1KYOD

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
245
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 66
structure length 245
sequence length 245
chains with identical sequence O
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1kyoD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1kyoD01
4FB1A 2YK3A 1HZUA 1R0QA 2VHDA 1F1CA 2CA4B 3L70D 4UB8V 2YQBA 2QJKB 1HJ4A 3DP5A 1KB9D 2BH5X 2EXVA 4L3GA 2ZXYA 1HROA 3KZIV 1C75A 4EIFA 3DMIA 2BGVX 4WQAA 2N9IA 1RZ6A 2HV4A 4EDFA 1NMIA 3L71D 1YEAA 1M70A 5CIGB 5KAFV 2ORLA 1PP9D 5CYTR 3RMZA 3SVWA 3BCCD 1IQCA 1CHIA 1EB7A 4AX3A 1YNRA 5TISV 1CC5A 3PXTA 5CIBB 1H32A 1LC2A 4FA5A 4Y5RA 2Y0CA 1MZ4A 1CXCA 3MK7B 1YFCA 4QAOA 1H31A 5GTIV 1CHHA 1MG2D 2N9YB 3HQ7A 4MU8A 1QYZA 1CIEA 4PD4D 3A9FA 2JQRA 2L91A 2LITA 3DR0A 3H1KD 1S5LV 1C6RA 3MK7C 3OCDB 2C1DB 1C6OA 4EICA 1WVEC 5DF5A 1YTCA 2AI5A 2GC4D 1NTKD 1SQPD 2OZ1A 3O5CA 4JCGA 3VNWA 2KS1A 4AAMA 2BPBB 1KIBA 2N9JA 1E2RA 1ETPA 2BCNB 5CIEB 1SQVD 4EIEA 2JWAA 3PHLA 2DGEA 1KB0A 2C1DA 3L4MA 1CIFA 3L75D 2CE0A 1FI7A 2AXTV 1B7VA 2QG4A 3PXSA 4GEDB 1DW2A 2ZBOA 1CSXA 5KAIV 1FJ0A 1H9YA 2PCBB 3CWBD 4O1QA 1DIQC 4PWAA 1CTZA 1CORA 1GDVA 1GIWA 351CA 5B6QA 1FI3A 1ZZHA 1FCDC 3CX5D 1M6ZA 1M60A 2PACA 3TDKA 1CRIA 1KV9A 4IL6V 2BLFB 3ZOWA 4XYDB 3WU2V 3WFEC 2CE1A 5CICB 1VYDA 1CSUA 1KYOD 2ZOOA 2QJYB 3PXWA 1YIQA 2ZZS1 4V2KA 2CA3B 1ZRTD 1CYCA 1HZVA 1AYGA 1I6EA 5GTHV 4RJTA 1U74B 1L9JC 1QN2A 5KLVD 2D0SA 1GU2A 5E79V 2V08A 2B12B 1HH7A 1DW0A 3WFBC 1CYIA 4D6TD 3OA8B 2DVHA 2FWLA 1LFMA 1I8OA 4PJ0V 1A56A 1I8PA 3PH2B 4AANA 4K3IA 3H1LD 1H32B 4FAVA 4WQ7A 451CA 1DT1A 1QL4A 3A0BV 3HQ6A 1W5CT 3CXHD 1NTMD 2C2CA 1RAQA 5DJQB 3NBTA 1KX7A 3CYTI 3OCDA 2GIWA 2B11B 1BE3D 3ZIYA 4FA9A 1CCRA 3JBTB 4XXLA 1RZ5A 1MG3D 3TF5A 1J3SA 4L1QA 4UB6V 2C1UA 5IY51 1U75B 1H31B 1H1OA 2K9JB 2MHMA 1NTZD 1L0ND 4N0KA 3PRJA 1A2SA 3HQ8A 1CRHA 4U3FD 4J20A 2JTIB 5DFSA 2KNCB 2CXBA 1N15A 1NNOA 1OCDA 3L74D 5C0ZA 3GW6A 1L0LD 3ORVA 2N3BA 1GJQA 1CCHA 2AIUA 3ZOXA 1H33A 1PPJD 3NBSA 1E29A 1E8EA 1H33B 1CTYA 1IRVA 4WQCA 1F1FA 2Y0EA 4AALA 3L72D 2C9XB 3O0RC 1N50A 1CNOA 1HRCA 3NWVA 4L3HA 3L4OA 3ZOYA 3RN0A 5TJHA 3GG2A 3FWLA 1SQXD 4WQBA 1A8CA 3A0HV 4RSZA 1H9XA 1NU1D 1QL3A 2A06D 1KYOW 3ZOOA 1I6DA 1HJ5A 1BCCD 2B10B 3RN1A 3PTZA 3TGUD 1AOFA 1N9CA 4WQEA 1IO3A 3ITKA 1CIGA 155CA 1CRJA 2B0ZB 3WC8A 1KX2A 2C8SA 2N18B 1I55A 1CSVA 1HJ3A 4DY9A 2IBZD 1YCCA 4KMGA 1DVHA 2L4DA 1JDLA 3X39A 3ZCFA 3TYIA 4O1WA 1FOCA 4WQDA 1LMSA 2QJPB 3O20A 1GQ1A 1WEJF 2Q3EA 3O1YA 1OAEA 2N18C 5H2FV 1EZVD 3WFCC 1CO6A 3CP5A 1LS9A 1C6SA 3KHUA 1W2LA 3RLMA 2PCCB 1CIHA 1CRCA 2N3YA 1NIRA 2YCCA 1CEDA 5AURA 4WQ8A 2BH4X 3C2CA 4H0KA 2Y0DA 3H1HD 5DJQC 3M97X 1DW1A 1IRWA 1CYJA 1CTJA 1GKSA 3SLEA 1L9BC 4GYDA 4WQ9A 2LIRA 4LJIA 5B66V 1COTA 2D0WA 1IZL0 1HCMA 3VMAA 5CIHB 1C52A 2YIUB 3H1ID 2OZ1B 2BCCD 2FYNB 1DW3A 2FRCA 1P84D 4NFGB 3HQ9A 4H0JA 2FYUD 1CXAA 2O3JA 1FHBA 2C1VA 3PLNA 4Q5PA 3H1JD 1C2RA 2XTSB 1AKKA 1FI9A 1RAPA 5KLIB 2V07A 4A7PA 4P4QB 2RN0A 3WFDC 1SQBD 1CRYA 2GB8B 5B5EV 4FA1A 3WUIA 1C2NA 3L73D 3SXTA 1C7MA 1CHJA 1QKSA 1CRGA 1K3GA 1I54A 5CIDB 1SQQD 1AOQA 1CSWA 1N90A 3VRDA 3SWSA 4AAOA 5KKZB 3VYMA 3OA8A 2I8FA 1DIIC 4FANA 5C9MA 4FA4A 1LC1A 1K3HA 2RMZA 2MTAC 3CX5W 1DVVA 3CXHW 1BL9A 5CIFB 4YE1A 1NMLA 4EIDA 3ZBMA 1BGYD 1YICA 1I5TA 3CU4A 2ZONG 1YEBA 5EXQA 3SJLA 2B4ZA 4PW9B 1S6VB 2GC7D
chains in the Genus database with same CATH superfamily
4FB1A 2YK3A 1LTBC 2WSEJ 4LGDE 2HPCA 1KQFB 3AEEC 1K05A 3IF4A 2IDBA 2ZXYA 2W27A 4EIFA 4D6TJ 1S72P 2N9IA 1YEAA 1QVFO 3N4XA 1NTME 2KI7B 1ZMEC 1PP9D 3RMZA 3SVWA 3JCUE 2Y9YA 3H25A 3BCCD 2XU6A 4IFFA 1YNRA 1X8YA 1Q7YQ 5AW1B 2B89A 4GIFA 2A45G 2W8ZA 1LP1B 1DX7A 5CIBB 4Z1MH 1H0TB 5AVYB 3MK7B 1NWQA 1VQLP 5KKZC 2C9LY 1H31A 3H6PA 3TK1A 5KJ7D 3H32B 4L73A 3A9FA 3AE8C 1JNMA 2P1JA 1S5LV 3H1IG 3L70E 4OGQB 5AW5B 5DF5A 1BDDA 2N9BA 5CCGC 2HPCB 3LIEA 2FYZA 1JTHA 3VMYA 1ETPA 2BCCE 1SQVD 1PGOA 2PRRA 3LW5J 1BCCG 4M3LA 1JY2N 4C46A 1KYOE 3V6IA 5DJTB 3G71P 3L75D 4N3YB 3RL0g 3MUDC 3D0WA 1LGHB 1GU4A 1G1IA 4GEDB 1MKMA 4GODA 2KSEA 1DIQC 1GIWA 351CA 4IL6H 1L0NE 1FCDC 3TDKA 1NTKJ 1CW5A 1SQXK 3KDPB 3KYQA 2OYHB 1T8ZA 3WU2V 3HE4A 2KZJA 1K9MQ 1N7LA 2QJYB 3PXWA 1U57A 4WY4D 1RHZB 4V2KA 3CMEP 1E5WA 3H1HE 4D6TE 2OYHC 3N7NA 3G3ZA 3CC2P 1JO5A 3CCQP 1AQTA 1L9JC 4I7ZC 2D0SA 3Q3DA 1PGQA 2E76B 1L0NK 3RL0C 5APYA 5H2FH 5CCHA 2O01N 1H88A 1NHLA 3WFBC 1CI6A 1RH5B 2FYNC 3B8EB 3M0DA 1CSBA 1LFMA 1QL2A 2WITA 1A56A 4W80A 3W67A 3JSVC 5CCHC 1GW3A 4DJGA 1QL4A 2C0WA 4JPZB 3HQ6A 1BGYE 1QEXA 1NTMD 3HE5A 3C1LA 2OYIA 1ZW0A 4FA9A 3CWBG 4DOJA 2OGUA 4UB6H 2O1JA 4EYYQ 1J3SA 3AEBC 4IL6X 1KN7A 5IY51 1OVRA 2K3RA 1LWUC 2LXBA 1EDLA 3L73G 1NJIQ 1Y47A 1NTZD 4OGQC 3B5NB 4GOFA 3RL0D 1CRHA 2IBZI 1M1JA 2VRSA 1NNOA 2ZT9C 3SFEC 3OJAB 3GW6A 1L0LD 1PV3A 4UB8H 1SQVG 4GDOA 3ZOXA 1H33A 1PPJD 3NBSA 3CL3D 1NO4A 2OTKE 1H33B 4GOEA 4GT1A 1CTYA 2WSSH 2CPSA 2Y0EA 1IK7A 1GL2D 2IYOA 2M5AA 1HRCA 3NWVA 3L35A 3L4OA 2UWJE 2NZ2A 5CJ4A 3HUSA 1N7SA 3CXHI 1SQVE 1IFPA 3S1KA 2IBZE 1NTZJ 4I2LC 1NU1D 2HYNA 1RF1C 1URQB 1OW8A 1EZVI 1PFIA 3CLQA 3GF7A 2B10B 3RN1A 3PTZA 3D71A 1IO3A 1KTMA 2E5TA 2WSFH 3WC8A 3M9QA 1HJ3A 3AEGC 2H43A 5CMZA 1FE6A 4KMGA 3G4SP 3A2AA 4PD4E 4Y28J 4HKZH 2JKVA 2ZJSE 3MHVA 1OAEA 4JF7A 3BASA 1EZVD 1NU1J 1EDKA 1M57D 3CP5A 2YIUC 3L37A 2R3SA 1RQVA 3RK2D 3SWKA 2E43A 3CCRP 2ZYGA 4U3FE 3RBZA 4R4LA 2ZT9B 1CIHA 3SWYA 2N3YA 2ZVNB 3SFDC 1L4AA 1SQPG 5AURA 2N1TA 3H1LJ 2R5DA 3D6YA 1W2EA 1YQ4C 1KILA 1OX3A 1RF0C 1QX8A 2KLUA 1KC8Q 1SQBJ 1ZV8A 1FDIA 2P10A 1IC2A 3V2QA 1MFTA 1ZR4A 1FU1A 2BASA 2SPZA 3KPEA 3L73J 1HCMA 5CIHB 1C52A 2A06G 1JY3N 2KK7A 3S9OA 1USEA 1DW3A 3TYYA 1N7SB 1LNQA 4NFGB 2I1JA 3H1LG 5AW7B 3T97A 2M8RA 2FYUD 1PPJE 2O3JA 3TGUE 4U3FJ 4H44C 3H1JD 2B87A 4BRYB 2E74D 1E79H 1RAPA 2MJZA 1DD4A 1ZP0C 2HFED 2RN0A 3WFDC 5KJ7C 2GB8B 1GZLA 1LTTC 1H8AA 3L73D 4MN4C 1OMIA 3SSUA 1I54A 5AW0B 3VN0A 1LTAC 3W68A 1KV4A 3MD0A 3OA8A 4RKUJ 4JYCA 4ZMDA 2K88A 4KHXA 1LTSC 4I7ZB 5APUA 1AA0A 2RMZA 2Q5UA 2JJLA 1LTJA 1Q90D 1T6AA 3CC4P 4BWNA 2P7JA 3WUUA 1GD2E 1I5TA 5KLVE 2A45I 5KAFE 1JCCA 1EXIA 3H32A 4JBZA 2B4ZA 1H0TA 1S6VB 3FWNA 2GC7D 1OXZA 2QM7A 1F1CA 2H8PD 1JY2P 3L70D 3MIWA 1BCCE 3SWFA 2W6JH 1FOSE 2Y9ZA 2OTLP 1Y9BA 3NMDA 3DMIA 2BGVX 1OFCX 1RZ6A 1NMIA 3G9RA 1KD1Q 1M70A 3NTNA 2ORLA 5KLVK 2OARA 1BE3E 1KORA 1L0NG 1N86A 2P67A 4OH8B 1IQCA 1CHIA 2XNDH 2FXPA 1NTMJ 4ASVA 5TISV 2Q6QA 2DW3A 1NTKE 1IJDB 1RF1A 3GHGA 1MZ4A 1OIPA 4K35A 3L70J 1YFCA 4QAOA 1BE3G 1IFIA 3CXHE 2IFNA 3HQ7A 3HTKA 5KLIC 2YXRB 1L0NJ 2JQRA 2LITA 3H1KD 3L71J 3WUTA 3MK7C 2GM4A 1URQD 2OQQA 1TU3F 3BRTB 4AUWA 1NTKD 2WSCH 2OZ1A 2WWWA 5AW2B 1QGKB 1FZBA 1YYCA 1IZNB 1YIJP 1KIBA 2GA1A 2N9JA 1E2RA 3C9IA 2WMMA 3AE9C 1KQLA 1P84E 2DGEA 1KB0A 5K5GB 3L4MA 4WWIA 1NAYA 2CE0A 2WQYC 2E74C 2O1KA 2AXTV 2Q7CA 1DW2A 2IPPA 1CSXA 1H9YA 5BU8B 4O1QA 1CTZA 4WVZA 1CORA 4HYTB 1GDVA 1FJKA 1KILB 4B86A 1YJ9P 1SQQJ 1L2PA 1FI3A 1MFZA 1MUUA 4ASWA 2Q9IA 2OYIB 2V7QJ 3CX5E 2PACA 2W90A 1T2KD 1CZQA 4IL6V 2KNCA 5B66E 3WFEC 4YXDC 1P84I 1YIQA 2HLOA 1RQUA 4UB8E 5APTA 4TT3H 5APSA 1UIIA 1AYGA 1VQ5P 2W6BA 3A0HH 1I6EA 1G2CA 3A0BH 2FXMA 1J1DC 1S4XA 1QN2A 1X79B 1GU2A 1JUNA 2KOGA 2B12B 4HJGH 1LTJB 3D70A 1R5SA 4WBAA 3OA8B 1W5CE 2JDIH 2IBZG 3FXDA 1R5LA 2AEFA 2E76D 1URQC 3H1LD 1H32B 4FAVA 4L76A 4WQ7A 1Q2NA 1DT1A 3A0BV 2QJPC 1URQA 1USDA 1M90Q 3CC7P 1W5CT 1LWUB 3CX5I 3RK2B 3NBTA 2NPSA 2QVAA 3CYTI 3OCDA 1BE3D 2XV5A 1IO4A 5TISH 2YXQB 1S5LE 3GLMA 3WUVA 1VQPP 3TF5A 3RK3C 2AXTH 4L1QA 3L71G 4WY4B 4UB6V 4L74A 1T3UA 3TNUB 2BCCG 2KSJA 2I8DA 4D6TG 2K9JB 2MHMA 2FKWB 1N73C 4N0KA 1SQQK 3PRJA 3HQ8A 2JTIB 3FX0A 5DFSA 1N15A 1OCDA 2N1TC 2XDJA 2H88C 1OVVA 1VQOP 1WMKA 1VQNP 3IFMA 1Q81Q 1IRVA 2JO1A 2P58A 1N50A 4CPGA 3G6EP 2YKPA 1U7MA 1HVVA 5AVQB 3BCCG 1IFMA 3M91A 3FWLA 4WQBA 4NPFX 4N6JA 3HE5B 1EDJA 4RSZA 1BGYG 4C7RA 3L74E 1LP1A 4DZOA 1KYOW 1LT9B 4WB4A 1I6DA 3VMZA 3L4FA 1HJ5A 3TGUD 2XKMA 1N9CA 4WQEA 3H1LE 4XA4A 1NTZK 1CIGA 3RL0B 2FXOA 2R5BA 2B0ZB 2C8SA 3I5CA 3WMM0 1LT9A 1SQBE 3CCEP 1X22A 1YCCA 1SQXE 3P8CD 1DVHA 1D7MA 2MKVA 3X39A 1HTLC 3TYIA 3VOPA 1FOCA 1NAFA 2HODA 2JWDA 4I1LA 3WFCC 1FC2C 1EDIA 4H44D 5KLVJ 2WPSA 4Y99B 3HD7A 3KHUA 3KXDA 3KZIE 4RO0A 3TGUJ 3U1AA 1CEDA 3R2PA 2ZAEB 4WQ8A 2BH4X 1FOSF 3C2CA 2PAJA 3HD7C 2Y0DA 1X9VA 3H1HD 1Z56A 2W83C 1AVYA 3EQ2A 1IRWA 1HGZA 2V7QH 1N7SC 1PP9G 1FZCC 1H89A 2N1TD 2LIRA 1LT1A 5B66V 4IL6E 1COTA 4WY4C 3USSA 2C9NY 3H1ID 2OZ1B 1KILD 2ZXEB 1VQ4P 1WRGA 4KJMA 1IK9A 1Q86Q 1NKNA 4IOIH 2ITAA 2Z5IA 4ZKUA 3AE3C 2R32A 1RE3C 1A02J 2LXCB 1YJNP 1RE4A 4Q5PA 4W7ZA 2WPRA 1AKKA 3O8ZA 1SFCB 4P4QB 3B5NA 3S4RA 5BVZA 1CRYA 1HF9A 1AFOA 3WU2E 3CXHH 1L0LG 1C2NA 3SXTA 1EQ7A 3V4WA 3VTPC 1YTZI 4AYCA 1AOQA 3AEDC 1N90A 3VRDA 3SWSA 4AAOA 5KKZB 2PGDA 3L36A 3A3YB 1LC1A 3LW5H 2POHA 2E75D 3CXHW 1SLQA 5CIFB 2E42A 2AEMA 1JY3O 3ZBMA 1YICA 2ZXXA 3MP7B 2ZONG 5AW8B 4ZKPA 4PJ0E 4UB6E 1SFCC 4O9BA 2M3BA 4UB8V 1RE3A 2I1KA 2YQBA 2QJKB 3I56P 1HJ4A 1VDFA 1KB9E 3VYIA 2E74B 1C75A 2ZT9D 2HV4A 2OYHA 4EDFA 5GTHH 3L71D 5CIGB 3CX5H 4NPDA 3P8CE 1OVUA 3NXSA 1JY3P 2B87B 1EB7A 2XNXA 3MGNA 5KJ7A 3UIAA 1CXCA 3A0HE 2PP6A 4R4MA 4K3AA 4TLFA 2M3EA 1MG2D 4EIJA 3B5ND 1QYZA 1CIEA 4PD4D 2ZFCA 5KAIE 3T97B 1C6RA 3OCDB 5CCGA 1C6OA 4EICA 1WVEC 3PJSK 2WZ7A 4IFDK 1K73Q 4RESB 2AI5A 2GC4D 1L4AD 1JTHB 3O5CA 1KB9I 1S5LX 1VQ6P 4JCGA 2N1TB 1RF1B 4AAMA 2BPBB 1YITP 3JC22 2CK3H 2KUBA 2BCNB 1KZUB 1PP9E 2IX7C 2JWAA 3V2NA 3AEFC 4H0LB 3AE7C 1EC5A 2D2CD 4PD4I 3CPWO 1DIPA 1SQPK 1B7VA 2QG4A 3PXSA 1J1DB 4OGQD 2ZBOA 5GTIH 5DJUB 5KAIV 1S2EA 3MZWB 4GKGA 5B6QA 3CX5D 1M6ZA 1M60A 1HGVA 2KZIA 1KV9A 2BLFB 3M9BA 3QWOC 2CE1A 1VYDA 1CSUA 1KYOD 1VPCA 4C7NA 3GHGC 1MV8A 5BU5A 3B5NC 2ZZS1 3TSIA 1SFCA 1OWAA 1ZRTD 1RE4C 1CYCA 1OW6A 4RJTA 1S9KD 3H1HG 1IFJA 2JP3A 3P7KA 3H1JG 1BE3J 2H7HA 1ZXGA 2WVRA 1AV1A 3AEAC 1SP4A 3E7KA 5AVVB 4HB1A 3L72G 2IFMA 2V08A 1HH7A 1GDTA 3IR9A 1BSNA 5E79E 1KYOI 3M06A 3BATA 2E76C 2FWLA 1JY2O 1SQPE 1I8PA 3PH2B 4AANA 3OAKA 2K9JA 4K3IA 3H1HJ 4H13B 3BCCJ 2P2UA 1PGJA 3L74J 3CXHD 1GK6A 1DEEG 1NU1K 1VF5D 1NTZG 1KX7A 3Q5PA 1CCRA 1IFNA 1NTMG 4XXLA 2IYPA 1MG3D 2FFDC 1MZ9A 2YKOA 1M1JC 3CWBE 1K04A 1H1OA 3F89A 1NTZE 5B5EE 1S9KE 2FYUG 2QJYC 5KAFH 3GHGB 3H1KG 1A2SA 3KZIH 4U3FD 4C7NB 5CBOA 2CXBA 2KS1B 3BRVB 1LJ2A 1GTWA 3L74D 3AE1C 1L4AB 2YNYA 4H13C 2YMYA 2N3BA 1GJQA 2YMKA 1N73B 1E29A 1KFNA 1NU1G 2OTJP 4LLHA 4WQCA 3L72D 2C9XB 3O0RC 2QEXP 3ZDMA 5KLVG 5CCGD 1CNOA 1SFCD 4L3HA 3ZOYA 5TJHA 3GG2A 1SQXD 1A8CA 2RKLA 1BSHA 1NU1E 3VMXA 1QL3A 3CWBJ 5AW3B 1PIXA 1GL2B 4Y99C 1YTZT 2H89C 3ZOOA 1JB0J 1AOFA 4QMAA 2D2CC 1CRJA 3HE4B 3FGAD 1FS0E 1KX2A 1VL2A 1JM0A 2N18B 1CSVA 1KMIZ 1YQ3C 2RH0A 2KB7P 3L72J 2QRXA 5KTBA 1JDLA 5C39A 4O1WA 4WQDA 2YKQA 1GQ1A 1WEJF 1KYOH 1ZRTE 2GUVA 3O1YA 2Q3EA 3RGUA 1BDCA 4U3FG 1LS9A 3H1IJ 2BCCJ 3E1IA 3MUDA 1GK4A 1W2LA 1GU5A 3CCVP 2Z5HA 3RLMA 1FZCB 2PCCB 1SQQG 1VQ7P 2G3AA 1NIRA 1RF0A 2E5YA 5APQA 3CCJP 3P32A 2NRGA 3BCCE 4PJ0H 2D2CB 4H0KA 2R3CA 5DJQC 3M97X 2R44A 1DW1A 5EFWB 1CTJA 2W6AA 2WT7A 3A7OA 3SLEA 3HD7B 1LTIC 4JQ0D 4WQ9A 3L72E 4LJIA 1VQKP 5CCHD 2D0WA 1KB9H 2FY8A 2BCCD 2HODB 1ZR2A 3QH9A 4U7JA 5GTHE 2FRCA 3L73E 3HQ9A 3Q1MA 2A06E 4H0JA 1CXAA 1HJ0A 2K37A 2O01J 5M1BA 1FHBA 2C1VA 3PLNA 1JEKA 1HUCA 5KLIB 2V07A 4H0LC 4A7PA 2ZVOB 1JCDA 1GW4A 5B5EV 3PP5A 3HUSC 4FA1A 1NVOA 4N78D 1FDOA 3CMAP 1C7MA 1QKSA 1KFMA 2WSCJ 3Q5SA 3IAOA 1SQQD 3KQGA 5AVZB 2FYUE 3Q2YA 1SQVK 2I8FA 1DIIC 4FA4A 2G8YA 1K3HA 2MTAC 3CX5W 1U7JA 3EFGA 1BL9A 2Q3IA 4YE1A 1NMLA 1RY3A 1BGYD 1S1CX 3RK3D 1HBWA 1N2DC 1YEBA 2KP8A 2ZYAA 1FZCA 5TISE 1BCCJ 4PW9B 2LR2A 3B4SA 3BVHA 1DD3A 1HZUA 1R0QA 2VHDA 1NKZB 2AEJA 2CA4B 1QL1A 1SQBK 2KLVA 3GF3A 3DP5A 1KB9D 2BH5X 2EXVA 4L3GA 5GTIE 1HROA 3KZIV 4BRYA 1VQ8P 2K9YA 4WQAA 5KAFV 4N78E 2J58A 5CYTR 4OVNF 1FJPA 2LKMA 1ZN5A 1L0LE 1ZOYC 4AX3A 2E75C 1J2JB 1PGPA 4EI2A 3RK2C 3U59A 4XE5B 3FXEA 1CC5A 3PXTA 2YO2A 5AVRB 1M1KQ 1H32A 1LC2A 4FA5A 4Y5RA 2Y0CA 1SVFA 3R4YA 3L75G 4BXLA 3L71E 3O6QB 2FFDB 5GTIV 4IFMA 1CHHA 1ZLLA 2N9YB 4MU8A 1AQ5A 3II6A 4LC1A 2L91A 3DR0A 1J1EC 4PD4H 2C1DB 1PP9J 1VF5B 5E79H 4YXWH 1YTCA 1G2CB 2J5UA 1SQPD 3V2RA 2FBWC 3B71A 2BEQD 3VNWA 2B88A 2KS1A 4DCKA 5CHXA 3RK3B 5CIEB 4EIEA 3OA7A 3LIDA 3AE5C 1KILC 1S3JA 2KIKA 3PHLA 1R8EA 2C1DA 1PL5A 2QSIA 1CIFA 4PV1D 1OZHA 4AQRD 1G1JA 3VP8A 1FI7A 3ABVC 1SQXJ 1N7SD 2FFDA 1NGMB 1FJ0A 2PCBB 3CWBD 2C0XA 4PWAA 3CCSP 3L74G 5B5EH 1ZZHA 3AE2C 1T2KC 1SQPJ 1CRIA 2E75B 2QE7H 3JCUH 3ZOWA 4XYDB 5CICB 1T3JA 2ZOOA 3H1KE 1A02F 1SQVJ 4PV1B 3HUSB 1SQBG 2CA3B 1HZVA 2M5AB 1XTGB 2L5GB 5GTHV 4WY4A 1U74B 1YI2P 3Q5RA 2O01H 5AVSB 3OW2O 2A45H 5KLVD 1J1EB 5L8RJ 3F5HA 4H0LD 5E79V 3GMAA 1WT6A 5AVXB 1DW0A 3V5BA 5AVUB 3M0AA 1CYIA 4D6TD 2DVHA 2QIWA 1I8OA 4PJ0V 1K8AQ 3AE6C 1JMMA 5CBNA 451CA 3WU2H 3I55P 5APXA 1QLED 2JR8A 2C2CA 1RAQA 5DJQB 1NTKG 1VQMP 4H13D 2GIWA 2B11B 3ZIYA 1GMJA 3C8VA 1X0TA 2IZ0A 3JBTB 2ZYDA 2PFXA 3RBXA 1RZ5A 1EXJA 1NTMK 3P8MC 2C1UA 1U75B 1H31B 1M56D 2NPSD 4HH2A 4EOTA 1SS1A 1L0ND 1FZAA 2WSEH 3H1KJ 4J20A 4L75A 3IN6A 2YO3A 2KNCB 1Y8AA 2M0BA 1FAVA 5C0ZA 2WSFJ 3ORVA 2IZ1A 3MTUE 1CCHA 2AIUA 1UIXA 2WT7B 1DH3A 1HH0A 1E8EA 1NTKK 2B9BA 2GUSA 1F1FA 4AALA 1PPJG 1FZEA 3TGUG 3L75J 3K5BA 3RN0A 5AW4B 1DEBA 2HR3A 5H2FE 3A0HV 1IFDA 1H9XA 2WPQA 1N8RQ 2CPBA 1BGYJ 1NYHA 2A06D 3CCUP 2QM8A 2QA4P 3H1JE 1BCCD 1KQGB 3M0DC 5APWA 3ITKA 2OYOA 3AE4C 3HRNA 155CA 2JEEA 1I55A 4DY9A 1FBMA 1LWUA 3CI9A 3RK3E 2IBZD 1LT9C 1M1JB 5KAIH 2L4DA 2NPSB 3ZCFA 1P84H 1LMSA 2QJPB 3O20A 4DT0A 2OYIC 1HJBA 2N18C 1SQXG 5H2FV 4XFJA 1CO6A 4JYBA 3M9HA 3PH0A 3NFQA 3A5TA 4YTPC 1C6SA 1GL2C 2NPSC 1LTJC 1EZVG 2Q1KA 2WTYA 1KILE 3H1IE 3L70G 1CRCA 2YCCA 3E1RA 3V4QA 1AVOA 3HD7D 1JOCA 5B66H 3EFFK 1W2BO 1GL2A 3AECC 1PZQA 5CJ0A 2KXPB 1CYJA 2HG5D 5APVA 1GKSA 3EWKA 2AXCA 1EZVE 4ZNCA 4KT0J 1FDMA 1L9BC 1Q82Q 4GYDA 1CI6B 1IZL0 3VMAA 1L4AC 5AVTB 1VF5C 3O6QA 2YIUB 3A0BE 2FYNB 1NOHA 4OWFA 3CCMP 1P84D 1N73A 2Z4EA 2WPVB 2QJKC 1FZGA 1AJYA 2J59M 1FZFA 1XTCC 1C2RA 2XTSB 1FI9A 1OW7A 1M8OB 1LTGC 1JMBA 2FYUK 1HWTC 3CD6P 1SQBD 1L0LJ 1QVGO 1KQSO 3WUIA 2KYVA 2K1AA 1M7LA 1CHJA 1CRGA 1K3GA 4H44B 5CIDB 4W7YA 1SQQE 2XZRA 3L75E 5AW9B 1YHQP 1YJWP 2BEZF 4I6MC 1CSWA 1NH4A 1VQ9P 1S5LH 3VYMA 5C9MA 4FANA 1YBKA 5AVWB 3CCLP 5AW6B 2AXTE 3TNUA 4YPCA 1DVVA 2FYUJ 3HTKB 4EIDA 3D6ZA 3H1JJ 3CU4A 3VP9A 1L0LK 4NPEA 5EXQA 3V2PA 3SJLA 4PV1C 2V4HA 3U1CA
chains in the Genus database with same CATH topology
4FB1A 2YK3A 1HZUA 1R0QA 2VHDA 1F1CA 2CA4B 3L70D 4UB8V 2YQBA 2QJKB 1HJ4A 3DP5A 1KB9D 2BH5X 2EXVA 4L3GA 2ZXYA 1HROA 3KZIV 1C75A 4EIFA 3DMIA 2BGVX 4WQAA 2N9IA 1RZ6A 2HV4A 4EDFA 1NMIA 3L71D 1YEAA 1M70A 5CIGB 5KAFV 2ORLA 1PP9D 5CYTR 3RMZA 3SVWA 3BCCD 1IQCA 1CHIA 1EB7A 4AX3A 1YNRA 5TISV 1CC5A 3PXTA 5CIBB 1H32A 1LC2A 4FA5A 4Y5RA 2Y0CA 1MZ4A 1CXCA 3MK7B 1YFCA 4QAOA 1H31A 5GTIV 1CHHA 1MG2D 2N9YB 3HQ7A 4MU8A 1QYZA 1CIEA 4PD4D 3A9FA 2JQRA 2L91A 2LITA 3DR0A 3H1KD 1S5LV 1C6RA 3MK7C 3OCDB 2C1DB 1C6OA 4EICA 1WVEC 5DF5A 1YTCA 2AI5A 2GC4D 1NTKD 1SQPD 2OZ1A 3O5CA 4JCGA 3VNWA 2KS1A 4AAMA 2BPBB 1KIBA 2N9JA 1E2RA 1ETPA 2BCNB 5CIEB 1SQVD 4EIEA 2JWAA 3PHLA 2DGEA 1KB0A 2C1DA 3L4MA 1CIFA 3L75D 2CE0A 1FI7A 2AXTV 1B7VA 2QG4A 3PXSA 4GEDB 1DW2A 2ZBOA 1CSXA 5KAIV 1FJ0A 1H9YA 2PCBB 3CWBD 4O1QA 1DIQC 4PWAA 1CTZA 1CORA 1GDVA 1GIWA 351CA 5B6QA 1FI3A 1ZZHA 1FCDC 3CX5D 1M6ZA 1M60A 2PACA 3TDKA 1CRIA 1KV9A 4IL6V 2BLFB 3ZOWA 4XYDB 3WU2V 3WFEC 2CE1A 5CICB 1VYDA 1CSUA 1KYOD 2ZOOA 2QJYB 3PXWA 1YIQA 2ZZS1 4V2KA 2CA3B 1ZRTD 1CYCA 1HZVA 1AYGA 1I6EA 5GTHV 4RJTA 1U74B 1L9JC 1QN2A 5KLVD 2D0SA 1GU2A 5E79V 2V08A 2B12B 1HH7A 1DW0A 3WFBC 1CYIA 4D6TD 3OA8B 2DVHA 2FWLA 1LFMA 1I8OA 4PJ0V 1A56A 1I8PA 3PH2B 4AANA 4K3IA 3H1LD 1H32B 4FAVA 4WQ7A 451CA 1DT1A 1QL4A 3A0BV 3HQ6A 1W5CT 3CXHD 1NTMD 2C2CA 1RAQA 5DJQB 3NBTA 1KX7A 3CYTI 3OCDA 2GIWA 2B11B 1BE3D 3ZIYA 4FA9A 1CCRA 3JBTB 4XXLA 1RZ5A 1MG3D 3TF5A 1J3SA 4L1QA 4UB6V 2C1UA 5IY51 1U75B 1H31B 1H1OA 2K9JB 2MHMA 1NTZD 1L0ND 4N0KA 3PRJA 1A2SA 3HQ8A 1CRHA 4U3FD 4J20A 2JTIB 5DFSA 2KNCB 2CXBA 1N15A 1NNOA 1OCDA 3L74D 5C0ZA 3GW6A 1L0LD 3ORVA 2N3BA 1GJQA 1CCHA 2AIUA 3ZOXA 1H33A 1PPJD 3NBSA 1E29A 1E8EA 1H33B 1CTYA 1IRVA 4WQCA 1F1FA 2Y0EA 4AALA 3L72D 2C9XB 3O0RC 1N50A 1CNOA 1HRCA 3NWVA 4L3HA 3L4OA 3ZOYA 3RN0A 5TJHA 3GG2A 3FWLA 1SQXD 4WQBA 1A8CA 3A0HV 4RSZA 1H9XA 1NU1D 1QL3A 2A06D 1KYOW 3ZOOA 1I6DA 1HJ5A 1BCCD 2B10B 3RN1A 3PTZA 3TGUD 1AOFA 1N9CA 4WQEA 1IO3A 3ITKA 1CIGA 155CA 1CRJA 2B0ZB 3WC8A 1KX2A 2C8SA 2N18B 1I55A 1CSVA 1HJ3A 4DY9A 2IBZD 1YCCA 4KMGA 1DVHA 2L4DA 1JDLA 3X39A 3ZCFA 3TYIA 4O1WA 1FOCA 4WQDA 1LMSA 2QJPB 3O20A 1GQ1A 1WEJF 2Q3EA 3O1YA 1OAEA 2N18C 5H2FV 1EZVD 3WFCC 1CO6A 3CP5A 1LS9A 1C6SA 3KHUA 1W2LA 3RLMA 2PCCB 1CIHA 1CRCA 2N3YA 1NIRA 2YCCA 1CEDA 5AURA 4WQ8A 2BH4X 3C2CA 4H0KA 2Y0DA 3H1HD 5DJQC 3M97X 1DW1A 1IRWA 1CYJA 1CTJA 1GKSA 3SLEA 1L9BC 4GYDA 4WQ9A 2LIRA 4LJIA 5B66V 1COTA 2D0WA 1IZL0 1HCMA 3VMAA 5CIHB 1C52A 2YIUB 3H1ID 2OZ1B 2BCCD 2FYNB 1DW3A 2FRCA 1P84D 4NFGB 3HQ9A 4H0JA 2FYUD 1CXAA 2O3JA 1FHBA 2C1VA 3PLNA 4Q5PA 3H1JD 1C2RA 2XTSB 1AKKA 1FI9A 1RAPA 5KLIB 2V07A 4A7PA 4P4QB 2RN0A 3WFDC 1SQBD 1CRYA 2GB8B 5B5EV 4FA1A 3WUIA 1C2NA 3L73D 3SXTA 1C7MA 1CHJA 1QKSA 1CRGA 1K3GA 1I54A 5CIDB 1SQQD 1AOQA 1CSWA 1N90A 3VRDA 3SWSA 4AAOA 5KKZB 3VYMA 3OA8A 2I8FA 1DIIC 4FANA 5C9MA 4FA4A 1LC1A 1K3HA 2RMZA 2MTAC 3CX5W 1DVVA 3CXHW 1BL9A 5CIFB 4YE1A 1NMLA 4EIDA 3ZBMA 1BGYD 1YICA 1I5TA 3CU4A 2ZONG 1YEBA 5EXQA 3SJLA 2B4ZA 4PW9B 1S6VB 2GC7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FB1 A;  2YK3 A;  1HZU A;  1R0Q A;  2VHD A;  1F1C A;  2CA4 B;  3L70 D;  4UB8 V;  2YQB A;  2QJK B;  1HJ4 A;  3DP5 A;  1KB9 D;  2BH5 X;  2EXV A;  4L3G A;  2ZXY A;  1HRO A;  3KZI V;  1C75 A;  4EIF A;  3DMI A;  2BGV X;  4WQA A;  2N9I A;  1RZ6 A;  2HV4 A;  4EDF A;  1NMI A;  3L71 D;  1YEA A;  1M70 A;  5CIG B;  5KAF V;  2ORL A;  1PP9 D;  5CYT R;  3RMZ A;  3SVW A;  3BCC D;  1IQC A;  1CHI A;  1EB7 A;  4AX3 A;  1YNR A;  5TIS V;  1CC5 A;  3PXT A;  5CIB B;  1H32 A;  1LC2 A;  4FA5 A;  4Y5R A;  2Y0C A;  1MZ4 A;  1CXC A;  3MK7 B;  1YFC A;  4QAO A;  1H31 A;  5GTI V;  1CHH A;  1MG2 D;  2N9Y B;  3HQ7 A;  4MU8 A;  1QYZ A;  1CIE A;  4PD4 D;  3A9F A;  2JQR A;  2L91 A;  2LIT A;  3DR0 A;  3H1K D;  1S5L V;  1C6R A;  3MK7 C;  3OCD B;  2C1D B;  1C6O A;  4EIC A;  1WVE C;  5DF5 A;  1YTC A;  2AI5 A;  2GC4 D;  1NTK D;  1SQP D;  2OZ1 A;  3O5C A;  4JCG A;  3VNW A;  2KS1 A;  4AAM A;  2BPB B;  1KIB A;  2N9J A;  1E2R A;  1ETP A;  2BCN B;  5CIE B;  1SQV D;  4EIE A;  2JWA A;  3PHL A;  2DGE A;  1KB0 A;  2C1D A;  3L4M A;  1CIF A;  3L75 D;  2CE0 A;  1FI7 A;  2AXT V;  1B7V A;  2QG4 A;  3PXS A;  4GED B;  1DW2 A;  2ZBO A;  1CSX A;  5KAI V;  1FJ0 A;  1H9Y A;  2PCB B;  3CWB D;  4O1Q A;  1DIQ C;  4PWA A;  1CTZ A;  1COR A;  1GDV A;  1GIW A;  351C A;  5B6Q A;  1FI3 A;  1ZZH A;  1FCD C;  3CX5 D;  1M6Z A;  1M60 A;  2PAC A;  3TDK A;  1CRI A;  1KV9 A;  4IL6 V;  2BLF B;  3ZOW A;  4XYD B;  3WU2 V;  3WFE C;  2CE1 A;  5CIC B;  1VYD A;  1CSU A;  1KYO D;  2ZOO A;  2QJY B;  3PXW A;  1YIQ A;  2ZZS 1;  4V2K A;  2CA3 B;  1ZRT D;  1CYC A;  1HZV A;  1AYG A;  1I6E A;  5GTH V;  4RJT A;  1U74 B;  1L9J C;  1QN2 A;  5KLV D;  2D0S A;  1GU2 A;  5E79 V;  2V08 A;  2B12 B;  1HH7 A;  1DW0 A;  3WFB C;  1CYI A;  4D6T D;  3OA8 B;  2DVH A;  2FWL A;  1LFM A;  1I8O A;  4PJ0 V;  1A56 A;  1I8P A;  3PH2 B;  4AAN A;  4K3I A;  3H1L D;  1H32 B;  4FAV A;  4WQ7 A;  451C A;  1DT1 A;  1QL4 A;  3A0B V;  3HQ6 A;  1W5C T;  3CXH D;  1NTM D;  2C2C A;  1RAQ A;  5DJQ B;  3NBT A;  1KX7 A;  3CYT I;  3OCD A;  2GIW A;  2B11 B;  1BE3 D;  3ZIY A;  4FA9 A;  1CCR A;  3JBT B;  4XXL A;  1RZ5 A;  1MG3 D;  3TF5 A;  1J3S A;  4L1Q A;  4UB6 V;  2C1U A;  5IY5 1;  1U75 B;  1H31 B;  1H1O A;  2K9J B;  2MHM A;  1NTZ D;  1L0N D;  4N0K A;  3PRJ A;  1A2S A;  3HQ8 A;  1CRH A;  4U3F D;  4J20 A;  2JTI B;  5DFS A;  2KNC B;  2CXB A;  1N15 A;  1NNO A;  1OCD A;  3L74 D;  5C0Z A;  3GW6 A;  1L0L D;  3ORV A;  2N3B A;  1GJQ A;  1CCH A;  2AIU A;  3ZOX A;  1H33 A;  1PPJ D;  3NBS A;  1E29 A;  1E8E A;  1H33 B;  1CTY A;  1IRV A;  4WQC A;  1F1F A;  2Y0E A;  4AAL A;  3L72 D;  2C9X B;  3O0R C;  1N50 A;  1CNO A;  1HRC A;  3NWV A;  4L3H A;  3L4O A;  3ZOY A;  3RN0 A;  5TJH A;  3GG2 A;  3FWL A;  1SQX D;  4WQB A;  1A8C A;  3A0H V;  4RSZ A;  1H9X A;  1NU1 D;  1QL3 A;  2A06 D;  1KYO W;  3ZOO A;  1I6D A;  1HJ5 A;  1BCC D;  2B10 B;  3RN1 A;  3PTZ A;  3TGU D;  1AOF A;  1N9C A;  4WQE A;  1IO3 A;  3ITK A;  1CIG A;  155C A;  1CRJ A;  2B0Z B;  3WC8 A;  1KX2 A;  2C8S A;  2N18 B;  1I55 A;  1CSV A;  1HJ3 A;  4DY9 A;  2IBZ D;  1YCC A;  4KMG A;  1DVH A;  2L4D A;  1JDL A;  3X39 A;  3ZCF A;  3TYI A;  4O1W A;  1FOC A;  4WQD A;  1LMS A;  2QJP B;  3O20 A;  1GQ1 A;  1WEJ F;  2Q3E A;  3O1Y A;  1OAE A;  2N18 C;  5H2F V;  1EZV D;  3WFC C;  1CO6 A;  3CP5 A;  1LS9 A;  1C6S A;  3KHU A;  1W2L A;  3RLM A;  2PCC B;  1CIH A;  1CRC A;  2N3Y A;  1NIR A;  2YCC A;  1CED A;  5AUR A;  4WQ8 A;  2BH4 X;  3C2C A;  4H0K A;  2Y0D A;  3H1H D;  5DJQ C;  3M97 X;  1DW1 A;  1IRW A;  1CYJ A;  1CTJ A;  1GKS A;  3SLE A;  1L9B C;  4GYD A;  4WQ9 A;  2LIR A;  4LJI A;  5B66 V;  1COT A;  2D0W A;  1IZL 0;  1HCM A;  3VMA A;  5CIH B;  1C52 A;  2YIU B;  3H1I D;  2OZ1 B;  2BCC D;  2FYN B;  1DW3 A;  2FRC A;  1P84 D;  4NFG B;  3HQ9 A;  4H0J A;  2FYU D;  1CXA A;  2O3J A;  1FHB A;  2C1V A;  3PLN A;  4Q5P A;  3H1J D;  1C2R A;  2XTS B;  1AKK A;  1FI9 A;  1RAP A;  5KLI B;  2V07 A;  4A7P A;  4P4Q B;  2RN0 A;  3WFD C;  1SQB D;  1CRY A;  2GB8 B;  5B5E V;  4FA1 A;  3WUI A;  1C2N A;  3L73 D;  3SXT A;  1C7M A;  1CHJ A;  1QKS A;  1CRG A;  1K3G A;  1I54 A;  5CID B;  1SQQ D;  1AOQ A;  1CSW A;  1N90 A;  3VRD A;  3SWS A;  4AAO A;  5KKZ B;  3VYM A;  3OA8 A;  2I8F A;  1DII C;  4FAN A;  5C9M A;  4FA4 A;  1LC1 A;  1K3H A;  2RMZ A;  2MTA C;  3CX5 W;  1DVV A;  3CXH W;  1BL9 A;  5CIF B;  4YE1 A;  1NML A;  4EID A;  3ZBM A;  1BGY D;  1YIC A;  1I5T A;  3CU4 A;  2ZON G;  1YEB A;  5EXQ A;  3SJL A;  2B4Z A;  4PW9 B;  1S6V B;  2GC7 D; 
#chains in the Genus database with same CATH topology
 4FB1 A;  2YK3 A;  1LTB C;  2WSE J;  4LGD E;  2HPC A;  1KQF B;  3AEE C;  1K05 A;  3IF4 A;  2IDB A;  2ZXY A;  2W27 A;  4EIF A;  4D6T J;  1S72 P;  2N9I A;  1YEA A;  1QVF O;  3N4X A;  1NTM E;  2KI7 B;  1ZME C;  1PP9 D;  3RMZ A;  3SVW A;  3JCU E;  2Y9Y A;  3H25 A;  3BCC D;  2XU6 A;  4IFF A;  1YNR A;  1X8Y A;  1Q7Y Q;  5AW1 B;  2B89 A;  4GIF A;  2A45 G;  2W8Z A;  1LP1 B;  1DX7 A;  5CIB B;  4Z1M H;  1H0T B;  5AVY B;  3MK7 B;  1NWQ A;  1VQL P;  5KKZ C;  2C9L Y;  1H31 A;  3H6P A;  3TK1 A;  5KJ7 D;  3H32 B;  4L73 A;  3A9F A;  3AE8 C;  1JNM A;  2P1J A;  1S5L V;  3H1I G;  3L70 E;  4OGQ B;  5AW5 B;  5DF5 A;  1BDD A;  2N9B A;  5CCG C;  2HPC B;  3LIE A;  2FYZ A;  1JTH A;  3VMY A;  1ETP A;  2BCC E;  1SQV D;  1PGO A;  2PRR A;  3LW5 J;  1BCC G;  4M3L A;  1JY2 N;  4C46 A;  1KYO E;  3V6I A;  5DJT B;  3G71 P;  3L75 D;  4N3Y B;  3RL0 g;  3MUD C;  3D0W A;  1LGH B;  1GU4 A;  1G1I A;  4GED B;  1MKM A;  4GOD A;  2KSE A;  1DIQ C;  1GIW A;  351C A;  4IL6 H;  1L0N E;  1FCD C;  3TDK A;  1NTK J;  1CW5 A;  1SQX K;  3KDP B;  3KYQ A;  2OYH B;  1T8Z A;  3WU2 V;  3HE4 A;  2KZJ A;  1K9M Q;  1N7L A;  2QJY B;  3PXW A;  1U57 A;  4WY4 D;  1RHZ B;  4V2K A;  3CME P;  1E5W A;  3H1H E;  4D6T E;  2OYH C;  3N7N A;  3G3Z A;  3CC2 P;  1JO5 A;  3CCQ P;  1AQT A;  1L9J C;  4I7Z C;  2D0S A;  3Q3D A;  1PGQ A;  2E76 B;  1L0N K;  3RL0 C;  5APY A;  5H2F H;  5CCH A;  2O01 N;  1H88 A;  1NHL A;  3WFB C;  1CI6 A;  1RH5 B;  2FYN C;  3B8E B;  3M0D A;  1CSB A;  1LFM A;  1QL2 A;  2WIT A;  1A56 A;  4W80 A;  3W67 A;  3JSV C;  5CCH C;  1GW3 A;  4DJG A;  1QL4 A;  2C0W A;  4JPZ B;  3HQ6 A;  1BGY E;  1QEX A;  1NTM D;  3HE5 A;  3C1L A;  2OYI A;  1ZW0 A;  4FA9 A;  3CWB G;  4DOJ A;  2OGU A;  4UB6 H;  2O1J A;  4EYY Q;  1J3S A;  3AEB C;  4IL6 X;  1KN7 A;  5IY5 1;  1OVR A;  2K3R A;  1LWU C;  2LXB A;  1EDL A;  3L73 G;  1NJI Q;  1Y47 A;  1NTZ D;  4OGQ C;  3B5N B;  4GOF A;  3RL0 D;  1CRH A;  2IBZ I;  1M1J A;  2VRS A;  1NNO A;  2ZT9 C;  3SFE C;  3OJA B;  3GW6 A;  1L0L D;  1PV3 A;  4UB8 H;  1SQV G;  4GDO A;  3ZOX A;  1H33 A;  1PPJ D;  3NBS A;  3CL3 D;  1NO4 A;  2OTK E;  1H33 B;  4GOE A;  4GT1 A;  1CTY A;  2WSS H;  2CPS A;  2Y0E A;  1IK7 A;  1GL2 D;  2IYO A;  2M5A A;  1HRC A;  3NWV A;  3L35 A;  3L4O A;  2UWJ E;  2NZ2 A;  5CJ4 A;  3HUS A;  1N7S A;  3CXH I;  1SQV E;  1IFP A;  3S1K A;  2IBZ E;  1NTZ J;  4I2L C;  1NU1 D;  2HYN A;  1RF1 C;  1URQ B;  1OW8 A;  1EZV I;  1PFI A;  3CLQ A;  3GF7 A;  2B10 B;  3RN1 A;  3PTZ A;  3D71 A;  1IO3 A;  1KTM A;  2E5T A;  2WSF H;  3WC8 A;  3M9Q A;  1HJ3 A;  3AEG C;  2H43 A;  5CMZ A;  1FE6 A;  4KMG A;  3G4S P;  3A2A A;  4PD4 E;  4Y28 J;  4HKZ H;  2JKV A;  2ZJS E;  3MHV A;  1OAE A;  4JF7 A;  3BAS A;  1EZV D;  1NU1 J;  1EDK A;  1M57 D;  3CP5 A;  2YIU C;  3L37 A;  2R3S A;  1RQV A;  3RK2 D;  3SWK A;  2E43 A;  3CCR P;  2ZYG A;  4U3F E;  3RBZ A;  4R4L A;  2ZT9 B;  1CIH A;  3SWY A;  2N3Y A;  2ZVN B;  3SFD C;  1L4A A;  1SQP G;  5AUR A;  2N1T A;  3H1L J;  2R5D A;  3D6Y A;  1W2E A;  1YQ4 C;  1KIL A;  1OX3 A;  1RF0 C;  1QX8 A;  2KLU A;  1KC8 Q;  1SQB J;  1ZV8 A;  1FDI A;  2P10 A;  1IC2 A;  3V2Q A;  1MFT A;  1ZR4 A;  1FU1 A;  2BAS A;  2SPZ A;  3KPE A;  3L73 J;  1HCM A;  5CIH B;  1C52 A;  2A06 G;  1JY3 N;  2KK7 A;  3S9O A;  1USE A;  1DW3 A;  3TYY A;  1N7S B;  1LNQ A;  4NFG B;  2I1J A;  3H1L G;  5AW7 B;  3T97 A;  2M8R A;  2FYU D;  1PPJ E;  2O3J A;  3TGU E;  4U3F J;  4H44 C;  3H1J D;  2B87 A;  4BRY B;  2E74 D;  1E79 H;  1RAP A;  2MJZ A;  1DD4 A;  1ZP0 C;  2HFE D;  2RN0 A;  3WFD C;  5KJ7 C;  2GB8 B;  1GZL A;  1LTT C;  1H8A A;  3L73 D;  4MN4 C;  1OMI A;  3SSU A;  1I54 A;  5AW0 B;  3VN0 A;  1LTA C;  3W68 A;  1KV4 A;  3MD0 A;  3OA8 A;  4RKU J;  4JYC A;  4ZMD A;  2K88 A;  4KHX A;  1LTS C;  4I7Z B;  5APU A;  1AA0 A;  2RMZ A;  2Q5U A;  2JJL A;  1LTJ A;  1Q90 D;  1T6A A;  3CC4 P;  4BWN A;  2P7J A;  3WUU A;  1GD2 E;  1I5T A;  5KLV E;  2A45 I;  5KAF E;  1JCC A;  1EXI A;  3H32 A;  4JBZ A;  2B4Z A;  1H0T A;  1S6V B;  3FWN A;  2GC7 D;  1OXZ A;  2QM7 A;  1F1C A;  2H8P D;  1JY2 P;  3L70 D;  3MIW A;  1BCC E;  3SWF A;  2W6J H;  1FOS E;  2Y9Z A;  2OTL P;  1Y9B A;  3NMD A;  3DMI A;  2BGV X;  1OFC X;  1RZ6 A;  1NMI A;  3G9R A;  1KD1 Q;  1M70 A;  3NTN A;  2ORL A;  5KLV K;  2OAR A;  1BE3 E;  1KOR A;  1L0N G;  1N86 A;  2P67 A;  4OH8 B;  1IQC A;  1CHI A;  2XND H;  2FXP A;  1NTM J;  4ASV A;  5TIS V;  2Q6Q A;  2DW3 A;  1NTK E;  1IJD B;  1RF1 A;  3GHG A;  1MZ4 A;  1OIP A;  4K35 A;  3L70 J;  1YFC A;  4QAO A;  1BE3 G;  1IFI A;  3CXH E;  2IFN A;  3HQ7 A;  3HTK A;  5KLI C;  2YXR B;  1L0N J;  2JQR A;  2LIT A;  3H1K D;  3L71 J;  3WUT A;  3MK7 C;  2GM4 A;  1URQ D;  2OQQ A;  1TU3 F;  3BRT B;  4AUW A;  1NTK D;  2WSC H;  2OZ1 A;  2WWW A;  5AW2 B;  1QGK B;  1FZB A;  1YYC A;  1IZN B;  1YIJ P;  1KIB A;  2GA1 A;  2N9J A;  1E2R A;  3C9I A;  2WMM A;  3AE9 C;  1KQL A;  1P84 E;  2DGE A;  1KB0 A;  5K5G B;  3L4M A;  4WWI A;  1NAY A;  2CE0 A;  2WQY C;  2E74 C;  2O1K A;  2AXT V;  2Q7C A;  1DW2 A;  2IPP A;  1CSX A;  1H9Y A;  5BU8 B;  4O1Q A;  1CTZ A;  4WVZ A;  1COR A;  4HYT B;  1GDV A;  1FJK A;  1KIL B;  4B86 A;  1YJ9 P;  1SQQ J;  1L2P A;  1FI3 A;  1MFZ A;  1MUU A;  4ASW A;  2Q9I A;  2OYI B;  2V7Q J;  3CX5 E;  2PAC A;  2W90 A;  1T2K D;  1CZQ A;  4IL6 V;  2KNC A;  5B66 E;  3WFE C;  4YXD C;  1P84 I;  1YIQ A;  2HLO A;  1RQU A;  4UB8 E;  5APT A;  4TT3 H;  5APS A;  1UII A;  1AYG A;  1VQ5 P;  2W6B A;  3A0H H;  1I6E A;  1G2C A;  3A0B H;  2FXM A;  1J1D C;  1S4X A;  1QN2 A;  1X79 B;  1GU2 A;  1JUN A;  2KOG A;  2B12 B;  4HJG H;  1LTJ B;  3D70 A;  1R5S A;  4WBA A;  3OA8 B;  1W5C E;  2JDI H;  2IBZ G;  3FXD A;  1R5L A;  2AEF A;  2E76 D;  1URQ C;  3H1L D;  1H32 B;  4FAV A;  4L76 A;  4WQ7 A;  1Q2N A;  1DT1 A;  3A0B V;  2QJP C;  1URQ A;  1USD A;  1M90 Q;  3CC7 P;  1W5C T;  1LWU B;  3CX5 I;  3RK2 B;  3NBT A;  2NPS A;  2QVA A;  3CYT I;  3OCD A;  1BE3 D;  2XV5 A;  1IO4 A;  5TIS H;  2YXQ B;  1S5L E;  3GLM A;  3WUV A;  1VQP P;  3TF5 A;  3RK3 C;  2AXT H;  4L1Q A;  3L71 G;  4WY4 B;  4UB6 V;  4L74 A;  1T3U A;  3TNU B;  2BCC G;  2KSJ A;  2I8D A;  4D6T G;  2K9J B;  2MHM A;  2FKW B;  1N73 C;  4N0K A;  1SQQ K;  3PRJ A;  3HQ8 A;  2JTI B;  3FX0 A;  5DFS A;  1N15 A;  1OCD A;  2N1T C;  2XDJ A;  2H88 C;  1OVV A;  1VQO P;  1WMK A;  1VQN P;  3IFM A;  1Q81 Q;  1IRV A;  2JO1 A;  2P58 A;  1N50 A;  4CPG A;  3G6E P;  2YKP A;  1U7M A;  1HVV A;  5AVQ B;  3BCC G;  1IFM A;  3M91 A;  3FWL A;  4WQB A;  4NPF X;  4N6J A;  3HE5 B;  1EDJ A;  4RSZ A;  1BGY G;  4C7R A;  3L74 E;  1LP1 A;  4DZO A;  1KYO W;  1LT9 B;  4WB4 A;  1I6D A;  3VMZ A;  3L4F A;  1HJ5 A;  3TGU D;  2XKM A;  1N9C A;  4WQE A;  3H1L E;  4XA4 A;  1NTZ K;  1CIG A;  3RL0 B;  2FXO A;  2R5B A;  2B0Z B;  2C8S A;  3I5C A;  3WMM 0;  1LT9 A;  1SQB E;  3CCE P;  1X22 A;  1YCC A;  1SQX E;  3P8C D;  1DVH A;  1D7M A;  2MKV A;  3X39 A;  1HTL C;  3TYI A;  3VOP A;  1FOC A;  1NAF A;  2HOD A;  2JWD A;  4I1L A;  3WFC C;  1FC2 C;  1EDI A;  4H44 D;  5KLV J;  2WPS A;  4Y99 B;  3HD7 A;  3KHU A;  3KXD A;  3KZI E;  4RO0 A;  3TGU J;  3U1A A;  1CED A;  3R2P A;  2ZAE B;  4WQ8 A;  2BH4 X;  1FOS F;  3C2C A;  2PAJ A;  3HD7 C;  2Y0D A;  1X9V A;  3H1H D;  1Z56 A;  2W83 C;  1AVY A;  3EQ2 A;  1IRW A;  1HGZ A;  2V7Q H;  1N7S C;  1PP9 G;  1FZC C;  1H89 A;  2N1T D;  2LIR A;  1LT1 A;  5B66 V;  4IL6 E;  1COT A;  4WY4 C;  3USS A;  2C9N Y;  3H1I D;  2OZ1 B;  1KIL D;  2ZXE B;  1VQ4 P;  1WRG A;  4KJM A;  1IK9 A;  1Q86 Q;  1NKN A;  4IOI H;  2ITA A;  2Z5I A;  4ZKU A;  3AE3 C;  2R32 A;  1RE3 C;  1A02 J;  2LXC B;  1YJN P;  1RE4 A;  4Q5P A;  4W7Z A;  2WPR A;  1AKK A;  3O8Z A;  1SFC B;  4P4Q B;  3B5N A;  3S4R A;  5BVZ A;  1CRY A;  1HF9 A;  1AFO A;  3WU2 E;  3CXH H;  1L0L G;  1C2N A;  3SXT A;  1EQ7 A;  3V4W A;  3VTP C;  1YTZ I;  4AYC A;  1AOQ A;  3AED C;  1N90 A;  3VRD A;  3SWS A;  4AAO A;  5KKZ B;  2PGD A;  3L36 A;  3A3Y B;  1LC1 A;  3LW5 H;  2POH A;  2E75 D;  3CXH W;  1SLQ A;  5CIF B;  2E42 A;  2AEM A;  1JY3 O;  3ZBM A;  1YIC A;  2ZXX A;  3MP7 B;  2ZON G;  5AW8 B;  4ZKP A;  4PJ0 E;  4UB6 E;  1SFC C;  4O9B A;  2M3B A;  4UB8 V;  1RE3 A;  2I1K A;  2YQB A;  2QJK B;  3I56 P;  1HJ4 A;  1VDF A;  1KB9 E;  3VYI A;  2E74 B;  1C75 A;  2ZT9 D;  2HV4 A;  2OYH A;  4EDF A;  5GTH H;  3L71 D;  5CIG B;  3CX5 H;  4NPD A;  3P8C E;  1OVU A;  3NXS A;  1JY3 P;  2B87 B;  1EB7 A;  2XNX A;  3MGN A;  5KJ7 A;  3UIA A;  1CXC A;  3A0H E;  2PP6 A;  4R4M A;  4K3A A;  4TLF A;  2M3E A;  1MG2 D;  4EIJ A;  3B5N D;  1QYZ A;  1CIE A;  4PD4 D;  2ZFC A;  5KAI E;  3T97 B;  1C6R A;  3OCD B;  5CCG A;  1C6O A;  4EIC A;  1WVE C;  3PJS K;  2WZ7 A;  4IFD K;  1K73 Q;  4RES B;  2AI5 A;  2GC4 D;  1L4A D;  1JTH B;  3O5C A;  1KB9 I;  1S5L X;  1VQ6 P;  4JCG A;  2N1T B;  1RF1 B;  4AAM A;  2BPB B;  1YIT P;  3JC2 2;  2CK3 H;  2KUB A;  2BCN B;  1KZU B;  1PP9 E;  2IX7 C;  2JWA A;  3V2N A;  3AEF C;  4H0L B;  3AE7 C;  1EC5 A;  2D2C D;  4PD4 I;  3CPW O;  1DIP A;  1SQP K;  1B7V A;  2QG4 A;  3PXS A;  1J1D B;  4OGQ D;  2ZBO A;  5GTI H;  5DJU B;  5KAI V;  1S2E A;  3MZW B;  4GKG A;  5B6Q A;  3CX5 D;  1M6Z A;  1M60 A;  1HGV A;  2KZI A;  1KV9 A;  2BLF B;  3M9B A;  3QWO C;  2CE1 A;  1VYD A;  1CSU A;  1KYO D;  1VPC A;  4C7N A;  3GHG C;  1MV8 A;  5BU5 A;  3B5N C;  2ZZS 1;  3TSI A;  1SFC A;  1OWA A;  1ZRT D;  1RE4 C;  1CYC A;  1OW6 A;  4RJT A;  1S9K D;  3H1H G;  1IFJ A;  2JP3 A;  3P7K A;  3H1J G;  1BE3 J;  2H7H A;  1ZXG A;  2WVR A;  1AV1 A;  3AEA C;  1SP4 A;  3E7K A;  5AVV B;  4HB1 A;  3L72 G;  2IFM A;  2V08 A;  1HH7 A;  1GDT A;  3IR9 A;  1BSN A;  5E79 E;  1KYO I;  3M06 A;  3BAT A;  2E76 C;  2FWL A;  1JY2 O;  1SQP E;  1I8P A;  3PH2 B;  4AAN A;  3OAK A;  2K9J A;  4K3I A;  3H1H J;  4H13 B;  3BCC J;  2P2U A;  1PGJ A;  3L74 J;  3CXH D;  1GK6 A;  1DEE G;  1NU1 K;  1VF5 D;  1NTZ G;  1KX7 A;  3Q5P A;  1CCR A;  1IFN A;  1NTM G;  4XXL A;  2IYP A;  1MG3 D;  2FFD C;  1MZ9 A;  2YKO A;  1M1J C;  3CWB E;  1K04 A;  1H1O A;  3F89 A;  1NTZ E;  5B5E E;  1S9K E;  2FYU G;  2QJY C;  5KAF H;  3GHG B;  3H1K G;  1A2S A;  3KZI H;  4U3F D;  4C7N B;  5CBO A;  2CXB A;  2KS1 B;  3BRV B;  1LJ2 A;  1GTW A;  3L74 D;  3AE1 C;  1L4A B;  2YNY A;  4H13 C;  2YMY A;  2N3B A;  1GJQ A;  2YMK A;  1N73 B;  1E29 A;  1KFN A;  1NU1 G;  2OTJ P;  4LLH A;  4WQC A;  3L72 D;  2C9X B;  3O0R C;  2QEX P;  3ZDM A;  5KLV G;  5CCG D;  1CNO A;  1SFC D;  4L3H A;  3ZOY A;  5TJH A;  3GG2 A;  1SQX D;  1A8C A;  2RKL A;  1BSH A;  1NU1 E;  3VMX A;  1QL3 A;  3CWB J;  5AW3 B;  1PIX A;  1GL2 B;  4Y99 C;  1YTZ T;  2H89 C;  3ZOO A;  1JB0 J;  1AOF A;  4QMA A;  2D2C C;  1CRJ A;  3HE4 B;  3FGA D;  1FS0 E;  1KX2 A;  1VL2 A;  1JM0 A;  2N18 B;  1CSV A;  1KMI Z;  1YQ3 C;  2RH0 A;  2KB7 P;  3L72 J;  2QRX A;  5KTB A;  1JDL A;  5C39 A;  4O1W A;  4WQD A;  2YKQ A;  1GQ1 A;  1WEJ F;  1KYO H;  1ZRT E;  2GUV A;  3O1Y A;  2Q3E A;  3RGU A;  1BDC A;  4U3F G;  1LS9 A;  3H1I J;  2BCC J;  3E1I A;  3MUD A;  1GK4 A;  1W2L A;  1GU5 A;  3CCV P;  2Z5H A;  3RLM A;  1FZC B;  2PCC B;  1SQQ G;  1VQ7 P;  2G3A A;  1NIR A;  1RF0 A;  2E5Y A;  5APQ A;  3CCJ P;  3P32 A;  2NRG A;  3BCC E;  4PJ0 H;  2D2C B;  4H0K A;  2R3C A;  5DJQ C;  3M97 X;  2R44 A;  1DW1 A;  5EFW B;  1CTJ A;  2W6A A;  2WT7 A;  3A7O A;  3SLE A;  3HD7 B;  1LTI C;  4JQ0 D;  4WQ9 A;  3L72 E;  4LJI A;  1VQK P;  5CCH D;  2D0W A;  1KB9 H;  2FY8 A;  2BCC D;  2HOD B;  1ZR2 A;  3QH9 A;  4U7J A;  5GTH E;  2FRC A;  3L73 E;  3HQ9 A;  3Q1M A;  2A06 E;  4H0J A;  1CXA A;  1HJ0 A;  2K37 A;  2O01 J;  5M1B A;  1FHB A;  2C1V A;  3PLN A;  1JEK A;  1HUC A;  5KLI B;  2V07 A;  4H0L C;  4A7P A;  2ZVO B;  1JCD A;  1GW4 A;  5B5E V;  3PP5 A;  3HUS C;  4FA1 A;  1NVO A;  4N78 D;  1FDO A;  3CMA P;  1C7M A;  1QKS A;  1KFM A;  2WSC J;  3Q5S A;  3IAO A;  1SQQ D;  3KQG A;  5AVZ B;  2FYU E;  3Q2Y A;  1SQV K;  2I8F A;  1DII C;  4FA4 A;  2G8Y A;  1K3H A;  2MTA C;  3CX5 W;  1U7J A;  3EFG A;  1BL9 A;  2Q3I A;  4YE1 A;  1NML A;  1RY3 A;  1BGY D;  1S1C X;  3RK3 D;  1HBW A;  1N2D C;  1YEB A;  2KP8 A;  2ZYA A;  1FZC A;  5TIS E;  1BCC J;  4PW9 B;  2LR2 A;  3B4S A;  3BVH A;  1DD3 A;  1HZU A;  1R0Q A;  2VHD A;  1NKZ B;  2AEJ A;  2CA4 B;  1QL1 A;  1SQB K;  2KLV A;  3GF3 A;  3DP5 A;  1KB9 D;  2BH5 X;  2EXV A;  4L3G A;  5GTI E;  1HRO A;  3KZI V;  4BRY A;  1VQ8 P;  2K9Y A;  4WQA A;  5KAF V;  4N78 E;  2J58 A;  5CYT R;  4OVN F;  1FJP A;  2LKM A;  1ZN5 A;  1L0L E;  1ZOY C;  4AX3 A;  2E75 C;  1J2J B;  1PGP A;  4EI2 A;  3RK2 C;  3U59 A;  4XE5 B;  3FXE A;  1CC5 A;  3PXT A;  2YO2 A;  5AVR B;  1M1K Q;  1H32 A;  1LC2 A;  4FA5 A;  4Y5R A;  2Y0C A;  1SVF A;  3R4Y A;  3L75 G;  4BXL A;  3L71 E;  3O6Q B;  2FFD B;  5GTI V;  4IFM A;  1CHH A;  1ZLL A;  2N9Y B;  4MU8 A;  1AQ5 A;  3II6 A;  4LC1 A;  2L91 A;  3DR0 A;  1J1E C;  4PD4 H;  2C1D B;  1PP9 J;  1VF5 B;  5E79 H;  4YXW H;  1YTC A;  1G2C B;  2J5U A;  1SQP D;  3V2R A;  2FBW C;  3B71 A;  2BEQ D;  3VNW A;  2B88 A;  2KS1 A;  4DCK A;  5CHX A;  3RK3 B;  5CIE B;  4EIE A;  3OA7 A;  3LID A;  3AE5 C;  1KIL C;  1S3J A;  2KIK A;  3PHL A;  1R8E A;  2C1D A;  1PL5 A;  2QSI A;  1CIF A;  4PV1 D;  1OZH A;  4AQR D;  1G1J A;  3VP8 A;  1FI7 A;  3ABV C;  1SQX J;  1N7S D;  2FFD A;  1NGM B;  1FJ0 A;  2PCB B;  3CWB D;  2C0X A;  4PWA A;  3CCS P;  3L74 G;  5B5E H;  1ZZH A;  3AE2 C;  1T2K C;  1SQP J;  1CRI A;  2E75 B;  2QE7 H;  3JCU H;  3ZOW A;  4XYD B;  5CIC B;  1T3J A;  2ZOO A;  3H1K E;  1A02 F;  1SQV J;  4PV1 B;  3HUS B;  1SQB G;  2CA3 B;  1HZV A;  2M5A B;  1XTG B;  2L5G B;  5GTH V;  4WY4 A;  1U74 B;  1YI2 P;  3Q5R A;  2O01 H;  5AVS B;  3OW2 O;  2A45 H;  5KLV D;  1J1E B;  5L8R J;  3F5H A;  4H0L D;  5E79 V;  3GMA A;  1WT6 A;  5AVX B;  1DW0 A;  3V5B A;  5AVU B;  3M0A A;  1CYI A;  4D6T D;  2DVH A;  2QIW A;  1I8O A;  4PJ0 V;  1K8A Q;  3AE6 C;  1JMM A;  5CBN A;  451C A;  3WU2 H;  3I55 P;  5APX A;  1QLE D;  2JR8 A;  2C2C A;  1RAQ A;  5DJQ B;  1NTK G;  1VQM P;  4H13 D;  2GIW A;  2B11 B;  3ZIY A;  1GMJ A;  3C8V A;  1X0T A;  2IZ0 A;  3JBT B;  2ZYD A;  2PFX A;  3RBX A;  1RZ5 A;  1EXJ A;  1NTM K;  3P8M C;  2C1U A;  1U75 B;  1H31 B;  1M56 D;  2NPS D;  4HH2 A;  4EOT A;  1SS1 A;  1L0N D;  1FZA A;  2WSE H;  3H1K J;  4J20 A;  4L75 A;  3IN6 A;  2YO3 A;  2KNC B;  1Y8A A;  2M0B A;  1FAV A;  5C0Z A;  2WSF J;  3ORV A;  2IZ1 A;  3MTU E;  1CCH A;  2AIU A;  1UIX A;  2WT7 B;  1DH3 A;  1HH0 A;  1E8E A;  1NTK K;  2B9B A;  2GUS A;  1F1F A;  4AAL A;  1PPJ G;  1FZE A;  3TGU G;  3L75 J;  3K5B A;  3RN0 A;  5AW4 B;  1DEB A;  2HR3 A;  5H2F E;  3A0H V;  1IFD A;  1H9X A;  2WPQ A;  1N8R Q;  2CPB A;  1BGY J;  1NYH A;  2A06 D;  3CCU P;  2QM8 A;  2QA4 P;  3H1J E;  1BCC D;  1KQG B;  3M0D C;  5APW A;  3ITK A;  2OYO A;  3AE4 C;  3HRN A;  155C A;  2JEE A;  1I55 A;  4DY9 A;  1FBM A;  1LWU A;  3CI9 A;  3RK3 E;  2IBZ D;  1LT9 C;  1M1J B;  5KAI H;  2L4D A;  2NPS B;  3ZCF A;  1P84 H;  1LMS A;  2QJP B;  3O20 A;  4DT0 A;  2OYI C;  1HJB A;  2N18 C;  1SQX G;  5H2F V;  4XFJ A;  1CO6 A;  4JYB A;  3M9H A;  3PH0 A;  3NFQ A;  3A5T A;  4YTP C;  1C6S A;  1GL2 C;  2NPS C;  1LTJ C;  1EZV G;  2Q1K A;  2WTY A;  1KIL E;  3H1I E;  3L70 G;  1CRC A;  2YCC A;  3E1R A;  3V4Q A;  1AVO A;  3HD7 D;  1JOC A;  5B66 H;  3EFF K;  1W2B O;  1GL2 A;  3AEC C;  1PZQ A;  5CJ0 A;  2KXP B;  1CYJ A;  2HG5 D;  5APV A;  1GKS A;  3EWK A;  2AXC A;  1EZV E;  4ZNC A;  4KT0 J;  1FDM A;  1L9B C;  1Q82 Q;  4GYD A;  1CI6 B;  1IZL 0;  3VMA A;  1L4A C;  5AVT B;  1VF5 C;  3O6Q A;  2YIU B;  3A0B E;  2FYN B;  1NOH A;  4OWF A;  3CCM P;  1P84 D;  1N73 A;  2Z4E A;  2WPV B;  2QJK C;  1FZG A;  1AJY A;  2J59 M;  1FZF A;  1XTC C;  1C2R A;  2XTS B;  1FI9 A;  1OW7 A;  1M8O B;  1LTG C;  1JMB A;  2FYU K;  1HWT C;  3CD6 P;  1SQB D;  1L0L J;  1QVG O;  1KQS O;  3WUI A;  2KYV A;  2K1A A;  1M7L A;  1CHJ A;  1CRG A;  1K3G A;  4H44 B;  5CID B;  4W7Y A;  1SQQ E;  2XZR A;  3L75 E;  5AW9 B;  1YHQ P;  1YJW P;  2BEZ F;  4I6M C;  1CSW A;  1NH4 A;  1VQ9 P;  1S5L H;  3VYM A;  5C9M A;  4FAN A;  1YBK A;  5AVW B;  3CCL P;  5AW6 B;  2AXT E;  3TNU A;  4YPC A;  1DVV A;  2FYU J;  3HTK B;  4EID A;  3D6Z A;  3H1J J;  3CU4 A;  3VP9 A;  1L0L K;  4NPE A;  5EXQ A;  3V2P A;  3SJL A;  4PV1 C;  2V4H A;  3U1C A; 
#chains in the Genus database with same CATH homology
 4FB1 A;  2YK3 A;  1HZU A;  1R0Q A;  2VHD A;  1F1C A;  2CA4 B;  3L70 D;  4UB8 V;  2YQB A;  2QJK B;  1HJ4 A;  3DP5 A;  1KB9 D;  2BH5 X;  2EXV A;  4L3G A;  2ZXY A;  1HRO A;  3KZI V;  1C75 A;  4EIF A;  3DMI A;  2BGV X;  4WQA A;  2N9I A;  1RZ6 A;  2HV4 A;  4EDF A;  1NMI A;  3L71 D;  1YEA A;  1M70 A;  5CIG B;  5KAF V;  2ORL A;  1PP9 D;  5CYT R;  3RMZ A;  3SVW A;  3BCC D;  1IQC A;  1CHI A;  1EB7 A;  4AX3 A;  1YNR A;  5TIS V;  1CC5 A;  3PXT A;  5CIB B;  1H32 A;  1LC2 A;  4FA5 A;  4Y5R A;  2Y0C A;  1MZ4 A;  1CXC A;  3MK7 B;  1YFC A;  4QAO A;  1H31 A;  5GTI V;  1CHH A;  1MG2 D;  2N9Y B;  3HQ7 A;  4MU8 A;  1QYZ A;  1CIE A;  4PD4 D;  3A9F A;  2JQR A;  2L91 A;  2LIT A;  3DR0 A;  3H1K D;  1S5L V;  1C6R A;  3MK7 C;  3OCD B;  2C1D B;  1C6O A;  4EIC A;  1WVE C;  5DF5 A;  1YTC A;  2AI5 A;  2GC4 D;  1NTK D;  1SQP D;  2OZ1 A;  3O5C A;  4JCG A;  3VNW A;  2KS1 A;  4AAM A;  2BPB B;  1KIB A;  2N9J A;  1E2R A;  1ETP A;  2BCN B;  5CIE B;  1SQV D;  4EIE A;  2JWA A;  3PHL A;  2DGE A;  1KB0 A;  2C1D A;  3L4M A;  1CIF A;  3L75 D;  2CE0 A;  1FI7 A;  2AXT V;  1B7V A;  2QG4 A;  3PXS A;  4GED B;  1DW2 A;  2ZBO A;  1CSX A;  5KAI V;  1FJ0 A;  1H9Y A;  2PCB B;  3CWB D;  4O1Q A;  1DIQ C;  4PWA A;  1CTZ A;  1COR A;  1GDV A;  1GIW A;  351C A;  5B6Q A;  1FI3 A;  1ZZH A;  1FCD C;  3CX5 D;  1M6Z A;  1M60 A;  2PAC A;  3TDK A;  1CRI A;  1KV9 A;  4IL6 V;  2BLF B;  3ZOW A;  4XYD B;  3WU2 V;  3WFE C;  2CE1 A;  5CIC B;  1VYD A;  1CSU A;  1KYO D;  2ZOO A;  2QJY B;  3PXW A;  1YIQ A;  2ZZS 1;  4V2K A;  2CA3 B;  1ZRT D;  1CYC A;  1HZV A;  1AYG A;  1I6E A;  5GTH V;  4RJT A;  1U74 B;  1L9J C;  1QN2 A;  5KLV D;  2D0S A;  1GU2 A;  5E79 V;  2V08 A;  2B12 B;  1HH7 A;  1DW0 A;  3WFB C;  1CYI A;  4D6T D;  3OA8 B;  2DVH A;  2FWL A;  1LFM A;  1I8O A;  4PJ0 V;  1A56 A;  1I8P A;  3PH2 B;  4AAN A;  4K3I A;  3H1L D;  1H32 B;  4FAV A;  4WQ7 A;  451C A;  1DT1 A;  1QL4 A;  3A0B V;  3HQ6 A;  1W5C T;  3CXH D;  1NTM D;  2C2C A;  1RAQ A;  5DJQ B;  3NBT A;  1KX7 A;  3CYT I;  3OCD A;  2GIW A;  2B11 B;  1BE3 D;  3ZIY A;  4FA9 A;  1CCR A;  3JBT B;  4XXL A;  1RZ5 A;  1MG3 D;  3TF5 A;  1J3S A;  4L1Q A;  4UB6 V;  2C1U A;  5IY5 1;  1U75 B;  1H31 B;  1H1O A;  2K9J B;  2MHM A;  1NTZ D;  1L0N D;  4N0K A;  3PRJ A;  1A2S A;  3HQ8 A;  1CRH A;  4U3F D;  4J20 A;  2JTI B;  5DFS A;  2KNC B;  2CXB A;  1N15 A;  1NNO A;  1OCD A;  3L74 D;  5C0Z A;  3GW6 A;  1L0L D;  3ORV A;  2N3B A;  1GJQ A;  1CCH A;  2AIU A;  3ZOX A;  1H33 A;  1PPJ D;  3NBS A;  1E29 A;  1E8E A;  1H33 B;  1CTY A;  1IRV A;  4WQC A;  1F1F A;  2Y0E A;  4AAL A;  3L72 D;  2C9X B;  3O0R C;  1N50 A;  1CNO A;  1HRC A;  3NWV A;  4L3H A;  3L4O A;  3ZOY A;  3RN0 A;  5TJH A;  3GG2 A;  3FWL A;  1SQX D;  4WQB A;  1A8C A;  3A0H V;  4RSZ A;  1H9X A;  1NU1 D;  1QL3 A;  2A06 D;  1KYO W;  3ZOO A;  1I6D A;  1HJ5 A;  1BCC D;  2B10 B;  3RN1 A;  3PTZ A;  3TGU D;  1AOF A;  1N9C A;  4WQE A;  1IO3 A;  3ITK A;  1CIG A;  155C A;  1CRJ A;  2B0Z B;  3WC8 A;  1KX2 A;  2C8S A;  2N18 B;  1I55 A;  1CSV A;  1HJ3 A;  4DY9 A;  2IBZ D;  1YCC A;  4KMG A;  1DVH A;  2L4D A;  1JDL A;  3X39 A;  3ZCF A;  3TYI A;  4O1W A;  1FOC A;  4WQD A;  1LMS A;  2QJP B;  3O20 A;  1GQ1 A;  1WEJ F;  2Q3E A;  3O1Y A;  1OAE A;  2N18 C;  5H2F V;  1EZV D;  3WFC C;  1CO6 A;  3CP5 A;  1LS9 A;  1C6S A;  3KHU A;  1W2L A;  3RLM A;  2PCC B;  1CIH A;  1CRC A;  2N3Y A;  1NIR A;  2YCC A;  1CED A;  5AUR A;  4WQ8 A;  2BH4 X;  3C2C A;  4H0K A;  2Y0D A;  3H1H D;  5DJQ C;  3M97 X;  1DW1 A;  1IRW A;  1CYJ A;  1CTJ A;  1GKS A;  3SLE A;  1L9B C;  4GYD A;  4WQ9 A;  2LIR A;  4LJI A;  5B66 V;  1COT A;  2D0W A;  1IZL 0;  1HCM A;  3VMA A;  5CIH B;  1C52 A;  2YIU B;  3H1I D;  2OZ1 B;  2BCC D;  2FYN B;  1DW3 A;  2FRC A;  1P84 D;  4NFG B;  3HQ9 A;  4H0J A;  2FYU D;  1CXA A;  2O3J A;  1FHB A;  2C1V A;  3PLN A;  4Q5P A;  3H1J D;  1C2R A;  2XTS B;  1AKK A;  1FI9 A;  1RAP A;  5KLI B;  2V07 A;  4A7P A;  4P4Q B;  2RN0 A;  3WFD C;  1SQB D;  1CRY A;  2GB8 B;  5B5E V;  4FA1 A;  3WUI A;  1C2N A;  3L73 D;  3SXT A;  1C7M A;  1CHJ A;  1QKS A;  1CRG A;  1K3G A;  1I54 A;  5CID B;  1SQQ D;  1AOQ A;  1CSW A;  1N90 A;  3VRD A;  3SWS A;  4AAO A;  5KKZ B;  3VYM A;  3OA8 A;  2I8F A;  1DII C;  4FAN A;  5C9M A;  4FA4 A;  1LC1 A;  1K3H A;  2RMZ A;  2MTA C;  3CX5 W;  1DVV A;  3CXH W;  1BL9 A;  5CIF B;  4YE1 A;  1NML A;  4EID A;  3ZBM A;  1BGY D;  1YIC A;  1I5T A;  3CU4 A;  2ZON G;  1YEB A;  5EXQ A;  3SJL A;  2B4Z A;  4PW9 B;  1S6V B;  2GC7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...