1KYOJ

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 20
structure length 127
sequence length 127
chains with identical sequence U
ec nomenclature
pdb deposition date 2002-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kyoJ00
1LO3H 2JTDA 4L3EA 4X9BA 3VXUE 2X1QA 2EZ0C 4YDKH 3HR6A 3K1DA 5FA4A 4M4PA 4IRSC 3Q6GL 3SPVA 3W9DB 5F1NB 4FMFA 5FA4B 1NFDE 1JHTB 5IF0B 2FEDC 2C3WA 5JIHA 2B1AH 3RVVD 1KFAL 3T0XA 4NBYB 4M9OA 3W11C 1FGVH 1K8IB 1NLBH 4PJ8B 3VFMB 2NQCA 2E8ZA 2EEAA 4BSWB 5KVDL 5L9DL 2HT4C 5IG7B 4HK0A 4DUXA 5GS0C 1PVHA 1EMTL 2M2DA 1KTDA 1CF8H 1QSEE 2W38A 4POZD 5C9JB 1WAAA 2HVJB 5H8DA 1ZOXA 4WJ5B 1SJXA 4GBXA 4X6CF 2EXWC 1LE5A 2DLGA 2H6PB 3L3HB 5JOFA 4WHYG 5B39A 4OGYL 4X6DB 2NY5L 4M00A 1RZIA 1XCQB 4PJ7B 4OT1H 1T0NB 3IDNB 4OM0L 3GGWA 3ABZA 3S36L 4YXHH 4AT6A 4OLWL 5E8OB 1BIIA 3B6SA 5T5NF 3U9UB 4E9LA 4J8RA 5KOVC 4LQ1A 4DN3L 1J1XL 5DQJA 4LBEA 1PX3A 4WTXA 1L0XA 4OLUH 2DQJL 3B2VL 3QIUB 4M93B 2I5YL 5FA3A 3LEVH 4KHTH 1AKJA 3RWFA 1AXSB 4QRRB 3RIAF 1YMMA 3U4EA 4M1DL 1J1OH 1OAQL 2NY7L 3MACH 5E8NA 2YRPA 5DRXB 3OKDB 4YBHA 1C12B 2FX9H 3LKSB 4M8QB 1Q0XH 4XPHL 4U1IB 4N9GA 2YC1B 4UB0L 3PWUB 4ODUB 5EBWA 1CN4A 3IGAB 4ODWA 5EOTB 4U1KA 3EOTH 3PV6A 1JPGB 1OAUL 4NRZA 2BNQD 5F7MC 5IEHA 5E2TL 5KG9A 1N5AB 1FGNH 43C9B 3RWJB 5D1ZA 4FTVB 3RPKA 4O2CB 4AMKL 1A14H 5JIPA 4JFQB 2B0SH 3MLWH 5GIRA 5E0QA 1T66D 2BJML 1PQZA 3MRCA 2FX7H 43C9A 2IAMD 3ZE0F 3OR7A 5EA0H 2VABB 4F7PB 4ZYKA 5JXEA 5AYUH 4Z76B 3MJ7A 1JF5A 4D8PB 2FBJL 1UH3A 4X6EB 3T8XB 4GW4A 1WTLA 2VZ1A 1IEAB 1WSST 1YEFH 3VFUA 25C8H 5EO9A 1CE6B 2P8LB 4DTGH 4L3CB 1U8JB 1ETZB 4RMTA 1MJUL 1ZHBA 4XPGH 5D7LE 15C8H 1BEYL 3SGJA 4QGYA 1A14L 5IBLC 3VFTB 3TNNA 3QJHB 1FE8L 1I1YA 3C2AL 5C6TL 2WAHA 2HKFL 3TT1H 3MRBA 1FN4B 2VE6B 2FBJH 5JO5B 1H0DB 3MA9H 2CRIA 2ZOKA 1RURH 4TTGA 3WJLA 4P0DA 1X5KA 1PKOA 3X11A 4WCYL 3ZDYE 5L88H 2EDLA 1N3NB 3H9HB 3QT2A 1MCPH 4EQ3A 1QSFE 4J3XA 2XKUA 4KQ4L 1UGNA 5D8JH 3VE0B 5I17B 1U8LB 5LXGL 1R3IL 4L1HA 1CK0L 1MHHB 2J6EH 4P99A 4YHZH 3LKNB 3EJZD 3OAYK 1RIHL 5DJ0B 3PF2A 3MRBB 5JO5A 5BMFL 4B7IA 2IANB 4Z7VF 5AEAA 1WWCA 5F7UA 4ODTH 4HK0B 1ADQA 1Q1JL 4U6HA 3WFZA 2P7TA 2WUCL 1INQA 2P42B 1PY9A 1FL3A 4NKIH 1NUNB 4XPBL 4LPXA 1TJIL 5EBGA 3FO9A 4HHAB 1XT5A 4Z6AT 2QHRL 4G8IA 5FEBA 5EUOF 3SO3C 2DMKA 2HFEB 2XYCA 4NQTA 3TYFB 4MB5A 4OCSH 3SE8L 3BVNA 3TF7C 2YEZB 4KDTC 2Y6SD 3SDAB 5DD1L 4OZGA 2AXFB 5HGHB 2GJ6E 5KZCB 4PJ5D 3TYGH 5C7XH 5KW9H 4Z0BH 4K23H 4LCIL 5E94A 1JUFA 3C6SA 1P6FA 4PRID 2YMXL 3Q1SL 4S1RL 2QQLH 1K6QL 4M6NH 5FYKD 1D5XA 2YD7A 3MRDA 4PJGE 2DTML 1MFEL 2O61B 2DICA 2XNAA 4HKBA 2V7HB 4RAVB 4NNYA 5IMKA 5SV4A 2HMID 1JPGA 4LCWB 1NUFA 3ARFB 4R96B 5F7DB 4F57L 4PJ9A 2CDEB 5L9DH 4HCRA 5IB4B 1RIHH 2OJZL 3VXRD 1XR8A 5DVKA 5B3JE 4ZFZA 5DHYB 1A6TA 1OAZL 4N0RA 1A3LL 3RL1B 3KXFD 3O4LA 4ZSOE 5C2BH 4HV8A 2WUCH 1MFAL 2ORBH 4H25A 4KK8C 1CGWA 4JFXA 4GMSL 3KPSD 4PTTB 3MRCB 5TDOA 1X6LA 1AHWB 3FFDA 3L3IA 5I1CH 3ZT6A 1A1OB 1JI1A 5E9DA 4CU7A 1AI1L 4X8XA 1F6LL 3CFKA 5F72S 3IU4H 3UTZB 4JO3H 2GIYA 1JPFB 3IXAA 3LY6A 3ZL4L 1EBAA 3RVXC 1S9YB 4MD4B 2IBZY 3KXFA 3O4LD 1EFXB 4GRLB 2XQBH 4OZ4B 5DMGC 4Y16B 2ZG1A 3FHAA 2EDKA 3S88H 2FX8L 1J12A 4QRSA 4DEPC 2KH2B 3S37H 2ORBL 1NBVL 3P0YL 2FO4A 2NY6C 3KPSE 3D18A 3HE7A 4LVOC 1RJZA 3MRQA 4I13B 1ZLSH 1QNZL 2LAAA 5C3LD 4PREB 3QEGH 4Q0XL 1RIUL 1T2QL 3DX7A 1FH5H 1HI6B 1YNTB 3K3QA 3L7EB 4S1QL 5CBEB 5B3JF 4Z5RB 5T1KB 4X7DC 5GISH 5F89A 3EYQC 4AEIH 1LP9E 4P46B 3VRLE 5T1LD 2JB6A 1TQBB 2NX5A 4G43A 1MREL 2YUWA 1X5LA 5GGUB 3NN8B 4NQCA 3BH9B 4RBPK 3EO1B 5E2TH 2G75B 1IARB 2X4NB 3SCMD 4J3VA 2VZ3A 1HHKB 2CMRH 2UVEA 3EYUH 4PV8A 1LEGA 3IU3B 4G7VH 3IDJB 2IMMA 1OY3B 3GSNL 1OAKH 2X9XA 4M6OL 5FYJL 4TSCL 4NGHL 5DF0A 5EFIB 4IOFC 4E41E 1HHJB 5CSZB 1KTDB 1GAFH 1PKQA 5HHOE 1JGLH 3TIEA 2G5BB 2F8VA 2BSTA 5F3HB 4NYLB 2R8SH 5JR1L 3LN5B 4ELKA 3BVNB 3O0RL 1ULVA 5E00B 1CDGA 1LE9A 1TIUA 1R24B 4H8WL 4PJFE 4NQEB 2Y4SA 4RIRA 3MV8B 2XACC 3NGBB 4ZUUB 2C3HA 1T80A 1B0GB 1I8IB 2VSCA 4CVZB 3H7LA 5AZ2L 5GGVL 4G9FD 1TNNA 5DQJB 1FAIH 2VDRL 3MV7D 4NNPL 4HK3J 1YYML 1CGTA 1MCOH 3KYOB 4QY8A 4OCNC 4IDJL 4G8GD 2VB5A 3BYTA 3RU8H 4HGWA 4Z7VB 4AT6B 3K8KA 2FL5B 4TUOA 4PGCA 4LHQB 3ZYJA 5FO7B 2Y5TB 2DL2A 4TUOB 3S3PA 1A2YA 4YXHL 3MGTB 1SY6H 3EHBC 4PRIB 3QDAA 1ZLVK 2J7LA 1KLGA 2QQKH 3I2CH 5E8DH 4P46D 5KJRL 1J1PL 1MF2H 1U9KA 4I2XB 5GJSL 4DGIL 2NX5D 5T1KD 2ZUUA 3C5ZC 2IADB 2CRYA 2NY5C 3PWJA 4FS0A 3RJDA 1ZT4B 1Z9OA 3MV8A 4KMLB 3U7WH 3PWLA 4PJHA 4H0HB 4UDUA 1BOGB 1CFQB 4RISL 2DQFB 2XWTA 3O11B 3U6RA 5KANG 1MUJA 3BO8B 5SWZB 3SKOA 4MQXD 2VIRA 3OF6A 1M7DB 4HW6A 3OB0H 1AO7D 3O3DA 2PXYA 4WTZA 1YJDH 3TN0D 3WFCL 2R69H 3X13A 1CQKA 1LO4H 2VR4A 3FTGA 2J4WH 3B2UC 4CN4A 3R8QA 3CFEB 2ZCHL 3L1OH 3DRTA 5JXEC 3FT3A 4BK5A 1JCKA 4FZEH 3HE7B 1B0WA 3OJ2C 4I18B 4I48A 5D6CA 4Y4HB 4HJGA 3VGAC 3BZEA 3CFEA 4XBEH 4ZUTA 4NRXB 2OXGA 2VDKL 4OKVA 1U3HC 4JKPL 1OGAE 4LRNH 1KPRB 4PBVC 3MNZB 3UPCA 3KR3L 3VH8G 3RI5K 3VWKC 4P46A 5DVNA 1W0YT 2Z91A 4FHBD 1H3PL 3G6DL 5HDLA 1KGCD 5MEOB 3WFDL 3C2SA 2ICES 4LPTA 1MCBA 1SMOA 4FQIH 4PRHE 2YUZA 4S2SA 1U93A 3VD7A 2MOVA 5H37G 3VDAA 5AD0B 4R90L 1MWAH 5EOQH 3GHBH 4YDLC 5D7IF 3K2UH 3GRWH 1DN2A 3E2HB 1C7TA 1DLHA 2PCPA 4UUJA 4QYOB 1XAUA 1UKQA 5MI0B 4QY8B 1H3TA 3VG9B 3WUWB 4DN3H 3B83A 4R4BA 2P8PA 3S35H 4QO1A 4OLYH 3CFDA 4EQ2A 4M3JA 1G84A 3CK0L 5DJCB 1U8KB 5T3XD 5C8JA 4MLSA 3SE3A 1ROWA 2G60H 4Y19E 3RVXD 1MNUL 3N0PB 1FRGH 2P43B 2AKRB 3OJVC 4NKDA 2DJ4A 5IMLB 1F3RB 5C09D 2HYMA 4RQQB 1D6VL 4JFXB 3BSZL 3GB7A 1ZT7B 1LP9B 2IQ9L 2CK0H 1OCWL 1VKXA 1CGXA 2V2TB 1U6AL 3B5TA 4YHYC 4X6CE 8CGTA 4EKXA 2ZUQB 4K8RL 1YQVL 3U4BL 4GAGL 2NXZB 4GBXC 4RMUA 1QRNA 4XNYH 4OFDA 4JY4B 1W8NA 2H3NA 3I85A 3S35L 1F3JA 4M6MH 1MUJB 3S7GA 4XGZA 3DNKA 1DDHB 1PD6A 4KTDH 5IIEA 4JFEB 3U0TB 3KYAA 4ETQA 5HGHA 4FN0A 4TUKL 3FQUB 2Q3ZA 5DTFB 3QDME 1AFVH 2ZJSH 3FT2A 5HHOB 2X9WA 5EBLA 1WC7A 3NCJL 2YD1A 3SOBH 3A67L 4JHWL 4Y16C 3SDCB 4LSRH 5MEPA 5F44A 3LQAL 5I1HL 4PRAA 1OGAB 1DANT 2GY5A 3KJ6H 1CU4L 2GYSA 3VXRA 3L7EA 4DAGL 1OVZA 4DKFH 4XPAH 3D87B 3JBG7 4P4KC 4JLRB 5IQ9A 3T0EB 1KIQB 3QFJA 4MNQB 4P2CG 5TPWL 2FZ3B 1E27B 1CFNA 4I0KA 4JRXA 5KSUB 4LLQB 4OQTH 3T3PE 4OQTA 1D9KD 4XWGL 4D2NA 4MD5A 5GS0L 1NMBL 1M7XA 1Q9KB 1JTPA 5FDWB 4YHPB 1NUGA 5CGYD 5T1KA 3F7PC 4V1DE 3V79C 4Z7VE 5F96H 3ARXA 2BXZA 4LHJB 4J4PC 5JQ6L 4MXQD 5L8JB 2E9IA 2CLVA 1G7LB 4DKDC 5DJ2A 2C4FT 1J87A 1FFPB 4FQQA 4MJ2A 1OP9A 3SDDD 1GZQB 3BP7B 2DIAA 3CJJA 4HMEA 4WFED 1RJYA 3QJHA 5DA4A 4O51A 2R4RH 4M5ZL 4XWOD 5J6HA 3WNOA 2VWEE 4JY5L 5IMMA 2QBWA 1LK2A 1WJ3A 3GI8H 4GQ9L 4WU7A 3REWB 3WNPA 1SM3L 3NZHH 4WUUA 1OSZA 4XBGB 1AGDA 4PJ9B 3QQ3A 4M5YH 5F6IC 5DT1L 5L6YL 4HDIB 4Z7UE 4LSRL 3HUJA 3D6GA 2CR6A 3ARED 4UV4L 4FABL 5D7LD 1R5WA 3STLB 4G43B 3MLYL 2R23A 3HG1A 3S5LG 5SWSB 3HUJF 1HHHA 5GXBB 3PDDA 4X5XA 4OFVA 2O61A 3DO3A 3M1BB 2KZ1B 3WKNA 4YK4B 4PTUA 3U2SA 5JPMA 3LEYH 4P2QB 5CILH 4AIOA 2R2EA 5EOTA 2Z8WC 1IGCH 3AS3A 4KXZH 2C3GA 3IS1X 2GJZB 5GGRY 4YWGL 3H42H 2R39A 1IQWL 3M8OH 4YK4C 1AP2B 1NMAL 5DJAB 2A6IB 3MV11 3PGFH 3IVKA 4EVNA 5EIQA 4OZIB 3K4AA 3O6ML 1WZLA 1RHFA 1MCJA 4LPUA 3HC0A 1YMMB 2XFXB 2BVPA 1J5OL 1N5AA 5C0BE 5C71A 3JUZA 4B0MM 1Y18A 1DVFD 3BIBX 4PRBB 5AWNL 1LEIA 3EW3B 3GIZH 4YZFE 5EU3A 1A1OA 1FVEB 1PLGL 4OAWA 1FORH 4G7YL 4XAWH 1AO7B 4C4KT 1RULH 3JTSB 4PJ8D 4M7JL 3T4AB 4DCQA 1H3VA 2W60B 3OKDA 5I76A 3CZJA 1O5DT 3MNVB 4MJIB 1MWAL 4JKKA 1CTOA 5C07B 4BJLA 1WZKA 3QUKB 1DP0A 4G3YL 1CDYA 3TT3L 4NDMA 4RZCB 5IHZA 2X7LB 5CHNA 3G6DH 4PRAB 3IFOB 2YN5A 1C5CL 4X4YA 5I1IH 4LLDB 3MRRB 3PXHA 3MRNA 3V7AE 3SKUD 3GM8A 3TV3H 2HP4A 4D94A 2F53E 3TBVA 3WFHB 4Q2ZB 4H5SA 3KPRB 4OFIA 4UAOC 2BC4B 3TBWB 3GBML 4N0YH 2YPLE 5CJQL 1XCQA 3G08A 5DWUL 3TBSA 4NBXB 5JW5A 2G60L 3GSWA 4MAYA 2A73A 5DFTA 3OMZA 4TULL 6FABL 3KNBA 4NQDB 4CBPA 3D3VA 2ZUXA 5DURD 2CKBB 2WW8A 5BVPL 2DWDB 3QHFH 2R9HC 4OLYL 4ZTPH 1UT9A 5A2IH 4URTB 2HRPL 3MO1B 3DV4A 2XOTA 5GS1C 1UACH 3MV7B 3F5WA 1G9MC 3PJSA 5IG7A 5JUEH 1QRND 5CFHA 1OAXL 2DLHA 1MJ7L 2AERT 1N0XH 4NSKA 3UTQA 5T33H 3O6FB 1T1YB 4FP8L 5FO8A 3BN9D 4X8JA 5FCUH 2P24B 5IESH 3SY0A 4CADA 4XVSH 3TBTA 4DUWA 1OF2B 2NY4D 5JR1H 3HNSH 1FLRL 4HJ0C 5IMOB 1SYSB 4EI5D 2VLJA 3FN0H 1EEZB 4OZIE 3V0VA 1IM9D 3QIWC 3IETB 3OAUH 3H3KA 4N1CA 3MBXL 4IMKC 3ZHLA 5C0IA 2OJZH 2I9TB 3HZKA 1AGBA 3OKMB 5JZ7C 2P48B 5C70A 4PJIA 2FEDD 5IBUG 3SGEI 4OZGE 2ICEB 2R1XB 4QRTA 1LE9B 5KS9A 3DMMB 3LMJL 4AM0B 3MRHA 4LAQL 5LAXB 4MSWA 3BI9X 1WIOA 5DEGA 2BVUA 1D9KC 4AL8H 3QWOB 3VFWB 3E6HA 1PKQB 5D7SH 2YKLL 1AI1H 5I8CA 1JFQL 1K3IA 2DKMA 35C8H 4WHDA 3KLAB 1ZEAL 5BZWB 1CDCA 2WQ8A 1SEBB 4OJFH 1RZ7L 4WO4A 4IS6A 4U1LA 4HC1L 1GGIL 1GXEA 1KUMA 1E6OL 3SKJH 3SEPA 3EIFA 5K93A 5K9OA 1KC5H 4Y5VC 4XVSL 5ETUB 1AR1C 2LVCA 1R6VA 3ET9F 4Z76A 5L7XH 1QFWM 1KJ2A 1M7DA 4M6AA 2Z91B 1I8LC 4OKDA 3ARDD 4LLWB 1CFBA 2IPTH 3I6GB 4Y2OA 1MCQA 3LIZL 3ARBC 4U1HB 2J12B 4NZTH 5DR5H 5F1NA 2A6JA 1YECL 3T0VA 5DJ8A 5H37H 1QHPA 5CP3H 1CDUA 1GZPB 4XP1H 1FNSH 3ZKQD 1F58L 2N4IA 3MCG1 3VMNA 4L8BB 1VEMA 2F5BL 4WUUB 5HYSA 5D1QA 4XAKE 4KK5C 3EJYD 1XR9A 32C2A 2IH3B 5D7JD 1YMME 1I7RB 3KDMA 5B3NA 5J6HB 1BX2A 3HI1B 5E4IA 1I3GL 3TWCH 3MACL 4FFYH 5ISZB 3ARFD 1SBSL 1EHNA 1NC4B 5L2JA 2VO5A 2OTUA 2DAVA 3ZSTA 5D6DA 4K3JH 2R8SL 4LASH 4KKLD 3TO4D 1MRDH 3RL1A 5GGSY 1HCVA 5JHDB 3RRQA 1RZ8B 3C6LC 4L3EB 2BCKB 1IFHL 3B6SB 3VRIA 2CDFB 3E3QE 2AEPL 3GIVB 4KDVA 2DN7A 5D71H 4XAKD 5KVFL 4NN5C 5GGQH 1R24A 3WEXA 1HIML 2F74A 1FAIL 4TSBH 3QCTL 5E5MB 3V8CA 3OL2A 5C9JA 4DVBA 1I8MA 4ZOBA 3FO1A 4DGYL 3IDGB 1HHJA 4F8TA 3V52L 2EC8A 1XR9B 2JCCA 2X40A 4EDXA 3TFKC 3AREC 5IW3A 1EDQA 2QQNH 3HZVA 3IDJA 1XF2A 1HDMB 4KGLA 1INEH 4PP1C 3FOMA 3IETA 1H8NA 5DUBB 5I2IB 1L4IA 4MNGE 1NC4D 3EYSH 1DL7L 3SCMA 2OX5A 1U8MA 1RVFL 5HYJB 2YPVH 5IIEB 5F97E 3LS4H 4OD1H 2IAMA 4X6BB 3Q2CA 2OI9B 4YGVA 5A16A 6FABH 5LQBL 3EUUA 1IJ9A 4K3DL 3TIEB 3UX9B 4D0DB 3CZFB 3W0WE 1MCPL 2J8HA 1ZV5A 3MLUL 3CLEH 3R1GH 1EGJL 2OK0L 5TE4L 3ZTNL 1C1EL 2VLKB 5EPMB 1HNGA 1X5IA 2XQYG 5IBTH 4HBQA 5TE7H 3GJFB 1R3KA 3BZ4B 1ACZA 3V5DB 1SEQL 1MJJB 1BD2A 1JWSB 2H8PB 1S7UB 4MQSB 1MFCL 5MHSE 4J4PA 5SX4H 3VGGA 3VXTB 5J0BA 4F33B 2KDGA 3F7VB 2QSCH 2H2SC 3IJYB 4DGYH 4DK6A 5HPOA 1QG3A 5CZXD 4IIQB 5C0EA 3MOBH 5E08H 2JIXA 3I6KB 3CLEL 4X9GA 1WISA 2W1NA 3GUTA 5I15L 5BRZB 3JV5A 4WVRA 4WW1B 1I9IL 2J8UB 3KPTA 2XN9E 2AXGA 4NO2B 1ORSB 4RFOL 5IVZB 1ZXQA 1FZOA 1KCKA 1W72B 1P1ZA 5I75B 1HEZB 3H6JA 3PP4L 1I8KB 5DFWH 4ZQKB 4U49A 2NXYC 4Y16A 4ZNEE 1S78C 3NFPB 2EH8L 5D72H 1V8HA 2FO1A 2FR4B 1BBJB 1FL6A 4LRIC 4NKOA 4LSDA 3Q6FB 1VCAA 5HVWA 1OQXA 4PG9A 4M7ZC 1N8ZB 3DMMD 1ZHNA 1I1CA 2VLJB 5H35A 1T0MA 1U92A 4JO1H 1MPAL 2JLLA 2ICEA 1AHWC 3BP4B 3IVKB 4Z9KB 1MVFA 4LIQE 5I6XB 1A7PH 4QRRD 2SEBA 4R2GD 4X8JB 2LU3A 3HZKB 3SKMA 2H32A 5FYJD 1J1XH 5ICYA 1YEGL 5IROC 5F21B 1IAMA 2J2ZA 5D7JB 2X4PB 2IALB 3RU8L 5I71B 5E9DD 4KJWC 3QQ9C 4TRPL 4DW2L 4R3SB 4PJEB 5I74C 2YA1A 4ZXBA 4QCIA 1Q94A 2CO7B 2VXVH 4PP2A 2PNDA 4R7NB 3WE6A 2C5DC 2VXTH 1B9ZA 3CFJB 2X1OA 2MNUA 4FRWA 1TCRB 4H8WH 1GGCH 3E2HC 4JFFA 4XVUC 2D4FA 4LAJH 3WMSA 4GKSA 4EI6A 5AZEH 3CX5J 1NEZB 1JUFB 1X3DA 4GG8B 5FCSH 2NPLX 1P4IH 1NMCB 5K9KA 2PTTA 2Z31C 2X89D 3WUZA 2DQGH 3MLRH 1FVCB 2VLKA 4OZFB 5J1AA 1FO0L 3IFPA 1MAML 1TCMA 4ZS6C 4Y4KC 1UH2A 2Y23A 3BT2H 5I8KL 5IM7A 2EO1A 4KGJA 3S4SG 4ORGA 2OM5A 2DLEA 4KK9D 5CD3B 5GS2H 1I85C 5HXMA 5IM7B 1MRFL 1Q9LB 2J8UF 4OF3A 4ERSL 2Z93A 3LN9A 4ZDHB 4MD5B 2HLFD 4OUOA 4RX4A 1F5WA 4OCXL 5JA9A 1CICD 4IIQC 1SBBA 1MWAA 1DBMH 4M43L 5HVHB 2ESVA 3JVGC 1LGVA 4JRYA 5I16A 4U0RC 4GW4B 1T1XB 7FABL 1ZA3B 3KLDA 1KPVB 4JKLA 2DB8A 3VFOB 4IHOB 5IWLC 3V4UL 5LGJA 5ITFA 1N59B 1PQZB 35C8L 4DVRH 3OX8B 1RIVH 1XF4A 4G9FA 3PQYE 3TESA 1N0XL 3RZCC 3BXNB 4Q6IA 5KG9B 3C5ZA 4PG9B 2NY4B 1BPVA 5HGBB 1GOGA 3BGMA 4JFEA 3U0TA 4X7CC 3V5KB 1XFPA 3MR9B 2E7MA 5EORL 1A6WH 5IJKC 3G6JA 1OARH 2BY2A 2DLTA 4PREA 3L5WB 2W0LA 5E2JA 3WKML 4LF3A 5IB1B 3D9AL 4ENEC 5FV1L 1F8TL 5DR5L 1IGCL 3ZTJH 2MCPH 5IVOA 1GGUA 5HGDA 5CEZL 1CWVA 5ESVB 3JWDC 1NC4A 4HC1A 4KJPC 5T1MA 5L2JB 3ULUL 1EXUB 5DSCB 1NGQH 5EULV 5JW4R 3DIFA 4G6AD 4Y5VB 1U92B 2DD8H 4M6ML 1MCWM 1BP3B 2ICWJ 1YNKL 5KVDH 5FUCC 3STZB 4RBPH 1Q38A 1X44A 2V6HA 1UM6H 4R4BB 2MTPA 5HHVL 3RWEA 3ULVE 4UT6L 1A7RH 1WGOA 4V1DB 3I6LE 2VDOL 3WO3B 3FRPA 1DN0B 4YHOL 3TA3D 3QNXB 1FNFA 3BPOB 2BSRA 1VPOL 4PV9B 4U1HA 1KEMH 1U2HA 2HRLA 4MJID 4BFIA 4UU9B 4MD0B 5INDB 5F88A 3CZFA 3LDBB 4UINH 1L7TL 1OB1A 3MZTA 1AE6H 4LHUD 1WBXA 1M05B 4PY7A 4YHLL 3MRKA 3D85B 2X4TA 5C0EB 2NXYD 2R4SH 5ESAB 3L1OL 3ROLA 3UAJC 1BJMA 2WIIB 3VXUD 3IT8D 3AREA 3B5HA 4JVPA 4TUJB 5I9QB 3KYMA 1NFDF 1EAJA 1E28B 3ZDZF 5ADOH 2IPKA 1MI5D 4YHKL 3P4MA 4JAMB 4XNQA 5DRZB 5GRVL 3C8KA 4B50A 5EN2A 3CD4A 1UA6H 5EU6B 2AP2A 5GRUH 4ZTPL 4MVBC 4RMSA 4Y5XC 2V2TA 5GZOC 2YSSA 2DQHL 1ZGLA 3MGOA 1ERNA 4M5ZH 4C4KO 3CGTA 4RQQA 3BUYA 1D5MB 1QSED 5I1JL 1CLOH 4FZEL 4CVUA 4N8PA 5FCUL 3RHWF 3F6LA 2A6DA 2J3SA 1RUQH 4IRSB 1DQML 1A1NB 3SPVB 3W9DA 3ARGC 4JZNB 4HLJA 4HIXL 3HN3A 3PGDA 4L4TA 2XT1B 3ZLQC 3FB5B 4WFFE 2EE6A 3I3EA 2P47B 4QHMB 2D7QA 3SQOH 2CXKA 5JXAH 1XF2B 2L0DA 4R4ND 1MREH 2VJXA 3NABH 4X99A 5D1XC 3WFDH 1ZA6B 1VFAA 3U46B 4PRPA 3O8XD 3V7MA 1CD1A 1NAKH 2F5AH 4FQPA 4PLJD 1G7HB 3J8F7 4M1CC 1ZHNB 1GGBL 1YEHL 1EIBA 1DQMH 4EOWH 3OKLB 2CGRH 3OHXA 5J3HD 1Z0MA 1H0DA 3EFDL 2VH5H 2WUBL 4NQVA 2YUXA 2FATH 1IBGH 2A1WH 1EA9C 3O0RH 2AGJL 1BQHG 4UUJB 1B2WH 3I50H 3S37X 3F7RA 1TZGH 2EECA 5FYLE 2NY1B 3NACH 2A77L 2A73B 3DYOA 5EDXA 4I18A 3I9GL 3T1WA 4POZC 1V7ML 3N9GL 5BS0B 4G9FE 4TQEL 4ZMAT 5E00A 2HA1A 2OTUB 3BE1L 3MLSL 2BC4A 4JM2F 4L4VD 2M26A 4ZO8A 1IGMH 4YBQC 1J1OL 1OAQH 2D7TH 4XNUH 4NPYB 1P4LB 3T8XA 4OD1L 4JM4H 1SHMA 4W6YB 1JHLH 2A0LC 2PXYB 3WS6C 5CILL 2VITB 3CX2A 3EYOB 1XZ0B 4WI9A 1LK3L 3VJ6A 4U1LB 1MCHA 3QDGA 4P5TA 3UP1A 4F7TA 5HYQB 4MD0A 3DUSB 3H42L 2CQVA 4FQ1L 3NMEA 2IFFH 5C08D 5E70A 3W5NA 1SY6L 5FKPB 2EDYA 4FQXB 1FSKB 5DD6A 1H8OA 1BM3L 2KQNA 4O02L 2GW5A 2R1YA 3VFWA 5GJTL 1KEGL 5CEXB 2B4CL 1TTFA 3HC0B 2D03H 5ENWB 3ULVH 1MLBB 2Y5TA 1Q9OB 3P4LA 3QIWA 3BPLB 5K9JH 5DD3L 1QBBA 2NY2D 3VXPB 4Q6YA 1G9NH 4U0QB 4XMKL 3L6FA 1LNUB 2RIKA 4AIXA 5T3XH 3OKEB 4PPTA 3AM8A 1OLZA 1T04B 3MRJB 1KJ2H 2V5SA 1B6DA 1O0VA 1UXWA 5BW7A 2VISA 4HIJB 2EEBA 1UH4A 1G0YR 3QZWB 3GMOA 4XBEL 2P5WD 1KIPB 3TVMB 3V5KA 1R3HB 1OW0A 4PTTA 4XWGH 1KPUB 5EPMA 1UYWL 1MI5E 5IW1B 4NC1C 2C1OB 3AXLB 3HLAB 4U1JB 2CIIA 4P2YA 1MELA 4G9FB 4HJ0D 3FB5A 4I4WB 3DX9A 4GRWF 4JQIL 4L4TB 2VLRA 1J18A 4XBPB 3FB7A 3QCVH 2R0WH 1S7RA 3RZCD 4YWGH 1JHKL 4IHOA 3BPCA 1JF1A 4OZIF 4MAYB 4NQED 3G04B 3DLQR 4P4KB 3GMLB 3HAEB 1I1AB 4ZAKD 3PNWB 5I1LB 5IK3A 5IMKB 3UO1H 1XCTA 1T1WB 2ADJA 3FFCD 1ZANH 5FYKE 4ALAL 1RJYB 2VN4A 4E41B 5ISZA 2W9DL 5C2UB 1Y6MR 1VACB 3D0LA 4N0CD 1J0KA 3RBSA 3ALXA 4OLXH 1N59A 2Y36L 2X4SA 1OSPL 1HXMB 2W65B 1MCLA 5D5MF 3SGEH 2VDNL 2YA2A 2OK0H 3LKQA 1M6OB 5FKAA 4P3DB 3AY4C 2FSEA 5D5MA 3W39B 1CLOL 3P0VL 2NY7H 2R0ZH 2BNRA 3U0PA 1MFEH 1WV7T 1ZHLA 4IDLA 1FFNA 5FKAB 3VE0A 5I17A 2EIEA 4BH7A 4U33A 3GSVB 5BQ7A 8FABA 4XNYL 3GIVA 4NNPH 1T6VN 4NZRL 2Q8BH 5GRUL 4X98B 4XPFL 2COQA 5I9QC 4DZBB 5FM8A 3RGVB 3ULVF 4JB9H 3QQ4A 2I60L 2VLME 1XGYL 3SGDI 1I1RA 4OCLC 4ZO6A 3L7FB 4WI4A 5HHOA 1HOCA 1EO8H 1I3RA 4D0BA 2AEIT 4TVPH 2PTTB 3AVEA 2UZYB 3CCHA 4NWTL 4Y8DC 1J05A 3RA7L 2VXUL 3O6LL 2P5WE 3QEHB 1N5YL 5IB3B 2NZIA 1GOHA 1AXTL 3MCKA 3DVGB 1EMTH 5L2KA 5EU3B 2BP3A 3BPNB 4H26B 3C8HA 2XTJE 4WUKH 5DK2B 1IQDA 1IBGL 1MCCA 1J0HA 4QRTB 1RU9H 4GRWH 1EO7A 1XF4B 2Q86A 1EUTA 3T2NL 3QZWA 3AU1B 5KVMC 3NZ8A 5CMAB 5DI8B 5EZJA 4L9LA 4OZFH 3ZZ1A 1KJ2B 2V17L 3BWUC 3PL6C 4R97C 3TVMC 3VXSE 4FZ8H 4QHLA 2WBJC 4OD2B 1KJ3H 4IRJA 1QNZH 5EZIL 5KVEL 4WFHD 2FHCA 1S9XB 4DFIA 1T22A 4ZQKA 1TDQA 3DHMA 3VI3E 2ARWA 1IZJA 3HE6D 4QT5B 1HHIB 3LRSA 4OLZL 4RFEA 3UJTL 4X4MA 4QRQB 4EEEA 2Q86B 3TBTB 5DEFA 3RKDD 5CEZH 5B4MC 3GHEH 4KMTL 4P5KB 1NGPL 4W6WB 5AG8A 5LKNA 1Q0XL 2JELH 4Z7UF 5T1DL 3B9KC 2QL1A 1U95A 4MQ7B 2EYRB 5I1AA 4JCMA 2D3VA 1RPQA 4ZFGL 4J8RB 2AQ1A 1B0RA 3RDTD 5C0CD 4ZD3L 2DLIA 5CJBA 2XWBA 5DMKB 5IVZA 1CCZA 4RDQG 3BRDA 1CFNB 1HHGB 4OZHF 5C0BD 4CJ0A 3P77A 2EDWA 4BZ1L 2OI9C 3EO9H 1Z9MA 3EJYC 4JDTH 5DZNA 1D5ZA 1KTRL 2Y72A 4HKZB 4Z95L 1YYLH 2JJTC 4XMPH 1S7XB 4XI5C 1FLTX 4M61B 3DECA 5I1EH 4G8FA 2XG5A 5EU5A 5H2BA 1IQWH 1OT2A 2R4SL 3M8OL 3HCVB 1T0NA 1UWXK 3IDNA 3L3JB 5LBSL 1LWRA 4WW2A 1SJEB 2QR0A 3KPSB 4AK1A 3KWWB 3TZVB 5FO9A 1T1ZA 4ZUWA 1TZIA 3MFFA 4LAQH 1FC1A 2BVQB 1INDL 3EFFA 4WFGD 2W0PA 1BZ9A 2AJXL 2PTVA 3RVVC 1S5HB 3V0WH 4ZYKB 4F7PA 1OD9A 4WCYH 1IZKA 4HIHA 1YYMH 4RGOH 1IAII 3AY4A 4D3CL 3T0BA 3Q0HA 4KJQD 2D7NA 1XGRB 4NKQB 3FHQA 1GPOL 5LXGH 2X4UA 4PJDF 1QSVA 4LCWD 5F8RC 1GGIH 3AMKA 4TNWK 1ONQB 3S5LA 1T04A 3MRJA 4YDVA 5D93B 1E4WH 2P8PB 2DF3A 3NA4A 5D7LB 5TF1H 4JFDE 4U7KA 2AJSL 1YY8B 5E6IC 1FJ1B 4OF5A 1S7RB 4GFTB 4JZNA 2Y36H 1B0GA 3OB0K 3RWGB 4W70A 3L5HA 4PJ7E 4P46C 4PJ5B 3I6LD 1S9VB 2OL3B 3LV3A 4YUEH 1CLYH 1RZKL 3E8UL 5L8KB 1MIEL 4XNXH 4OCYH 2ATKA 3MJ9L 3IRPX 4YR6A 3QRFM 4LSSL 4WY7L 2OR9H 3IF1A 1OTTD 5DK2A 2DOCA 2ATPA 2VLLA 2F5AL 1BQLL 3I75B 1I9EA 3QFDA 3FONB 2EXYD 3QG6B 4WWKA 5IFAL 4MA3A 3SDXE 3QH3B 1TXKA 4NQUA 5KSVA 1TLKA 3D25A 1EHXA 4PBXA 1UWEH 4NM4H 3BKJL 2FX7L 5D7IE 5ANME 1S5IH 5T3ZE 1MIEH 3HNSL 3FFCA 4K3JL 4ONGL 3HPLB 1ZLSL 3RIFF 5KW9L 4LNRA 5AUMA 1G7IB 5JXED 3RA7H 3AM8C 5EU6D 3DYPA 4HPOH 1MLBA 3K2MC 3GSRA 4YXKH 4XC1L 3ETBF 4YX2H 3QIBD 1CT8A 3MJ8B 5D1QB 4X98A 2EDEA 3IXTB 2FECL 5E1AB 3KJ4B 3ZKND 2D0HA 1YA5A 3D18B 1GCFA 3ZMRA 1U8OA 1YY9C 1JHTA 3PWLB 2OTPA 2BRQA 3H2WA 5CJ8A 2VL4A 4G7VL 2F54A 4KKAD 4RMVA 3RAJL 3AB0B 2P8MA 2R2BA 5D6CB 4F7MB 1EHAA 2NXYB 4JFED 3V6OC 1JGVL 4JQXC 3DVIA 4XBGA 3LS5L 3NCMA 1JRHL 1HE7A 4EDXB 2P5EA 1Q0YH 4KKNA 1TENA 4F7EA 5L88L 5FF6A 2QADC 4OB5L 1MJ8L 1U41A 4KAQH 4O2EB 4F58H 5E5MA 1RHHB 1MQKH 3WUWG 4LP4A 5C09B 4FG6D 1T7VA 3U4AA 4FTVD 4YPJA 3WS6A 3WXVH 2FGWL 4XVJL 1BAFH 4LVHB 2R0KH 1FORL 4ZFFA 3CLFH 2YBRA 5KSAA 1OGTA 2AK4D 1JRHH 2VLRB 4ORGB 3MV9B 1G7QA 1FZKB 2APWA 3RVTD 4E5XB 3QDMD 4KWUA 1J8HA 3MUJA 4P23B 3OAYH 3UTSE 2GTZA 1VKXB 2ATPB 4GRLC 3SE8H 4GAFB 4JN1L 5KSBF 1FNEB 2R0ZL 4PRIA 4S1SH 4Y88A 4KAQL 1CFVH 1M71B 1Z0NA 3CU1A 5IFHH 2FZ3A 1YEGH 4W4OC 4PJ5A 3C09C 1S8DB 1QFPA 2OJEA 3WCYA 1NL0H 5CINH 2P5EB 2BJMH 1F58H 2NYYD 5CZKA 3QRGL 4FMKA 1YY8A 3P4MB 3TNMA 4U1SA 4YO0B 1T03L 4YDLB 2Z31D 3S4SA 5BV7C 5D7LA 3SO5A 3GSQB 1JE6A 2A6JB 3QPQD 1PSKL 5DJZB 3VGBA 5D1XA 3QI9B 4ENED 2BNQE 1G7JA 4N0UE 1BX2B 1QA9B 3HKFA 1ACYL 4I0CC 1DDHA 3ARQA 1KG0B 3BUYB 1YJDL 3T77A 2WANA 4ZPTA 5GRZA 3LCYA 1BFOB 5D71L 5T33L 4PY8J 3FO2A 1A6PA 3S36X 5C6TH 2NY1C 2X41A 5CP3A 3OJMB 4HQQH 3G6JF 2WINA 3RKDC 2FO4B 1MCSA 5IEKA 2VDNH 3TV3L 2YPKB 3HFML 3NIFF 3GSWB 5SWZD 1HQ4B 3ZDXE 1VB9A 4OZ4A 3QULB 3TA3C 1KNOB 1WZMA 5CWSB 1YMHA 3FTGB 1CG9B 1MLCA 2B2XH 2BNRE 3UTZA 4DN4L 1FNLA 2EDNA 4LMQI 1IAIM 1FC2D 1AD9A 3SJVB 5DJXA 4CDHA 1YN7A 4NO0B 1G7IA 1SVZA 3DI3B 2UVFA 4NKIL 1HI6A 2PCPB 4JB9L 4PJ9C 5EUOB 5HI4C 1SYVB 3K1KC 3CFCL 5ADOL 1IE5A 2ENYA 5A40E 2E6PA 3BZFA 4N0FB 5EIIB 1UENA 4S2SB 4W4OA 3SDXB 1IAKA 3V6BR 4ZXBB 1U8IA 1NGYB 3X17A 4XPTL 4X0KA 5CIPH 4Y19D 1LVEA 1CFSB 4GRLA 1U36A 1BBDH 1H9VA 5C7XL 3U30C 2EXYC 3RUGE 4ZD3H 1MNUH 5HYFA 4WNQA 3RY6A 2I07B 2NLJA 1MCWW 1ORQB 4O4YH 4PTUB 3VXTA 5JPMB 5FB8A 4I2XE 5J4MA 2GTWA 4N1HB 3TCXA 4OZIA 2XA8L 4JDVA 4RFEB 1UJTA 3O6MH 1KJVB 5SWSA 4L1DA 1ZVSB 2FX9L 4LSUH 5E24E 1KXTB 4ONGH 3TO4A 4JREB 4NQSA 1HKLL 1DANU 5HHQA 4O2FA 3EFFB 1BVZA 1YYLL 4HDIA 4I3RL 4R26L 5B38A 2NY0B 4QXGH 1QQDA 3F6IA 3D3VB 1CE1L 3JTTB 5FO9B 4WEBH 3T77B 4X6BA 2VZTA 1PG7W 4MCZA 1J8HD 1NFDA 4W6XB 1AIFB 2D0FA 1U0QA 5HHMB 4LCWA 2AJYH 1F90L 1S5HA 1F4WH 1I4FB 3QO0A 1GL4B 4XPAL 2IH1B 4BFEA 3ISWA 3QZWG 3OKNA 2PUQT 5HI3D 2ZOLB 5HVFB 1PDKA 2FJFB 3TWCL 1T1ZB 1JPTH 4G8GA 1A5FH 3WDHA 3X3GH 1G9MH 1FG2B 3S88L 5JUEL 3EOYG 3DUHA 1L9NA 2BRRL 4BQBA 4QRPE 4GG8A 1TPXB 3D2UA 3G9AB 5EUOE 2W60A 2AJVL 3EYFA 2R4RL 2NY3C 2VLRE 3QUYD 5GRVK 4G6FB 1NLBL 3MSPA 1F11B 4TOYH 5ACZB 1IILE 2ZOKB 1ADQH 3ARGB 3M17B 3VXMB 4C54A 1FFPA 1FN4A 2VE6A 5HGAB 5F9JA 4TSAL 1AQKH 3GSNA 4TNVK 3JVGA 5EUKB 3U7WL 4EZMA 4HCRL 4KQ3H 1XGYH 2I9LB 3SDCA 3GBNH 1V3JA 3LEXA 3LPGA 2XWBB 3E8UH 4Q58C 1NCWL 3Q5OA 3VFSA 4XNZC 1Y0LB 4F9PC 1MQ8A 1S3KL 1Q9WB 3BAEL 4GAGH 4YHYB 3C9NB 4ODVL 3OKOB 2AJYL 3LQMA 1HDMA 3MUZ1 3QR2A 4GRMB 3TGXA 3RL2B 2W9LA 4U3XA 4JREC 4QWWC 3RZCB 4J3WA 4C59B 2F53B 1KJVA 5E6IA 3DTXA 2Z31A 2PETA 2VXQH 1A4KB 2G75A 1KXVC 4PJGB 3NN8A 5J3HC 5HHPA 2BOCB 3STLA 3QPQC 3LEYL 4ETQB 3VI3F 3JWDL 1KJMB 3VXOA 3QUXD 1LO5A 4H8WC 5JQ6H 3VH8B 1U8IB 2MKLC 5FYKU 2E7LA 5HYSG 1INEL 3MA7B 2ADGA 2FB4L 3PHSA 3RWIB 1LP9A 2KL6A 3GRWA 4NNYB 1KYOJ 5C0ND 1G6RB 2YRLA 3T3MF 2HT3D 4MNQE 1R0AH 3ZYIA 5EZOH 3MCLL 2Y07H 4UT9H 4JY5H 2J88L 3LS5H 4FTVA 1K4CA 3PP3K 3KLAA 3BH8A 3QEUB 5MEOA 1BIIB 3U9UA 4X6DE 4XMLH 1NMCC 1A6VL 1YQVH 3P4OB 3U4BH 4PRHA 2A9MH 3SO3B 1V05A 5DLMH 2YWZA 2PYFA 1AHWA 4DVRL 3SDAA 4ZFOB 1PYWA 3GJFA 3O6KH 5JLZB 2V2WA 4OGXH 1NJ9B 4JHAL 1NKRA 4I0PC 1WT5A 5F9OH 3O3AA 3QPXH 5MP6H 1QO3B 4K7FA 4P5MB 2ZCLL 3FFCE 5DVOA 1UB5A 4OSUL 4A6YL 4AEEA 5T3ZD 5GZNC 2AJ3B 4GG6F 4ODSL 3O2VH 1OARL 4HS6B 4YH6A 1JNNL 2OSLB 3MOAL 5D70L 1H5BC 5DJXB 4JQIH 2PW2B 3O81A 2H26A 4JHBA 1P84J 3MBED 3RGHA 3FQUA 4TNWF 4Z7UB 3NIFE 3SKOB 4Y2DB 5D7JC 4G9DA 1I9IH 4QTHA 5HVGB 3OG6B 3NCJH 4LCUB 2NY1D 2WIMA 4YHNB 2EYTA 1VA9A 2FCBA 3LSOB 3BP5B 4XCEB 3K46A 1CDBA 5LWYL 1Z5LA 5HHME 3TPKA 2ERJB 4HMDA 4U05A 2QSQA 2WBJA 2I60H 4ONHA 1WIUA 4QF1A 3QUYB 5EC2A 3FT4B 3RDTA 3BD5A 4PGDB 4LKXB 3R0NA 4QXGL 4L9LC 4NN6B 5DEZA 1ZLWH 1R5VB 1ODAA 5EOQL 1A3QA 3A6CH 1MY7A 5D2LB 4O5LH 1L7TH 4HUKB 4GMTH 4NHCL 4MGXA 5ERWB 1Q94B 3AUVA 1UWGL 5FGBA 1F4WL 3QPXL 2QEJA 4KTEH 4PRDA 1AXTH 4YIQA 4NGHH 2IANA 4O2FB 2IAMC 4YHLH 1KYOK 4MWFB 1KCSL 1NFIB 3KPPA 3VRJB 4GRWE 1TVBA 2BOBB 2ED7A 3P0GB 4JZOA 4WFGE 4ZUUA 5IFJB 1F90H 5I1DA 3W5MA 5GSVB 1T5XB 3F7YB 3TJEH 1N64H 3QUZD 4P2RA 5EOCH 5D96C 2J88H 5IV2A 1JYVA 1OCWH 5DFVD 4WNQB 1L0YA 4B53A 3LN5A 4ELKB 3BSZH 1IL1B 2WWKO 1QFOA 4XWOC 2AXHA 3FQXB 3MLTA 4HH9B 4K9EC 3P9WB 4PG2A 5MEQA 4H88L 4GKZA 1X4XA 1EJ6A 5KOMC 3HZYB 2DKSA 1MI5B 2Z4QB 4PV8B 1XGQB 3FQRB 5ENWA 5TH2B 2MPAL 3BESR 2Q3AA 5BMFH 1R3LB 1KT2A 5SWZE 3NPSC 1MAMH 3DX8B 5KAQF 1NAMH 5DS8B 2L7JA 4O5LL 3O2VL 4U2YA 4Z78A 2GJ6D 1IKNC 5D6DC 4C83B 3VD3A 5K9OB 3IU3A 4JVWA 1KBGH 4LCUA 1UZ8A 2DLFH 5DI8A 2DQFA 4JHZA 5HPMA 5HYJE 2E27H 4BFGA 4H0GA 5GGUA 3T4AA 2EO9A 3LB6C 1E0OB 4FQLH 1KELH 2KZWA 1TVDA 1G7MB 4JO2L 3GSXA 5D2NE 4UNUA 2YC1A 4XHJD 5FYLD 1FBIL 4RGNC 1FVEA 1NGPH 5E1AA 1CBVH 1SMAA 3I75A 2EH8H 5FGSA 4PJCA 4BK4A 1QFWI 3MOBL 1MHCA 1MIML 4N0CC 5E08L 4AENA 4LHUA 3GM0A 1P7QD 4JG1H 3H9SB 3T1FA 3MRPA 4P4RB 1A3LH 3ARBA 2Q7YA 5B21A 4AQOA 1Q9WA 4F57H 4Z8FH 4G42B 4UIKL 1IFHH 1NFIA 3KPPB 3VRJA 2NNAB 4O9HH 1JV5B 1OW0C 5I0DA 2HJKA 4ZOCA 5KSVB 2BMKB 1IEBA 1FFOB 2P45B 3FQTA 2ZSVB 4JPWH 1G9ML 2JK5A 2R0KL 1UXSB 5C07E 1XF5A 4JO3L 4NQXA 4Z7WB 1TFHA 4U4BA 4AH2B 3GSVA 4TTDC 5IVXE 4CKVX 5AZEL 3ILPB 1VSCA 1KC5L 3LPWA 5I1CL 3DJ9A 4NBZB 4OZHA 4O4YL 2YPVL 5D5MB 3LKPB 2X70A 4QF1B 4QNPF 4F80A 1PJ9A 4P3DA 4PRNA 2VXUH 3O6LH 5IB1A 1G7QB 1XGPA 5FYJH 5T3ZL 1AGDB 4ODTL 3X12A 2A9NH 5GISL 5LGJB 3FO0H 2ADIA 2YPLB 4Y4FD 2NW3A 4P23C 1BWWA 3ES6B 4TRPH 4UMGA 3LIZH 4JY6A 1NCWH 5SWSD 5JTWA 4KH2A 5K59E 3KS0H 3QUXC 4LVHC 3BN9C 1IC7H 5IK3B 3AREB 1GGYA 5ID0A 3QDJB 4Z0BL 2Y5EA 5CSBA 3L5JA 4PJDA 1IGTA 3QDMB 5CJXA 4IMKA 3VFNA 3VXSB 2BVYA 3I02B 2APXA 3DTXB 5EN2B 3WFCH 3PWPA 4RA3A 2NW3B 4PGZA 5DC9B 1BVLB 1I3GH 3AS2A 5FFLA 4APQB 5FOBB 1YEEH 1YEKH 3WD5L 3E1F1 4GXUN 5F7WC 2HMIC 3KYMB 3V4UH 4LSQH 3ZDZE 3A6OA 4U6YA 4JM2D 4MS8D 5HI5D 1AO7A 2ED8A 1ZLUH 4HFUL 3MLXH 5D7SL 2MQCA 5IBLD 4LSVH 2YOCA 3NH7L 4HPOL 5DC0A 5DJCA 1GAFL 5IW6B 5KBNC 4N8VA 2QQKL 1TTUA 3B9KB 3BKCH 2FIKA 1J88A 3BD4A 5DD0L 3T65A 4X6DF 4KI1A 2R29L 4TN9A 5ESQA 3C08L 4I5BB 5FDYA 1DBJH 4HXAL 1PKQE 2D7PA 3QUKA 5IHLB 1EFXA 3T3ME 3QIWB 4LVOB 5CJQH 2B1HL 3BD3A 4YFLF 2B7DT 4LSVL 3U1SL 2XZCH 4XB8A 4KMTH 3AMLA 1U8JA 5E6ZA 3HR5A 1FYTE 1HNFA 1MHEB 2APVA 5EO9B 4LEXH 4WV1B 5E9DB 4GXUM 1U95B 4JO1L 3R1GL 5SX5K 4DKFL 5HYJD 5FK9B 5CJOH 4OV5A 3DRQA 4BSVB 3EDKA 1GYAA 1IQDB 4NZTL 3P0YH 3BXNA 4YHIB 4I48B 3QDGE 3ULVD 1WCBB 4LF3B 5EA0L 2YD9A 3CVHA 3HPJB 2B5IC 2BZDA 4HUWB 4ZO9A 1IEAA 3DVFA 2WINB 1KGCE 2X4PA 1RAMA 1DUYB 1KB9J 4Y5XA 3R0MA 3ZE0E 4M3KB 4NUJB 2IBZX 3PQYB 5IHUH 2VAAB 3W2DL 2V7HA 5IMOA 4BZ2H 1JNHA 3KHQA 1OF2A 2OR9L 1JZ2A 3L7FA 3M1BA 4P48A 1U6AH 4LFHD 1ORQA 4EN3C 5E5RB 1R0AL 4UT7H 4IOFD 1EGJA 2CUHA 3RGVC 1EBPA 2NCMA 5C0GA 4JRYE 3MA9L 1A22B 4N9GB 1LO0L 3DVGA 2BNRB 3MCKB 3U0PB 4ZSOB 5I8EA 4G8EB 2HFEA 1UKTA 1IAKB 3CPLA 5BJTA 5IMMB 1U8LA 3TO2B 1NCCH 1T5XA 5FOBA 4APQA 4KRPC 1IRAY 3BN3B 2J8UE 4O9HL 5I66B 4X99B 3BP7A 5L0QB 3H9ZA 1GC1C 2QQNL 3OKKB 2R9HD 5IFAH 3UJJL 4FXLA 4QOKD 1X5FA 3EYSL 4PLKC 4XPBH 5D7IB 5ANMB 4AG4H 1WICA 5KSBA 2OTWB 2IJ0C 4HXBL 3PIQB 3HC3H 3U6RB 1MFDL 4Z8FL 3UJTH 3BP6A 2XTJC 1CLYL 1A6AA 3DX6A 1RZKH 1QKZL 1ZTXL 3ARDB 3W2DH 5ADPL 5TJWK 2JKXA 3JTSA 5KSUA 2XQYK 3JV0A 2VXSH 2BHZA 4JPWL 2GJ6A 3FOMB 1KACB 2EKSB 4MNGB 1LEIB 3EJJX 3C87A 2OQJB 3WDIA 4RFNB 1OP3K 4LCCC 1ZLVH 4S10A 1HH6A 4JAMA 5DRZA 1EGJH 4AG4L 4HWUA 2XZAH 3Q5TA 4MA8H 5HSFA 3ARVA 1U91B 1QA9A 3V4PL 1ZHBB 4PB0L 3FCTA 1YPZA 3L5XL 4PJEA 4RGND 2DTMH 1XMWA 1F6AB 4GXVH 1H5BA 3GO1H 4LARL 3TN0C 4QHNA 3H7BA 3O8XC 3T2QA 2ZUSA 3OAZH 1NLDL 4X7FC 1MRDL 4AIZA 2H9GA 3V4VH 3IDMB 2WM0A 1H3GA 2R2EB 3RUGF 3UYRH 4UV7L 5ICZB 4PGBA 2HKFH 5CD5C 3WV0A 1X5ZA 2I25N 4LNVA 5JDSB 5AYQA 2Y1VA 3MLZH 2E5EA 4PJBF 3AC0A 4PD4K 3NGBC 4V2CB 3C60A 5F7LB 1MHCB 5MERB 5DUPL 4MA7H 3DVNB 4Y1AD 1P6AB 1INDH 1X5JA 4GUPB 1I1FA 2F53D 2UYLA 3JWOC 2OYPA 1CL7H 3KPMB 4WEBL 1OSZB 1FSKC 4FQXC 3NBNA 2AK4A 2ICWI 5C0FB 2XN9B 2NMSA 1KTLB 4K3HA 4JFHE 2XIDA 4GUPA 4JKWA 4X7TA 1HILB 1HHKA 4XXCC 3BZFB 1JYWA 1U8HA 4CW1A 4N5ED 2NNAA 4Y4KA 5C3TA 4JZOB 4WFHE 3N50A 3TJEL 2EDDA 4O2EA 4WJ5A 4Y7MA 4Y4KB 1CYGA 2KUTA 2Y06H 3MUGA 5DZLA 2MFNA 2YZ8A 3UTPE 5IGXH 1QR1A 1KCLA 4FQCH 1GC1H 2J8OA 4JJ5A 3RNQA 1CFTB 1ZVYA 3E3QC 4K3EL 2VR5A 5F8QC 3DX8A 4JEGB 4PJCB 2GITA 2ED9A 4ZXBD 2EDRA 3WSQH 2FRGP 2HKHH 3IFNL 3LH2H 4KK5D 1D6EA 4JO4L 5BS0E 2NXZC 2GK2A 5E4EB 5C0AB 4HUVB 5K9JL 1QPPA 4OLWH 1DR9A 2XNAB 1AQDB 4N8CH 1KFAH 1XGRA 1VFMA 3DO7B 1S9WB 1ZHKB 2XKSA 4UIMB 3EAKA 3RP1A 4M48H 5T3ZH 5CKGA 4WUUE 5DUPH 5LGHH 4WWKB 3IJSA 1X5XA 2DQTH 3D0LB 1NC2D 3UBXA 3QDJA 2X4QB 5ECJE 1A8JH 4ZFOL 5LG1A 2L7UA 3CH8A 1T83A 3BWAA 1A6AB 3O11A 3G04A 3O4LB 2Z93B 4P2OA 4ZDHA 4OF8A 5C09E 4E42B 5K59F 1S9VA 1YEHH 3RWHB 3SOBL 1WBYB 4UB0H 1WAAF 3V4VL 3AGVA 1DFBL 5DJDB 1XGPB 4UTAL 2B5IB 1WBYA 3QEQA 3CH1A 1N6QL 4YPGA 4G80A 2VR9A 1S7TB 2Y7QA 4QWWD 3ZL4H 1RUKH 1KCUH 1KJ3L 2JIXD 3T0EC 1NKOA 4NZDA 4OZFA 5DHXB 1DBKH 1A4JA 1I1AD 4ZAKB 1CGSL 3PXJA 4NCC1 1YDPB 4U6VH 1ZANL 1E4KA 2OL3A 3LV3B 4PIRF 1RJCA 1MRCL 1YQ2A 2G2RB 3NA9L 2AQ2A 1I7RA 1EFQA 2XN9D 3QJFB 3FL7A 4X4XA 5GS2D 1PLGH 4PGBB 2EDQA 3O6FD 5DD0H 2EDBA 4R7DB 4L4TD 2FJFA 4Y5YA 1MFBH 4QHKI 3RVWD 1MF2L 1NQBA 3F5WB 3PJSB 1WITA 1E4XL 3GEWB 4H88H 4GH7B 4Y19B 1EVTC 3DSNA 1LDPH 2F54B 1G6RA 1IGFH 2KKQA 3MXVH 5DURB 1XIWB 2VDQH 5FGCB 2X9YA 1DQLL 5MHSD 1D7FA 4MB3A 3U1SH 4J3UA 3TBSB 2VDMH 2HJLB 5I8OL 1BOYA 3G5YA 3FN0L 4MCYA 3CDYA 2EYSB 4GS7B 5ICXB 5L7XL 2D31A 4ZG1A 1H3WM 2YN3A 1LO5B 3MXWL 3U82B 3MO1A 3W81A 1QR1B 4NQDE 5EFIA 1EK3A 3ARWA 3MOQA 4HC1H 4JFPB 1T4KA 2X42A 4WEMB 1JN6A 3S3SA 3UMTA 3RY6C 4HD9A 4V1DA 3LQZB 5E4EC 1RSFA 4APQC 5CGMA 1KV3A 4HFWB 3WBDA 3UYOD 4LRNL 4HFUH 3WHXA 43CAA 2VDKH 4KK9C 2XI9A 1JBJA 5EBWB 1EEYA 1TJIH 1CXLA 1DBBL 2VNCA 3RIAK 3MUGB 1QLRB 4JQVC 2BNQA 4N0UA 5EG6C 3LKRA 3WIIH 3JWNC 2ATKB 3ZYZA 3QHTC 3VXNB 1S3KH 3BAEH 5C0BA 4F37F 2AXGB 4NO2A 2Z4QA 3CSPA 4XHQA 3RTQA 4JFYA 2VQ1B 3GK8L 1BHGA 1DUZA 3A6BL 5BV7L 5IB4A 1ADQL 3LMJH 4MA7L 1J8HE 2AEQL 1MHPH 2VMFA 3QIBB 3MODL 1QBML 4LK4A 4F15C 2H9GB 5HGAA 3F65A 5LWYH 2VLLB 3HE7C 3QQ4B 4QLRA 2H32H 3ARFA 1F00I 1T2QH 1OQOA 2R29H 1SY6A 4LP5A 2K1MA 2WBWB 4W4NA 4MXQC 3QEUA 3BH8B 1CZ8H 1AR2A 5BS0D 5CWSA 4NHCH 2VLJE 1FZMB 1RU9L 1RZIB 2O5XL 3FB6A 4KVCH 2XWJA 3HI6L 2DTSA 3BZ4A 5EC1B 4PB9L 4PJCE 4U6YB 5H94A 4Y2DC 3T08A 1QZ1A 1F4XH 1E6OH 1T22B 1CGYA 1UCTA 3NIDE 1KPVA 3FKUS 2IBGA 1IC4L 2CMRL 3C9NA 5F9DC 5I18L 3JV6B 1IAOB 1F3DJ 3LAFA 4S0SD 3GMPB 4N8VB 5CP7A 1H5BB 4PJHF 3MUY1 1BQSA 1JGEB 4RSVA 4DGVH 3D3VE 5B38G 3I84A 2AJZA 4JANB 2W0KA 2X89A 1I7UA 3O6FA 4WTWA 5DJZA 3UTTB 3WJJA 3BQUC 4NC2B 3FOLA 2LV4A 3WNNA 2IGFL 3MRNB 5HDOA 1AGFB 2ICWA 1AR1D 1TZIB 2PYEE 4GRMA 4XTRC 4ZUSA 4FQ2L 4XP4L 1CD9B 3RVUD 3QUML 5LGHL 5MP6L 5EU7E 2FH6A 1FG2A 2BSSB 5ALCL 3WS3B 4U2ZA 4PGEA 3SKNB 2FSEB 1AJ7L 2YD4A 5FHBL 4OZHB 2WIIA 4WO4C 4R26H 5DHVB 1KJ2L 3H0TA 5EO1B 3CC5A 2HG5B 4XB7A 1FL3B 4I3GA 4YQXL 2VQ1A 2PYED 4GG6E 5DLML 3MNVA 4MJIA 4F9LC 3IFPB 3UO1L 1H3XA 1D9KA 1FVCA 4FFVC 1NJ9A 2KQMA 1P2CB 4K71C 5BVJB 3OXSA 3WIHL 4JKPH 1RUPL 4JZJA 4B5EA 3LKQB 3MV01 2VSDA 3QCVL 4LSTL 2Y07L 4UT9L 3LB6D 3T0DA 3V6OA 3B3IA 1VFOA 4DZ8A 3VU2A 3L3KB 4JG1L 4XH2B 1YUHA 4G6KH 1WC7B 1VGKA 2AQ3A 4GKOA 4CVXA 4FQ1H 1TCRA 4GMTL 1HHHB 1T0MB 4J12A 4R90H 3L3GB 5CBAB 3D39E 2ICCA 3WJLC 4HV8B 4OLXL 2ARJB 3GNMH 1G1YA 4GLRI 1JGEA 3FO2B 2VDML 5I18H 2DI9A 3VJ6B 1GSMA 3F12A 1DQQB 1P1ZB 2HFFB 3ZHKA 3LKSA 3NFSL 3CFBB 3ESUF 2YXMA 4AEFA 1KENH 1QP1A 3N1PC 3NABL 1V3LA 3VXUA 2AI0H 1WTGT 4U1JA 4K2UL 1FYTD 2HTKC 1MVUB 1XIWD 4KK6D 4X80L 2VXTL 2FLRT 2JELL 3HHRB 4U1GC 3SJVE 2JCCE 4H26A 4MAYC 2NY0C 2P5WA 2EE2A 3OZ9H 3TNMB 5GQBA 4PJXA 3VA6A 4G6ML 1C5DB 2NY2C 1RZGA 1V3KA 3KPOA 3C6SB 3FMGH 2EEDA 4EI5A 2WUBH 3EZ8A 1CU4H 3VWJA 3PABA 4XCNB 3OKOA 3QXDA 3CFCH 4YHPA 4RAUB 3QFDB 4HBCH 4OIAA 4JDZB 1W0VA 4OZGB 4Y4FC 2YPKA 3K4DA 4KKLC 3QNZB 5IJVB 1CICA 4JRWA 4GT7A 1EHLL 1PW3A 1QSEA 4OZFG 2NTSP 5IB2B 1G7HA 1BQUA 2D7OA 3RUGB 3F7YA 4FQHA 4HHAA 5D9SB 4J2XA 4HPYH 5C0RH 4WGWB 5GGVH 4X5WB 4C56E 4WUKL 2GY7B 3ILQC 2R2HA 3TN0B 4JFZH 5F7KC 3ULUD 1JNLL 3CSYB 4I3SH 3JWOL 3SCMB 1MCRA 2FWOB 5J12C 1X5YA 1SYSA 5IT2H 1DBKL 4KVCL 4WI8A 3IDXL 1BGXL 5I1DB 3KR3H 4RRPG 3H9SD 4PS4L 4UI2A 1A6ZA 2HLAA 3CU7A 1JWMB 1QBLH 3G6AA 4X83A 3BOVA 4POYA 1D5IH 1BBDL 3CLFL 2RR3A 1CLZL 5EU6A 4NCC2 4HKXA 4QRUA 1G6VK 2EDFA 3IFLL 3BMVA 3MV7E 5GS0D 4PJ8A 3VFMA 5C0AD 5HHVH 1P53A 3GRWL 3DX6B 1U3ZA 3SHSA 4FNLL 3ES6A 2GI7A 4KU1A 3HZYA 2F58L 5H2BB 3NCYP 2Q1EA 1KEML 3SBWA 2UWEE 4KROC 5C08E 3QCUH 4M1CD 1FG9C 1RZFH 3FQXA 3K4ZA 4M48L 4YNYA 3BT2L 4ZTOH 1RI8A 4YEFA 1BLNA 3QO1B 2QKIA 4U1SB 4YO0A 1A6UL 3WHE1 5DO2D 5EBMA 4Y5YB 3QXWA 4M93C 4Y0GA 3AXLA 3HLAA 3SDDA 3TPUA 4XHJC 3GB7B 2EKJA 4IRZH 1HINH 2CRZA 4OZHE 5DUML 4WI3A 1IGYA 4LQFL 4IRSA 1DE4A 4K7FB 2MCG1 3UPRA 5I76B 1OOAA 4IEFB 1F97A 4DCQB 4G8EA 2NTFB 3F58H 3MYZA 4P59H 4MJ6A 4L3EE 1F4YH 5J8OA 2GKIA 1FL6B 3OKEA 3C5JB 1UJ3C 1FCCA 5CSZA 3N06B 4J1UB 1FZKA 1F8TH 5DJDA 4EUPB 1HEZA 1T3FB 3ARTA 4R2GB 1IMHC 5LBSH 1A1NA 4OCWL 4JFYB 3MRIA 3HMXH 3KS0J 2VKXA 2IPKB 1G9EA 4Y4HA 2ID5A 4WWID 5HPMB 3ARBB 2P5WB 3HFMH 1D5MA 4LKXA 4IRJC 3S35X 4OLZH 3TIDA 3IAPA 1JI2A 2IQ9H 4HS8L 3BFOA 2CRMA 1BQHB 3HG1E 5C0JA 3PL6A 2J6EL 7CGTA 1BZ7B 5CLWA 1MFBL 3PABB 2E9WA 2EXWD 1B90A 1M7IB 4ERSH 1I75A 2ARJQ 4FXKB 4KQ3L 4PJXB 4GAYB 3VD9A 1GZPA 4M7JH 1TJHH 1OAYH 1RJZB 3FCTB 3C8DA 3QBTB 4RGNB 3AU1A 5E03A 4XNXL 5BRZD 3EO1A 3OPZL 2H6PA 1NPUA 3L3HA 3IFNH 2JJWA 1SJVA 4YHKH 2FGWH 1FNGB 3LVEA 2JB6B 4I0PA 3MRGA 5IB5B 4WV1C 1EFXD 3I2CL 4B7LA 4D0DA 1P5VA 1YNKH 1J86A 2D31B 3DI2B 4P3CH 5DYOB 1KN2L 4DZ8B 3N1MC 3DMMA 3G6AB 1CDHA 5GGTA 4KZEH 4JJ5B 4RNRB 5EU4A 1YEEL 1I7ZA 5HD8D 2EZ0D 1EERB 4WO4D 3X3FL 4JGUA 3OXSB 1XIWA 1DN0A 1CE1H 2MCPL 3DV6A 5I30H 3L3OB 1QOKA 3QWRA 5FM5M 4QOKB 4JDTL 3QDHA 2HVKB 2W9EL 4ZS7L 4NNXB 2CD0A 3QA3B 3SE3C 2QADB 5I1EL 5M94B 3PGDB 1RY7B 2QSVA 1KIRA 5T5NG 4Z7WF 2RGSA 2E7LC 3GSNH 4S1SL 1LO4L 5DZOA 3DXAE 4WTZG 1B4RA 4JRXE 4U3HA 5GGQL 1A7RL 3IAGC 3MLRL 4PGCB 4XI5D 3GKZA 2CK2A 2JB5H 4HIEB 5BZDB 2P24A 2BOBA 3PWNB 4XP9L 4YXLL 4K71B 5KS9B 1RUKL 3MGOB 4LOUC 5J57B 4ZO7A 5F3HA 5KTEL 4OJFL 4PUBH 1FYTB 5FV2A 4NT6B 5F9AC 4QXTA 4FA8A 3UYRL 5SX4I 3U30B 3FAWA 5DHYA 4E5XA 4KXZI 2VDLH 1D5XB 3K0WA 2DYPD 3R8BB 2IC2A 4KV5E 2CUMA 5F7DA 2ICWB 2XICA 3RWHA 3DSFH 4OIIH 2ZG3A 3TJHD 4DJMA 1Z3GL 3D2UD 3GMNB 1DL7H 2DJSA 1BVKA 2BDNL 3KPRA 3V7AG 1ONQA 3CDCA 3EYFB 1U3HA 4EOWL 4ACPA 1TJGH 4RGMB 4KI5D 1EPFA 3VWJC 1RUAL 1YPZF 1NFDB 5GRJL 1QBLL 2HH0L 5I30L 2JJUA 3QUYC 1QVOB 4HS6A 1IGJA 3B43A 4HUWA 4TSAH 4YBLB 4YHNA 5T1DH 4IRSD 5FYJU 5LQBH 4KRMB 1WCBA 3GBLA 4OIIL 2IQAB 1FP5A 4UV7H 3W0WB 4Z7UA 2YMXH 1QSEB 4LSSH 1II4E 2BDNH 1KPUA 5LCVL 2H45A 2IMNA 1NCTA 1RUQL 2XWJB 4YAQA 1SBSH 2JE8A 3T2OA 2OSLA 3R4DA 1CXFA 3HR5B 3LHPL 2VC2L 3QDGD 1A6UH 5E7FA 3GSRB 4FQHB 3MV8E 4KROB 3RHWK 5J9PA 1RZFL 1UVQA 4X4YB 4J23A 1P4BH 1JMXA 1LNUA 5DSCA 2Y6SC 4KJYB 1IC7L 3RPIB 1JFQH 5IFHL 4TULH 2HT2C 1CTNA 3GJFH 1FZOB 3DETD 1OP3H 3KPLB 3MA7A 3P30H 4LFHG 4TSBL 4QRRE 3RWEB 4XCNA 2LAGB 2HFGL 4K55A 5C0FA 3AFLA 3QH3A 4AJ0A 1MY5A 1DBAL 4L3CA 4BKLB 1HKFA 3O2WH 4PR5B 4ZNEA 3RY4A 3DURB 3WXWL 1J11A 1CFSA 1QFUL 5A3ID 1P4BL 1YEKL 1T7ZA 1N0LA 1A64A 2X1XR 5FAAA 2R23B 3HG1B 3SKNA 4HT1L 1NDMB 4HJGB 4PBWD 1A6TB 4UINL 3QFJE 3DUSA 4WI7A 1R5IB 2N1KA 2F54E 5T3XL 3RWGA 5EUOA 1QQDB 1VDGA 5IEHB 1RVFH 2BNQB 4N0UB 1IC5H 3EYOA 3V6FB 2YD3A 3IKKA 1KJMA 3VXOB 3O2WL 1TQBC 2FYYA 2PN5A 4WDIB 4NZRH 1FNSL 1VACA 5DMIL 3QDJD 4DW2H 4NN7B 5DDHB 1MQKL 5B39G 4MJ5B 3BE1H 3TYFA 3V4PH 1FZJA 4OV6F 1U91A 4JY6B 5E8NB 1DZBA 3BYYA 5JORB 5HBBA 1I7TA 2I07A 2YS4A 4NOBA 5FA3B 2O26U 4MDJA 4MXVE 2YPLD 4Y4FB 1T3FA 1CDIA 3W0WA 4I8DA 4ORZC 3OR6A 1Q9KA 1VGEH 5L2KB 2DYPA 4KKCC 3SGKC 2CJUL 3O6FC 1K85A 2FLBT 4F8QA 1A47A 1RMFL 2R0LL 4LVEA 4HZAA 2UUDH 3QHZH 3GBNL 2DDQH 4HZLB 1LK2B 3REWA 1DQJA 3RVTC 3BGAA 1NANI 3QIWD 1A21A 4RCAA 3E0GA 3P73B 4LVNB 5ID1A 1XF1A 4JLRA 3VXQB 2X1WL 1AQKL 4JO2H 1HOCB 5JZ7D 1FFOA 2YRZA 4YX2L 3MRRA 1AJ7H 3H3BC 5FHBH 5IHBA 2NY6B 4PJIF 5EBLB 4LQFH 2GHWB 3TM6A 4DZBA 4PJIE 3UTTA 3MLPA 3MREA 2VUYA 2BSSA 1U8NB 3WS3A 1TMCB 3OAZK 1HWHB 3QAZC 2I24N 4PP2B 4JRXD 4NHUB 2FHFA 2BK8A 1WIPA 4Z7QE 3ARFC 1DBML 4JFFE 3HRPA 4ELMB 5E56A 1KF9B 1WEJH 3ZDYF 4APQD 1JWUB 1U8PB 2DBJA 5F7FA 2ZUQC 4WHCA 5IQ9B 3D48R 3RTQC 3SGKA 1Q0YL 4Z7NF 2EYTB 1W8OA 3MJ9A 1RULL 2JJSA 4Y1AE 2IPUK 3VMPA 3VXSD 1Z3GH 1DLFH 1FFQA 4QCIB 3DOSA 5ID0B 2Y9RT 3G5XB 4GW1A 2QV2A 2F74B 1IGML 4PJFA 4WEUD 2EIDA 2NY6D 1TZHB 4JFDB 2N7BA 2XPGA 2WSKA 3UTTE 3INUH 4XPFH 3IDUA 2DJUA 4C57C 5BXFB 4JDVB 1S8DA 2ZZUT 3NIGE 1HN1A 1U8QB 2CLRA 4I0PB 1CR9H 1NDMA 2BY3A 1TTGA 1HSAB 2MHAB 4MQTB 2EH7L 5JMOC 2GQHA 5FGRA 3T0EE 3ZE2E 5J11B 4MNHA 2JIXB 5LCVH 3LKOA 5HJ3A 4TVSa 2ZUYA 2F5BH 2ITDA 1UXWB 4N90E 2FEEI 2JK5B 5E1HB 5I8CB 4MJ6B 1C12A 3KPMA 2WK2A 4HFWA 2VXQL 4FP8H 1QBAA 4X7EC 4BYHA 4F3FB 3V0WL 1MJJA 3L6FB 4QOKA 1LQSR 4KPHL 5IFJA 2X1PA 3MUHL 5DJ6A 4HULB 4LIQL 1U2CA 1EHLH 3IF1B 3CFIC 2E27L 1IC1A 4GW5B 3OAUL 2W9EH 4ODVH 5CEYA 1FH5L 2HVJA 5EH1A 1MCKA 4K94H 5IJKA 1I1AC 2GT9A 1NDGA 4IMLA 4ELME 3NPZB 1XR8B 4WWKD 3MBXH 3PDOB 4I1NB 4LEOA 3G6JB 1S7WA 2H2SD 3F8UB 4FOMA 3GGWB 1BD2B 5J56B 1CFQA 2BSED 5MERA 1JF6A 4XTRD 1G0XA 4MAUH 3OV6A 1EEQA 3QI9A 5FHAL 4LLQA 1TJHL 3GHBL 3A6CL 3UTPD 4ZPVA 3WIFA 1JZ4A 1J0ZA 1QD0A 4QXUH 1BFVL 2IQAA 4BELD 1FV1B 2LTQB 1VHPA 1JHKH 4J6RH 2EYSA 3LSOA 4XMLL 1T2JA 1IGJB 4JFOB 3MX0A 4P2OC 4UIMA 1F45A 1UA6L 5IVNA 4K8RH 4XCCH 4MNGA 1MFAH 4PJDB 4G9DB 1JWUA 1LDPL 1NCBH 2UZIL 4Y2DD 3RIFK 1YPZE 1A4JB 3MLVL 4K9EL 5I1JH 3BO8A 3GI9H 4DKAA 3HAEA 2X4UB 4CAGA 3MLYH 1JZ7A 4XVTH 1RZJH 3LEXB 1MFCH 2R2HB 5JPNB 5D1QD 2ZJSL 2CDFA 4HCRH 4BUGA 3E6FA 2EE9A 3QG7H 2UY7A 4S0TD 1RQ5A 4XPHH 5I1GH 1AKJD 1CFTA 2ZCKH 3H9SE 4KZEL 3O6KL 4TPRH 4Z7QF 2IF7A 1HYSD 1ZT1B 2ZSWA 3RY5A 3V2AR 5IB2A 3WO4C 1UZ6F 1YEJH 4NC1E 1JWMA 3VGHA 2ZUWA 3M07A 3BUTA 3QUZB 5FUOH 1ZT1A 2ZSWB 3W0WD 5DUMH 4JR9H 4BZ1H 4MAUL 4F7EB 2OP4L 3TO2A 2FD6H 3D39D 4HUUA 3E6FB 1JPSL 4OBRA 4YDIL 1TVBB 2Z0BA 4UTBH 3TPUB 1TVHB 3QG7L 3RVUC 3QA3A 4H0IA 3PDGA 4PJAA 1UM6L 3GDBA 3OR6B 4JFFB 4GS7C 3DV6B 5DVLA 3QWQB 5C1MB 2G9HA 1HSAA 3UBXB 3I9GH 4PJHE 2YK1H 1N5YH 3NACL 4HGKC 5DK0B 3O2DA 1XIWC 3KPRE 2XZQH 5IR1B 4L4TE 4CMMB 3GK8H 1DQDL 1Z6JT 1RZJL 2V7NB 1IT9H 2DYPB 4Z7OF 1S9XA 1P84K 2A2QT 1RK1A 2R2CA 4RAUA 4ZS6D 1IAOA 2BVQA 1QEWB 2FYYB 4WDIA 2DBLL 4RWHA 3WIFB 3P4NB 4ZOAA 3LQAC 3RX8A 3TO4B 2BOCA 5SWSE 1HXYA 5DT1H 5L6YH 4P2QA 1YC8A 3S96A 4QRSB 1U8OB 1F42A 4CNIB 4DEPB 3RZWA 1SEBA 4M03A 4O2CA 1FVDA 4OGXL 3P9LB 5BZWA 3EYVA 3VW3H 1A7NH 3QAZB 4BQ6A 2CKBH 3G5ZA 3AS0A 3MBEB 4KKCD 5E99L 5I73B 1GGCL 1QYGH 1WQVT 2OQJA 4NM8H 4R4FH 3TN0A 3INUL 2PO6C 5F89B 2N56A 3FFDB 4PR5A 4PY7B 4XCFH 5TQ2H 3TIDB 3GSUB 4GBXD 3EOAB 4XP4H 3ARDA 4WO4B 3SDYL 1BOGA 3S98A 3KLHC 4LVNC 4YHIA 2DM2A 3L5XH 4N0FA 2ARJA 4LCCA 2R15A 5JDSA 4X6FB 1R3JB 3U36A 3I6KA 4J7RA 3GSNB 2BHYA 1YN7B 3OSKA 4NO0A 4UQ3A 4QHKJ 1EZVY 2OCFD 5HGBA 4ELMA 1KBGL 1CQYA 1D6VH 3VXQA 4GSDH 5TFSH 2BY0A 4WI2A 3PWVB 4EXPX 4PJ7A 1RUML 3OX8A 1SEQH 4KVNL 1T21A 1AP2A 5HDQH 5D2NA 1J5OH 4N5UA 2XPGB 2APTA 5J9PB 1BLNB 1T66C 3QCUL 1UADC 1B4JL 4IJ3C 4YFEA 4UOJA 1B2WL 3I50L 4U1NA 5DRWB 1BIHA 4RIRB 3NAAH 3D39B 4YHMH 5DMIH 3SBWC 1AFVL 1X5AA 2WLZA 3GKWH 2AJUH 2DQJH 5D93C 1RUMH 1ZHLB 1U8MB 1B3JA 4UNVA 3CXHK 4U1NB 4HIHB 5A43C 5F7YC 4L8SA 5BV7B 3KPQA 3SE4A 5B38B 4HKXB 3UTOA 1EVUA 1VGKB 1U3JA 4OFPA 2OMNA 2XRAL 4UT6H 4DKEL 4PJAB 2W65A 2ERJC 4L29B 5CGTA 4MDJB 4XNQB 3B3IB 3PWPB 3MQIA 1ZVSA 3L3DA 3C09B 1CGUA 3MV8D 5T5FL 4WW2B 2NR6D 3QDMA 1IGTB 2VZUA 2O5YL 2IG2L 2X44D 5KN5A 1A7OH 1MWAB 1V7MH 3N9GH 3FJTA 2FIRT 4KFZC 3T2PA 4L8SB 4Q2ZA 1NBZB 1ZT7A 3TZVC 3FN3A 4ODHH 4CL7A 3PV7A 4N90D 1F4XL 2HTKD 3ROLB 1E27A 3C6LA 3ULSB 3QEQB 2X7LA 4ODSH 3C5SB 4IJ3B 5TDNA 1FL5A 1KCUL 4PJBA 3EJZC 4ZFFB 2UZIH 4D0CA 2HG5A 1NGYA 2FJGA 1UQSB 1TITA 5FYLL 1MEXH 3L95B 5JHDE 4HG4K 5I1GL 1OAYL 5IKCA 1C5BH 1MRCH 4XT1C 2GCYA 3G5VB 3BWAB 1HHIA 1SYVA 3LRSB 4JPIA 1G6RH 5FUOL 4ESKA 5DTFA 5M7QA 3FRUA 3KPRD 2B39A 4HWBA 4UDTA 4DN4H 2PYFB 5CIPB 2ZP0T 3GMOB 3LZFH 4C56B 3OBAA 3MRPB 4HS8H 4TSCH 4FG6C 4Y4FA 3QP3A 3THMH 4OLEA 5HYSB 1YMHB 2ZOLA 2BMKA 2IFGA 1IAIH 2D0GA 3WYRA 4PJAF 5DJ8B 1KPRA 4X7SL 4PB0H 4X5LA 2XTJB 1MOEA 1TQCC 4X6FA 3BPNC 4NKOB 1FO0H 5B8CB 1W0WB 3ZSSA 2D7MA 2MWCA 1I8KA 1CE6A 5GS3A 4AENB 3BKCL 3K74B 4ONOA 4QXWA 3VFVB 3VFGH 3AS1A 3CXHJ 1NC2A 3JV6A 4EIGB 2W92A 4JG0L 4E41D 1WWBX 1ZWIA 1O7SA 3PL6B 4HX1A 4QRRA 2H32B 2VDRH 2DMBA 1UM4L 4GKNB 4Y8AA 3MLXL 2PW1A 2D03L 1R3HA 5F1IA 2FH8A 1IM9A 2IBBA 5JA8B 3BP4A 3DURA 2UWEB 1J0JA 2GTWB 1Z9SA 2Z31B 4OFKA 5J13B 3BX7C 3IAQA 3S8WA 4X7TB 1HZHH 1S7VA 3SE9L 1ZT4A 5GZOD 2VITA 3ZKXC 4R0LC 4YBQD 2YKLH 5KJRH 1S7QA 4K3EH 1U3YA 5FM4A 1QLFA 1BJ1H 3C6LD 1QEWA 5BQ7B 1FPTL 8FABB 1FFRA 4I2XA 1A02N 3C08H 3B2VH 1TETL 5JQHC 2AV7B 3KXFE 1YC7A 1KLUA 4LU5H 5LAXA 1MH5A 2DQCL 3VG0L 3W39A 4YR6B 3G5YB 4YFLI 5AD0A 5GHWL 1C08B 4OCRL 1NBVH 4P2RB 1UVQB 4P23A 2VN7A 4N9OB 2AABL 1MI5A 3O3EB 3EZJB 1UZ6E 3KLHD 2DKUA 1A0QL 3U9PL 3WN5A 1UXSA 3HA0A 4R4NC 2RAMA 1INQB 4X9FA 1NGZA 1KIRB 1OTTC 1MSPA 1HH9B 1RIUH 3UJIH 1OGAA 4H1LG 1QLRA 4JFDA 3SJVD 2GK0B 3HC3L 3UBXG 3SDAD 5HYJA 5C9KA 2IANE 4NCDA 1RHHA 1NBZA 2AJVH 4RMQA 4PRHD 5F6HI 4XPGL 4DFHA 4P5TB 3F7QA 4XC3H 5HDQL 1RD6A 3T1FB 3C2AH 1RZKC 2DQIL 5FXCH 2WBKA 4UZGA 1KN4H 3DO7A 5I1KH 2QKIB 2IH1A 5GGRA 3TP4A 1NFKA 3LN4A 4RGNE 4MA8L 4LPYA 2GJ6B 3BEWB 1RV6X 5CEZE 3GSXB 5HY9B 4E41A 1U3HB 4K7PX 5B22A 4YGVB 5A16B 4XCCL 2PYEA 3ARUA 3IS0X 5JIIA 1NCDH 1FIEA 4QTHB 5BOPA 1R5VA 1J8KA 1R3IH 4KHXL 3QI9D 4HIJA 2PYEB 3T0ED 3NH7H 4TOYL 4LEOB 4HUXB 4I3RH 3Q1SH 1FNHA 1OGAD 1H3UA 1RZ8A 4MHHG 3LN4B 1XH3B 1RURL 1BZ7A 4HKZA 4Q0XH 1JV5A 4G6JL 3RJQB 5HHOD 3DYMA 3X3GL 4P2QD 1ZEAH 2SEBB 1JNNH 3UZEA 1JGUH 3MRMA 5ID1B 3MRQB 4JFQA 1CD1B 1BF2A 4HXAH 5DA0B 5E2VL 4Y2DA 4PJ5E 2Q6WA 5E99H 3SKJL 3O4LE 1IKNA 4GAYA 5IBTL 4P4RA 2NX5E 3GMMB 3QB7C 1IEBB 3FQTB 1DEEB 4YZFF 2AV7A 1S9KC 4WY7H 1K8DA 4YDJA 4NNXA 3FB8A 1BJ1J 4Z0XA 3DXAB 1Q1JH 4OLVL 2EDTA 4LLUA 2N7AA 4PJ9D 4G42A 5EZLB 1DBAH 1S78D 1UB5B 2I5YH 3ULVL 3CFKB 2MHAA 5KS9E 3ZE2F 4YHZL 3O8XB 1KCRL 1CIUA 3OGCA 5DQ9A 1I7ZB 2BVTA 4E0RA 1YJDC 3RWFB 4HWBH 4EVNB 5F1IB 4JCLA 1UWEL 3HAEH 4NM4L 5I8OH 5T1MB 3NIGF 2J5LB 3SDDB 2YD5A 1UWXH 4KHXH 3U7YL 3MNZA 2BXYA 4JQVA 2C1PA 4ZFZB 4OI9A 4NFDA 4RFNC 4L8SC 3F7VA 1EEZA 4XC1H 1ZGLP 2B8OT 2JCCF 2DQTL 1C1EH 5FUZL 3U0WH 4CN1A 4KJWD 1ZSDB 3LKOB 5HJ3B 4AMKH 5B39B 5C0AA 4HUVA 1HXYB 3TLRA 2Q8BL 5DGQA 5F9WB 3B9AA 4GKZB 4I77L 5J12B 4BZYA 1MFNA 5HHXH 1KULA 4LHUG 1NAML 3QO1A 1OWWA 2QQLL 5F7EH 1QFWH 1JVKA 5DRNA 2XKNB 4XP5L 4XCEA 1WBXB 2VDLL 3VFGL 2AJXH 5A2FA 5DMJB 5F7HA 2YZ1A 1D3CA 2GUOB 3QFJD 4U1MA 3TZVD 1FYHB 1M1SA 1TZHA 3CCHB 1TZGL 1H8SA 3HE7D 5ETUA 1GPOH 3HCVA 3UBXI 2DDQL 1UM4H 2IADA 2YUVA 3M45A 3U83A 2XRAH 1KELL 5ITBH 5IKCB 1QKZH 3WLWD 1WBZB 2HH0H 1VENA 5FECA 3L9RA 1BQLH 1FL5B 1P7KB 2XQBL 3P77B 1NEUA 2EKSA <