D6T D;  1SFC D;  1U7M A;  2Y9Z A;  5AVX B;  2E74 D;  1ZME C;  2D0W A;  4L75 A;  1CSV A;  1KYO H;  3SWF A;  3OA8 A;  3HTK B;  4UB8 H;  2N9B A;  2LIR A;  2OZ1 B;  2K9J A;  4AYC A;  2WSC J;  1CRJ A;  2FRC A;  1LTJ C;  2R5D A;  1S6V B;  3SWS A;  1RQU A;  2HLO A;  4Y5R A;  5APU A;  3Q1M A;  5C0Z A;  1Z56 A;  1HJ4 A;  2C1D A;  4NFG B;  4PD4 I;  351C A;  4RKU J;  3CX5 E;  1FZC A;  4YXW H;  3RBX A;  2GC7 D;  3L72 E;  3L72 G;  1CHI A;  1HVV A;  1PP9 G;  1PP9 E;  3NXS A;  3IFM A;  2VHD A;  1FDI A;  5H2F V;  1Y9B A;  3H1K E;  3H1K G;  4BRY B;  3EQ2 A;  1H1O A;  3S4R A;  4PD4 D;  2AXT H;  2PRR A;  1N86 A;  4UB6 E;  2E75 B;  1MG2 D;  1NML A;  4H0L D;  2YKO A;  1LJ2 A;  2HV4 A;  1YJN P;  1N7S B;  1T3J A;  3Q5P A;  4XYD B;  2O01 J;  4OH8 B;  1WVE C;  1YEB A;  1W2E A;  1BCC G;  1BCC E;  4Q5P A;  4YPC A;  4RES B;  3F89 A;  1L9B C;  3TF5 A;  2YCC A;  3G71 P;  2FBW C;  1XTC C;  2KK7 A;  2JWA A;  3EFG A;  1Y47 A;  2R3C A;  4DY9 A;  1GK4 A;  3OJA B;  3HE4 A;  4MU8 A;  4WQD A;  2B88 A;  1AQ5 A;  2P7J A;  3B5N A;  5AW8 B;  2J58 A;  3SLE A;  1H33 B;  3WUU A;  2Q9I A;  5B5E V;  1CSW A;  1URQ A;  1CI6 B;  4GDO A;  3PXW A;  2DGE A;  3AEF C;  2YIU C;  3E1R A;  4K35 A;  2JO1 A;  4D6T E;  4D6T G;  1VQL P;  2W8Z A;  1PGQ A;  2WT7 B;  2B0Z B;  3WFD C;  2Q3I A;  1H89 A;  2Y0C A;  4H13 B;  5B66 E;  1CXA A;  1H0T B;  1JY2 N;  2KS1 B;  3SWY A;  2XKM A;  3CYT I;  5AW4 B;  1VQM P;  1KYO D;  1AFO A;  4N78 D;  4JQ0 D;  3QH9 A;  4L73 A;  1AV1 A;  1T8Z A;  3OCD A;  2E75 C;  2Z5H A;  4DZO A;  1Q81 Q;  2HOD A;  2PAJ A;  1YBK A;  5K5G B;  3KYQ A;  1N7S C;  2IX7 C;  5CCH D;  4K3I A;  2IYP A;  1I8P A;  3L75 D;  4ZMD A;  3C8V A;  1JB0 J;  4U7J A;  1OVV A;  3V2Q A;  1DII C;  5H2F H;  4KJM A;  1SFC A;  4PD4 E;  2B12 B;  1KB9 H;  3P8C D;  3L4M A;  5E79 E;  1S4X A;  4AAM A;  3B4S A;  2IBZ I;  3VP9 A;  2RKL A;  2BH5 X;  1PZQ A;  1IFP A;  5KAI E;  2QSI A;  1LTB C;  1K9M Q;  1HZU A;  1SQP K;  4GOE A;  1OFC X;  4W7Y A;  3MIW A;  1CIF A;  1GU5 A;  1LGH B;  3V2R A;  2KUB A;  3LID A;  3VMX A;  1DVH A;  4EDF A;  1IRV A;  3WUI A;  2E75 D;  2OYH B;  3L75 J;  1HGV A;  2CXB A;  5KJ7 C;  3VP8 A;  2IBZ D;  3GLM A;  1USD A;  1S5L X;  1N7S D;  4YXD C;  2N18 B;  5BU5 A;  1JMM A;  4L3H A;  1FDO A;  1A02 J;  3A3Y B;  1OZH A;  2OYI C;  1SQX J;  3S9O A;  2ZT9 B;  3I55 P;  2YNY A;  3QWO C;  1GTW A;  4EIJ A;  1L0L J;  2QJY C;  3TNU B;  3EWK A;  3MHV A;  3M9B A;  4AX3 A;  4H13 C;  1T6A A;  5AUR A;  1N90 A;  3SFD C;  1JCD A;  3G4S P;  3GF7 A;  1KV4 A;  3CMA P;  4FAV A;  3B8E B;  3SSU A;  3HD7 B;  3JCU H;  3AE5 C;  2ITA A;  1E2R A;  4W7Z A;  1FBM A;  5B5E H;  3CCM P;  1IQC A;  5CMZ A;  4PW9 B;  3G3Z A;  5KJ7 D;  1SLQ A;  2KSE A;  1QN2 A;  2BGV X;  2Q7C A;  3HE5 A;  2B10 B;  1SQV K;  2W6J H;  5KLV K;  5CYT R;  2O1J A;  1LT9 B;  3FXD A;  1VF5 C;  4N78 E;  5KAF E;  2VRS A;  1GQ1 A;  3H32 A;  4WQB A;  4L74 A;  1NOH A;  4H13 D;  1KX2 A;  1HJ0 A;  4C7N A;  2B87 A;  1CSX A;  2FXP A;  2GIW A;  3Q5S A;  3L75 E;  3L75 G;  1FJ0 A;  2KNC B;  1NTM D;  1TU3 F;  3O8Z A;  2C9L Y;  5APW A;  2CE1 A;  2HYN A;  2OYH C;  3LW5 J;  2QG4 A;  3P7K A;  3VMZ A;  1SQX E;  1SQX G;  1VQ9 P;  3L71 J;  2N18 C;  1FJP A; 
#chains in the Genus database with same CATH homology
 4O1W A;  451C A;  3A0H V;  3TDK A;  1A8C A;  1CIH A;  3PRJ A;  3WU2 V;  1CO6 A;  2RMZ A;  1RZ6 A;  1DVV A;  2JTI B;  3WC8 A;  1C6R A;  2FWL A;  3CXH D;  3O20 A;  3OA8 B;  2C1U A;  1BCC D;  1FI7 A;  2N9Y B;  1F1F A;  2N3Y A;  2K9J B;  1ETP A;  4L3G A;  1CIE A;  1HRC A;  1JDL A;  1KYO W;  4FA4 A;  4WQ9 A;  5B6Q A;  1DW1 A;  1GJQ A;  2ZON G;  1HCM A;  1YIC A;  3WFB C;  1C6S A;  5IY5 1;  5TIS V;  1CHJ A;  2C1D B;  2ZZS 1;  3BCC D;  1HJ3 A;  1S5L V;  2PCB B;  2ORL A;  3ZBM A;  3VMA A;  4WQE A;  1KX7 A;  1HJ5 A;  4H0K A;  2XTS B;  3WFE C;  1N9C A;  4FA1 A;  1LFM A;  1U74 B;  3A9F A;  1H32 B;  2ZBO A;  2GC4 D;  2GB8 B;  1FI3 A;  1AOQ A;  1N50 A;  2BPB B;  1CNO A;  2N9I A;  2C2C A;  1C52 A;  2B11 B;  1M6Z A;  4H0J A;  3TGU D;  2RN0 A;  2CA4 B;  5B66 V;  1LC1 A;  3PLN A;  4GYD A;  4D6T D;  1CYI A;  1AKK A;  3RLM A;  3ORV A;  4L1Q A;  2D0W A;  1ZRT D;  4AAN A;  1CSV A;  2QJY B;  4PJ0 V;  3OA8 A;  4A7P A;  4IL6 V;  4EID A;  2LIR A;  2OZ1 B;  3SVW A;  1CRJ A;  3ZOO A;  2FRC A;  5DJQ B;  1CSU A;  1SQP D;  1S6V B;  3SWS A;  1MG3 D;  4Y5R A;  1GKS A;  4N0K A;  5C0Z A;  2CA3 B;  1HJ4 A;  1CCR A;  1AOF A;  1I6D A;  2C1D A;  4NFG B;  351C A;  4PWA A;  1SQQ D;  1EZV D;  1SQB D;  2FYN B;  1CCH A;  5DFS A;  1CED A;  2O3J A;  2GC7 D;  1CHI A;  3ZIY A;  2Y0D A;  2VHD A;  5H2F V;  1L9J C;  4KMG A;  3PH2 B;  2AIU A;  2L91 A;  3CP5 A;  1A56 A;  2QJK B;  5TJH A;  5E79 V;  1H1O A;  1N15 A;  2ZXY A;  4PD4 D;  5KAI V;  1H32 A;  1IRW A;  3DMI A;  5KKZ B;  2D0S A;  1CC5 A;  1QYZ A;  1MG2 D;  1NML A;  1I8O A;  4XXL A;  4EIE A;  3O0R C;  1KB9 D;  2HV4 A;  3L73 D;  1CXC A;  1HRO A;  3KZI V;  1SQX D;  2FYU D;  3RN0 A;  1I55 A;  3VYM A;  4XYD B;  1L0L D;  2PCC B;  5DF5 A;  1WVE C;  1K3G A;  5EXQ A;  1DW0 A;  1YFC A;  2MHM A;  1YEB A;  1AYG A;  1RAP A;  3L74 D;  3ZOY A;  1NMI A;  2OZ1 A;  4Q5P A;  4O1Q A;  3NBS A;  3GW6 A;  4JCG A;  3SXT A;  3ZOX A;  1L9B C;  3TF5 A;  2Y0E A;  2YCC A;  1HZV A;  3OCD B;  3TYI A;  1R0Q A;  3CX5 W;  2JWA A;  1SQV D;  5KLV D;  1FI9 A;  4DY9 A;  5CIG B;  1NNO A;  1KIB A;  1EB7 A;  4MU8 A;  3L70 D;  4WQA A;  1E29 A;  2N3B A;  4WQD A;  3HQ8 A;  3O1Y A;  3SLE A;  3A0B V;  1H33 B;  1I54 A;  5B5E V;  1CSW A;  3PTZ A;  1H9X A;  3PXW A;  2DGE A;  1W2L A;  5GTI V;  1RZ5 A;  3PHL A;  1J3S A;  2B4Z A;  1BL9 A;  1QKS A;  3VRD A;  2LIT A;  4LJI A;  155C A;  1H31 B;  1LMS A;  5CIH B;  1OCD A;  1VYD A;  3CXH W;  2B0Z B;  1CTJ A;  3WFD C;  1KV9 A;  2Y0C A;  1CXA A;  1YCC A;  5KAF V;  2YQB A;  2PAC A;  4J20 A;  1NTK D;  1IO3 A;  2BLF B;  4FAN A;  3CYT I;  1I6E A;  1BGY D;  1KYO D;  1A2S A;  3PXS A;  4AAO A;  3L71 D;  3X39 A;  1KB0 A;  1OAE A;  3OCD A;  2DVH A;  1CRG A;  4FA5 A;  1W5C T;  3ZCF A;  1GDV A;  4K3I A;  3O5C A;  3VNW A;  1I8P A;  3L75 D;  2N9J A;  3H1H D;  1M60 A;  1NTZ D;  3HQ9 A;  1DII C;  4WQ8 A;  2JQR A;  1H33 A;  1DIQ C;  1NIR A;  2B12 B;  1DT1 A;  1QL3 A;  3PXT A;  3L4M A;  3RMZ A;  2BCC D;  4AAM A;  3C2C A;  2A06 D;  4GED B;  1U75 B;  1PPJ D;  2BH5 X;  4YE1 A;  1C6O A;  1CHH A;  5C9M A;  1H31 A;  1MZ4 A;  1HZU A;  1GU2 A;  1H9Y A;  4EIF A;  2ZOO A;  2C1V A;  1CIF A;  4FA9 A;  1C2N A;  2MTA C;  3MK7 B;  1QL4 A;  1DVH A;  4EDF A;  1IRV A;  3WUI A;  2KS1 A;  5CID B;  2CXB A;  2IBZ D;  1FCD C;  1CRH A;  1YIQ A;  2C8S A;  4P4Q B;  2N18 B;  4EIC A;  4L3H A;  1RAQ A;  3ITK A;  2V08 A;  2EXV A;  1C2R A;  5GTH V;  2AI5 A;  3H1J D;  1LC2 A;  3RN1 A;  2QJP B;  1LS9 A;  1L0N D;  4AX3 A;  5DJQ C;  1FOC A;  5AUR A;  1N90 A;  1YEA A;  3KHU A;  1P84 D;  4FAV A;  3CWB D;  4RSZ A;  1YTC A;  5CIB B;  1BE3 D;  1K3H A;  1CYC A;  1COR A;  1NU1 D;  1E2R A;  3HQ6 A;  3FWL A;  3H1L D;  1C75 A;  1HH7 A;  5CIC B;  1IQC A;  1YNR A;  4QAO A;  2BCN B;  1WEJ F;  1E8E A;  4PW9 B;  2L4D A;  4UB8 V;  1CYJ A;  1GIW A;  2BH4 X;  3NWV A;  1QN2 A;  2BGV X;  2V07 A;  1CRY A;  1C7M A;  5KLI B;  2B10 B;  4FB1 A;  5CYT R;  1CRC A;  1COT A;  4V2K A;  4RJT A;  2Q3E A;  5CIF B;  1GQ1 A;  1CRI A;  1B7V A;  4WQ7 A;  1CTZ A;  4WQB A;  3M97 X;  1DW3 A;  1I5T A;  3GG2 A;  3CX5 D;  3H1I D;  3HQ7 A;  2YIU B;  1KX2 A;  3DR0 A;  3L72 D;  4AAL A;  4WQC A;  3ZOW A;  1CSX A;  1PP9 D;  1DW2 A;  2GIW A;  2YK3 A;  1FJ0 A;  1ZZH A;  4UB6 V;  2KNC B;  2AXT V;  1IZL 0;  1M70 A;  1NTM D;  3H1K D;  3MK7 C;  3CU4 A;  3DP5 A;  3NBT A;  3WFC C;  5CIE B;  1CIG A;  2I8F A;  2CE1 A;  2C9X B;  1FHB A;  1CTY A;  4U3F D;  2QG4 A;  2CE0 A;  3JBT B;  3L4O A;  1F1C A;  3SJL A;  2N18 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...