1KYOK

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 15
structure length 107
sequence length 107
chains with identical sequence V
ec nomenclature
pdb deposition date 2002-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kyoK00
2GFBA 1J5OL 4YHLH 3BKJL 2NXZD 4W4NA 3W9DB 4G80B 3T2OA 5IVXF 1CU4H 2WLZA 1IILE 1CIUA 4WI6A 1HHJA 3VGFA 1GGYA 5BZWB 4ONGH 3SKNB 1CLZH 5DJDA 1N7MH 3CNKA 4NKMB 3UTQB 2JJTC 3V6OE 3ARWA 4O5LH 5I0ZA 2MCPL 3OGCA 2XTJC 3EAKA 3TPUB 3L1OL 2RCSH 3PWUB 5I15H 5ICZA 2I24N 2DB8A 3K2UH 2AVGA 3O8XC 3DUUA 1KENL 2VQTA 1JV5B 1YEIL 2CKBL 5ID0B 3SKOB 1U95B 3DBXA 3SY0B 3PL6B 1AGBA 3EYSH 4HZLB 1RZIA 2KH2B 3UPCA 1JWSB 5TDNB 5HXMA 3OKOA 5GSRB 2J5LC 4NQVA 1F4YH 1XFPA 3T1FB 2VZTA 4LGPB 1CDGA 4X98A 4Y1AD 5BOZG 4QRQA 5GGTA 2M26A 4L1HA 4R97C 4J3UA 3VXUD 3TN0A 1S7WB 3OJ2C 2RCSL 3NFPB 3DROA 2EDYA 2WUCH 3K2UL 3EYVA 4FXKB 1N6VA 5DT1L 3WFEH 1I7RB 1WC7B 2BFVL 2FEDC 4EI5C 5DWUH 3B2VL 1MFAH 2XFXA 3OKMA 4MVBC 5D7JA 4C54A 3U7WL 5E8PA 3LSOA 2QHRL 4QRPE 5EBLA 3TYFA 3R06A 4PJIB 1SBBA 1N5AA 1BF8A 2JJVA 3DX7A 1K85A 1DQMH 1DBBH 3BGMA 3MPCA 5FCUL 4S1DD 3H6JA 4R8WH 4P2CG 3UTPD 5CEZL 4YXHH 1QUNA 1C16B 2CLRA 3MV8D 2VLKA 3CDGB 3IRZA 3KPSD 4XWOD 4UDUA 5KS9F 2O5XH 4YE4H 3KPRD 4I0CC 2MQ0A 5ABDE 1U92A 3TGXA 1HXMB 2R2BB 3LY6A 3FOLB 4NZRL 2PETA 1HSBB 2XQYK 4TVPL 5DSCA 2F5AH 3HAEB 5MEPA 5EZOH 4HWBH 1BMGA 3SQBA 3T8XB 3QFJB 5DWUL 1HNGA 4MD4B 1BGXL 5T3ZE 4HGWB 4JHWH 3SCMD 5T1DL 3PHOA 4GW1A 4D9RE 43CAB 4LLUB 2K7QA 3VFWA 5F8RC 4RA0C 5D6CA 1N64H 3V4UL 1H0DA 4BK4A 1XAUA 3DETC 1U93B 5JXAH 4XAKE 1WBZB 2VLJB 4KHXH 4YE4L 1OB1B 4KAQH 3ZHKA 3SDXF 4NKIL 4WW2F 3SOBL 2OR9H 1JYNA 4MSWA 1P7HL 3EYQD 2X4QB 5T1MA 3MNWB 4UV7H 4U6VH 1G7JB 3C08L 1ZT7B 1FJ1B 5TH2B 1NMCC 3OPZH 5L2KA 1IKFL 5I8KH 3NIGE 1A7RL 2W59A 1UM4L 1ADQH 3GHEL 1I1CA 4MZ2A 1IL1A 3QWQB 3B43A 5GRUH 3RDTC 2W0PA 2NX5E 2IANA 4HC1L 1KLFA 3S35H 4G8GE 4QGTA 3HR6A 2W9EL 1AO7A 4DKDC 3MCG1 1CZ8L 4TVSa 4ZSOB 3DV4B 2ZOKB 1VACA 4Y19E 4HKBB 1J18A 3WFCL 3HE6C 2YD7A 2GI7A 1J86A 3B8YA 3AB0B 3I50L 4UILH 4R3SA 1HEZA 1G6RA 3U1SL 5A40E 2P5ED 2WBJB 1BD2B 3X11B 5J6GB 4LCWD 4P23A 2VISA 2X4RB 4RAUB 3WO3B 2JCCF 3FB8A 4PJ7A 1KTRL 1T20B 4TNWF 3BKCL 5I8KL 1OP3K 2NR6D 3IDXH 1Y6NR 5E7FA 2V2TA 4MDIB 1OGAE 1CE1L 4NO0A 3MRDA 5KSVA 3EOTL 5FM8A 8FABB 3ARUA 3L7FB 3PWPA 1LP9B 1U6AL 2RQ8A 3M8OL 1AGEB 4QKXB 4PJ5B 5GRXG 3QUZD 4OM0L 4LFHG 1X5GA 4B0MM 3QEGH 4XH2A 4K8RD 3V0AC 1HKLL 2BY2A 4D0BB 4DVBB 3TO4D 2BSSA 4HQQH 4C4KT 1MRDH 1MWAA 2ESVB 4XI5D 1MCKA 4NO5A 1CFVH 4XVTL 2G9HA 3DRTB 2Z31A 3MSPA 1NAMA 3HZMA 2IG2L 1QA9B 4PRNB 1F42A 4LRIC 1OD9A 3QDJB 4XC3L 1DE4B 4WWID 1S9KC 1C1EH 2FJHB 3QDGD 3OAYH 1KBGH 4UMGA 2JK5A 3RRQA 1WZLA 3QIWC 4KZDH 1TQBC 4U3XA 4ZOBA 4GKOA 3BQUD 3SDCC 3MCLL 1Y18B 2D03H 3KNBB 4RMSA 1XIWB 3RZCD 5BRZB 1JNHA 2B8OT 3NCBB 3DV6A 2PO6D 4KROC 2XNAA 1UACH 1YMMD 1FFOA 3LEYH 4BZ2H 4WTZA 4XVSL 3W9EA 5IFJA 2XTJB 4MJIB 4O2EB 4F8TA 2VKXA 4ODXB 3H3PH 4RIRB 1QHOA 1KPRA 3WUWB 5J4MA 3WIHA 4JFHE 1YEJL 3O8XB 4S1RL 1Q0YH 2Q87A 3B9DA 5CCKL 4YWGH 3BP7A 5BW7A 4G9FB 4AH2A 2X4OB 4L3EE 4X8XA 1W0YT 4OZGE 3OG4B 1IFHH 5B4MD 5E5UB 4KUZL 3FO2A 2VC2H 3IT8D 4HUKB 1LE5A 4OZIF 4QXTA 3GUTB 5DRXA 5JHDA 4U2ZA 3HZYB 1G9NH 3IS1X 4PGBB 3MOBL 2XRAH 4P5KB 5DUPL 2H32H 2J5LB 3X3GL 2GCYA 2FH6A 4JFFE 5JLZA 3MACH 4DKAA 3GBLA 1RK1A 4ZUUA 4XNXL 2ZUWA 4QHMA 4PB9L 4BZ2L 1D6VH 4R97B 5HHNB 4Y2OA 1H3XA 4HDIB 4M7LH 3VWJA 1RQ5A 3QDAA 4M7JH 3RY4A 4Z7UB 1CDYA 1CFSB 5HYFA 3IFOB 4HBQA 2PW1A 2NNAB 5DHVB 2IH3B 4JQVA 2BNQE 1T1ZB 4LSRH 3QCVH 5BV7L 4WHYH 5I1HH 1RFDL 2H2SC 5IUSA 4H26A 4K94L 3MRBA 3CH1A 1S7TA 4XCNA 1WITA 5EUOA 4I18C 5E70A 5D7IE 1FFRA 1BFVL 1X4ZA 4OF5A 4Z95H 3TBWA 3MACL 4RSVA 4R96A 1EAPB 3SGKA 5E2JA 4JFDD 1JPSH 3TV3H 2HKFH 2ADIB 1NEUA 3TBYB 3MLYL 1OAUL 4HUNB 5F97E 2NW2A 4GAYB 1D9KC 2X1OA 4LPTA 3R0MA 3I6GB 5IW6B 4WFGD 3QCVL 4P3DA 1TZHB 5C09A 3KYOB 4BM7A 1R3HA 2RR3A 1OM3H 4HKJA 5KSUB 3FB6B 4G7VH 3ZYJA 4PJXF 4RAHA 3W0WE 4OIIH 4P5TA 1LE9A 1DFBL 2DJ4A 2DF3A 1QTYT 2GIYA 4Z95L 2CRIA 1DVFD 5MHSE 3FT4B 1GVIA 1NDMB 4Z7OE 1I7UB 1J9CT 2OL3H 1MVUA 3QEHA 1UH4A 1T03H 1JWMA 2GTWB 5I1LA 5EIVA 4X7TB 2F15A 4PBVC 3KYNA 2CH8A 5D7LA 2AV1B 3PHSA 1JRHI 1GGCH 2DTML 4Y16A 2VQUA 4NOFA 2YPLB 4ZYKB 3GDBA 1D5IH 4XP4L 5E9DE 4PS4H 4U1KA 2YSSA 1ZVSA 5JQ6L 3ZKQD 2Z91A 2ICCA 1JZ2A 4F7TB 2IBBA 1FNGB 2JE8A 2BVTA 4MQTB 4KKCC 5FUCC 3ROLB 5EORL 3DTXA 3JZ7A 5I66A 4CVUA 4PJFF 1UQSA 3LS4L 4LU5H 3RDTB 2BOBA 3PF2A 4D3CH 2R2HB 5JZ7C 2IADB 4HFWA 4JO1H 1MEXH 2ZSVA 3RNKB 2A6IA 2ZUQB 1SYSB 1UYWL 4L8CB 1AE6H 3GJFK 4GLRI 3S36X 3RQ3A 1BZ9A 1QFWL 3KLDA 3HE6B 3V5DB 1F5WA 1NGQH 3F7RA 1N0XH 1EHNA 2EIZB 1CXFA 2FHFA 2GAZB 4NO3A 2VXVL 1GGCL 4OGAC 4OV6F 3THMH 3T0WA 3GB7B 1D5IL 2NY5C 4DK6A 2WWKO 5DJYA 3MFFB 3VXMD 5J1TC 5DJ0B 4QYOA 1S7UA 3GKWH 1G7LA 4MXQC 4EDWH 2UVFA 3F12B 4W4OC 5GSVB 1A4KB 5I6XC 5TF1L 4DW2H 4OT1H 4UB0H 4ODVL 3CK0L 3TVMD 2I27N 4O58L 2BSRA 4XWOC 12E8H 3AM8C 1MJ8L 3EDDA 3ULVC 3L95B 3MV7A 4Y88A 2HT3C 5JMRA 1R5IA 4HUVB 5DK2B 1R5WA 4OQTA 43C9B 1IC4H 1CICC 2NYYD 3KJ6H 3CFDB 5D8JH 3S3PA 3MXVH 4CJ1A 1HWHB 4KUCD 4P4KA 5BCAA 4KKBC 1VFBB 2D4FA 4NNXA 5DHXB 5GGSB 3ZYOA 4U4BA 5D1XA 5FYJH 4ZDHB 1I3GH 3B9KC 5ICXA 3TA3A 3WKMH 1FAIH 5IFAL 1NJ9B 3QIWB 4PGJA 4FFVC 1IAIM 1KV3A 1TQBB 3HPJA 3W81A 4R2GB 3CDFA 4UQ3B 3SDCB 3HS0B 3LKSA 1AJ7H 4DEPC 3T04D 1UEYA 4QY8A 2VTFA 4S10A 3EYQC 4KROB 1MCDA 1WBYB 3KXFE 1N2RB 3GMMB 1RZKH 3VI4E 5IBUB 4OCLC 5HYEA 3LEVH 3OBAA 4LF3B 3D39D 4FG6D 5D2NA 1AXIB 1FORL 1ZANH 2HRLA 2VABA 4B5EA 4YFLF 3T0DA 3MMEB 1J1OH 2F58L 4Y5VA 5HDQL 5DEGA 1S5HA 3PQYD 3UTTB 1UWXK 4HWEH 5MP6H 3V5HB 1WCBB 1IBGL 4C57C 3EGSB 4NO2A 1BM3H 1I8MB 4MLSA 3WJJC 3FHAA 5GRVK 1CFTB 1I7ZB 1JPFA 1R3KB 5I1CL 5EZIL 4DVRH 1NCWH 3E8UH 2FSEB 3OJDB 4LAQL 1DDHB 2X05A 5D71L 1MNUH 1GGBL 4GQ9L 4U33A 1NL0L 3LKOA 3C6SB 4RZCA 5T5NG 2F53B 2JELH 2R8SH 2P8LA 2H3NB 3CFJB 4I0PA 2V9RA 4M7KL 1BREA 5A2FA 3GIZH 3CX2A 3SGDH 4Z5RB 5GS0H 1CE6A 1CD8A 2C1OB 2OLDA 3LB6D 1N4XH 2E8YA 2YN5A 3VD3A 3IS0X 1DZBA 2WW8A 4FN0A 2UWEA 4K8RC 4YHMH 3O9WD 1ITCA 3BPOC 2Q7NA 4U6XA 1CVSC 2J8HA 1X7QB 1EHAA 3LMJH 4FHBD 4F3FA 2UYLA 3VJ6B 3TBTA 4LVOB 5C70A 4RNRA 3EFDL 3I75B 1D9KB 5CJOL 5KTEH 3UTSE 3VE0B 2P24B 3BPLC 2O5ZL 2D7MA 3L5WB 5C08B 3GSUA 4QXUL 3GSQA 2BP3A 4RDQF 5DDHA 2EH8L 3FMGL 1MSPA 3QUMB 1OSZA 2DKUA 5J1AB 5E7BA 5KJRH 1MJ7L 4L9LA 3MLPA 3EYFB 4E0RA 1KGCE 2VDKH 2WUBL 3LEXA 5CGTA 2AGJH 2Q76A 2Y1VA 4KQ4H 4S1QL 5KVMC 1JFQL 2VLKE 4IIQA 4UT7H 2PTTB 1BPVA 1KTLB 1TENA 1T7XA 3L3JB 1LK3H 3PGFL 3RPIB 4BSVB 1IGIL 1JCKA 3LHPL 4WUUB 3QFDA 5IVOA 3K7UA 2D0HA 1KIQB 5DS8B 3H7BA 5DC0A 4R7NA 2DLGA 3DLQR 2QKIA 3PWLA 2IFFL 1FN4B 1OAQL 3CFCH 2G75B 4JZNB 1FO0B 4FZ8L 3GMQA 1ZS8A 4DTGH 1MCPL 1EBAA 1NPUA 3TZVD 1BQHA 5BS0D 3D0VB 5KJRL 3CPLA 3RWHB 5HJ3B 4J8RB 3GRWA 3S34H 2VDKL 4XCYA 3SDDA 4HWNA 4KQ4L 1PG7X 4QRSB 2UUDK 1K5NB 3H9ZA 4X6DA 3N1FC 2B4CL 1HZHL 3S37H 3T3ME 3ZSTA 2GEEA 4GUPA 3L3HA 1A3LL 1MLCB 4P99A 1HYSC 5F9JB 5HHQB 1V7ML 1INDL 1DL7L 2Y07H 1FYTE 5L2KE 4CU6A 1Q9OA 2P8MB 3O6KH 4Q97A 3KLAB 2F5BH 2APFA 2IAMC 2AK4E 4RRPA 5I6XB 2ARWA 2A38A 2WIMA 3OKKB 3S88H 3BSZL 3IYLW 4NUJB 5D7KE 2E8ZA 3DURB 3TH3T 1GGIH 1AO7E 1U8OA 4M93C 1FL5B 3C5JB 1FFPB 4JRXA 1S5IH 4BFEA 2W9DH 3CVHB 1SBSH 5F44A 3VFMB 3RWJB 1LEIA 1QPPA 1T66D 4KKLD 4GKNB 1CICB 3DYOA 3D3VB 1H3TA 3QHFL 1P1ZB 2N7AA 4PJ7E 5C07D 2MHAA 3AY4A 2PYFA 1U3HA 3OKNB 5HYQA 1CF8L 2FO4A 5AD0B 4NJAH 5JXEC 5C0FB 1KJ2H 5GGVL 3B9KB 5KVDL 3CFEB 4G43A 4G8EB 4CU8A 3MLVL 2D9QB 4C56D 2QTEA 1GGIL 2Y36H 4PP1C 1ZVHA 5KBNC 5GGUA 3BP4A 5F3HA 4DEPB 1T0NB 2VDOL 2GJZB 4HEME 4XXCA 4NCC2 1A9BB 4DGIH 5GGRY 2ADGB 3L3KA 3N0PB 4M62H 5ESQA 5HGDA 3D48R 1MAML 4ZOEA 1CTOA 5L0QC 4XT1C 1RZJC 1ZT1A 3V79C 5D7SL 5T33L 3HNVH 4DN4L 1KELH 4CVZA 5TJWK 5HHOD 2XWJB 4E41E 4OLUH 1FV1A 1OTTC 4PUBH 4M6MH 2AEQL 2DYPD 3TT1H 3WDHA 3BZEA 1U8PA 1JNNL 4KXZI 1QR4A 3MBEA 1RIHH 3BW9A 4RCAA 4Z7NF 2D7NA 2V5SA 2BHYA 2VXUL 5JIHA 2M2DA 4F7MB 4XMLL 3EDJA 2EYSB 4JFXB 1QSFB 3AXLB 3OAUL 3F62A 4LP5A 1T89C 1FVCA 4TUJA 1KIPB 2C9AA 3PXJA 5DQDH 1JHTB 1EMTH 1N5YL 5HVHC 3QUXC 3MUJA 1HOCB 2G5BB 2K3TA 4LPXA 4MA1C 1MCBA 1HH9B 5I1IH 2J8UA 5FV2A 4ZNEE 4EUPH 1J0IA 1RUKL 1YEDB 3P9LB 4OLUL 4L29A 5I8OL 1JGEA 5JA8B 4Z7UF 1D5MB 1T7WA 1I75A 1EVUA 1L7TH 4JRYA 5EO9B 3L3OA 2YR3A 4Q0XH 4D8PA 5ADPL 5D1QD 1PGRB 2WBKA 2WV3A 4Y4FD 5EZJB 5H35B 2HH0L 2F74B 1QSED 1T1WA 5F7KC 5BQ7A 1LMKA 2X44D 4L4JA 5E8NA 3VDCA 2AV7A 3CIQA 3BZ4A 2EDEA 3WJLC 1VADB 3FB7A 4POYA 1EMTL 3PHQB 2F54E 3S3JA 4OGXH 5EIIA 3MGTA 2LAAA 3OAZK 4M8QA 3VXRB 2XWBB 2UUDH 3MLSL 2G60L 3E2HC 5DHVH 1FVEA 2R0WH 1OGTA 1JGUH 4AK1A 3ULUF 3MA9H 3GMLB 3FO1A 3ZLQC 1I8IB 5EUOE 4OZHA 1UB6A 4MD5A 1L6ZA 4YUEH 4NQED 5IEHB 5HHPB 4HX1A 4MQ7A 4K71C 4TSCH 4FG6C 4NQCB 4NBXB 5HD8D 5L2JB 2VIRA 4X6CE 4NRXA 5F9OL 4M1GL 2BXZA 2BSTA 4FQ2H 3ULUH 1N6UA 4L3CB 4MS8C 5KZCB 2R0WL 1KT2A 2VE6B 3EYOB 1OP5H 3ZTNH 4FQHA 1OGAB 3U30C 1MFBH 3MLWH 1SMAA 4GT7A 1JI2A 1I9RH 4IRJD 2VAAB 4X4XA 1QNZL 1A7QH 2IPUG 3RVTD 2EC9U 1LVEA 4BKLA 3GMOA 2YWYA 1XR9B 2ZNWA 4O2FB 3T65B 3OWEA 2JIXB 4Y2DD 5SWSA 4MDJB 4NN5B 1A1NB 1T5WA 4G8IA 4WTXA 1KCRH 1X6NA 1MQ8A 5BJTA 4MNQB 2H9GA 1OF2B 3WFBL 4ONFL 4MD0B 5LQBL 2UZIH 4J4PC 3IJSA 5HYJA 1Z9MA 2A6JB 3HUJF 4HXAL 4M43L 5SWZD 3ZE2F 2CIIA 2W60A 3EIFA 3GSVB 5CGYD 1XGQB 3NN8A 3O6MH 2A6DA 1VFUA 5EO1A 1PKQB 3TCLA 1JHKL 4Z7VA 5JUEL 4AENA 1A7QL 2FJFB 4WCYH 4MWFA 1OT2A 1YDPA 1UXSA 4HD9A 4HPYH 1VKXB 2X9WA 1FNFA 3G5VB 3IJYB 2IAMB 1EUUA 3G08A 3PP3H 4MCYA 3EOBB 4OD1H 3UBXG 4LQ1A 1HIMH 3MRMA 4K23L 4F33B 4D0CB 4Y8AA 5IVXA 4JFED 3D69A 4M93B 4TSBL 1DLFL 4L4VE 4TUKH 5F7EH 2AJUH 2OSLA 5IB1A 1VFOA 4XGZA 2EXYC 5H2BB 4LEOA 4GRWB 4ISVA 4PP2B 5K9QG 4V1DB 1FL6A 3ZSSA 3OB0H 3RIAK 3IKKA 4RFOH 1BOYA 2IQ9H 3SJVB 1MF2L 1Q9KB 4GSDL 3QULB 1MIMH 4XPAL 2XWTA 2FO1A 1G7PA 3ZL4L 1VERA 2FYYA 1U8MA 5KSBF 2ICWI 4R9HA 5J7CC 2M8XA 4XB7A 5JW4M 1MI5A 4LCYB 2FX8H 3MV9B 3T4AA 1J1XH 1OLLA 2EIDA 4YHKH 5K59E 2HLFC 4CVXB 3HMXH 3BJ91 3V0WH 2EDWA 2P48B 2MFNA 2WP3O 4JDTL 2L0DA 1UEMA 3H9SA 5IV2B 2ED9A 1L0YA 4LDOB 2AEPL 1Q9WA 5F7LB 1WAAE 3BI9X 4PJBB 2VKWA 3UTOA 2OXHA 1D7FA 2XN9D 2GJ6E 3L5IA 3HNSH 1ROWA 2P42B 1G7MA 5CP3H 4WNQA 4F15C 1AGDA 3TZVC 3V4PL 5IM7A 5DD1L 3OAZH 3I3BA 3QIUD 4K3HA 5DURB 1IKNC 3HNTL 4G6JH 2EZ0C 3IKCA 3OSKA 3B5TA 2ENYA 2A73A 2CGRL 3MREA 4X0KB 2DQEL 1XF2B 1OVZA 4HWBA 3RWCB 3HMXL 1A6ZA 3BWAA 4XPFH 5EA0L 2CRMA 4IHOB 1XF5B 3QDMB 4S2SA 3OR7B 2B20A 1FDLL 3ILPB 3TN0C 2CDFB 3B3IA 3Q6FA 4JPVL 4OCMC 5DJAA 5D2NE 5E2TH 4XWGL 5KS9A 1A7BA 2VDLL 5EZLB 5HVHB 3QUXB 1B2WH 5IOPA 1MH5B 1MELA 3ARPA 4MA1B 4G6FB 3P4OB 2FB4H 5I71C 3SKJL 5D7JC 5CBEA 3ARGA 4PRIB 1IEAB 5JW3H 1X5AA 4JKPL 4QXWA 4BFIB 5CEXB 3W0WB 4LFHD 2GITA 5CMAB 4ZS7H 4P2QB 3ARXA 5I1GH 5C92A 5DQJB 1EZVX 1T66C 4KKLC 5JNYB 2ICWJ 3WXVH 1EO8H 4WI2A 4K7FA 3QJHB 3QWRD 3FQRA 4RFEB 1XGUB 1IGTA 4IOIB 5EFIB 2BVQB 3R8BB 3ZKMC 1ADQA 3C2SA 1ZTXL 4M3KB 4JDZA 4H25B 4Y4KD 4H1LB 5IMKA 4YFEA 1W72B 1IGFL 1TETH 1GH7A 2IQAA 3ECBB 4XCCL 3WNKA 4ELME 4O2CB 2BRRH 5E9DB 3SDXA 2E5EA 3VFTB 2FB4L 2O5YH 5EU5A 4YX2L 3NA4A 4XNMB 4N8VA 3E2HB 4PGCA 5E2VL 1NC2A 3A0OA 4PJAB 1AKJA 3JWNC 3L6FA 2CDGA 1TXKA 1BEYL 2BVOA 1CDJA 1HI6B 2AJXL 2APBA 3GM8A 4YLQT 5IHZA 3BPNC 4RX4D 1INQB 3IVKB 3G5YB 1PLGH 4XCFL 1BECA 4JDVB 5KAQF 1L7IH 1VDGA 4Z8FL 4K71B 5F7HA 5CP7B 4DGVH 4EXPX 1I9JH 5SX5H 2BERA 1WIUA 2PXYB 1S7QB 4JFOB 1YC7A 2VWEC 4JFQA 3RIFK 2YKLL 3U79A 2J12B 5DD3H 4AEIH 4NJ9H 3HC3L 4LIQL 2FECI 4XNQB 1G7HB 4FFYH 4PR5B 4Q9RL 3LQZB 3CU1A 1CS6A 2CR6A 2PUQT 5D9SA 3JWDC 4HK0B 3DOSA 35C8H 4B7LA 1VCAA 2H1PL 1CXHA 1UC6A 3WFHB 1UH2A 4U1MA 4LSSH 1RSFA 4OZFG 5F7MC 4JM2C 3VGGA 5CJXC 4WJ5B 1BFTA 2PNDA 5DJ2B 4OCWL 5I16A 1PLGL 4P2RE 1ZLWH 1D5XA 4GG6E 3WXWH 5FGCE 2J6EL 1LWRA 1M71A 4HW6A 1Q0XL 3QQ3A 1SVZA 5C0CE 3D18A 4F58L 5JR1H 3VGAC 3ARQA 4EIGB 3QI9D 3B2UC 3C87A 4OCXH 1FIGH 1RULH 1P84J 4ORZC 4ZXBD 5DD6B 3SPVB 4G6KL 4YBLC 3QB7C 5ID1A 1MY7A 4WW1A 3UC0H 5BZDA 3HMWL 3WN5A 1KEML 1LEKB 3RFZC 1FZOA 3RWGA 5L88L 3HR5B 1U8JA 5EOQL 2FR4A 4EI6A 4CDHA 2DM3A 1XF4B 1Z9SA 1YPZF 3QUML 5FGRA 5DVMA 4KQ3L 4OAWA 2XYCA 1T80A 2PYEE 2MQCA 4K3JH 3E6FB 3ESUF 1NGZA 2VDRL 2CMRH 2F8OA 5ERWA 4FZEH 4X6DE 5B8CC 2ID5A 4OCXL 3RX8A 4XCEA 3ULVF 2H32A 1U2HA 1JPGB 4EOWH 4BH8A 1S7RB 1YEFH 5I1AA 1QSZA 1KFAL 3WIIL 2NY5H 4TPRH 4OD3L 4MJ6B 3SHSA 2YPVL 3CVIL 2ADJA 3WSQL 2GFBB 1U8LA 4K3EL 3O45A 3GSWA 1FO0L 1GHFH 4QRPD 1AP2A 5EBWA 4J23A 1J05A 3T1WA 4RBPH 5HD8C 1YNKH 2DDQH 4MA8H 3SO3C 2ERJC 1HHJB 4G5ZL 4P46A 1EO7A 3QJFA 5DJDB 2NW3A 4PJ9D 4RGOL 3ULVH 3ARVA 5J13C 2W92A 1NC4A 4TTDD 2NY6C 3OGCB 4KMQA 2XPGA 5D4QA 3OKYA 4IRJC 5ICZB 2FBOJ 3TLRA 5E6ZA 2R56L 1CGSL 5DEFA 3RVTC 3DUUB 4TPRL 4XMKH 5F21B 5BW7C 1KCSL 5T3ZD 4Y2DC 5LJYH 4F15B 3DBXB 3D2UD 1AGBB 4AT6A 4D9RD 4EN3A 5I30H 1LDPH 1RZIB 5D2LF 3BIKA 4NQDA 3RIFF 3OKOB 1YNKL 4MAYA 2R69L 4NQVB 2XZQH 1NAKL 4WY7H 4HK3N 1WT5A 4X98B 2EE6A 4QRQB 2XICA 1L0QA 4PB0H 4KK9C 3CVHL 3VWJC 2GSGB 5J1SC 1ZLSL 5FKPA 1CR9H 3TN0B 1QRKA 3DROB 3Q6GL 5HHME 3P4NA 4GXUM 4JQVC 3RUGF 2OL3A 5IKCA 4ONHA 1VPOH 2XFXB 3OKMB 5D7JB 3LSOB 3O3UN 1IAMA 1MCNA 1VSCA 2NX5D 3DVIA 5EBLB 4ETQA 3TYFB 3R06B 4G8GD 1N5AB 3F7YA 3DX7B 3C9NA 3SGKC 4PJXA 5AZ2H 3BGMB 4Y19D 3NBNA 4JVPA 4CKVX 5IGXH 4FP8L 1RZFL 2CLRB 5EWIH 2VLKB 4Q74A 4UDUB 4QWWC 1NFDE 3O3BA 1U92B 2VMFA 3JTTA 3QZWG 4NC1C 5IVZA 3WD5L 4AIXA 5DSCB 3BT2L 2HT4C 5MEPB 5C0IA 2NZIA 5AZEH 2R1WA 3O41A 4YPGA 1XH3A 3FCTB 3PHOB 3TYGH 4D0DA 1Z9LA 4GW1B 4YHNA 2P4AB 3WEXA 3W2DL 1A21A 1CLCA 2HYMA 2R0LH 4HT1L 3VFWB 4BELD 4RISH 4LDEB 5D6CB 4K8RH 1H0DB 3V7MA 1IAIL 5KANI 4APQA 4H0GA 5DHYB 5I75B 3JWOC 3VXTA 1RURL 4FFWC 4HKXA 4I9WE 3H42H 4MSWB 4UIKL 5DVOA 4WI4A 4Y16C 1XF1A 2BNRA 4YBQD 5T1MB 3WFZA 2VSCA 4LARL 5FO8A 2WZPD 2XZAL 4J3WA 3LPWA 3U0TA 3O3EA 1FP5A 3MXWL 1ZLVK 2HP4A 4XNYL 1IL1B 2R0LL 5D93C 1OSPH 2IANB 3QNXA 5I18L 4YXLH 1YNLL 4ZUWA 2DI7A 4JY4B 1AO7B 5AG8A 1W8OA 1VACB 2EEDA 4KHTH 3H7LA 3ZO0A 4N0CD 1MQKL 4KDVA 1JGVH 1T2JA 4QGYA 4O4YH 4EVNA 5CEYA 1U3JA 4R3SB 1HEZB 1G6RB 3ZE1E 3VRJA 2UZYB 3AVEA 1MFEL 4POZC 1BIIA 2VISB 3ALXA 3FB8B 4PJ7B 3RNQA 4JFHD 3IJHA 2EE2A 4ENED 1BQLH 2A2QT 5DK3A 2V2TB 4L3ED 3LS5L 1RU9L 1IM9D 1J0HA 4NO0B 3MRDB 1B0WA 5KSVB 2C4FT 2ATKA 5DD0H 1WEJL 3KAAA 3PWPB 4O02L 3TM6A 1H3UA 1T04A 3KJ4C 4YXLL 3VCLA 4Y4KC 4MQXC 4ODTL 4KHTL 5IESH 4PD4J 4JFFD 5JTWA 3EW3B 3T3PF 4XH2B 4MMZC 1TJIH 4R4BA 3ISWA 1Z0NA 1X5ZA 2BSSB 3X3FL 1UKTA 1MWAB 3CFBA 1CGVA 3G6DH 4NO5B 1CD9B 3QG6A 3BN9D 1MRCL 2Z31B 2R29L 4P4KC 1U3ZA 1NAMB 1ZLUH 3HZMB 5B3JE 2BNQD 1E4JA 5D1XC 3FJTA 2B2XL 2W65A 2JK5B 5IW3A 3TA3C 3FL7A 4GRWF 1GL4B 4Y4HD 3VH8G 3IXAA 4HUUA 4J12A 3MA7A 4YZFF 3JVGA 1GJIA 3O4LA 3SO3B 2ERJB 4M7LT 5IVXE 1MCOH 5AG9A 3DV6B 3L7EA 2XNAB 4OFIA 2BC4A 5I1KH 4UUJA 3LD8B 5ETUA 5ID0A 1FFOB 1YUHA 5J13B 1S78C 4OF3A 1NCTA 2F9BT 4U6TA 4KV5F 5IFJB 1AGCA 4C4KO 1HHKA 2L7JA 5GSRA 5GZOD 1KPRB 1SEBA 4GRWH 4M6AA 4FQCL 2YRZA 2DQGH 1OT1A 2Y9RT 3BP7B 4AH2B 4KTDH 4M5YL 4Y8DC 1A7PL 4PJBF 2ZUSA 3FO2B 1LE5B 4QXTB 1JPST 2ATPA 5DRXB 5JHDB 3A67H 3QHTC 5MHSD 1MI5E 3DJ9A 1A0QL 4P4RA 4P9MH 4GKZA 1UENA 2GCYB 1MFCL 5JLZB 1TVBA 4ZUUB 1IQWH 4XNUL 3I9GL 3FFCA 4QHMB 4X4ME 5JQHC 4LLYA 3LCYA 4GMSL 3VWJB 2J2ZA 4OCYH 2PF6A 5DA4A 5GRZA 3RY6A 3I6LE 1JZ6A 3FTGA 1QRNE 2AK1H 4F57L 1O7VA 2PW1B 3HPLA 2PW2A 4WI3A 4NKOA 1X4YA 3P4LA 4PFEA 4H26B 1SY6H 3QQNA 4CJ0A 3MRBB 1S7TB 4XCNB 5EUOB 4YFDB 1FNSH 3X12A 4XPHL 2A0LC 2Q1EA 4YXKL 1HSBA 3QZWA 3TBWB 4R96B 2QQKH 3D6GA 3MRKB 4RFNC 1ZLVH 3VW3L 4NWUH 4D9LL 2A9MH 4TTGA 2VLRA 4XP1H 4KJWC 4IRSA 1JWUA 4HGWA 1A2YA 3TPKA 4QOKA 4XRCA 2VL4A 1NFKA 3C5ZD 5EN2A 2NW2B 5GGRA 2OP4L 1RZJL 4IRZH 3WNLA 5C09B 5I2IA 1J8HA 1R3HB 4HKJB 3ULSA 4HLZG 4JVWA 5EU3A 5H37H 1MFDL 3NA9L 1QFWI 1T21A 1LE9B 4P5TB 4JVUA 1A14L 2CRZA 3ARFD 3HB3C 2PKDA 2RAMA 4UNTA 5JW4R 5I1JL 1P7QA 4PY7A 3GO1L 2IPTL 2VXQH 1MVUB 2V17L 1TZGL 3QEHB 5C71A 4IIQC 1I3RA 2I25N 5CGMA 1DEDA 1JWMB 5I1LB 2I60L 1RZ7H 3KYNB 5D7LB 5MENA 4Y16B 3VFSA 4P9HL 5FGBA 3B4NA 3SDXE 1UZ8A 4U1KB 2YSSB 1ZVSB 1ZHLA 4MA3A 3UAJC 2Z91B 3NABH 2ZCKL 5CWSA 2LE9A 4NT6A 4PRHA 3DTXB 5I66B 4J3SA 1UQSB 5D93B 1RUQH 2BOBB 2DIAA 1VGKA 1AFVH 3Q0HA 4HFWB 3O2DH 2ZSVB 2A6IB 2DQCL 3DMMD 3SDDC 2VXQL 5EU6A 5GISL 2X40A 1T83A 1SM3L 3KXFD 1KJ2A 1LILA 1W72L 2DLFL 5D6DA 5T3XL 4YGVA 1HINL 4NO3B 5DFVC 3WHXA 1T7ZA 1ZXQA 1B4JH 4G7YH 2FEEI 3M07A 5DJYB 3D9AL 4PJ8C 3VGEA 3T2QA 4QYOB 1S7UB 2QSCL 4OUUA 2IMNA 1G7LB 3FQTA 2QQQA 4F80A 5GS2D 3UJJL 3QNZA 3QCUL 1JL8A 2JCCE 5IJKA 3STLA 3JXAA 1BAFH 3TBSA 3IGAA 1TPXC 4OFDA 4LAJH 1AY1L 2BSRB 3KJ4B 3PV7A 3MV7B 2YBRA 2NPLX 4QEGA 2P49B 1R5IB 2VNCA 3AS2A 2N7BA 1R5WB 2EDTA 1YEEL 5TE6L 1S7SA 2VDNL 5A3ID 4GBXD 1E28A 4TNVK 4YNYA 4YHOH 2A77L 1CN4A 1RIVL 5BRZA 1WGOA 4P4KB 4J6RH 1X5IA 3HG1A 4NNXB 2OS7A 1U3HC 6CGTA 4OFYA 2E9IA 4X9IA 3QDHA 1YECL 5D1XB 3BXNA 4ZPVA 5TQ0L 2A1WH 5ICXB 3TA3B 1FFQA 2HAZA 2JJTA 5GRJH 4UDTA 1JHLH 3HPJB 2ADFL 1F8TH 3S96B 3LKSB 3DUHA 2V7HA 3LKPA 4ZFFA 2YRPA 5C2BL 2AXHA 1OY3B 3Q5OA 4EUPA 1EBPA 4XXCC 4ERSH 3NAAH 4WEBL 4LSTL 1R0AH 3T0ED 1I85A 4ZPTA 5JPMA 2FX7H 1E4WH 4TN9A 3BE1H 4I3RL 1AHWA 4PG2A 2VABB 4GW4A 1Q38A 3P9MB 2HTLC 3UTSD 5F1NA 3U9PL 1BQUA 4Y5VB 4XP6L 5DEGB 2XZZA 5HY9A 1S5HB 3ZTJH 5JORA 3N85L 3CJJA 2R2EA 4YFLI 3MBEC 2OK0H 4N0CC 3QIBC 5D70H 5FO9A 4NO2B 4OCSL 4UNUA 4O51A 2EDFA 2OMNA 1RVFL 3CXHJ 3PWVB 3IFNL 1DQJA 1JPFB 5DHVA 4OZIE 2IH3A 4JB9H 1KGCD 2B1AH 5CKGA 3SGDI 4JG0H 5E08L 1GIGL 4EI5A 2FX7L 3LKOB 4WU7A 3MJ9H 2P8LB 4JCMA 4I0PB 4J2XA 4IEFB 3WNNA 2VITA 4XVUD 1EAPA 1CLOH 1CE6B 2EYRA 2ZSWA 4G6ML 4W70A 3OX8A 2OI9B 1G0DA 1CD1A 2FL5A 1W0WA 2UWEB 5CAYB 5J57B 1ORSA 5C6PB 2WANA 2R0KH 3W5MA 4U6XB 4RFNB 1WIPA 5FM4A 4F3FB 3C6LD 2UYLB 3BMVA 1RUAL 3TBTB 2D31A 4BSWA 5C0JA 5BVJA 4RNRB 4ZO6A 4LASL 1CL7L 1J0YA 4Y4HC 1QLEH 5D96C 1FYTD 1NEZG 1P5VA 5L2KD 2NZ9D 5KVFL 3LRSA 2AK4D 4U1LA 4UBDD 3GSUB 4JGJA 4KK5D 2VDMH 4PJHE 1F4XH 1LO3H 5DMJB 1CFBA 1OLZA 5DDHB 1EHLL 3U4BH 1V8HA 1VEMA 1II4E 5D7KD 1OSZB 1A6UH 2AV1A 3H3BC 2MJWA 3ZDXF 4PJXE 1EJOL 3MLZH 4XC1L 3LN4A 3OJVC 4A6YH 4L9LB 4E0RB 5GGTL 3LEXB 5A16A 5GJTH 2Q76B 4IIQB 4RMRA 4YJZL 4ZTPH 5F6IC 1Z2KA 5DK0A 3HUJA 3S36H 4P23D 3UYRL 3QFDB 1AI1H 5DFWH 4ETYA 3H7BB 4R7NB 5DVNA 2R23A 2QKIB 3PWLB 3ARDD 3RVVD 2CD0A 1FSKC 3AROA 1DQLH 1NGXA 3VFOA 1CXKA 3GMQB 1ZS8B 2ARJQ 5CZVL 1A6UL 3BUYA 1BQHB 3GMRA 4N8CL 1PZ5A 5F7UA 3CPLB 4GRLA 5E4IA 5HI3C 4XCYB 4PJFE 4Z0XA 3SDDB 1KG0A 2DQTL 4H88L 2D7TL 3F12A 4JM2F 5E6IA 4X6DB 5JOEA 3V6ZA 25C8H 2Z8SA 1YEHH 4P48A 1JRHL 3DX6A 3KPPA 3F5WA 4GUPB 3L3HB 2P5WE 3BGFC 3REWA 4X6FA 4FA8A 2X1XR 1JPTH 3SDAA 5K9JL 5EG6C 3VWKD 4DUXA 3L95A 2YXFA 2E7CA 3MJGX 5T1KA 4E41D 1Q9OB 2P43B 2APVA 3V0VA 1K4CA 1S7XA 5SV3A 2DJSA 2FBJH 2N4IA 1TPXB 5D72H 4P0DA 5TQ2H 3SE9L 1I9IL 3QEQA 1QBMH 5KSAA 2Y5TA 4PJCE 4HBCL 1A3RH 1U8OB 4XAWH 5CUSL 1BVLA 1FIEA 5KSBA 5CP3A 2X9YA 3KPNA 3VXNA 2NY0C 4JRXB 4OKVB 5FYJE 1BWWA 4MB3A 3ZYIA 4CRPA 3PP4L 1LEIB 1GRWA 1IGCL 5K33A 1QYGH 1AR1C 1G6RH 3QHZH 4FQ1H 5F1KC 2Z93A 2IGFL 4LCUA 3RHWK 1UWEH 2BVPA 4PLJD 2MHAB 5ADOH 4KKNA 2PYFB 1U3HB 5HYQB 1BLNB 1D6EA 2FGWL 2R2CA 2FO4B 4XZUA 1NSNL 3JWDL 3W11D 5MERA 4M6OL 3GMMA 4PJGA 1J12A 4JZJC 4G43B 2MKLC 4PRPE 2Q8AH 2BY1A 1X5XA 3AS3A 5GGUB 3BP4B 5F3HB 1KLGA 2PTUA 1RMFL 3IU4L 3L3KB 5ESQB 5HGDB 3ZT7A 4ZOCA 4CADA 4FQ1L 1G6RL 2F54D 2YA1A 5HHMB 4XHQA 4OB5H 5C86A 3VXPA 2BDNH 2HFGH 5GGQH 3EGSA 1FLRH 1IQDA 1ZT1B 3TJEH 4AEHH 1BF2A 2OM5A 1NAMH 2CK0H 4AG4L 1FGVL 2EE3A 3ET9F 4FQLH 4CVZB 5HYSA 1DJSA 2RIKA 1FV1B 3U0PB 3TH4T 3BZEB 1U8PB 2D9CA 3MBEB 4E42A 3BW9B 5C0BD 3QIBB 4NZUH 3WFDH 3C8KA 3CFJA 4X9BA 4CUCA 1WTLA 3O4LE 4EEEA 1K9TA 4L8BA 3UDWA 2YOCA 4PGDA 3CMOH 1C5CL 1KF9B 3OR6A 4WWKD 1FVCB 4TUJB 4YAQA 4OB5L 1MWAL 3ARED 4UV4L 3FO0L 1F3DH 4I18A 5ITFA 1NAML 2CK0L 3Q48A 3X14A 1X3DA 4OLVH 3QUYA 3WIHH 2J8UB 1KCVL 3ARGC 2R4RL 1KN2H 5F7WC 4L29B 5DZNA 1JGEB 4Y89A 3VI3F 5SWQA 2RBLA 2X4SA 5A2LH 4F9LA 3VXSA 1G7IA 4JRYB 5CILH 3L3OB 3NCJH 4D8PB 1CBVH 3ARSA 3QBTB 4NZUL 1UH3A 1NCAH 3FRUA 1FGNH 4BYHA 2XTLA 1M6OA 4YQXH 1X5YA 5CJQL 4GBXC 5BQ7B 2K1MA 4LOUC 5E8NB 1KEGL 5HDBF 4DKEL 2AV7B 2HVJA 3BZ4B 4BK5A 3ZDYF 2WAHA 2J88H 2NY4D 1FPTL 4JM4H 3FB7B 1LO2L 3CCHA 4M5ZL 5EIIB 4M8QB 4LMQI 2J4WH 1SQ2N 3GEWB 4PJIE 4UT6L 3WIHL 1A6PA 5D96B 1FVEB 1OGTB 3T2PA 4KTEH 3GHBH 1FNEA 4B53A 3FO1B 1QFHA 4FQXD 4M02A 5CILL 3NCJL 4OZHB 1UB6B 4MD5B 4J1UA 3T0EC 2HG5A 1CWVA 4HX1B 3ABZA 1DQDL 4MQ7B 4IMKA 4KZEH 1YQVH 4L4VD 3QFJE 3K8LA 3DIFA 1CGWA 1YJDH 2VIRB 4NRXB 4PIRF 3MGAA 1CCZA 4QOKE 1CLYH 4JQIH 5I8CA 4JPIA 5DMIL 4U49A 3G5XB 4HUXA 3HE7D 4Y1AA 1IC5H 5DTFA 2BSTB 4C55A 5F6IB 4NN7C 3TBVA 5F7DA 5A2JH 3D0VA 3RTQD 1PG7H 2YZ8A 1KT2B 2F8VA 3VXUA 4FQHB 2VDQH 5IROC 3GBNH 4PGEA 1XCQA 4X4XB 2DQHH 2VLJE 5FCSH 4EJ1C 1FSKB 3GMOB 4BKLB 1Q94A 2AJVH 3K1KC 2BJMH 4FQQA 4RMVA 4XTRC 1Q72L 1DBKL 4URTB 5SWSB 1YQ2A 1T5WB 4G8IB 4JFZL 5CLWA 5BJTB 2H9GB 3GBMH 1OAYL 4NKDA 1YPZA 2VLME 3IJSB 5HYJB 5I1DA 3QXUA 1RZGA 5HI4D 5F7NC 4FMKA 4W4OA 3MNVA 4U1JA 3O4OB 2CIIB 2W60B 3BGFB 3QCTL 2GJ6D 3NN8B 2VZ1A 4LHQB 2A6DB 3KPSA 4KY1H 3KPRA 3TCLB 4Z7VB 4AENB 3MRJA 2DQHL 4MWFB 1YDPB 1UXSB 1KCUH 4PRHE 4MCYB 3G08B 2FWOA 2MPAH 1OTUC 1Q8MA 2BY0A 3UO1H 1F11A 3MRMB 2B1HH 3HFMH 1BD2E 4U7MA 3SCMA 5IVXB 4JO3H 4NRZA 3QR2A 3D69B 5IBTH 2E27H 1HH6A 2NY0B 2OSLB 2QEJA 1FRGL 2DQIL 3JWOL 4XGZB 3RGVD 1HWGB 4OCRH 1UZ6F 2OZ4H 4MJ6A 1QBAA 2NZ9C 1LP9E 2V2WA 4ISVB 4LEOB 1XGPA 3V7AE 1PX3A 1FL6B 2EXWD 4X7SH 4PJ5E 4LBEA 3MLXH 4NM4H 4NZTH 4JPKH 4KJPD 3P11L 4KRPD 1T0NA 2F8XC 3BVNA 2XWTB 4LRNH 5K93A 1G7PB 3EJZD 4LCCA 2FYYB 5LWYH 3FO9A 3UYPA 3WCYA 2ESVE 1J11A 2KBGA 1MI5B 1NGPH 5ICYA 3MUHL 5D2LA 3T4AB 3LIZH 4P46C 2E27L 3KYKL 5EC1A 1MRFH 4MAUL 3V4VL 3QDJE 3O6FD 3H9SB 4Q9BA 4DKFH 5IWLC 1QBBA 2X41A 4W6XB 1Q9WB 3BP5A 4OQTH 5JW4N 4ZUSA 1E27A 3ARDC 4M48H 1OAZL 3RVXD 5C6TH 1QFWM 2Y6SD 2DWDA 4WU5A 4LVHB 5BRZE 2LQRA 2APTA 3VFNA 1G7MB 3DGCR 5HHXL 3OZ9H 1ZA3A 4IDJH 4WNQB 1AGDB 3MODH 5HDOA 5IM7B 2K7PA 2P5EA 3S97C 4ZD3H 5F71A 4EN3C 4X80L 3RUGA 1YYML 2YUZA 1A5FL 1IAOA 4LCWA 1JK8B 5BVPL 5GXBB 1N3NA 1SMOA 1JHTA 3EJYD 3IKCB 2XTJE 4MJIE 4GW5A 4NHCL 2A73B 4LHUG 4JHAH 4OI8A 3MREB 1WT5C 5EBMA 1A6ZB 3BWAB 1HH9A 2FX9H 1QFUH 4S2SB 3L3DA 5TFSH 4RQQA 4G9FE 1QKZH 5C8JA 4JLRA 1D5MA 1IE5A 5ISZA 3Q2CA 5DR5L 3B3IB 3Q6FB 3MNZA 3VWKC 1HN1A 2C3WA 3BDYL 3QUZA 4NHUA 5DJAB 3IFPA 4HEPG 2YEZA 5KS9B 4XHJD 5FOBA 3NPZB 5IOPB 5L8LB 5DJ8A 1CT8A 3TO4A 1U8KA 4BZ1L 3DX9A 3MYJA 5CBEB 3ARGB 1EV2E 3ARBC 5D5MA 5A2KH 1WZ1H 5HGHA 2GITB 4FTVD 2I5YH 1A6VH 1XGTA 4P2RD 2Z92A 3INUH 4Z7UE 5GPRA 4TQEH 3QDGA 4JR9L 1RV6X 4KGLA 4OJFL 3DXAD 1VHPA 3FQRB 1QBLL 1IGTB 3BQUA 1IEBA 5C0CD 2UWEF 4JDZB 5IMKB 4M4RA 1EK3A 3RZCA 5CD5C 2IQAB 5E6YA 2AQ1A 4LSQL 2PO6A 3S9DB 5JHLL 3SGJA 2DM4A 4NFBA 5EU5B 4N8VB 1MCIA 2JJUA 5FHAH 1GAFL 4PGCB 1NC2B 5FK9A 4HV8A 5I19H 1T6VN 1AKJB 1I4FA 3L6FB 2CDGB 1NDGA 1H3PH 2BVOB 1KIUA 1WFUA 2I5YL 3O3AA 4K9EH 1I1FA 2EO9A 4NQUA 5IHZB 2J8OA 5AYUH 2P47B 3RBSA 4APQC 2PYED 4BQ6A 1HHHA 4HJ0D 4NWTH 4JFQB 1YEGL 4WFFE 3RAJH 2AW2A 3T65A 1JTPA 2C7UA 4NN7B 4HS6A 1CIDA 1JIBA 4GAJL 5FHAL 1URLA 1O5DT 2YZ1A 5D9SB 2HJLA 4YDKL 4XBEH 4U05A 1DLHA 4GRMA 3EYUL 4U1MB 2EYTA 3FRPA 3D85D 1XGYH 5AWNL 1PD6A 5AYUL 3DARA 2CQVA 1D5XB 2BVYA 3RGHA 2YPLE 1I8KA 5ALCH 1M71B 4NWTL 3AREC 2HA1A 1CK0L 3QQ3B 3ZDZE 3RX7A 4GKSA 1T1XA 3HAEG 3VMOA 4P49A 3MYZA 3O2VL 1UKSA 4JFDA 2FRGP 3RWIA 2AJYH 5FYLL 3FOMA 5T3ZH 2OQJA 3H3KA 1U9KA 3PIQA 4H20H 4CL7A 4IS6A 4WW1B 3QRGH 4X7EC 3ZE2E 5BZDB 5ID1B 1RZKC 2WP3T 3WN5B 1ZAGA 1BBDH 3V9FA 3ZHDA 4G3YH 1FZOB 1ACYL 3RWGB 1Y6MR 3NIGF 1U8JB 5EU7C 2FR4B 4Z77A 1AD0A 1I1AD 4EI6B 2LU4A 2B0SL 1DQQA 3TNMA 1KCLA 1HHIA 3WDIA 3REVA 4OAWB 1NCDH 4OLXL 4OTXH 5MEOA 2R4SH 3GRWH 1NGZB 5FV1L 5IB2A 2A9NL 4AQ1B 5E99H 1N59B 1R3JA 1T0MA 1DVFA 5ERWB 3BEWA 4XNZC 1J1PL 1NCCL 1FG9C 4Z0BL 1CDBA 2H32B 4BH8B 5I1AB 1PG7W 3CC5A 4LSVH 4Z76A 2YA2A 5B38A 1NMBH 1GCFA 2ADJB 3U83A 4G3YL 1U8LB 3O45B 3GSWB 4OGZA 4HCRH 4FABH 1AP2B 5EBWB 3VD4A 4AL8H 4F7CA 5ACZA 5IQ7L 5C0AD 3S35X 1WBXA 2AI0H 1X5LA 3A6BL 4XP9H 5LBSL 4CVWA 3DSNA 4MNGA 4P46B 4OLYH 3GRWL 3QJFB 2E7BA 1SY6A 2MKWA 1CGUA 2NW3B 5EOCH 1NC4B 1U8NB 3WLWC 3RKDC 3ZKXC 1EJ6A 2DD8H 4M6NH 3FQUA 2XPGB 3T09A 5D1ZC 1NGWA 1FQ9C 5JIKA 5DEFB 4MXWH 2Y72A 4UTBL 3FONA 3HI5L 5IVNA 3V7AG 4ZFOA 1CGTA 4EN3B 1KTDA 2VDPL 3VXMA 4OKDA 1DBMH 4YHIB 4AMKH 4XPGL 2AP2A 3M17A 4NQDB 4XP9L 5I1EL 4MAYB 1INEL 1C8PA 2X4TA 4LLAA 1DN0A 1N6QL 3SGEH 5F9AC 1UVQA 1WV7T 3HI6H 1MHPH 1M7DA 5T5NF 3TVMA 2RGSA 3DNKA 3UTTE 4BUGA 5FKPB 2DD8L 2DWEA 2NY3D 3DSFL 3RY6C 1HYRC 3QXWA 5CHNA 4L5FH 5HI5C 4FQIL 4I3SL 3P4NB 3MRPA 4YDVA 2YMXH 1TJHH 1FE8L 1F90H 2OL3B 3MLUL 4ONHB 5IKCB 4IOIA 3TT3H 2ZCLL 2YC1A 1UWGH 3F7PC 3ARBB 3G6JA 3WJLA 3U0WH 2OTPA 4ETQB 2F53E 4GXUN 1C08A 3QQ4A 3F7YB 3PGCA 3BYTA 3C9NB 3ARYA 4PJXB 2DBLL 3BZDA 3GK8L 5ILTH 4IRSC 5JPNA 2R0ZL 1DBAH 2J1KA 4F9PC 3O6LL 3O3BB 4N90D 4KJPC 1K2DA 3TP4A 4ALAH 3P0YL 3JTTB 4UINH 2AJSH 5IVZB 1REIA 3Q5TA 2RFXA 4W68A 3O2DA 1ACZA 1A7OH 5CZKA 5C0IB 2H8PA 4JDVA 3PGDA 4U7SA 2AABL 5EC2A 2R1WB 1OPGL 3D39A 3O41B 4YPGB 1XH3B 5IHUL 4TSAL 4D0DB 4R90L 2Q6WA 4YHNB 3BKYH 4NM8H 2V5MA 2FGZA 4DQOH 1ND0A 5ANMA 1MHEA 3PQYA 1KYOJ 3KPTA 3VRLE 4ZFGH 2H6PA 4APQB 5ILTL 1IC1A 1ULVA 3VXTB 4HKXB 5FGSA 5C08E 2FHBA 1R3IH 3LPGA 3RVUC 4MA7H 2BNRB 5FGBC 4HIJA 5DJ2A 3BEVA 4PREA 4JO4L 4FFZH 3WUZA 4LCIH 5FYKH 3B6SA 4PRDA 2I07A 2EDBA 3ZKND 5FO8B 1EZVY 4OM1L 3GMNA 3QPQC 5DD5L 3NFSH 3U0TB 4YHZL 4DCQA 3O3EB 4BUHA 1BQSA 4KJQC 1T2QH 3KPOA 1S3KL 5GRWA 5FXCH 4DQOL 3QNXB 1LQSR 5DQ9A 2I9LA 3DYPA 4ZUWB 4ZFGL 2XKNA 4KMTL 5T1LD 1T83C 5IFHL 5KVEH 3K8KA 4ZTOL 4XHJC 3BH8A 3S5LA 3GI8H 4Z7OF 4EVNB 5CEYB 5D6DC 3O9WA 3HR5A 5FUCE 3VRJB 4NNPL 3L3GB 1BIIB 3GI9H 2X89D 1AGFA 2H2PC 5FYKL 3RNQB 3IJHB 5I76A 3UPRA 3A6OA 1CDUA 3MV11 3BZFA 2Q8BH 5IJKC 4R7DA 2Z35A 5TE7L 1LEGA 2ATKB 4PY8I 1OTSC 1NANI 1T04B 4KMLB 4Z7VF 3LKQA 2RB8A 4TVPD 4YEEA 1UB5A 1UGNA 4HMEA 3NZHL 2Z8WC 1FH5L 4R4BB 1JZ4A 4UOJA 3AGVA 3P40A 3QO1A 1CTNA 3CFBB 3I6LD 4XNZB 1QRND 4FNLH 1LO0L 3BDBA 3QG6B 3VXQA 4UTAH 5JIIA 1PBYA 2EDDA 3TFKD 2Q8BL 3KPSE 1FFNA 3EZ8A 3P73A 1R24A 5L9DH 2Z4QA 3NFNA 4KFZC 2W65B 4I2XA 5AYQA 3ULVE 4JFYA 4QXGL 3IXAB 4HUUB 3MA7B 3T08A 3CZJA 3NACH 4WIQA 2X4NA 3MJ9A 1A6AA 3IXTA 5C7XL 3IAQA 5JW5A 4MJ4A 3D3VE 4KK6D 3MOAL 3CU7A 3O4LB 1LO4H 2IPUK 4GAGL 3WE6A 4RGNC 3L7EB 1I85C 1JMXA 4YHLL 2BC4B 2AXJA 4UUJB 5ETUB 5ELIA 1F4WH 1YUHB 3TZVA 4CMHB 2P8PA 4CMMA 5BS0A 1UXWB 4LPWA 3ZKXB 1KB5H 1CU4L 1I1YA 1AGCB 1AHWC 3TH2T 4PG2C 1HHKB 1IKNA 3NVQA 5D1ZB 1SEBB 4NDMA 2JB5H 2V5RA 5DMGC 7FABH 4LNVA 4ONGL 1CLZL 4FXLA 5DJXB 1N7ML 4TOYH 1EFXD 2HJFA 2E6PA 4O5LL 1F6FB 4JAMA 1IZKA 2GSGA 3J7HA 5CIPH 5L8JB 7CGTA 2ATPB 5I15L 4RWYH 4P4RB 4GKZB 5D2LE 1TJGH 1BZQK 4PY8J 5DZLA 1QO3A 3MLRH 1TVBB 5E00A 3FFCB 5IHLB 4EDXA 3F8UB 4LLYB 1NGYA 1L6XA 5JMOC 3EYSL 4PLKD 3VI4F 5JDSA 3U2SA 1BX2A 4X4YB 3FTGB 3WS3A 1MCQA 1F4YL 2N1KA 1HSAA 7FABL 1T5XA 3HPLB 4A6YA 3RI5K 2PW2B 2KPNA 2R1XB 5F3BA 1AXSA 4NKOB 4AIZA 3CFIC 5LVEA 1NC2D 1MCCA 1AKJD 5DFTA 1QSFE 2XZCH 3BGAA 4LKCA 4WI7A 5E5MA 5IJVA 3X12B 5C07A 1ETZA 5F93C 3ULUC 3MRQA 2VR4A 2WUCL 3BAEH 2W0KA 4PRAA 5IBUG 3QZWB 4EQ2A 3N1QC 4DUVA 3QWOA 3WFEL 3C60D 3C5SA 3NCYP 2VLRB 3MROA 1MFAL 4IRSB 1JWUB 2QADC 1A2YB 2EIBA 4QOKB 4XRCB 3FCTA 4C56A 5GIRA 5ISZE 2DTSA 1I7TA 5HVWA 5EN2B 1AC6A 1YN7B 4QTIH 4MJ5A 5GGRB 3LH2H 3R1GH 1KOAA 2FZ3A 1DQML 1DBBL 4P2OD 5GS2H 3RA7H 2HMIC 3GMPA 5I2IB 2ZWLT 1NLBH 1J8HB 2Q3AA 5IBLD 2QQNH 4R8WL 4YXHL 2M1KA 3ULSB 5DUMH 1P2CA 2NY7H 5DHYA 5EU3B 5BMFH 2O5XL 4Y5XC 1T21B 1NBVH 4G42A 1CFQA 1WQVT 3UJTH 2GK2A 4M1CC 4ZQKA 4QNPE 2F5AL 5DJCA 3VXRE 4HFUH 4HWBL 2P1YA 5EZOL 1P7QB 1VGEH 4PY7B 2DYPA 5I73B 3FT2A 1Q1JH 4JHWL 4CGTA 1I3RB 2DLHA 1ZMYA 3F65A 3VGDA 5MENB 4JM2A 3EHBC 1YY9D 2GSIA 1N64L 2NTFA 3VFSB 5CJXA 3UMTA 2VL5A 4JY4A 1UZ8B 4KGJA 2C3HA 1WCQA 1ZHLB 5GRYA 4MA3B 5IT2H 2OBGA 3NZ8A 2QSQA 4WGWB 5JXAL 3BIAX 4NQCE 4KHXL 4GS7C 3N9GH 1V3KA 5CWSB 4KAQL 3MRRA 1NBVL 4NT6B 1JNLH 4PRHB 2OR9L 1NUDA 3CLFH 1IJ9A 1VGKB 4GRLC 3DX8A 4UV7L 4LPUA 4U6VL 4R4FH 1G9MC 3KYMA 1NBZA 1IAKA 3OPZL 5EU6B 2XKSA 4XPBH 4N0UA 1ADQL 5E6IC 3VMNA 1RHHA 2PR4H 5D1QA 3WDJA 1JGLH 3S6CA 1KJ2B 4LL9A 1KUMA 4YGVB 5GRUL 2QV2A 4RMWA 4GG8A 3WHXB 2GTZA 3S35L 1QSEA 3RWEA 3SDAC 1CDHA 2WWMD 1MJUH 5DLMH 4OUUB 1KN4H 4GMTH 3FQTB 4MNQE 1HXYA 3QNZB 2X7LA 3WO4C 3STLB 2OYPA 4UILL 5L6YH 3TBSB 3IGAB 5B8CA 1Z6JT 1AH1A 4HGMA 5KSAC 3GSNH 3FFDA 2DAVA 3ZMRA 2YBRB 1DEEA 3IDXL 1PKQE 4WO4D 1MIEH 4NQEA 4JO2H 2DMBA 1S7SB 4MJ2A 3K8MA 3T3PE 1T7VA 2HTKC 3I02A 1E28B 2DIBA 2NXYD 4YNYB 1X9QA 2ORBH 4ZAKD 4EKXA 5DLML 3HG1B 3QEGL 4HXBH 3BESR 5C9JA 3S98A 3BXNB 4ZPVB 1B3JA 1NKRA 2NY1D 4HQQL 1MRDL 4UDTB 5J9PA 1CFVL 5L8KB 4MAYD 1CXIA 1EA9C 2MOVA 2ZCHH 3KR3H 4GRWE 3RU8H 2V7HB 3LKPB 4IRJA 4V1DE 5TE4H 3TJHD 4ZFFB 4MCZA 1OW0A 4EUPB 2EDRA 2HT2D 3SJVE 1C1EL 4IM8A 1KBGL 4PPTA 4RGNB 4ZPTB 5LGKA 5JPMB 2OCFD 5TF0A 4KZDL 4Y2DA 2VOTA 3S37X 2CXGA 2D03L 3LZFH 1AHWB 1IGMH 2R9HD 4GW4B 4JZOA 3NIFE 4ACPA 5F1NB 4KV5E 2IPKA 1MREH 3MV9E 5E2WH 2CR3A 1NCUA 3VFPA 1WFTA 3RVWC 3WYRA 4C59B 5HY9B 1B4RA 1UACL 5SWZA 4BQCA 5JORB 3LEYL 5LGJA 1NCBH 2FATH 2R2EB 1P7KA 1EGJH 1I3UA 2VQ1A 3MJ7A 3H3PL 4X5WA 5FO9B 3JV4A 4O51B 4NP4H 4PJBE 1UA6H 4UIMA 1DQJB 1Q0YL 1CL7I 3EDFA 4YWGL 3UDWC 4FS0A 2VLLA 4EI5B 1IFHL 4CAGA 2B7DT 2VC2L 5IMOA 4ESKA 1X5KA 4WU7B 2LV4A 5FUZH 2W91A 3KS0J 4JFEA 1DUZA 1G9NL 1J88A 1K3IA 2D4DA 2XRAL 3QG7H 3SDYH 3QUYC 1F6LL 4HH9A 3OJMB 5F88A 2VITB 3MRKA 3TO2A 2EYRB 2ZSWB 4I48B 1D6VL 3QDME 4JY5H 4ODSH 5EOTA 4F9LC 3OX8B 4M7LL 1CD1B 2FL5B 4M7JL 1W0WB 4U7KA 3FKUS 3N06B 5ITBH 3WNPA 3D87B 1ORSB 1KXVC 5IR1A 4NRYB 2NXZC 2LTQC 2CDEA 4LSRL 2AQ2A 3BPCA 2F19H 3IAGC 5I1HL 2FH8A 4UQ2A 2NY2D 4Q58C 1F2QA 1PZUB 5F96H 4PRIE 1RAMA 2QADB 3OKLA 5INCA 5FB8A 1QSVA 1RUMH 2DQDH 2D31B 4BSWB 2D0GA 2P5WD 5C0JB 5BVJB 2C3VA 1H9VA 5HHVH 2R15A 5I0DA 1OP3H 1G7QB 4P2QE 3BOVA 4K3DH 1JPSL 3TV3L 3FZUD 4L4TD 2HKFL 1YYLH 4AEFA 3IDNA 2ZG3A 4KK6C 2X9XA 2RHEA 5DO2D 3LRSB 4U1LB 3KLHD 2XA8H 3UYOD 2XN9A 3LV3A 1C5DA 4W6YB 2XT1B 5T3XE 5TPWH 1KPVA 4IMKC 1MAJA 3C2AH 1KC5H 3EZJB 3LN4B 3QIUA 1U8IA 1OM3L 5FYJD 2X70A 5F96L 4G7VL 1NMCB 5A16B 1MCFA 4PJAE 4KK8D 3F58H 1UCBH 4KPHH 4OIIL 1XZ0A 5DK0B 3HUJB 4C58B 1GXEA 3IU3A 1OP9A 2YPKA 1YYLL 2R23B 2C26A 2OL3L 1KJMA 3V52H 1T03L 1NGXB 2H45A 4LHUD 2BZDA 3WHE1 4M9PA 3VFOB 1L9MA 2Z9TA 2OZ4A 5CFHA 1QLRA 4JG1H 4PRPD 5CINH 3BUYB 4OI9A 4NNYB 3GMRB 1PZ5B 4LLVA 5FO7A 4GRLB 1CG9A 4PS4L 2WIIA 5E2UH 1KB9J 1X5FA 4KTYA 3BN3B 4Z0XB 1KG0B 1DTUA 4R6UA 3LQAH 5E6IB 3AC0A 3KG5A 3V6ZB 4ZUVA 3D0LA 3DX6B 3KPPB 3KHOA 3BD3A 3F5WB 4S1DC 4LU5L 3REWB 4X6FB 3QWRA 4D3CL 4YHYC 4JO1L 3SDAB 1A6TA 4LGRB 4OZFH 1MEXL 4Y4KA 3CLEH 5ACMA 1AE6L 5F1IA 5FDWA 1WTGT 5T1KB 4K7PH 4OIBA 1NGQL 3WO4B 1N0XL 3V0VB 1X5HA 5F9DC 3VU2A 1K4CB 5E8OA 1S7XB 1P9MA 3THML 3LRHA 3QEQB 5KSAB 3SCMC 5HSFA 3BISA 2Y5TB 4JREC 1BHGA 1BVLB 4G6AD 3GKWL 5KSBB 3VD7A 3QO0A 3KPNB 3U36A 3UZEA 3VXNB 4EDWL 4NCDA 1T1YA 1S8DA 4DW2L 4RX4A 3ZKSD 3PL6D 4OT1L 4UB0L 4U6HA 1WF5A 1ZHNA 3QQ9D 2C4FU 1A6WH 3FQWB 2FEEL 5B22A 3S96A 4C83B 2Z93B 12E8L 4EBQH 2Y7QA 4LCUB 2BVPB 4LK4A 1D6EB 1LO5A 4XZUB 1AR2A 2VZVA 5MERB 1VFAA 4LCCC 4PJGB 4AQOA 1C12A 1IC4L 3KJ6L 2E3VA 4N68A 5D8JL 2DQUH 3MXVL 4HS3A 1D5BB 1ZEAH 4OF0A 2V9QA 4O9HH 3P9MA 1KLGB 5FYJL 1E4XH 1XGRB 1YY9C 1I3GL 3MR9A 5J6HA 5FEBA 3WKML 1FAIL 4LLWA 5DF0A 2BSED 4CADB 2FHCA 1L9NA 4ZSOE 3EDKA 4YDIH 1U8HA 3VXPB 1PSKH 1IQDB 4LNRA 1AJ7L 3V6OA 1MCHA 1TITA 3PWVA 5I17A 1IMHC 5HYSB 3NTCH 3QI9A 1RZKL 1F97A 3LEVL 4KDTC 4JGMA 4ZXBA 1AQKH 4OGYH 2NR6C 5E8DH 1EEYA 1ZANL 4E42B 3W5NA 3C8KB 3DVGA 4K7PY 1P4BH 2V7NA 3QSKB 1J1OL 2HVKA 4JPWH 4L8BB 3W82A 3QFJD 1K4DA 4PGDB 1A22B 1WWWX 4HWEL 3OR6B 3TNNA 5MP6L 3MBXH 1SHMA 3QUZC 4YAQB 1MJJA 4I18B 1BM3L 2CKNA 5ITFB 2KQNA 3X14B 3QUYB 3JV6A 3TO4C 4LLQA 4DVRL 1NCWL 3E8UL 3QH3A 4JFPA 4XI5C 1MNUL 3HLAA 3WKNA 5SWQB 5DRZA 2MWCA 2VLJD 2BHZA 2X4SB 4X5LA 4I77H 3VXSB 4ZUTA 3BO8A 1G7IB 1RK0A 4OGYL 1FAKT 2XG4A 4OI7A 2JELL 2R8SL 1B6DA 3GJFH 3FRUB 2CJUH 4FQPA 1JI1A 3GIZL 1M6OB 2GY7B 3HC0A 2NXZB 3L5XH 5GS0L 4M1DH 2LTQB 3BQUC 2VLMD 4QRPA 1M1SA 2DN7A 2HVJB 1N4XL 3RZCC 2YD9A 4R26H 4R4ND 4OV5A 1MPAH 5JW4Q 2PO6C 3CCHB 3PABA 4YHML 3SGJC 1MAKA 4PJ9A 4CN4A 4QHLA 2NY1C 1U0QA 1NBYA 1F58H 3HCVA 4KXZH 5A1AA 3LMJL 1EUTA 3HA0A 4ZS6D 2K9UA 4HIXH 1TDQA 3TJHC 1FNEB 1BFSA 4CBPA 4PRHD 5J3HD 2HT2C 5C07E 2XACC 4J1UB 2WBJD 2HG5B 3A6CH 4KKAD 1BD2D 2CJUL 5KTEL 1N26A 4PJEF 5B4MC 5IQ9A 1Z3GH 3OGOE 5KVGH 1F3DJ 1KJ3H 3DIFB 3ZDXE 4UI2A 2CUHA 5C3LD 5I8CB 3UZVB 3P2TA 2WQ8A 4JPIB 4HUXB 5BO1H 4Y1AB 1AXTH 1BFOA 5DTFB 5CLTA 3MRGA 5FKAA 2B5IC 3TBVB 4Y7MA 4LEXH 4YPJA 5F7DB 4ELMF 4OLWH 4PJ5D 2VXSH 4U31A 5C0ND 1K3ZA 3VXUB 1OARH 1UM6H 4HIXL 3SQOH 3EO0A 2AGJL 4PGEB 1XCQB 3K4AA 4UT7L 2UY7A 3ETBF 1Q94B 4FQQB 2VWEE 2ESVD 1LK3L 1SEQH 1WWCA 1GSMA 4H1LG 3HKFA 4LLMA 3BKMH 3KPQA 4NKDB 4PJ8A 1V7NH 3PNWA 1YPZB 3QDJD 1KJ3L 5I1DB 2NX5A 3CFCL 2XQBH 1RZGB 4HCRA 1NLDH 5C2UB 3MNVB 1A7NH 3IDIA 4U1JB 1QVOA 4DTGL 4Y19A 4U0RC 3K4DA 4XP5H 2IANE 4Y5YA 4KWUA 1XIWD 4YHYB 5BRZD 3MV8B 2FD6H 3KPSB 2DKSA 3S34L 1UWXH 3KPRB 4N9GA 2VERN 4TULH 4X7DC 4JN2A 4S1SH 3MRJB 4OKVA 3V5KA 1F13A 2P46B 3FN0H 1G0XA 1NMAH 3BP6A 3S37L 2FWOB 5C0EA 2XTJD 3G5ZA 1IZJA 4MJID 1MCJA 5GJSH 1F11B 4FRWA 4QRTA 3BUTA 3SCMB 2Y07L 4NRZB 4JREB 5FYJU 3O8XD 4H5SA 1HH6B 3UX9B 3P0VH 3DWTA 4YDLC 3O6KL 1BLNA 1I8LA 4G9FD 4N0UE 2F5BL 1DVFC 1A7NL 3WBDA 4NUGH 1JZ8A 4KRLB 3I2CH 4HG4J 5DI8A 3S88L 3PWPE 2V2WB 4WV1A 1XGPB 5JOFA 3OKDA 3QNYA 4BQBA 3U82B 3U4AA 4LBEB 1JGDA 4WHDA 2HFFA 4OFKA 1S5IL 4P3CH 1WJ3A 4W6WB 2W9DL 3BVNB 3FN0L 2IALA 1P84K 1SBSL 5DRWA 3GSRA 3SBWC 4LCCB 5GRVL 3FO9B 2QSTA 3OF6A 2G2RA 4LKXA 5D2LB 5ICYB 32C2A 4N9OB 5JO5A 1OWRM 5EC1B 2LFGA 4K2UH 2CIKA 4OLZH 4KVCH 1NKOA 4ODWA 4NJAL 4HF5H 3U0PA 1KJ2L 5F9WC 3I6KA 2AQ3A 3BP5B 4AEEA 4ZUSB 1QHPA 1E27B 2FJGA 2Y36L 3QIBA 5H94A 2DWDB 4WU5B 1H8NA 6FABH 4NQSA 4G8FA 4P3CL 3VFNB 4DOHB 4TYUA 1ZA3B 3DUSA 1RUPH 2P5EB 1FZJA 2B39A 2X1WL 5MEQA 4DGIL 4P59H 4HIIA 3RUGB 4M62L 2W07A 1IAOB 2CLVA 4LCWB 1VA9A 3BX7C 4Z7WB 4YBHA 1N3NB 2VXTH 1GPOH 1ZHKA 4OCNC 4RAVA 4OLEA 4GW5B 3BHBA 3O0RH 4L3EA 3V8OA 4OZGA 2AXGA 3HNVL 1IM9A 5EBMB 1MFNA 1KELL 3EJJX 3FQNA 2AEIT 3TVMC 3L3DB 4RQQB 1M7XA 4HF5L 5C8JB 4JLRB 4PUBL 5ISZB 3QXAA 4M6ML 2ITCA 3TT1L 3MNZB 4NHUB 3QUZB 4JFFA 4WFFD 3IFPB 1RIHL 3UTZB 5DMKA 2YD4A 2YEZB 5FOBB 5JHDE 1AIFA 1B6UA 1P4IH 5DJ8B 3BPOB 3QISA 1CT8B 2NYYC 3TO4B 5BXFA 1U8KB 2DRUA 3DX9B 3MYJB 4HIHA 5DUBA 3LN9A 2OJZH 4X8JA 5J0BA 3DETD 5D5MB 2A83A 5DVLA 1PEWA 4Y0GA 3P77A 1GPOL 5HGHB 5DQDL 3KGRA 2BX5A 1XGTB 1S9YA 2Z92B 3O0RL 3VI3E 3NCEB 5IK3B 3QDGB 2YPLD 3MRIA 4Y4HA 1ZGLA 5I1IL 1GOFA 5LCVH 2E9BA 5KW9H 3BQUB 4RGMC 1IEBB 5D7IA 3BPLB 1KPUA 4QRRA 4L9DA 1L7TL 3RZCB 2PCPA 4Q0XL 4JFEE 5HDBE 2PO6B 3RDTD 5DYOA 1A8JH 3CSYA 2HWZH 1OCWH 5FK9B 2Z0BA 4HV8B 1I4FB 5C0RH 1NDGB 3GIVA 4HS8H 3HE6D 4PGZA 2YRLA 1LNUA 2BCKB 3O3AB 1I1FB 4OGXL 3G5XA 1HQRA 5C0DA 2QQLH 5LGHH 4PTUA 4XX1E 3BD5A 4NC1E 3QXDA 3F7VB 5DC4B 4TUOA 1HHHB 5KW9L 1E6OH 3PV6A 4I8DA 1UCTA 1JGUL 5C09E 1UM5H 1S7VA 4HUWA 3MA9L 2VAJA 5TDOA 4PV8A 4HLZH 4N0FB 4YUEL 1NFDF 2HRPH 2C7UB 2B5IB 4HS6B 3NCCB 3F6IA 4TSCL 2B4CC 2YD2A 2HJLB 1U8QA 3U7YH 1DLHB 4HAGA 4XPTH 3VG0H 4GRMB 5FUOH 1EH9A 4MYWB 3EBAA 2EYTB 3FQXA 3AMLA 4HJJH 3VXOA 1DR9A 4FQ2L 3U9UA 3ULUL 2BXYA 5D7LE 5C6WH 5IW1A 3LB6C 1I8KB 4HPOH 3PUCA 3E3QC 3ZTNL 4U3HA 1MFBL 3MLWL 1I9RL 3VA6A 15C8H 4GKSB 4XBGA 1Z5LA 1T1XB 2XG5A 3O9WC 4UZGA 2CSPA 3QIWD 1YEKH 3MOQA 4U1NA 4P5MA 4JFDB 4R2GD 3RWIB 3SDCD 2BNUA 3C8HA 1H3VA 4HMDA 4U0RB 2LABA 5E24E 3FOMB 3IRPX 1TLKA 1KCRL 2OQJB 3PIQB 4IS6B 3C5ZA 4Z7QF 2Z8RA 2UZIL 5EBGA 5CD3A 2ZUVA 3G6AA 3WNOA 4KROD 3T2NH 2IBGA 3O2WH 3P4MB 1KB5A 1FBIH 4Z77B 1AD0B 4K55A 1DQQB 4N1CA 3TNMB 2HKHH 1HHIB 3REVB 3O6ML 1Q9LA 4BSJA 1OAKH 5MEOB 3BRGC 3CXDH 1G9MH 2Y06H 3FN3A 4WCYL 4B41A 5IB2B 4YDLB 4WHTA 3ARFA 4W81A 4HPYL 1R3JB 3UTTD 5CIPA 1T0MB 4LSUH 1DVFB 5T5FH 3BEWB 4YDJA 4LSPH 1CDIA 4OD1L 4JZJA 1HIML 3ZE1F 1IC7H 2XA3A 4IJ3C 2DLIA 4ORGA 3CC5B 3AB0C 3VMPA 4Z76B 3TWCH 5B38B 3MV7E 2EH7H 4TUKL 5F7EL 4KKAC 2AJUL 3T2NL 3MRFA 4NZJA 5KN5A 3MZGB 1MY5A 3O2WL 4UU9A 1RJYA 2OR8A 4F7CB 5ACZB 3HC4H 2F53D 3LKNA 2GT9A 1WBXB 5E95B 5L0QB 2VH5H 5IP4A 4RFOL 1J5OH 2IQ9L 4MNGB 4PJGF 5E56A 3BKJH 3ILQD 1MIML 4U1SA 2H2SD 5MI0C 1JK8A 1KNOA 3FQUB 2IC2A 1LD9A 3SEPA 3DMMA 1NGWB 2ZNXA 2FX8L 1J1XL 3KXFA 4YK4C 4YHKL 3FONB 5B3JF 3SGEI 1QQDA 3V0WL 4ZFOB 1PAMA 5JOPE 2MCPH 4LDLB 1JMZA 3L1OH 5KG9A 1EERB 3BRFA 4WFEE 1KTDB 3VXMB 3DGGA 3M17B 1KENH 5CBAA 1WIOA 2X4TB 1DN0B 4NKQB 4EIZC 1D9KD 1YEIH 4ODBD 2CKBH 3HNSL 1WFNA 1UVQB 4QLRA 3LN5A 1YC8A 4OD2A 1W8NA 1M7DB 3N1PC 3TVMB 1XIWC 3O3DA 1JP5A 5C08D 2DWEB 4G6JL 5E8EA 5CHNB 3MRPB 4WTWA 4YDVB 4QHNA 4XPFL 4JKWA 4JKKA 5CJ5A 4GBXA 2YC1B 3G6JB 5E2TL 3B8SA 4AY0A 1C08B 3QQ4B 5B3NA 1J8KA 5EOCJ 2AJZA 3PGCB 5DT1H 1B2WL 1EIBA 5FHBH 2BFVH 2DM2A 4WTZG 9CGTA 4WUUD 2ZJSH 3B2VH 3U7WH 5JPNB 5JW3L 2QHRH 3ARZA 4RGMB 4PTTA 4OUOA 4TNWK 3GM0A 4KKCD 4AIOA 1K2DB 4PG9A 2BVEA 4ZS7L 2UWEE 5FCUH 5I1GL 2RFXB 3T0EA 5CEZH 1XMWA 5JZ7D 2H8PB 3WXVL 1EO8L 3PGDB 3ARRA 3RIAF 5EC2B 3D39B 3OAYK 4F7EA 3QEUA 2Q6WB 1TETL 4NZRH 4TVPH 3UTSA 1RIUH 2BRRL 3RL1A 1ND0B 5ANMB 5FHBL 2X09A 1MHEB 3PQYB 4OGAD 2ZJSL 5FYLE 3U46A 2O5YL 5DA0B 1BGXH 2H6PB 3WL9A 5T1DH 3OQ3B 3U30B 3WLBA 4MXQD 5IROA 4YH6A 5CSGA 3V4UH 3K4ZA 4N8PA 4WDIA 4HIJB 3BEVB 4JHBA 4PREB 3GSNA 4QO1A 1L7IL 3B6SB 4PRDB 2I07B 4IBLT 4PLNC 2YWZA 3IDJA 4S11A 4KI5E 4DGVL 3ULVD 1NUFA 1I9JL 3GMNB 1WK0A 4NKIH 5IIEA 1ZSDA 3SOBH 2HT3D 4DCQB 5ECJE 1ODAA 1FZMA 3KPOB 1RIUL 5DD3L 4AEIL 4CW1A 4NJ9L 1G0YR 1S9VA 5DQ9B 3C08H 1CICD 3D3VD 2I9LB 2UVEA 4FFYL 1IKFH 3UBXA 2XKNB 4PJDB 1A7RH 1UM4H 3GHEH 4KKBD 4XX1G 2KQMA 35C8L 3BH8B 1T4KA 5D1QC 3S5LB 2BK8A 4LSSL 3O9WB 4Y4FC 4HC1H 3HI1A 1VB9A 2W9LA 3B9KD 2W9EH 3BD4A 1CZ8H 4FFVD 5HGBA 2V5YA 1AGFB 3WFCH 3WXWL 5I76B 3C6LA 3UPRB 3CX5J 3B9AA 4BQ8A 2HJKA 3BZFB 3I50H 4R7DB 3U1SH 5JR1L 2Z35B 1EAJA 1N59A 1LEGB 3RZWA 2CPCA 3L5HA 5AUMA 1FYTA 1FIGL 1RULL 2Y23A 3MRCA 1AQDA 3QXTA 3LKQB 3BKCH 4O00A 1UB5B 1FL3A 1K8DA 2E7MA 3UC0L 1CE1H 2AK4A 4DZ8A 5IMLA 3EOTH 3MUZ1 1ZGLP 1U6AH 2QHLA 4PBXA 1EGJA 3V8CA 3WHE0 3IDMA 3M8OH 2ZUQC 1IGJA 4QRUA 3QO1B 2JF1A 4OM0H 3VXQB 2HLAA 3E0GA 3QA3A 3KPLA 4MXVF 1ITBB 1AD9A 2EECA 2EKSA 4IJ3B 1HKLH 1K6QH 1FFNB 4K3JL 3P73B 1R24B 2Z4QB 3NFNB 4I2XB 4D2NA 2CMRL 4JFYB 4JRXE 3CAFA 5FDYA 1QSFD 1QLFA 4GH7B 1U8NA 4FZEL 4XVTH 2X4NB 1A6AB 3IXTB 1H5BA 5IWLA 2IG2H 2GK0A 1JZ5A 3G04A 5JW5B 4EOWL 1YEFL 1OW0C 3ARDA 4XC3H 2LVCA 3SE4A 1TNMA 2NY5L 3WE6B 3PWJA 5C0GA 3TZVB 1UADC 3MCLH 2P8PB 4CMMB 5BS0B 1GHFL 5ISZD 2VN7A 5MI0B 1I1YB 4YHIA 4HGKC 2AJ3A 2DDQL 4MA8L 4NDMB 4JE4B 1K6QL 4YK4B 2FLBT 3AFLA 3ULVL 2CXKA 2HJFB 2C5DC 4XVSH 5GS1C 4XAKD 1JZ3A 4JAMB 3KDMA 3B9VA 1XF3A 5CGYC 1TVDA 1F2XK 3H2WA 1A9EA 3VWKA 1FNAA 1YEJH 4S1RH 5EB9A 3SE8H 2YN3A 4E41A 5CCKH 3VXRD 2R1YA 3RJDA 2VUOA 4XMKL 3ES6B 1QO3B 4LQFH 5E00B 4Z7WF 4KUZH 4R2GC 4M7ZC 4EDXB 5I71B 4YGAB 5EULV 1NGYB 5FM5M 5I30L 4JEGB 1LDPL 3F6LA 3ARBA 5JDSB 5DUPH 3MOBH 2XY1A 3U2SB 1BX2B 3X3GH 4XBPB 3WS3B 2XZQL 1DANT 4U1HA 1HSAB 1T5XB 4WY7L 4A6YB 4XNXH 4PB9H 5F3BB 1AXSB 4PB0L 4QHUA 5CSZA 4AIZB 1YJDC 4NQCD 5EDXA 4M3JA 1CR9L 2D0FA 4LKCB 4ZFZA 5E5MB 5IJVB 5F72S 5C07B 1ETZB 3SE8L 3MRQB 4ZNEA 3DO3A 4PRAB 5BV7H 1RFDH 1OQOA 4K94H 3QWOB 4LQFL 3WS6A 5D5MF 5KZCD 3C5SB 2J8UE 1VPOL 3MROB 1OGAD 3CUPA 4XVJH 3W39A 4CDGC 4KJYA 3CXHK 1BFVH 4C56B 5GIRB 1N8ZA 1TCMA 1I7TB 4JCLA 4JRYE 1CGYA 4MJ5B 3UZQA 2JIXD 4KRMB 1PY9A 5AZ2L 2FZ3B 3BPNB 3GMPB 3MLYH 1OAUH 4MNQD 4Z6AT 5IGXL 2F54A 4F7PA 1P2CB 2WINA 1P69B 5EWIL 4S0SD 1Z0MA 2YD6A 4WI5A 4PV9A 4G42B 1KJVA 1CFQB 4IMLA 3ILQC 4ZQKB 4OZFA 3GFUA 1SJHA 5DJCB 5HHOB 2JKXA 5FYKE 3QIUC 1HYSD 1B0GA 1WLHA 5AZEL 4DAGH 2DYPB 4NQXA 3FT2B 1GC1C 3DHMA 4XVJL 4M00A 3TYGL 1DFBH 5C0BA 1ZT4A 4QRRE 1QR1A 3ZZ1A 2IAMD 2IH1A 2ZUUA 4OZHE 4JM2B 4RISL 2GSIB 2NTFB 4K8RL 2VL5B 4X6CA 4LVOC 4OIAA 4WWKA 1DUYA 3NZ8B 1KULA 3AREA 4YIQA 2ZPKH 3MRRB 2RJMA 3H42L 2DTMH 4HKZA 3VGAB 1EO5A 3DI2B 4KRNA 4XP4H 4PJHF 5JQ6H 3L3GA 1WZKA 3DX8B 4V1DD 4DAGL 3KYMB 1NBZB 1IAKB 4YBLB 3SJVD 4N0UB 5EORH 2XXMB 5B39G 2CO6B 1RHHB 5D1QB 1SJVA 3LS4H 5EH1A 4Y4FB 1OSPL 5JXED 4GG8B 2GTZB 1QSEB 3RWEB 1UYWH 2FCBA 1R5VA 5SWSE 3VFGH 1BBJA 3MV9D 1M4KA 1QFWH 3J8F7 4PP1D 1MHCA 2APWA 1JGVL 3OXSA 1HXYB 2ZPKL 2X7LB 4O4YL 5HYJE 1YY8A 2VXVH 1P9MC 2NLJA 3MGOA 5B8CB 3ZE0F 2UY6A 1DCLA 3FFDB 2W0FA 1BQLL 1DEEB 4FQXA 3UBXI 5TF1H 3S3SA 4Z7VE 4MNHA 4NQEB 5HPMA 4ODVH 3CK0H 5DD0L 1BJ1H 4O58H 1OTTD 3I02B 5DURD 1MJ8H 2O61A 1ZKAA 3RKPA 1A1MA 1B0RA 4L4VA 3U7AA 3VFGL 5IESL 3AS0A 2OR7A 5K9KA 5E5RB 1EXUB 3STBA 5K9QI 2DQFA 3MJ8A 1BQHG 3IF1A 5C9JB 3QDMD 1TJIL 3HE7A 5ESAA 1I3VA 4MX7A 1UXWA 5J9PB 3RTQA 2NY6B 3G6DL