1KYOD

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 66
structure length 245
sequence length 245
chains with identical sequence O
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kyoD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kyoD01
3JBTB 4AALA 5B6QA 4GEDB 4U3FD 3CP5A 4EICA 4D6TD 1CYIA 3NWVA 4V2KA 3PLNA 3ZIYA 2YIUB 1L0ND 4H0JA 1CTZA 3VMAA 5CIBB 1VYDA 2I8FA 4LJIA 3TYIA 2V07A 2ZBOA 1C6RA 2KNCB 2MTAC 1RAPA 1DVHA 1CRIA 3HQ9A 1QYZA 4WQDA 2N3BA 1BE3D 2YCCA 3DP5A 1CSUA 2V08A 3PXWA 1H33B 1FI9A 3L75D 2B12B 2D0SA 4UB8V 2BPBB 5KLIB 3X39A 3L74D 3CXHD 4EIFA 2QG4A 1C75A 1A56A 1DW0A 2C1DB 1S6VB 3CX5D 4UB6V 1YFCA 1AKKA 1BL9A 3PHLA 2C8SA 1HCMA 1CHJA 1DW1A 2ZXYA 5TISV 2B10B 1NMLA 1CTYA 3TDKA 1IRWA 2C1DA 3H1ID 1GU2A 2QJPB 1B7VA 1DW3A 3H1LD 1U75B 2Y0EA 2O3JA 3CXHW 1QL3A 1I6EA 2D0WA 1YTCA 1A8CA 2MHMA 3A9FA 3O1YA 2DVHA 1SQPD 3CX5W 2CA3B 3CU4A 1K3HA 2Q3EA 2BCCD 2N3YA 1CSWA 1F1FA 1CRGA 2JTIB 3OA8B 3TGUD 1LC2A 1SQQD 3KZIV 1CORA 3DR0A 4JCGA 2OZ1B 3SXTA 4FANA 1YICA 1CSXA 3PH2B 2VHDA 1LS9A 3SVWA 5GTIV 1NTZD 1CXCA 1CSVA 2BLFB 1NTMD 1H31B 2ZONG 4GYDA 3C2CA 1WEJF 1IQCA 2OZ1A 2YK3A 3A0BV 2ZZS1 2EXVA 1SQBD 1LFMA 2L4DA 1CO6A 2IBZD 2PACA 2KS1A 1HJ3A 1H9XA 4FAVA 1YEAA 1ZRTD 4Q5PA 1RZ6A 1L9BC 2C9XB 3PXTA 5CIGB 1C6SA 3HQ7A 1HROA 1N50A 1HH7A 1OAEA 1I5TA 1KV9A 3HQ6A 3VNWA 1HZUA 3MK7C 3MK7B 2AI5A 1KB0A 1CIGA 3ITKA 4XYDB 1A2SA 1H1OA 3GW6A 1M6ZA 2FYNB 3PRJA 2Y0DA 2ZOOA 3O0RC 2BH5X 1YCCA 5CIEB 4XXLA 1C7MA 3L4MA 1CNOA 1GDVA 2GIWA 5B5EV 4A7PA 2DGEA 4WQBA 1M70A 3O5CA 4L3HA 1S5LV 1WVEC 1C52A 3L73D 2FWLA 1NMIA 5CIDB 3ORVA 1H33A 1GQ1A 2QJYB 4J20A 2LIRA 4N0KA 3H1KD 1HZVA 1CEDA 1EZVD 1I55A 5C0ZA 4WQAA 4AANA 1FJ0A 1IRVA 4O1QA 2PCBB 3WUIA 4WQEA 1I6DA 1NNOA 4IL6V 1W2LA 1CIEA 5KKZB 4KMGA 3SJLA 4PWAA 351CA 1I54A 2JQRA 3ZOWA 2CXBA 1MZ4A 5KAIV 1N9CA 1YEBA 1HJ4A 1IO3A 1RZ5A 4O1WA 4P4QB 2C1UA 1CRCA 1GIWA 4WQ8A 3NBTA 1AYGA 4FA5A 1NTKD 1I8PA 1QN2A 5CICB 1KYOD 2C1VA 3L71D 1LMSA 2B0ZB 5E79V 4FA1A 1E2RA 3KHUA 3A0HV 2N9YB 3SLEA 3RLMA 1EB7A 3VYMA 1FCDC 2N9IA 3OA8A 4WQ9A 5DJQC 1CHHA 5DJQB 4EIDA 4MU8A 2B4ZA 1DVVA 1CC5A 3HQ8A 3WC8A 1KIBA 4YE1A 1K3GA 4EDFA 3SWSA 1ZZHA 2PCCB 4FA9A 5H2FV 4WQ7A 1KB9D 451CA 5IY51 1AOFA 4NFGB 1JDLA 1H31A 1SQXD 3ZOXA 5KLVD 3GG2A 1GJQA 1CYCA 1CRYA 4RSZA 5TJHA 3ZBMA 3PXSA 3L4OA 1M60A 4L3GA 1GKSA 5CIFB 4WQCA 1CRHA 1W5CT 2ORLA 5KAFV 1J3SA 1CYJA 5GTHV 1C2NA 2YQBA 4QAOA 3FWLA 4AX3A 1L0LD 2FYUD 3WFCC 3DMIA 1YNRA 3L70D 2BCNB 1PP9D 2GB8B 4PW9B 3L72D 1LC1A 2C2CA 1H32B 1CCRA 1FOCA 4H0KA 5C9MA 1N15A 3WFBC 1DIIC 3RMZA 3CYTI 3ZOYA 2CE0A 3OCDB 1IZL0 3O20A 4PD4D 1NIRA 2B11B 3WU2V 2AXTV 2Y0CA 1CRJA 4RJTA 1CCHA 1FI3A 3ZCFA 3H1HD 1CIHA 1ETPA 2QJKB 1KX2A 2RN0A 1C2RA 1COTA 155CA 4EIEA 1H32A 3PTZA 1CXAA 4AAMA 1H9YA 4PJ0V 3VRDA 1HRCA 1CHIA 2N9JA 3OCDA 2K9JB 2FRCA 1E8EA 2JWAA 5CIHB 1YIQA 1CIFA 3BCCD 1RAQA 1PPJD 4Y5RA 2LITA 5CYTR 1CTJA 2RMZA 3NBSA 1DIQC 2GC7D 2CA4B 1DW2A 4L1QA 1F1CA 3RN1A 5AURA 5B66V 1MG2D 1MG3D 2N18C 2N18B 4K3IA 2BGVX 1KX7A 1P84D 5EXQA 1OCDA 3CWBD 3WFEC 2A06D 2AIUA 2L91A 3ZOOA 1AOQA 2HV4A 4AAOA 2CE1A 1E29A 5DFSA 1SQVD 3H1JD 1FI7A 3RN0A 1U74B 3TF5A 1HJ5A 1BGYD 2XTSB 4DY9A 1NU1D 4FA4A 2BH4X 1FHBA 1BCCD 2GC4D 1QKSA 5DF5A 3WFDC 4FB1A 1KYOW 1C6OA 1L9JC 1R0QA 3M97X 1DT1A 1I8OA 1N90A 1QL4A
chains in the Genus database with same CATH superfamily
1SFCB 4AALA 5B6QA 3AE8C 4UB6E 4OGQD 4BRYB 3CP5A 4EICA 5KJ7D 3NWVA 2YIUC 2YIUB 4H0JA 3G6EP 3IAOA 3VMAA 1TU3F 1L0LK 2KNCB 2IZ1A 1RAPA 3L70G 1QYZA 1IFJA 4WQDA 2E75C 3AEEC 2YCCA 5AVZB 1CSUA 2HLOA 1JTHB 3PXWA 1USDA 1FI9A 4H13C 4H13B 3L75D 1MFTA 4IL6E 1P84I 1DW0A 2YMKA 1BDCA 3RL0C 3RL0B 3B4SA 1LWUC 1LT9C 1LWUB 1LT9B 1JOCA 3CCMP 2C8SA 1HCMA 4WY4C 2WQYC 4WY4B 2PGDA 2P10A 2OYIC 2OYIB 1SQQE 2WSCJ 4W80A 1Q86Q 3L72J 2KI7B 2KZIA 1FAVA 1J2JB 3HD7D 4GT1A 3I55P 2AEMA 3H1LD 2ZAEB 1BGYE 4O9BA 4GKGA 3H32B 3OJAB 1Y47A 2IFNA 1HTLC 5BVZA 2J58A 1SQPD 3E1IA 1PGQA 3M91A 2FXOA 2CA3B 2JJLA 2Q3EA 4NPEA 1N86A 5AVTB 3VP8A 1H8AA 3TGUD 1SQBE 1VQ9P 1GTWA 5APSA 2E76D 4ZNCA 3DR0A 3H6PA 3SXTA 4FANA 1YICA 3L35A 1KILE 2W27A 3T97A 1L4AD 2KSJA 2QEXP 4H0LC 3V4WA 4H0LB 3B71A 1VQLP 2XZRA 4UB8H 2V7QH 5GTIV 1NTZD 1NTMD 2JO1A 3WU2H 1Y9BA 2ZONG 2WTYA 3LW5J 4HKZH 1NTZK 1IQCA 5BU5A 3A0BV 2ZZS1 4IL6X 3HE5A 2KLUA 1CO6A 2PACA 3CX5I 4WB4A 3W67A 1H9XA 2JDIH 3SFDC 1G1JA 1PGJA 1VQKP 1L9BC 2XNDH 5CIGB 1SQVJ 1J1EC 4JYCA 1J1EB 3P7KA 1N50A 1KQGB 3F5HA 1I5TA 1KV9A 1WMKA 2QM8A 3AEGC 3RK3D 1RE3C 4ZKPA 3TYYA 4DOJA 2ZT9C 3V2PA 2ZT9B 3A3YB 2ZFCA 2AI5A 1KB0A 1CIGA 1DIPA 5B66H 3ITKA 1BE3G 1QVFO 2YMYA 3M9QA 1M6ZA 5APVA 1OMIA 5KLIC 4XXLA 3L4MA 5APUA 2WPQA 1CNOA 3PP5A 4OVNF 1DX7A 5B5EV 2C9LY 2KNCA 2WZ7A 4L3HA 1S5LV 4LC1A 3L73D 1HGVA 1L0NJ 5CIDB 3H25A 1JTHA 2QJYC 2QJYB 1GQ1A 2LIRA 2P1JA 1KMIZ 3TGUE 1PP9J 4K35A 1VF5D 5E79E 5C0ZA 1YBKA 4AANA 1KYOE 2PCBB 1I6DA 2DW3A 1LT9A 1NNOA 4IL6V 1QLED 1KC8Q 2JKVA 4WY4A 4KMGA 1YQ4C 3CCSP 1NTME 4PWAA 3V2QA 2OYIA 2CXBA 1MZ4A 3CWBG 1H88A 1W5CE 4IFFA 3JCUE 3RK2D 1CRCA 1M56D 1AYGA 1NTKD 1CW5A 5CICB 2RH0A 1LMSA 1AQTA 3H1IJ 3AEDC 1NTKK 1E2RA 3KHUA 3Q2YA 1M57D 2NRGA 3BASA 2A45H 3RLMA 3B5NA 1DD4A 2B4ZA 2IZ0A 1MUUA 3WC8A 3TNUA 1K3GA 4YE1A 2OYHC 4EDFA 1T2KC 1GDTA 4WQ7A 1KB9D 5IY51 1X0TA 3BATA 2GA1A 1N7SC 1N7SB 4D6TG 1GJQA 1XTCC 3L70E 4WVZA 1PP9E 1NU1J 1EZVI 1BCCJ 4L3GA 4AUWA 1W5CT 1NVOA 3D70A 1J3SA 5GTHV 4HB1A 3CPWO 3TK1A 1JCCA 3R4YA 3KQGA 3L74G 1GK6A 3WFCC 5AW9B 1N73C 1ZXGA 1N73B 3KXDA 1RE3A 4PJ0E 2BCNB 4U3FJ 2O1KA 5TISE 3V6IA 2C2CA 3D0WA 1FZEA 2KSEA 3E7KA 2K37A 5C9MA 1FZGA 3GF3A 3P8CD 3HRNA 2Y9ZA 3I5CA 2CE0A 3OCDB 3O20A 4PD4D 1OX3A 2AXTV 2W83C 2JP3A 4RJTA 1ZMEC 3ZCFA 3H1HD 1FZBA 2WSSH 2C9NY 4NPDA 2Z5HA 3RBZA 1COTA 4EIEA 1H32A 3JCUH 1H9YA 2MKVA 3EWKA 4N3YB 2LXBA 1CHIA 3HD7C 2K9JB 3HD7B 2P67A 1AFOA 4KJMA 2IDBA 3SWYA 1CTJA 4H44D 3NBSA 1DIQC 2GC7D 2CA4B 2AEJA 3HE4B 3B5ND 3IN6A 1U57A 1ZV8A 3L71G 1BCCE 1MG2D 2E76C 1KQFB 4K3IA 2E76B 2BGVX 1S3JA 5CCGC 3CWBD 2L91A 3GF7A 2BEQD 1L4AC 1IFNA 1L4AB 3B8EB 1AOQA 1NKZB 2CE1A 2R5DA 1UIIA 2KZJA 2WPVB 1M8OB 1URQD 3PH0A 1HJ5A 3GMAA 2BCCJ 2IBZG 5AVWB 4U3FE 2WSFJ 2JR8A 4TT3H 2OTLP 1DEEG 5AW8B 4Z1MH 4C7RA 1Q81Q 1Q2NA 1L9JC 1R0QA 2NZ2A 1BE3E 3PJSK 5AVYB 2CK3H 4PJ0H 4NPFX 2ZYGA 1AQ5A 3RK3C 1HGZA 3RK3B 2W6JH 5CCHD 1N7SA 4D6TD 5KAIH 1PV3A 3A5TA 4V2KA 3PLNA 3ZIYA 1NO4A 2YKPA 5CIBB 5APQA 1C6RA 3FXDA 1OZHA 5APXA 2FYUK 2M3EA 5KJ7A 3VP9A 5KLVJ 1Q7YQ 3DP5A 3L72G 1NAYA 2V08A 3M9HA 1FDMA 1H33B 2D0SA 3P32A 2BPBB 3HTKB 3L74D 3Q5RA 3CI9A 1E79H 1A56A 1N73A 4YXDC 5M1BA 3CCJP 1GW4A 1A02F 1HH0A 5AVVB 2D2CD 2OTJP 2WMMA 1EDLA 1CHJA 1VF5C 1VF5B 2WSEH 5C39A 1KB9H 2W90A 3A2AA 5TISV 2B10B 2R44A 3TDKA 1IRWA 2C1DA 2XU6A 2E5YA 1JMBA 4HH2A 3H1KJ 4XE5B 5GTIE 1DH3A 4LLHA 2Y0EA 3T97B 2D0WA 4CPGA 3A0BE 3A9FA 3O1YA 2DVHA 3CU4A 2KK7A 2OGUA 3NFQA 3M06A 1F1FA 1CRGA 3V4QA 1SQQD 1HJBA 3KZIV 2FFDC 2FFDB 4JCGA 1MFZA 3HE4A 1SQQK 1SQVG 2VRSA 4D6TE 1S4XA 3L4FA 1E5WA 1YTZT 1CSVA 2BLFB 2A45I 2B89A 1H31B 1ZR2A 1L2PA 3CC4P 4GYDA 1L4AA 3OW2O 2HODA 4PD4H 2YK3A 1GK4A 1SQBD 2YNYA 1Q90D 3BVHA 1QEXA 2IBZD 3AEFC 1KILD 2YKQA 3L36A 1SQBK 1VQPP 2R32A 3AEBC 1RF1A 1IFMA 5B5EE 1C6SA 3L74E 1HROA 1HH7A 1OAEA 1S5LE 1L0NG 1OWAA 3MD0A 3VNWA 2Q5UA 3L37A 1SQXJ 1JUNA 1CI6B 2H88C 1PP9G 3IR9A 3H1KE 1WRGA 1H1OA 3U1AA 2Y9YA 1JMMA 2ZOOA 1LTGC 2L5GB 4YXWH 5AW1B 1EXIA 5CIEB 1C7MA 1KTMA 2Q1KA 2IYPA 1AV1A 3V5BA 1EXJA 1M70A 1K9MQ 1L0LJ 1A02J 1JY3P 5GTIH 1JY3N 1H33A 1LP1B 5AW0B 3HTKA 1LTSC 1M1JA 1HZVA 1CEDA 3H1IG 1FU1A 1IRVA 4O1QA 3L75J 4ZMDA 3L71E 2FXPA 3GHGA 1KFNA 3SJLA 1FDOA 4H44C 4H44B 2JQRA 2KIKA 3B5NC 3B5NB 1N9CA 4YPCA 1YEBA 3C1LA 1HJ4A 1SQPK 3M0AA 3O6QA 1RZ5A 2HYNA 4P4QB 4WQ8A 3JC22 2IBZE 1S5LX 4FA5A 1OW8A 2XNXA 3E1RA 3TNUB 1KYOD 5CHXA 2B0ZB 1SQXE 3D71A 1IK9A 2N9YB 1NU1G 3H1LJ 3VYMA 1BCCG 2N9IA 5DJUB 4WQ9A 1DEBA 5B5EH 2FFDA 1FZCC 4JPZB 1FZCB 4UB6H 1SQPJ 1NTMK 3VMZA 5GTHE 5L8RJ 1S5LH 4EIJA 1Y8AA 1KFMA 1G2CB 4FA9A 5H2FV 5EFWB 1L0LE 1H31A 3H1JJ 1AJYA 4U3FG 4QMAA 3ZOXA 3FGAD 3P8MC 3K5BA 2H7HA 1CRYA 5TJHA 1FDIA 4GIFA 3ZBMA 1VQ4P 1M60A 1NTZJ 1MV8A 4IL6H 4DCKA 3L72E 3D6YA 3AE3C 2N1TD 1CRHA 1LTJA 2FY8A 5KAFV 2AXTE 3C8VA 1C2NA 2YXQB 2J5UA 4QAOA 2MJZA 3FWLA 3LIDA 4W7YA 3MIWA 3DMIA 3L70D 1PP9D 2GB8B 1CI6A 4PW9B 2WITA 3V2NA 1FOSE 2V4HA 1H32B 4GDOA 3S1KA 3OA7A 1DIIC 3RMZA 3ZOYA 2E74D 2D2CC 2D2CB 1NIRA 1YHQP 3WU2V 2XDJA 1GU4A 1CRJA 1IFDA 1FI3A 1VQ8P 1CIHA 4TLFA 2QJKC 2M8RA 2QJKB 1KX2A 1H89A 1LP1A 3OAKA 3VRDA 2PFXA 3FWNA 2A06E 2N9JA 1KB9I 2W8ZA 3O8ZA 3L73J 2FRCA 1GW3A 2WWWA 1E8EA 5CIHB 2BCCG 1SQVE 3H1JE 4JYBA 2O01H 1NHLA 4L1QA 1F1CA 3RN1A 1PGPA 3AE4C 5GTHH 5B66V 1MG3D 4Y99C 4Y99B 1R5LA 1HBWA 1OCDA 3WFEC 1EQ7A 1M90Q 2AXCA 1N8RQ 4Y28J 3USSA 5DFSA 2H89C 1RH5B 1FI7A 3RN0A 4DZOA 1LGHB 2C0WA 4LGDE 1OXZA 2WSCH 2LKMA 1NU1D 2G8YA 1AA0A 2BH4X 1BCCD 1NTKJ 1OVRA 1L0NE 2R5BA 1N2DC 2AXTH 1URQA 1KYOW 1KILC 5KLVG 1RQVA 1KILB 1FZCA 1RY3A 4PD4I 1BSHA 3GLMA 1SLQA 1DT1A 2FBWC 4OGQC 4OGQB 2PP6A 1G2CA 5KJ7C 2YKOA 3JBTB 4MN4C 1VQMP 4GEDB 4U3FD 3CXHE 1G1IA 3Q5SA 2WSEJ 3CX5E 1X8YA 3CC7P 1VYDA 2I8FA 4LJIA 3TYIA 2PAJA 2Q9IA 2MTAC 5CCHA 1DVHA 5E79H 2N3BA 1BE3D 2QA4P 1KYOH 1YTZI 3W68A 3S9OA 3KYQA 3BRTB 5AVQB 1LTAC 3H1KG 2Q6QA 3X39A 2E75D 2HR3A 3H1IE 4I7ZC 4I7ZB 2P58A 2QE7H 2POHA 2QG4A 2W6BA 4DJGA 3EFGA 2C1DB 1S6VB 2B9BA 1U7JA 3PHLA 4OWFA 3F89A 4GODA 2ZYDA 3KZIE 5DJTB 2ZXYA 1ZN5A 1NMLA 1CTYA 3AE9C 3A0HE 2OQQA 1PPJG 1DW3A 1M7LA 1LTIC 2WVRA 1VQOP 2O3JA 3CXHW 1NU1E 3SFEC 1CZQA 1A8CA 1M1KQ 3H1HJ 3CX5W 1BSNA 1K3HA 3CC2P 2BCCD 4PV1D 3OA8B 1LC2A 2K9YA 1D7MA 3NXSA 2HODB 3S4RA 2B88A 1IZNB 1OVUA 4HJGH 1T6AA 4C46A 1YJNP 1CSXA 3PH2B 1H0TB 3I56P 3SVWA 1AVOA 1RF1C 1RF1B 1CXCA 1NGMB 1SQXG 4EI2A 3C2CA 3CXHH 2OZ1A 3A7OA 1OVVA 3G71P 4I2LC 1OW6A 1LFMA 2L4DA 1HUCA 1QX8A 1JNMA 4FAVA 1ZRTD 4Q5PA 1RZ6A 2C9XB 5TISH 2QM7A 1YJWP 1KILA 1L0LG 2N1TC 4YTPC 2N1TB 1HZUA 3MK7C 3MK7B 1K8AQ 1NWQA 4XYDB 1A2SA 2KLVA 1EZVE 3L75G 3O0RC 1N7LA 1YCCA 3WUVA 3KZIH 1M1JC 1M1JB 3Q1MA 3U59A 3CCVP 1GDVA 2Z4EA 4A7PA 5CJ4A 2DGEA 4WQBA 1LTBC 3O5CA 2HG5D 1WVEC 1WT6A 2E74C 2E74B 1C52A 1R5SA 1NMIA 2KOGA 2FYUJ 3GHGC 3GHGB 2YO2A 3ORVA 2B87A 4J20A 4N0KA 3H1KD 1YYCA 2BCCE 3CMEP 1KD1Q 2V7QJ 1I55A 4WQAA 1RE4A 2Z5IA 3O6QB 1DD3A 3WUIA 2KP8A 3H1LG 1W2LA 2IBZI 3CLQA 1SQPG 3RK2C 3RK2B 1W2EA 2I1KA 1J1DC 5KAIV 1GZLA 1J1DB 4B86A 3Q3DA 2Q3IA 2A06G 5H2FE 2Q7CA 4O1WA 1GIWA 2W6AA 4OH8B 1I8PA 1QN2A 2O1JA 1LJ2A 3H1JG 2QSIA 1ZR4A 1ZRTE 3L71D 4R4LA 5AW6B 4FA1A 2FKWB 1SVFA 3A0HV 3BCCJ 5AVRB 2O01N 1R8EA 2H8PD 5KLVE 3SLEA 1RQUA 3AE5C 1FOSF 1NTZG 1EB7A 1RHZB 1NJIQ 1FCDC 2ZJSE 3OA8A 4MU8A 3V2RA 5KAFE 3HQ8A 1KIBA 1H0TA 3SWSA 1SQQJ 1LTJC 1LTJB 4K3AA 3RBXA 1JY2N 3MGNA 2FYUE 1SQXD 1VPCA 2ITAA 3GG2A 1CYCA 1BGYJ 4RSZA 3PXSA 2IYOA 4UB8E 1HWTC 3WU2E 2QVAA 1SQBJ 2YQBA 1GL2D 2QRXA 1YI2P 3JSVC 2YXRB 1L0LD 1PZQA 4WWIA 2N1TA 1FJPA 3CMAP 1YNRA 2WSFH 1RF0C 2C0XA 1XTGB 2E75B 3L72D 2O01J 3L73G 1FOCA 4H0KA 1KYOI 1JY3O 1N15A 1OW7A 3G9RA 2J59M 3CYTI 3BCCE 2B11B 1PPJE 2NPSA 3A0BH 1FC2C 1ZP0C 2Y0CA 3M0DC 4IFMA 1CCHA 5B66E 1GU5A 1ETPA 1C2RA 155CA 2QIWA 2E42A 3PTZA 5H2FH 1NYHA 4RESB 2HFED 1LTTC 1MZ9A 4M3LA 1RAQA 3AE2C 5CYTR 4Y5RA 2LITA 4AQRD 5AW5B 1DW2A 1CSBA 3CCQP 4AYCA 1NTKG 5KAFH 4PV1C 4PV1B 4C7NB 3U1CA 3QH9A 2ZYAA 4N78E 1P84D 5EXQA 3CCRP 2CPSA 3ABVC 3HUSA 4EOTA 2A06D 1URQC 1URQB 3WUUA 2HV4A 4AAOA 1QL1A 4I6MC 5CCGD 1E29A 2FYZA 2E43A 1HF9A 1SQVD 3H1JD 3TF5A 2KS1B 3MHVA 4DY9A 3TGUJ 1VQ7P 1SQVK 2OARA 4FA4A 1FHBA 2XKMA 4GOFA 1JCDA 5DF5A 3WFDC 3II6A 3R2PA 2WT7A 1C6OA 3CXHI 1GD2E 2M5AB 1PL5A 3M97X 1IK7A 1YJ9P 3NMDA 5AW4B 5CCHC 1NTMJ 3ZDMA 1QL4A 1QVGO 3L75E 2OTKE 3FXEA 3VMXA 1CYIA 1KN7A 2RKLA 2OYOA 1L0ND 1CTZA 4XFJA 2V07A 2HPCB 2ZBOA 1L0NK 1QGKB 1HJ0A 1CRIA 3HQ9A 1SFCA 2NPSD 5CBNA 1KQLA 3VOPA 4KHXA 4BRYA 3CD6P 1Q82Q 2B12B 4UB8V 5KLIB 1ZW0A 3CXHD 4EIFA 1C75A 3WUTA 3H1LE 4XA4A 1EDJA 3IF4A 1EZVG 3CX5D 4UB6V 1VQ6P 1YFCA 1NH4A 1AKKA 3H1HG 1RF0A 1BL9A 1SQPE 1KV4A 1P84E 1NAFA 1DW1A 4GOEA 3L70J 1ZOYC 3AE7C 1VDFA 3SWFA 2I8DA 5AW3B 3M0DA 3H1ID 2QJPC 1GU2A 2QJPB 1B7VA 1LWUA 4U7JA 5CMZA 1S72P 1ZLLA 1U75B 5APYA 1QL3A 1I6EA 4N6JA 1YTCA 1NTZE 2K1AA 1S9KD 2MHMA 3MZWB 1T3UA 2GM4A 2WPRA 1JO5A 2N3YA 3FX0A 1CSWA 2JTIB 3AEAC 3G3ZA 1CORA 3VMYA 2OZ1B 1KZUB 3H32A 4I1LA 2BASA 2VHDA 1LS9A 1EDKA 4C7NA 2GUSA 2P2UA 5APTA 3N4XA 3RK3E 3AECC 1NU1K 1OFCX 1WEJF 2EXVA 2ZVNB 2N9BA 3CCEP 2OYHB 2R3CA 2KS1A 1HJ3A 1BDDA 1JEKA 1YEAA 4RKUJ 2IX7C 4IFDK 3PXTA 3KPEA 3HQ7A 1EC5A 4ASWA 1SFCD 3HQ6A 3EQ2A 2M5AA 3G4SP 1VQNP 2FYUG 3SWKA 1X22A 3L73E 1T8ZA 1GL2C 1GL2B 1IC2A 3MUDC 3AE1C 4EYYQ 2XV5A 4BWNA 1U7MA 2FYNC 3GW6A 3LW5H 2FYNB 2B87B 1SP4A 3PRJA 3VYIA 1IO4A 2Y0DA 3Q5PA 2BH5X 1MKMA 2WPSA 3N7NA 1P84H 4RO0A 1FZAA 2GIWA 4H13D 2HPCA 1RE4C 1SS1A 2JEEA 4WBAA 2ZXEB 3RL0g 1X79B 1S9KE 5KAIE 2FWLA 2LR2A 4JF7A 3RL0D 5CBOA 1IFPA 2PRRA 3TSIA 4W7ZA 4JBZA 1UIXA 4WY4D 1EZVD 1BE3J 1GMJA 3CL3D 1NTKE 2R3SA 1FJ0A 3BCCG 1KQSO 4WQEA 2KXPB 1CIEA 5KKZC 3WMM0 5KKZB 4L73A 351CA 1I54A 2LXCB 3ZOWA 2KUBA 3NTNA 3AE6C 3IFMA 4BXLA 1W2BO 2M3BA 1IO3A 1SQQG 2C1UA 3M9BA 3NBTA 3CCUP 1KB9E 2I1JA 2C1VA 2ZXXA 5AW7B 5E79V 1BGYG 2KB7P 1KORA 5DJQC 1CHHA 5DJQB 4EIDA 4H0LD 2M0BA 4L75A 1OIPA 1DVVA 1CC5A 1QL2A 2G3AA 1SQBG 1HVVA 2BEZF 2FXMA 3CWBJ 3CX5H 1EDIA 1ZZHA 2PCCB 451CA 1LNQA 1AOFA 4NFGB 4ASVA 1JDLA 1PFIA 1IJDB 5KLVD 5AVSB 3L4OA 2OYHA 5KLVK 1GKSA 5CIFB 4WQCA 2P7JA 2ORLA 1CYJA 1T3JA 3P8CE 4PD4E 2ZT9D 2A45G 3CCLP 2K88A 2CPBA 4AX3A 4KT0J 3H1HE 1FJKA 1FS0E 2FYUD 3MTUE 2NPSC 4L74A 2NPSB 3LIEA 5AW2B 2H43A 1PGOA 4HYTB 5KTBA 1GL2A 2AEFA 4D6TJ 1IFIA 1X9VA 3MUDA 1LC1A 3A0HH 3MP7B 1CCRA 4DT0A 3WFBC 5K5GB 3C9IA 1IZL0 1K73Q 1VL2A 1JB0J 1K05A 3KDPB 1FBMA 2RN0A 4R4MA 1NKNA 5AVUB 3QWOC 2YO3A 3L74J 1LT1A 1CXAA 4AAMA 3RGUA 1AVYA 4IOIH 2GUVA 3CWBE 4PJ0V 2UWJE 1HRCA 5BU8B 3OCDA 1NOHA 1JM0A 3HUSC 3HUSB 3BRVB 2ZVOB 2JWAA 4JQ0D 1YIQA 5AVXB 5CJ0A 1CIFA 3BCCD 3TGUG 1PPJD 2RMZA 4L76A 3EFFK 1USEA 5AURA 2N18C 2N18B 2K9JA 3HD7A 3SSUA 1KX7A 3VN0A 3UIAA 2AIUA 1NTMG 1S1CX 3VTPC 3ZOOA 1YITP 2WT7B 1K04A 3HE5B 2E5TA 1PIXA 2KYVA 1U74B 2K3RA 1BGYD 2IPPA 1Z56A 2XTSB 2IFMA 3D6ZA 1JY2P 5APWA 1JY2O 5CCGA 1VQ5P 2GC4D 1FE6A 1QKSA 1T2KD 4N78D 4FB1A 3L71J 1YIJP 4ZKUA 2SPZA 1SQXK 1S2EA 1FZFA 1N7SD 2JWDA 1YQ3C 1I8OA 1SFCC 1N90A
chains in the Genus database with same CATH topology
3JBTB 4AALA 5B6QA 4GEDB 4U3FD 3CP5A 4EICA 4D6TD 1CYIA 3NWVA 4V2KA 3PLNA 3ZIYA 2YIUB 1L0ND 4H0JA 1CTZA 3VMAA 5CIBB 1VYDA 2I8FA 4LJIA 3TYIA 2V07A 2ZBOA 1C6RA 2KNCB 2MTAC 1RAPA 1DVHA 1CRIA 3HQ9A 1QYZA 4WQDA 2N3BA 1BE3D 2YCCA 3DP5A 1CSUA 2V08A 3PXWA 1H33B 1FI9A 3L75D 2B12B 2D0SA 4UB8V 2BPBB 5KLIB 3X39A 3L74D 3CXHD 4EIFA 2QG4A 1C75A 1A56A 1DW0A 2C1DB 1S6VB 3CX5D 4UB6V 1YFCA 1AKKA 1BL9A 3PHLA 2C8SA 1HCMA 1CHJA 1DW1A 2ZXYA 5TISV 2B10B 1NMLA 1CTYA 3TDKA 1IRWA 2C1DA 3H1ID 1GU2A 2QJPB 1B7VA 1DW3A 3H1LD 1U75B 2Y0EA 2O3JA 3CXHW 1QL3A 1I6EA 2D0WA 1YTCA 1A8CA 2MHMA 3A9FA 3O1YA 2DVHA 1SQPD 3CX5W 2CA3B 3CU4A 1K3HA 2Q3EA 2BCCD 2N3YA 1CSWA 1F1FA 1CRGA 2JTIB 3OA8B 3TGUD 1LC2A 1SQQD 3KZIV 1CORA 3DR0A 4JCGA 2OZ1B 3SXTA 4FANA 1YICA 1CSXA 3PH2B 2VHDA 1LS9A 3SVWA 5GTIV 1NTZD 1CXCA 1CSVA 2BLFB 1NTMD 1H31B 2ZONG 4GYDA 3C2CA 1WEJF 1IQCA 2OZ1A 2YK3A 3A0BV 2ZZS1 2EXVA 1SQBD 1LFMA 2L4DA 1CO6A 2IBZD 2PACA 2KS1A 1HJ3A 1H9XA 4FAVA 1YEAA 1ZRTD 4Q5PA 1RZ6A 1L9BC 2C9XB 3PXTA 5CIGB 1C6SA 3HQ7A 1HROA 1N50A 1HH7A 1OAEA 1I5TA 1KV9A 3HQ6A 3VNWA 1HZUA 3MK7C 3MK7B 2AI5A 1KB0A 1CIGA 3ITKA 4XYDB 1A2SA 1H1OA 3GW6A 1M6ZA 2FYNB 3PRJA 2Y0DA 2ZOOA 3O0RC 2BH5X 1YCCA 5CIEB 4XXLA 1C7MA 3L4MA 1CNOA 1GDVA 2GIWA 5B5EV 4A7PA 2DGEA 4WQBA 1M70A 3O5CA 4L3HA 1S5LV 1WVEC 1C52A 3L73D 2FWLA 1NMIA 5CIDB 3ORVA 1H33A 1GQ1A 2QJYB 4J20A 2LIRA 4N0KA 3H1KD 1HZVA 1CEDA 1EZVD 1I55A 5C0ZA 4WQAA 4AANA 1FJ0A 1IRVA 4O1QA 2PCBB 3WUIA 4WQEA 1I6DA 1NNOA 4IL6V 1W2LA 1CIEA 5KKZB 4KMGA 3SJLA 4PWAA 351CA 1I54A 2JQRA 3ZOWA 2CXBA 1MZ4A 5KAIV 1N9CA 1YEBA 1HJ4A 1IO3A 1RZ5A 4O1WA 4P4QB 2C1UA 1CRCA 1GIWA 4WQ8A 3NBTA 1AYGA 4FA5A 1NTKD 1I8PA 1QN2A 5CICB 1KYOD 2C1VA 3L71D 1LMSA 2B0ZB 5E79V 4FA1A 1E2RA 3KHUA 3A0HV 2N9YB 3SLEA 3RLMA 1EB7A 3VYMA 1FCDC 2N9IA 3OA8A 4WQ9A 5DJQC 1CHHA 5DJQB 4EIDA 4MU8A 2B4ZA 1DVVA 1CC5A 3HQ8A 3WC8A 1KIBA 4YE1A 1K3GA 4EDFA 3SWSA 1ZZHA 2PCCB 4FA9A 5H2FV 4WQ7A 1KB9D 451CA 5IY51 1AOFA 4NFGB 1JDLA 1H31A 1SQXD 3ZOXA 5KLVD 3GG2A 1GJQA 1CYCA 1CRYA 4RSZA 5TJHA 3ZBMA 3PXSA 3L4OA 1M60A 4L3GA 1GKSA 5CIFB 4WQCA 1CRHA 1W5CT 2ORLA 5KAFV 1J3SA 1CYJA 5GTHV 1C2NA 2YQBA 4QAOA 3FWLA 4AX3A 1L0LD 2FYUD 3WFCC 3DMIA 1YNRA 3L70D 2BCNB 1PP9D 2GB8B 4PW9B 3L72D 1LC1A 2C2CA 1H32B 1CCRA 1FOCA 4H0KA 5C9MA 1N15A 3WFBC 1DIIC 3RMZA 3CYTI 3ZOYA 2CE0A 3OCDB 1IZL0 3O20A 4PD4D 1NIRA 2B11B 3WU2V 2AXTV 2Y0CA 1CRJA 4RJTA 1CCHA 1FI3A 3ZCFA 3H1HD 1CIHA 1ETPA 2QJKB 1KX2A 2RN0A 1C2RA 1COTA 155CA 4EIEA 1H32A 3PTZA 1CXAA 4AAMA 1H9YA 4PJ0V 3VRDA 1HRCA 1CHIA 2N9JA 3OCDA 2K9JB 2FRCA 1E8EA 2JWAA 5CIHB 1YIQA 1CIFA 3BCCD 1RAQA 1PPJD 4Y5RA 2LITA 5CYTR 1CTJA 2RMZA 3NBSA 1DIQC 2GC7D 2CA4B 1DW2A 4L1QA 1F1CA 3RN1A 5AURA 5B66V 1MG2D 1MG3D 2N18C 2N18B 4K3IA 2BGVX 1KX7A 1P84D 5EXQA 1OCDA 3CWBD 3WFEC 2A06D 2AIUA 2L91A 3ZOOA 1AOQA 2HV4A 4AAOA 2CE1A 1E29A 5DFSA 1SQVD 3H1JD 1FI7A 3RN0A 1U74B 3TF5A 1HJ5A 1BGYD 2XTSB 4DY9A 1NU1D 4FA4A 2BH4X 1FHBA 1BCCD 2GC4D 1QKSA 5DF5A 3WFDC 4FB1A 1KYOW 1C6OA 1L9JC 1R0QA 3M97X 1DT1A 1I8OA 1N90A 1QL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JBT B;  4AAL A;  5B6Q A;  4GED B;  4U3F D;  3CP5 A;  4EIC A;  4D6T D;  1CYI A;  3NWV A;  4V2K A;  3PLN A;  3ZIY A;  2YIU B;  1L0N D;  4H0J A;  1CTZ A;  3VMA A;  5CIB B;  1VYD A;  2I8F A;  4LJI A;  3TYI A;  2V07 A;  2ZBO A;  1C6R A;  2KNC B;  2MTA C;  1RAP A;  1DVH A;  1CRI A;  3HQ9 A;  1QYZ A;  4WQD A;  2N3B A;  1BE3 D;  2YCC A;  3DP5 A;  1CSU A;  2V08 A;  3PXW A;  1H33 B;  1FI9 A;  3L75 D;  2B12 B;  2D0S A;  4UB8 V;  2BPB B;  5KLI B;  3X39 A;  3L74 D;  3CXH D;  4EIF A;  2QG4 A;  1C75 A;  1A56 A;  1DW0 A;  2C1D B;  1S6V B;  3CX5 D;  4UB6 V;  1YFC A;  1AKK A;  1BL9 A;  3PHL A;  2C8S A;  1HCM A;  1CHJ A;  1DW1 A;  2ZXY A;  5TIS V;  2B10 B;  1NML A;  1CTY A;  3TDK A;  1IRW A;  2C1D A;  3H1I D;  1GU2 A;  2QJP B;  1B7V A;  1DW3 A;  3H1L D;  1U75 B;  2Y0E A;  2O3J A;  3CXH W;  1QL3 A;  1I6E A;  2D0W A;  1YTC A;  1A8C A;  2MHM A;  3A9F A;  3O1Y A;  2DVH A;  1SQP D;  3CX5 W;  2CA3 B;  3CU4 A;  1K3H A;  2Q3E A;  2BCC D;  2N3Y A;  1CSW A;  1F1F A;  1CRG A;  2JTI B;  3OA8 B;  3TGU D;  1LC2 A;  1SQQ D;  3KZI V;  1COR A;  3DR0 A;  4JCG A;  2OZ1 B;  3SXT A;  4FAN A;  1YIC A;  1CSX A;  3PH2 B;  2VHD A;  1LS9 A;  3SVW A;  5GTI V;  1NTZ D;  1CXC A;  1CSV A;  2BLF B;  1NTM D;  1H31 B;  2ZON G;  4GYD A;  3C2C A;  1WEJ F;  1IQC A;  2OZ1 A;  2YK3 A;  3A0B V;  2ZZS 1;  2EXV A;  1SQB D;  1LFM A;  2L4D A;  1CO6 A;  2IBZ D;  2PAC A;  2KS1 A;  1HJ3 A;  1H9X A;  4FAV A;  1YEA A;  1ZRT D;  4Q5P A;  1RZ6 A;  1L9B C;  2C9X B;  3PXT A;  5CIG B;  1C6S A;  3HQ7 A;  1HRO A;  1N50 A;  1HH7 A;  1OAE A;  1I5T A;  1KV9 A;  3HQ6 A;  3VNW A;  1HZU A;  3MK7 C;  3MK7 B;  2AI5 A;  1KB0 A;  1CIG A;  3ITK A;  4XYD B;  1A2S A;  1H1O A;  3GW6 A;  1M6Z A;  2FYN B;  3PRJ A;  2Y0D A;  2ZOO A;  3O0R C;  2BH5 X;  1YCC A;  5CIE B;  4XXL A;  1C7M A;  3L4M A;  1CNO A;  1GDV A;  2GIW A;  5B5E V;  4A7P A;  2DGE A;  4WQB A;  1M70 A;  3O5C A;  4L3H A;  1S5L V;  1WVE C;  1C52 A;  3L73 D;  2FWL A;  1NMI A;  5CID B;  3ORV A;  1H33 A;  1GQ1 A;  2QJY B;  4J20 A;  2LIR A;  4N0K A;  3H1K D;  1HZV A;  1CED A;  1EZV D;  1I55 A;  5C0Z A;  4WQA A;  4AAN A;  1FJ0 A;  1IRV A;  4O1Q A;  2PCB B;  3WUI A;  4WQE A;  1I6D A;  1NNO A;  4IL6 V;  1W2L A;  1CIE A;  5KKZ B;  4KMG A;  3SJL A;  4PWA A;  351C A;  1I54 A;  2JQR A;  3ZOW A;  2CXB A;  1MZ4 A;  5KAI V;  1N9C A;  1YEB A;  1HJ4 A;  1IO3 A;  1RZ5 A;  4O1W A;  4P4Q B;  2C1U A;  1CRC A;  1GIW A;  4WQ8 A;  3NBT A;  1AYG A;  4FA5 A;  1NTK D;  1I8P A;  1QN2 A;  5CIC B;  1KYO D;  2C1V A;  3L71 D;  1LMS A;  2B0Z B;  5E79 V;  4FA1 A;  1E2R A;  3KHU A;  3A0H V;  2N9Y B;  3SLE A;  3RLM A;  1EB7 A;  3VYM A;  1FCD C;  2N9I A;  3OA8 A;  4WQ9 A;  5DJQ C;  1CHH A;  5DJQ B;  4EID A;  4MU8 A;  2B4Z A;  1DVV A;  1CC5 A;  3HQ8 A;  3WC8 A;  1KIB A;  4YE1 A;  1K3G A;  4EDF A;  3SWS A;  1ZZH A;  2PCC B;  4FA9 A;  5H2F V;  4WQ7 A;  1KB9 D;  451C A;  5IY5 1;  1AOF A;  4NFG B;  1JDL A;  1H31 A;  1SQX D;  3ZOX A;  5KLV D;  3GG2 A;  1GJQ A;  1CYC A;  1CRY A;  4RSZ A;  5TJH A;  3ZBM A;  3PXS A;  3L4O A;  1M60 A;  4L3G A;  1GKS A;  5CIF B;  4WQC A;  1CRH A;  1W5C T;  2ORL A;  5KAF V;  1J3S A;  1CYJ A;  5GTH V;  1C2N A;  2YQB A;  4QAO A;  3FWL A;  4AX3 A;  1L0L D;  2FYU D;  3WFC C;  3DMI A;  1YNR A;  3L70 D;  2BCN B;  1PP9 D;  2GB8 B;  4PW9 B;  3L72 D;  1LC1 A;  2C2C A;  1H32 B;  1CCR A;  1FOC A;  4H0K A;  5C9M A;  1N15 A;  3WFB C;  1DII C;  3RMZ A;  3CYT I;  3ZOY A;  2CE0 A;  3OCD B;  1IZL 0;  3O20 A;  4PD4 D;  1NIR A;  2B11 B;  3WU2 V;  2AXT V;  2Y0C A;  1CRJ A;  4RJT A;  1CCH A;  1FI3 A;  3ZCF A;  3H1H D;  1CIH A;  1ETP A;  2QJK B;  1KX2 A;  2RN0 A;  1C2R A;  1COT A;  155C A;  4EIE A;  1H32 A;  3PTZ A;  1CXA A;  4AAM A;  1H9Y A;  4PJ0 V;  3VRD A;  1HRC A;  1CHI A;  2N9J A;  3OCD A;  2K9J B;  2FRC A;  1E8E A;  2JWA A;  5CIH B;  1YIQ A;  1CIF A;  3BCC D;  1RAQ A;  1PPJ D;  4Y5R A;  2LIT A;  5CYT R;  1CTJ A;  2RMZ A;  3NBS A;  1DIQ C;  2GC7 D;  2CA4 B;  1DW2 A;  4L1Q A;  1F1C A;  3RN1 A;  5AUR A;  5B66 V;  1MG2 D;  1MG3 D;  2N18 C;  2N18 B;  4K3I A;  2BGV X;  1KX7 A;  1P84 D;  5EXQ A;  1OCD A;  3CWB D;  3WFE C;  2A06 D;  2AIU A;  2L91 A;  3ZOO A;  1AOQ A;  2HV4 A;  4AAO A;  2CE1 A;  1E29 A;  5DFS A;  1SQV D;  3H1J D;  1FI7 A;  3RN0 A;  1U74 B;  3TF5 A;  1HJ5 A;  1BGY D;  2XTS B;  4DY9 A;  1NU1 D;  4FA4 A;  2BH4 X;  1FHB A;  1BCC D;  2GC4 D;  1QKS A;  5DF5 A;  3WFD C;  4FB1 A;  1KYO W;  1C6O A;  1L9J C;  1R0Q A;  3M97 X;  1DT1 A;  1I8O A;  1N90 A;  1QL4 A; 
#chains in the Genus database with same CATH topology
 1SFC B;  4AAL A;  5B6Q A;  3AE8 C;  4UB6 E;  4OGQ D;  4BRY B;  3CP5 A;  4EIC A;  5KJ7 D;  3NWV A;  2YIU C;  2YIU B;  4H0J A;  3G6E P;  3IAO A;  3VMA A;  1TU3 F;  1L0L K;  2KNC B;  2IZ1 A;  1RAP A;  3L70 G;  1QYZ A;  1IFJ A;  4WQD A;  2E75 C;  3AEE C;  2YCC A;  5AVZ B;  1CSU A;  2HLO A;  1JTH B;  3PXW A;  1USD A;  1FI9 A;  4H13 C;  4H13 B;  3L75 D;  1MFT A;  4IL6 E;  1P84 I;  1DW0 A;  2YMK A;  1BDC A;  3RL0 C;  3RL0 B;  3B4S A;  1LWU C;  1LT9 C;  1LWU B;  1LT9 B;  1JOC A;  3CCM P;  2C8S A;  1HCM A;  4WY4 C;  2WQY C;  4WY4 B;  2PGD A;  2P10 A;  2OYI C;  2OYI B;  1SQQ E;  2WSC J;  4W80 A;  1Q86 Q;  3L72 J;  2KI7 B;  2KZI A;  1FAV A;  1J2J B;  3HD7 D;  4GT1 A;  3I55 P;  2AEM A;  3H1L D;  2ZAE B;  1BGY E;  4O9B A;  4GKG A;  3H32 B;  3OJA B;  1Y47 A;  2IFN A;  1HTL C;  5BVZ A;  2J58 A;  1SQP D;  3E1I A;  1PGQ A;  3M91 A;  2FXO A;  2CA3 B;  2JJL A;  2Q3E A;  4NPE A;  1N86 A;  5AVT B;  3VP8 A;  1H8A A;  3TGU D;  1SQB E;  1VQ9 P;  1GTW A;  5APS A;  2E76 D;  4ZNC A;  3DR0 A;  3H6P A;  3SXT A;  4FAN A;  1YIC A;  3L35 A;  1KIL E;  2W27 A;  3T97 A;  1L4A D;  2KSJ A;  2QEX P;  4H0L C;  3V4W A;  4H0L B;  3B71 A;  1VQL P;  2XZR A;  4UB8 H;  2V7Q H;  5GTI V;  1NTZ D;  1NTM D;  2JO1 A;  3WU2 H;  1Y9B A;  2ZON G;  2WTY A;  3LW5 J;  4HKZ H;  1NTZ K;  1IQC A;  5BU5 A;  3A0B V;  2ZZS 1;  4IL6 X;  3HE5 A;  2KLU A;  1CO6 A;  2PAC A;  3CX5 I;  4WB4 A;  3W67 A;  1H9X A;  2JDI H;  3SFD C;  1G1J A;  1PGJ A;  1VQK P;  1L9B C;  2XND H;  5CIG B;  1SQV J;  1J1E C;  4JYC A;  1J1E B;  3P7K A;  1N50 A;  1KQG B;  3F5H A;  1I5T A;  1KV9 A;  1WMK A;  2QM8 A;  3AEG C;  3RK3 D;  1RE3 C;  4ZKP A;  3TYY A;  4DOJ A;  2ZT9 C;  3V2P A;  2ZT9 B;  3A3Y B;  2ZFC A;  2AI5 A;  1KB0 A;  1CIG A;  1DIP A;  5B66 H;  3ITK A;  1BE3 G;  1QVF O;  2YMY A;  3M9Q A;  1M6Z A;  5APV A;  1OMI A;  5KLI C;  4XXL A;  3L4M A;  5APU A;  2WPQ A;  1CNO A;  3PP5 A;  4OVN F;  1DX7 A;  5B5E V;  2C9L Y;  2KNC A;  2WZ7 A;  4L3H A;  1S5L V;  4LC1 A;  3L73 D;  1HGV A;  1L0N J;  5CID B;  3H25 A;  1JTH A;  2QJY C;  2QJY B;  1GQ1 A;  2LIR A;  2P1J A;  1KMI Z;  3TGU E;  1PP9 J;  4K35 A;  1VF5 D;  5E79 E;  5C0Z A;  1YBK A;  4AAN A;  1KYO E;  2PCB B;  1I6D A;  2DW3 A;  1LT9 A;  1NNO A;  4IL6 V;  1QLE D;  1KC8 Q;  2JKV A;  4WY4 A;  4KMG A;  1YQ4 C;  3CCS P;  1NTM E;  4PWA A;  3V2Q A;  2OYI A;  2CXB A;  1MZ4 A;  3CWB G;  1H88 A;  1W5C E;  4IFF A;  3JCU E;  3RK2 D;  1CRC A;  1M56 D;  1AYG A;  1NTK D;  1CW5 A;  5CIC B;  2RH0 A;  1LMS A;  1AQT A;  3H1I J;  3AED C;  1NTK K;  1E2R A;  3KHU A;  3Q2Y A;  1M57 D;  2NRG A;  3BAS A;  2A45 H;  3RLM A;  3B5N A;  1DD4 A;  2B4Z A;  2IZ0 A;  1MUU A;  3WC8 A;  3TNU A;  1K3G A;  4YE1 A;  2OYH C;  4EDF A;  1T2K C;  1GDT A;  4WQ7 A;  1KB9 D;  5IY5 1;  1X0T A;  3BAT A;  2GA1 A;  1N7S C;  1N7S B;  4D6T G;  1GJQ A;  1XTC C;  3L70 E;  4WVZ A;  1PP9 E;  1NU1 J;  1EZV I;  1BCC J;  4L3G A;  4AUW A;  1W5C T;  1NVO A;  3D70 A;  1J3S A;  5GTH V;  4HB1 A;  3CPW O;  3TK1 A;  1JCC A;  3R4Y A;  3KQG A;  3L74 G;  1GK6 A;  3WFC C;  5AW9 B;  1N73 C;  1ZXG A;  1N73 B;  3KXD A;  1RE3 A;  4PJ0 E;  2BCN B;  4U3F J;  2O1K A;  5TIS E;  3V6I A;  2C2C A;  3D0W A;  1FZE A;  2KSE A;  3E7K A;  2K37 A;  5C9M A;  1FZG A;  3GF3 A;  3P8C D;  3HRN A;  2Y9Z A;  3I5C A;  2CE0 A;  3OCD B;  3O20 A;  4PD4 D;  1OX3 A;  2AXT V;  2W83 C;  2JP3 A;  4RJT A;  1ZME C;  3ZCF A;  3H1H D;  1FZB A;  2WSS H;  2C9N Y;  4NPD A;  2Z5H A;  3RBZ A;  1COT A;  4EIE A;  1H32 A;  3JCU H;  1H9Y A;  2MKV A;  3EWK A;  4N3Y B;  2LXB A;  1CHI A;  3HD7 C;  2K9J B;  3HD7 B;  2P67 A;  1AFO A;  4KJM A;  2IDB A;  3SWY A;  1CTJ A;  4H44 D;  3NBS A;  1DIQ C;  2GC7 D;  2CA4 B;  2AEJ A;  3HE4 B;  3B5N D;  3IN6 A;  1U57 A;  1ZV8 A;  3L71 G;  1BCC E;  1MG2 D;  2E76 C;  1KQF B;  4K3I A;  2E76 B;  2BGV X;  1S3J A;  5CCG C;  3CWB D;  2L91 A;  3GF7 A;  2BEQ D;  1L4A C;  1IFN A;  1L4A B;  3B8E B;  1AOQ A;  1NKZ B;  2CE1 A;  2R5D A;  1UII A;  2KZJ A;  2WPV B;  1M8O B;  1URQ D;  3PH0 A;  1HJ5 A;  3GMA A;  2BCC J;  2IBZ G;  5AVW B;  4U3F E;  2WSF J;  2JR8 A;  4TT3 H;  2OTL P;  1DEE G;  5AW8 B;  4Z1M H;  4C7R A;  1Q81 Q;  1Q2N A;  1L9J C;  1R0Q A;  2NZ2 A;  1BE3 E;  3PJS K;  5AVY B;  2CK3 H;  4PJ0 H;  4NPF X;  2ZYG A;  1AQ5 A;  3RK3 C;  1HGZ A;  3RK3 B;  2W6J H;  5CCH D;  1N7S A;  4D6T D;  5KAI H;  1PV3 A;  3A5T A;  4V2K A;  3PLN A;  3ZIY A;  1NO4 A;  2YKP A;  5CIB B;  5APQ A;  1C6R A;  3FXD A;  1OZH A;  5APX A;  2FYU K;  2M3E A;  5KJ7 A;  3VP9 A;  5KLV J;  1Q7Y Q;  3DP5 A;  3L72 G;  1NAY A;  2V08 A;  3M9H A;  1FDM A;  1H33 B;  2D0S A;  3P32 A;  2BPB B;  3HTK B;  3L74 D;  3Q5R A;  3CI9 A;  1E79 H;  1A56 A;  1N73 A;  4YXD C;  5M1B A;  3CCJ P;  1GW4 A;  1A02 F;  1HH0 A;  5AVV B;  2D2C D;  2OTJ P;  2WMM A;  1EDL A;  1CHJ A;  1VF5 C;  1VF5 B;  2WSE H;  5C39 A;  1KB9 H;  2W90 A;  3A2A A;  5TIS V;  2B10 B;  2R44 A;  3TDK A;  1IRW A;  2C1D A;  2XU6 A;  2E5Y A;  1JMB A;  4HH2 A;  3H1K J;  4XE5 B;  5GTI E;  1DH3 A;  4LLH A;  2Y0E A;  3T97 B;  2D0W A;  4CPG A;  3A0B E;  3A9F A;  3O1Y A;  2DVH A;  3CU4 A;  2KK7 A;  2OGU A;  3NFQ A;  3M06 A;  1F1F A;  1CRG A;  3V4Q A;  1SQQ D;  1HJB A;  3KZI V;  2FFD C;  2FFD B;  4JCG A;  1MFZ A;  3HE4 A;  1SQQ K;  1SQV G;  2VRS A;  4D6T E;  1S4X A;  3L4F A;  1E5W A;  1YTZ T;  1CSV A;  2BLF B;  2A45 I;  2B89 A;  1H31 B;  1ZR2 A;  1L2P A;  3CC4 P;  4GYD A;  1L4A A;  3OW2 O;  2HOD A;  4PD4 H;  2YK3 A;  1GK4 A;  1SQB D;  2YNY A;  1Q90 D;  3BVH A;  1QEX A;  2IBZ D;  3AEF C;  1KIL D;  2YKQ A;  3L36 A;  1SQB K;  1VQP P;  2R32 A;  3AEB C;  1RF1 A;  1IFM A;  5B5E E;  1C6S A;  3L74 E;  1HRO A;  1HH7 A;  1OAE A;  1S5L E;  1L0N G;  1OWA A;  3MD0 A;  3VNW A;  2Q5U A;  3L37 A;  1SQX J;  1JUN A;  1CI6 B;  2H88 C;  1PP9 G;  3IR9 A;  3H1K E;  1WRG A;  1H1O A;  3U1A A;  2Y9Y A;  1JMM A;  2ZOO A;  1LTG C;  2L5G B;  4YXW H;  5AW1 B;  1EXI A;  5CIE B;  1C7M A;  1KTM A;  2Q1K A;  2IYP A;  1AV1 A;  3V5B A;  1EXJ A;  1M70 A;  1K9M Q;  1L0L J;  1A02 J;  1JY3 P;  5GTI H;  1JY3 N;  1H33 A;  1LP1 B;  5AW0 B;  3HTK A;  1LTS C;  1M1J A;  1HZV A;  1CED A;  3H1I G;  1FU1 A;  1IRV A;  4O1Q A;  3L75 J;  4ZMD A;  3L71 E;  2FXP A;  3GHG A;  1KFN A;  3SJL A;  1FDO A;  4H44 C;  4H44 B;  2JQR A;  2KIK A;  3B5N C;  3B5N B;  1N9C A;  4YPC A;  1YEB A;  3C1L A;  1HJ4 A;  1SQP K;  3M0A A;  3O6Q A;  1RZ5 A;  2HYN A;  4P4Q B;  4WQ8 A;  3JC2 2;  2IBZ E;  1S5L X;  4FA5 A;  1OW8 A;  2XNX A;  3E1R A;  3TNU B;  1KYO D;  5CHX A;  2B0Z B;  1SQX E;  3D71 A;  1IK9 A;  2N9Y B;  1NU1 G;  3H1L J;  3VYM A;  1BCC G;  2N9I A;  5DJU B;  4WQ9 A;  1DEB A;  5B5E H;  2FFD A;  1FZC C;  4JPZ B;  1FZC B;  4UB6 H;  1SQP J;  1NTM K;  3VMZ A;  5GTH E;  5L8R J;  1S5L H;  4EIJ A;  1Y8A A;  1KFM A;  1G2C B;  4FA9 A;  5H2F V;  5EFW B;  1L0L E;  1H31 A;  3H1J J;  1AJY A;  4U3F G;  4QMA A;  3ZOX A;  3FGA D;  3P8M C;  3K5B A;  2H7H A;  1CRY A;  5TJH A;  1FDI A;  4GIF A;  3ZBM A;  1VQ4 P;  1M60 A;  1NTZ J;  1MV8 A;  4IL6 H;  4DCK A;  3L72 E;  3D6Y A;  3AE3 C;  2N1T D;  1CRH A;  1LTJ A;  2FY8 A;  5KAF V;  2AXT E;  3C8V A;  1C2N A;  2YXQ B;  2J5U A;  4QAO A;  2MJZ A;  3FWL A;  3LID A;  4W7Y A;  3MIW A;  3DMI A;  3L70 D;  1PP9 D;  2GB8 B;  1CI6 A;  4PW9 B;  2WIT A;  3V2N A;  1FOS E;  2V4H A;  1H32 B;  4GDO A;  3S1K A;  3OA7 A;  1DII C;  3RMZ A;  3ZOY A;  2E74 D;  2D2C C;  2D2C B;  1NIR A;  1YHQ P;  3WU2 V;  2XDJ A;  1GU4 A;  1CRJ A;  1IFD A;  1FI3 A;  1VQ8 P;  1CIH A;  4TLF A;  2QJK C;  2M8R A;  2QJK B;  1KX2 A;  1H89 A;  1LP1 A;  3OAK A;  3VRD A;  2PFX A;  3FWN A;  2A06 E;  2N9J A;  1KB9 I;  2W8Z A;  3O8Z A;  3L73 J;  2FRC A;  1GW3 A;  2WWW A;  1E8E A;  5CIH B;  2BCC G;  1SQV E;  3H1J E;  4JYB A;  2O01 H;  1NHL A;  4L1Q A;  1F1C A;  3RN1 A;  1PGP A;  3AE4 C;  5GTH H;  5B66 V;  1MG3 D;  4Y99 C;  4Y99 B;  1R5L A;  1HBW A;  1OCD A;  3WFE C;  1EQ7 A;  1M90 Q;  2AXC A;  1N8R Q;  4Y28 J;  3USS A;  5DFS A;  2H89 C;  1RH5 B;  1FI7 A;  3RN0 A;  4DZO A;  1LGH B;  2C0W A;  4LGD E;  1OXZ A;  2WSC H;  2LKM A;  1NU1 D;  2G8Y A;  1AA0 A;  2BH4 X;  1BCC D;  1NTK J;  1OVR A;  1L0N E;  2R5B A;  1N2D C;  2AXT H;  1URQ A;  1KYO W;  1KIL C;  5KLV G;  1RQV A;  1KIL B;  1FZC A;  1RY3 A;  4PD4 I;  1BSH A;  3GLM A;  1SLQ A;  1DT1 A;  2FBW C;  4OGQ C;  4OGQ B;  2PP6 A;  1G2C A;  5KJ7 C;  2YKO A;  3JBT B;  4MN4 C;  1VQM P;  4GED B;  4U3F D;  3CXH E;  1G1I A;  3Q5S A;  2WSE J;  3CX5 E;  1X8Y A;  3CC7 P;  1VYD A;  2I8F A;  4LJI A;  3TYI A;  2PAJ A;  2Q9I A;  2MTA C;  5CCH A;  1DVH A;  5E79 H;  2N3B A;  1BE3 D;  2QA4 P;  1KYO H;  1YTZ I;  3W68 A;  3S9O A;  3KYQ A;  3BRT B;  5AVQ B;  1LTA C;  3H1K G;  2Q6Q A;  3X39 A;  2E75 D;  2HR3 A;  3H1I E;  4I7Z C;  4I7Z B;  2P58 A;  2QE7 H;  2POH A;  2QG4 A;  2W6B A;  4DJG A;  3EFG A;  2C1D B;  1S6V B;  2B9B A;  1U7J A;  3PHL A;  4OWF A;  3F89 A;  4GOD A;  2ZYD A;  3KZI E;  5DJT B;  2ZXY A;  1ZN5 A;  1NML A;  1CTY A;  3AE9 C;  3A0H E;  2OQQ A;  1PPJ G;  1DW3 A;  1M7L A;  1LTI C;  2WVR A;  1VQO P;  2O3J A;  3CXH W;  1NU1 E;  3SFE C;  1CZQ A;  1A8C A;  1M1K Q;  3H1H J;  3CX5 W;  1BSN A;  1K3H A;  3CC2 P;  2BCC D;  4PV1 D;  3OA8 B;  1LC2 A;  2K9Y A;  1D7M A;  3NXS A;  2HOD B;  3S4R A;  2B88 A;  1IZN B;  1OVU A;  4HJG H;  1T6A A;  4C46 A;  1YJN P;  1CSX A;  3PH2 B;  1H0T B;  3I56 P;  3SVW A;  1AVO A;  1RF1 C;  1RF1 B;  1CXC A;  1NGM B;  1SQX G;  4EI2 A;  3C2C A;  3CXH H;  2OZ1 A;  3A7O A;  1OVV A;  3G71 P;  4I2L C;  1OW6 A;  1LFM A;  2L4D A;  1HUC A;  1QX8 A;  1JNM A;  4FAV A;  1ZRT D;  4Q5P A;  1RZ6 A;  2C9X B;  5TIS H;  2QM7 A;  1YJW P;  1KIL A;  1L0L G;  2N1T C;  4YTP C;  2N1T B;  1HZU A;  3MK7 C;  3MK7 B;  1K8A Q;  1NWQ A;  4XYD B;  1A2S A;  2KLV A;  1EZV E;  3L75 G;  3O0R C;  1N7L A;  1YCC A;  3WUV A;  3KZI H;  1M1J C;  1M1J B;  3Q1M A;  3U59 A;  3CCV P;  1GDV A;  2Z4E A;  4A7P A;  5CJ4 A;  2DGE A;  4WQB A;  1LTB C;  3O5C A;  2HG5 D;  1WVE C;  1WT6 A;  2E74 C;  2E74 B;  1C52 A;  1R5S A;  1NMI A;  2KOG A;  2FYU J;  3GHG C;  3GHG B;  2YO2 A;  3ORV A;  2B87 A;  4J20 A;  4N0K A;  3H1K D;  1YYC A;  2BCC E;  3CME P;  1KD1 Q;  2V7Q J;  1I55 A;  4WQA A;  1RE4 A;  2Z5I A;  3O6Q B;  1DD3 A;  3WUI A;  2KP8 A;  3H1L G;  1W2L A;  2IBZ I;  3CLQ A;  1SQP G;  3RK2 C;  3RK2 B;  1W2E A;  2I1K A;  1J1D C;  5KAI V;  1GZL A;  1J1D B;  4B86 A;  3Q3D A;  2Q3I A;  2A06 G;  5H2F E;  2Q7C A;  4O1W A;  1GIW A;  2W6A A;  4OH8 B;  1I8P A;  1QN2 A;  2O1J A;  1LJ2 A;  3H1J G;  2QSI A;  1ZR4 A;  1ZRT E;  3L71 D;  4R4L A;  5AW6 B;  4FA1 A;  2FKW B;  1SVF A;  3A0H V;  3BCC J;  5AVR B;  2O01 N;  1R8E A;  2H8P D;  5KLV E;  3SLE A;  1RQU A;  3AE5 C;  1FOS F;  1NTZ G;  1EB7 A;  1RHZ B;  1NJI Q;  1FCD C;  2ZJS E;  3OA8 A;  4MU8 A;  3V2R A;  5KAF E;  3HQ8 A;  1KIB A;  1H0T A;  3SWS A;  1SQQ J;  1LTJ C;  1LTJ B;  4K3A A;  3RBX A;  1JY2 N;  3MGN A;  2FYU E;  1SQX D;  1VPC A;  2ITA A;  3GG2 A;  1CYC A;  1BGY J;  4RSZ A;  3PXS A;  2IYO A;  4UB8 E;  1HWT C;  3WU2 E;  2QVA A;  1SQB J;  2YQB A;  1GL2 D;  2QRX A;  1YI2 P;  3JSV C;  2YXR B;  1L0L D;  1PZQ A;  4WWI A;  2N1T A;  1FJP A;  3CMA P;  1YNR A;  2WSF H;  1RF0 C;  2C0X A;  1XTG B;  2E75 B;  3L72 D;  2O01 J;  3L73 G;  1FOC A;  4H0K A;  1KYO I;  1JY3 O;  1N15 A;  1OW7 A;  3G9R A;  2J59 M;  3CYT I;  3BCC E;  2B11 B;  1PPJ E;  2NPS A;  3A0B H;  1FC2 C;  1ZP0 C;  2Y0C A;  3M0D C;  4IFM A;  1CCH A;  5B66 E;  1GU5 A;  1ETP A;  1C2R A;  155C A;  2QIW A;  2E42 A;  3PTZ A;  5H2F H;  1NYH A;  4RES B;  2HFE D;  1LTT C;  1MZ9 A;  4M3L A;  1RAQ A;  3AE2 C;  5CYT R;  4Y5R A;  2LIT A;  4AQR D;  5AW5 B;  1DW2 A;  1CSB A;  3CCQ P;  4AYC A;  1NTK G;  5KAF H;  4PV1 C;  4PV1 B;  4C7N B;  3U1C A;  3QH9 A;  2ZYA A;  4N78 E;  1P84 D;  5EXQ A;  3CCR P;  2CPS A;  3ABV C;  3HUS A;  4EOT A;  2A06 D;  1URQ C;  1URQ B;  3WUU A;  2HV4 A;  4AAO A;  1QL1 A;  4I6M C;  5CCG D;  1E29 A;  2FYZ A;  2E43 A;  1HF9 A;  1SQV D;  3H1J D;  3TF5 A;  2KS1 B;  3MHV A;  4DY9 A;  3TGU J;  1VQ7 P;  1SQV K;  2OAR A;  4FA4 A;  1FHB A;  2XKM A;  4GOF A;  1JCD A;  5DF5 A;  3WFD C;  3II6 A;  3R2P A;  2WT7 A;  1C6O A;  3CXH I;  1GD2 E;  2M5A B;  1PL5 A;  3M97 X;  1IK7 A;  1YJ9 P;  3NMD A;  5AW4 B;  5CCH C;  1NTM J;  3ZDM A;  1QL4 A;  1QVG O;  3L75 E;  2OTK E;  3FXE A;  3VMX A;  1CYI A;  1KN7 A;  2RKL A;  2OYO A;  1L0N D;  1CTZ A;  4XFJ A;  2V07 A;  2HPC B;  2ZBO A;  1L0N K;  1QGK B;  1HJ0 A;  1CRI A;  3HQ9 A;  1SFC A;  2NPS D;  5CBN A;  1KQL A;  3VOP A;  4KHX A;  4BRY A;  3CD6 P;  1Q82 Q;  2B12 B;  4UB8 V;  5KLI B;  1ZW0 A;  3CXH D;  4EIF A;  1C75 A;  3WUT A;  3H1L E;  4XA4 A;  1EDJ A;  3IF4 A;  1EZV G;  3CX5 D;  4UB6 V;  1VQ6 P;  1YFC A;  1NH4 A;  1AKK A;  3H1H G;  1RF0 A;  1BL9 A;  1SQP E;  1KV4 A;  1P84 E;  1NAF A;  1DW1 A;  4GOE A;  3L70 J;  1ZOY C;  3AE7 C;  1VDF A;  3SWF A;  2I8D A;  5AW3 B;  3M0D A;  3H1I D;  2QJP C;  1GU2 A;  2QJP B;  1B7V A;  1LWU A;  4U7J A;  5CMZ A;  1S72 P;  1ZLL A;  1U75 B;  5APY A;  1QL3 A;  1I6E A;  4N6J A;  1YTC A;  1NTZ E;  2K1A A;  1S9K D;  2MHM A;  3MZW B;  1T3U A;  2GM4 A;  2WPR A;  1JO5 A;  2N3Y A;  3FX0 A;  1CSW A;  2JTI B;  3AEA C;  3G3Z A;  1COR A;  3VMY A;  2OZ1 B;  1KZU B;  3H32 A;  4I1L A;  2BAS A;  2VHD A;  1LS9 A;  1EDK A;  4C7N A;  2GUS A;  2P2U A;  5APT A;  3N4X A;  3RK3 E;  3AEC C;  1NU1 K;  1OFC X;  1WEJ F;  2EXV A;  2ZVN B;  2N9B A;  3CCE P;  2OYH B;  2R3C A;  2KS1 A;  1HJ3 A;  1BDD A;  1JEK A;  1YEA A;  4RKU J;  2IX7 C;  4IFD K;  3PXT A;  3KPE A;  3HQ7 A;  1EC5 A;  4ASW A;  1SFC D;  3HQ6 A;  3EQ2 A;  2M5A A;  3G4S P;  1VQN P;  2FYU G;  3SWK A;  1X22 A;  3L73 E;  1T8Z A;  1GL2 C;  1GL2 B;  1IC2 A;  3MUD C;  3AE1 C;  4EYY Q;  2XV5 A;  4BWN A;  1U7M A;  2FYN C;  3GW6 A;  3LW5 H;  2FYN B;  2B87 B;  1SP4 A;  3PRJ A;  3VYI A;  1IO4 A;  2Y0D A;  3Q5P A;  2BH5 X;  1MKM A;  2WPS A;  3N7N A;  1P84 H;  4RO0 A;  1FZA A;  2GIW A;  4H13 D;  2HPC A;  1RE4 C;  1SS1 A;  2JEE A;  4WBA A;  2ZXE B;  3RL0 g;  1X79 B;  1S9K E;  5KAI E;  2FWL A;  2LR2 A;  4JF7 A;  3RL0 D;  5CBO A;  1IFP A;  2PRR A;  3TSI A;  4W7Z A;  4JBZ A;  1UIX A;  4WY4 D;  1EZV D;  1BE3 J;  1GMJ A;  3CL3 D;  1NTK E;  2R3S A;  1FJ0 A;  3BCC G;  1KQS O;  4WQE A;  2KXP B;  1CIE A;  5KKZ C;  3WMM 0;  5KKZ B;  4L73 A;  351C A;  1I54 A;  2LXC B;  3ZOW A;  2KUB A;  3NTN A;  3AE6 C;  3IFM A;  4BXL A;  1W2B O;  2M3B A;  1IO3 A;  1SQQ G;  2C1U A;  3M9B A;  3NBT A;  3CCU P;  1KB9 E;  2I1J A;  2C1V A;  2ZXX A;  5AW7 B;  5E79 V;  1BGY G;  2KB7 P;  1KOR A;  5DJQ C;  1CHH A;  5DJQ B;  4EID A;  4H0L D;  2M0B A;  4L75 A;  1OIP A;  1DVV A;  1CC5 A;  1QL2 A;  2G3A A;  1SQB G;  1HVV A;  2BEZ F;  2FXM A;  3CWB J;  3CX5 H;  1EDI A;  1ZZH A;  2PCC B;  451C A;  1LNQ A;  1AOF A;  4NFG B;  4ASV A;  1JDL A;  1PFI A;  1IJD B;  5KLV D;  5AVS B;  3L4O A;  2OYH A;  5KLV K;  1GKS A;  5CIF B;  4WQC A;  2P7J A;  2ORL A;  1CYJ A;  1T3J A;  3P8C E;  4PD4 E;  2ZT9 D;  2A45 G;  3CCL P;  2K88 A;  2CPB A;  4AX3 A;  4KT0 J;  3H1H E;  1FJK A;  1FS0 E;  2FYU D;  3MTU E;  2NPS C;  4L74 A;  2NPS B;  3LIE A;  5AW2 B;  2H43 A;  1PGO A;  4HYT B;  5KTB A;  1GL2 A;  2AEF A;  4D6T J;  1IFI A;  1X9V A;  3MUD A;  1LC1 A;  3A0H H;  3MP7 B;  1CCR A;  4DT0 A;  3WFB C;  5K5G B;  3C9I A;  1IZL 0;  1K73 Q;  1VL2 A;  1JB0 J;  1K05 A;  3KDP B;  1FBM A;  2RN0 A;  4R4M A;  1NKN A;  5AVU B;  3QWO C;  2YO3 A;  3L74 J;  1LT1 A;  1CXA A;  4AAM A;  3RGU A;  1AVY A;  4IOI H;  2GUV A;  3CWB E;  4PJ0 V;  2UWJ E;  1HRC A;  5BU8 B;  3OCD A;  1NOH A;  1JM0 A;  3HUS C;  3HUS B;  3BRV B;  2ZVO B;  2JWA A;  4JQ0 D;  1YIQ A;  5AVX B;  5CJ0 A;  1CIF A;  3BCC D;  3TGU G;  1PPJ D;  2RMZ A;  4L76 A;  3EFF K;  1USE A;  5AUR A;  2N18 C;  2N18 B;  2K9J A;  3HD7 A;  3SSU A;  1KX7 A;  3VN0 A;  3UIA A;  2AIU A;  1NTM G;  1S1C X;  3VTP C;  3ZOO A;  1YIT P;  2WT7 B;  1K04 A;  3HE5 B;  2E5T A;  1PIX A;  2KYV A;  1U74 B;  2K3R A;  1BGY D;  2IPP A;  1Z56 A;  2XTS B;  2IFM A;  3D6Z A;  1JY2 P;  5APW A;  1JY2 O;  5CCG A;  1VQ5 P;  2GC4 D;  1FE6 A;  1QKS A;  1T2K D;  4N78 D;  4FB1 A;  3L71 J;  1YIJ P;  4ZKU A;  2SPZ A;  1SQX K;  1S2E A;  1FZF A;  1N7S D;  2JWD A;  1YQ3 C;  1I8O A;  1SFC C;  1N90 A; 
#chains in the Genus database with same CATH homology
 3JBT B;  4AAL A;  5B6Q A;  4GED B;  4U3F D;  3CP5 A;  4EIC A;  4D6T D;  1CYI A;  3NWV A;  4V2K A;  3PLN A;  3ZIY A;  2YIU B;  1L0N D;  4H0J A;  1CTZ A;  3VMA A;  5CIB B;  1VYD A;  2I8F A;  4LJI A;  3TYI A;  2V07 A;  2ZBO A;  1C6R A;  2KNC B;  2MTA C;  1RAP A;  1DVH A;  1CRI A;  3HQ9 A;  1QYZ A;  4WQD A;  2N3B A;  1BE3 D;  2YCC A;  3DP5 A;  1CSU A;  2V08 A;  3PXW A;  1H33 B;  1FI9 A;  3L75 D;  2B12 B;  2D0S A;  4UB8 V;  2BPB B;  5KLI B;  3X39 A;  3L74 D;  3CXH D;  4EIF A;  2QG4 A;  1C75 A;  1A56 A;  1DW0 A;  2C1D B;  1S6V B;  3CX5 D;  4UB6 V;  1YFC A;  1AKK A;  1BL9 A;  3PHL A;  2C8S A;  1HCM A;  1CHJ A;  1DW1 A;  2ZXY A;  5TIS V;  2B10 B;  1NML A;  1CTY A;  3TDK A;  1IRW A;  2C1D A;  3H1I D;  1GU2 A;  2QJP B;  1B7V A;  1DW3 A;  3H1L D;  1U75 B;  2Y0E A;  2O3J A;  3CXH W;  1QL3 A;  1I6E A;  2D0W A;  1YTC A;  1A8C A;  2MHM A;  3A9F A;  3O1Y A;  2DVH A;  1SQP D;  3CX5 W;  2CA3 B;  3CU4 A;  1K3H A;  2Q3E A;  2BCC D;  2N3Y A;  1CSW A;  1F1F A;  1CRG A;  2JTI B;  3OA8 B;  3TGU D;  1LC2 A;  1SQQ D;  3KZI V;  1COR A;  3DR0 A;  4JCG A;  2OZ1 B;  3SXT A;  4FAN A;  1YIC A;  1CSX A;  3PH2 B;  2VHD A;  1LS9 A;  3SVW A;  5GTI V;  1NTZ D;  1CXC A;  1CSV A;  2BLF B;  1NTM D;  1H31 B;  2ZON G;  4GYD A;  3C2C A;  1WEJ F;  1IQC A;  2OZ1 A;  2YK3 A;  3A0B V;  2ZZS 1;  2EXV A;  1SQB D;  1LFM A;  2L4D A;  1CO6 A;  2IBZ D;  2PAC A;  2KS1 A;  1HJ3 A;  1H9X A;  4FAV A;  1YEA A;  1ZRT D;  4Q5P A;  1RZ6 A;  1L9B C;  2C9X B;  3PXT A;  5CIG B;  1C6S A;  3HQ7 A;  1HRO A;  1N50 A;  1HH7 A;  1OAE A;  1I5T A;  1KV9 A;  3HQ6 A;  3VNW A;  1HZU A;  3MK7 C;  3MK7 B;  2AI5 A;  1KB0 A;  1CIG A;  3ITK A;  4XYD B;  1A2S A;  1H1O A;  3GW6 A;  1M6Z A;  2FYN B;  3PRJ A;  2Y0D A;  2ZOO A;  3O0R C;  2BH5 X;  1YCC A;  5CIE B;  4XXL A;  1C7M A;  3L4M A;  1CNO A;  1GDV A;  2GIW A;  5B5E V;  4A7P A;  2DGE A;  4WQB A;  1M70 A;  3O5C A;  4L3H A;  1S5L V;  1WVE C;  1C52 A;  3L73 D;  2FWL A;  1NMI A;  5CID B;  3ORV A;  1H33 A;  1GQ1 A;  2QJY B;  4J20 A;  2LIR A;  4N0K A;  3H1K D;  1HZV A;  1CED A;  1EZV D;  1I55 A;  5C0Z A;  4WQA A;  4AAN A;  1FJ0 A;  1IRV A;  4O1Q A;  2PCB B;  3WUI A;  4WQE A;  1I6D A;  1NNO A;  4IL6 V;  1W2L A;  1CIE A;  5KKZ B;  4KMG A;  3SJL A;  4PWA A;  351C A;  1I54 A;  2JQR A;  3ZOW A;  2CXB A;  1MZ4 A;  5KAI V;  1N9C A;  1YEB A;  1HJ4 A;  1IO3 A;  1RZ5 A;  4O1W A;  4P4Q B;  2C1U A;  1CRC A;  1GIW A;  4WQ8 A;  3NBT A;  1AYG A;  4FA5 A;  1NTK D;  1I8P A;  1QN2 A;  5CIC B;  1KYO D;  2C1V A;  3L71 D;  1LMS A;  2B0Z B;  5E79 V;  4FA1 A;  1E2R A;  3KHU A;  3A0H V;  2N9Y B;  3SLE A;  3RLM A;  1EB7 A;  3VYM A;  1FCD C;  2N9I A;  3OA8 A;  4WQ9 A;  5DJQ C;  1CHH A;  5DJQ B;  4EID A;  4MU8 A;  2B4Z A;  1DVV A;  1CC5 A;  3HQ8 A;  3WC8 A;  1KIB A;  4YE1 A;  1K3G A;  4EDF A;  3SWS A;  1ZZH A;  2PCC B;  4FA9 A;  5H2F V;  4WQ7 A;  1KB9 D;  451C A;  5IY5 1;  1AOF A;  4NFG B;  1JDL A;  1H31 A;  1SQX D;  3ZOX A;  5KLV D;  3GG2 A;  1GJQ A;  1CYC A;  1CRY A;  4RSZ A;  5TJH A;  3ZBM A;  3PXS A;  3L4O A;  1M60 A;  4L3G A;  1GKS A;  5CIF B;  4WQC A;  1CRH A;  1W5C T;  2ORL A;  5KAF V;  1J3S A;  1CYJ A;  5GTH V;  1C2N A;  2YQB A;  4QAO A;  3FWL A;  4AX3 A;  1L0L D;  2FYU D;  3WFC C;  3DMI A;  1YNR A;  3L70 D;  2BCN B;  1PP9 D;  2GB8 B;  4PW9 B;  3L72 D;  1LC1 A;  2C2C A;  1H32 B;  1CCR A;  1FOC A;  4H0K A;  5C9M A;  1N15 A;  3WFB C;  1DII C;  3RMZ A;  3CYT I;  3ZOY A;  2CE0 A;  3OCD B;  1IZL 0;  3O20 A;  4PD4 D;  1NIR A;  2B11 B;  3WU2 V;  2AXT V;  2Y0C A;  1CRJ A;  4RJT A;  1CCH A;  1FI3 A;  3ZCF A;  3H1H D;  1CIH A;  1ETP A;  2QJK B;  1KX2 A;  2RN0 A;  1C2R A;  1COT A;  155C A;  4EIE A;  1H32 A;  3PTZ A;  1CXA A;  4AAM A;  1H9Y A;  4PJ0 V;  3VRD A;  1HRC A;  1CHI A;  2N9J A;  3OCD A;  2K9J B;  2FRC A;  1E8E A;  2JWA A;  5CIH B;  1YIQ A;  1CIF A;  3BCC D;  1RAQ A;  1PPJ D;  4Y5R A;  2LIT A;  5CYT R;  1CTJ A;  2RMZ A;  3NBS A;  1DIQ C;  2GC7 D;  2CA4 B;  1DW2 A;  4L1Q A;  1F1C A;  3RN1 A;  5AUR A;  5B66 V;  1MG2 D;  1MG3 D;  2N18 C;  2N18 B;  4K3I A;  2BGV X;  1KX7 A;  1P84 D;  5EXQ A;  1OCD A;  3CWB D;  3WFE C;  2A06 D;  2AIU A;  2L91 A;  3ZOO A;  1AOQ A;  2HV4 A;  4AAO A;  2CE1 A;  1E29 A;  5DFS A;  1SQV D;  3H1J D;  1FI7 A;  3RN0 A;  1U74 B;  3TF5 A;  1HJ5 A;  1BGY D;  2XTS B;  4DY9 A;  1NU1 D;  4FA4 A;  2BH4 X;  1FHB A;  1BCC D;  2GC4 D;  1QKS A;  5DF5 A;  3WFD C;  4FB1 A;  1KYO W;  1C6O A;  1L9J C;  1R0Q A;  3M97 X;  1DT1 A;  1I8O A;  1N90 A;  1QL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...