1KYOK

Yeast cytochrome bc1 complex with bound substrate cytochrome c
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
b'DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/electron transport
total genus 15
structure length 107
sequence length 107
chains with identical sequence V
ec nomenclature
pdb deposition date 2002-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kyoK00
2R29H 5D1XD 3OKYA 5DJAB 2AKRA 1D9KB 3H3BC 5DUBA 3BP7B 4JFED 1GGCH 4MNGB 3G08B 2LV4A 2UVFA 4MD4A 2QSCL 4FQIL 1RIUH 1FVEA 2MHAA 4NJ9H 4PG9B 4F7EB 2ADFH 1U92B 2H2PD 3T2NL 4L8SC 2PTUA 4LF3B 4JY4A 3DVGA 2EDDA 5BV7H 1FE8L 3L7EB 1E28B 2X4UB 4Z77B 5ICYB 1J87A 4URTB 4X99A 4M00A 5DURB 1XGQB 3MLWL 4LARL 5F88B 4S1SH 1VFBB 2J12B 5FA3A 5ABDE 5HI5C 1ZAGA 3ARDC 3AS3A 4OZ4A 3NFNA 1G6RB 4OZFA 4UOW0 1EJ6A 5IM7B 1JGLH 4W6YB 4M7JH 4ZOCA 1J88A 4QRRD 2ED7A 4CMHC 2PYEE 3ZHDA 5IW3A 1ZHBB 5JORB 5ALCL 5F71A 1FORH 5C07B 1IGYB 1XCQB 4ZDHA 4UT9H 3LAFA 4BM7A 5F72S 1HOCB 3VXPA 1TFHA 4LLYB 5D1QA 3GSWA 1G7IA 1N59B 3SE4A 1Z5LA 1ADQH 1JNNH 4EBQH 1FBIL 1YN6A 4IIQB 4OQTH 1ZT1B 4OIIL 4M6NL 5B22A 4E41E 5J13C 3W9DA 1A4JA 5DHYB 1ZKAA 4H0IA 2NXZB 5IKCA 2OX5A 5FYKD 4JKPH 1QRKA 1NGQL 4X8JB 4XBGB 4MCZB 5JW5A 5LQBH 2DIJA 3GJFK 5MP6L 1M7DB 5E7BA 3CFJA 2IANA 4F2MA 1R3LB 1GAFL 3CH1B 4EVNA 2FYYB 2VWEE 2HLAB 3BP6A 3VWKB 3HE6C 5E24E 1XGYH 5F9JA 1P4LB 2Z8WC 3P4OB 1K6QH 4MJID 3PWJB 4O58H 5EB9A 1NKOA 1C7SA 2GTWA 5GGSA 1H3GA 4XNUL 5DS8B 1YMME 3VA2C 3DTXA 1YNLH 4KMTL 4G7VL 5GRYA 1KOAA 4ONHB 4HZAA 2FO4A 5FHAL 4AH2B 4Z5RA 3VI3F 3W2DH 1T1WA 1F3JA 3C6LB 2UYLA 2Y06L 3D0VA 3JTTA 4ODVL 4XVSH 1JGDB 3C09C 1DVFB 5KBNC 4DZ8A 2HWZH 3ZDZE 3PL6C 3TT3H 1W0VA 5GGSY 7CGTA 4R90H 5ESQB 1AH1A 4DGVL 1JZ7A 5MHSD 4HJJL 3AU1B 5J4MA 5J11B 4J23A 2J4WL 4S1QH 2OK0L 5IV2B 3FO9B 3N06B 1H9VA 5ERWA 3IJYB 3KGRA 1XIWA 3H3PL 4P2RD 4JPKL 3REWB 2A9NL 2J2ZA 3IFPB 3L5WA 2ZUQC 1DR9A 4I1NB 2E6QA 5E6ZA 3PWPB 1A7QL 3QUML 3QXAA 3B5GA 3GMMA 4NQEA 3WDIA 3TF7C 2FH8A 3AGVA 2L0DA 2P47B 4LCWE 4Y4KC 4NO0A 3E8UL 1FV1A 2O26U 5T3ZL 4YHKL 4GXUN 2FHCA 4W81A 1X5ZA 43C9B 2YWZA 2NY4D 4PRHE 3RGVB 3EFFA 2A0LC 4DTGL 4PJEA 3IAPA 4KKLC 3BSZH 4GUPA 4ALAH 3EYVA 3KPOA 5HDLA 4D0DB 5HHQA 3L3JA 3ZYOA 2Z31B 1FGVH 3BPCA 5A16B 3SCMA 1NCBH 3VXME 1AE6L 2JELL 5DJ2B 1FC1A 1OM3H 2EO9A 1ZGLM 2NX5A 7FABH 1DQQB 4FFZH 4JFYA 4YHIA 1NCWH 1CLCA 3AB0C 3E3QE 5JMOC 4X0KB 5D5MA 1HZHH 2APBA 2ESVE 3X3GH 4HDIA 4XC1H 4PY7B 1WC7B 4MAUH 5I76B 5D7LE 3LEXA 4AYFA 3QWOA 2DYPA 3H42H 4FA8A 2EYTB 2F19H 3TN0B 4HKZB 5IBLC 2DQHL 1JZ8A 5T1LD 5DJ0A 3BKYH 3VGEA 1YEKL 1GZQA 2DMKA 3ARGC 4PP2A 4LLQB 4D9QD 4G8GE 3F5WB 5ICZA 1J1OL 2BVPA 5F3BB 1M7XA 3EBAA 4HIHB 4NQCD 2E27H 4HPYH 2W65A 1I1CA 5C0BE 2PKDA 1IZJA 4QCIB 4D9LL 5KVEL 4FMKA 3LVEA 1YECH 3PIQA 4FTVD 3GSOA 3T4YB 2X05A 1DQML 5IT2H 5FCUH 2ARJB 5HI5D 4XHQA 2BY1A 3MBEB 4X98B 3C2SA 4U1NB 3SDCA 1KNOB 1C5BH 1G7QB 1R3HB 1P4BH 4LSVL 1RK0B 4EN3C 5T1MB 3QUXA 5DJ6A 1FRGH 3WLBB 5ILTL 4Q9QH 1Y18A 1CDUA 3SO5A 5CBEB 1H15A 2OL3A 5D71L 3OKLB 4Z78B 2ARWA 1RPQA 4IS6B 3GSQB 3OR7A 3FFCA 1DBML 2LFGA 1I3RA 3ECBA 5J6GB 1TNNA 2XYCA 4XZUA 1OAUL 5ISZE 1WZ1H 1CD8A 2HKHL 5DQ9A 2DQEH 4GW1B 5SWZA 1M7IA 2PXYA 4K3JH 4F9LA 4JPIA 3MLRH 3JWDC 4ONFL 2R0LL 4KWUA 3TH4T 4XP9H 4H0HB 1UM4H 3F7RA 2DTMH 3SDAA 4P5TB 4PJ5A 5BW7C 1KB5A 2DF3A 5AD0A 2E9BA 2X6MA 1XR8B 1MFAL 1XF5B 4IRJA 5GRXG 2X41A 1IVLA 5HYIA 3HI1B 4OSUL 3K4ZA 2KH2B 2VDMH 4NO2B 3CXHJ 1ZK9A 3QAZC 1NGZA 4UDTB 3K81A 5C0FA 3VFVB 2EDNA 3BP7A 4C56E 1QLRA 2DB8A 2GW5A 1H3XA 3G08A 1K8DB 4QHKI 1CLOL 3QDGB 5ICXB 1FCGA 3VFPB 2WM0A 1YC8A 2SEBB 3JV0A 4XMLL 4LFHG 3RIAF 3VFRA 4YX2H 2ICWB 1U92A 3PL6D 1JYXA 2CK0H 4Y4FB 3H9ZA 3FQXB 3U9PL 2ADIA 3P9WB 4Y8DC 1TZGH 5IJVB 2X4UA 4Z77A 3GI9L 5HHVH 1Q9WB 5KAQF 2ZCHH 2CLVB 3JWOH 2ADJB 5MENB 1AGDA 1MCOH 5EU5B 5FXCH 1JHTA 2AK4E 4A2LA 1QSEE 4JO3L 3RY5A 4XMKH 1XZ0B 3VH8G 1OWWA 3RAJL 4ODSH 5DI8B 1F00I 1JI1A 5IM7A 2FIRT 4KK9C 4RMUA 5F6IC 1BD2E 3VI3E 4WFGE 3FQTB 4L4VE 4NPYB 4QGTA 4Y4KD 5E1AB 1P7QB 3DX6B 3DROA 4LRNL 2MKWA 1IGYA 1XCQA 4BQ6A 1SVCP 3MLUH 4NQDA 3I2CH 4PRIE 1HOCA 1UFUA 3MR9B 3OF6A 4LLMB 4X7CC 3BP5A 3B9KA 2A0LD 3A6BH 1OW0A 4IIQA 1ZT1A 4QRTB 1DQDH 1GZPB 5DHYA 4AIOA 1OHQA 4OIBA 1SBSL 5D1QC 5E56A 5I0DA 2FECL 5IR1B 3CCHB 4N8VA 3SE4C 1H8SA 4XBGA 4M3JA 5DC4B 1RMFL 1HEZB 1M7DA 4ONGL 5I16A 4HAGA 3QIUB 1R3LA 3K46A 3I9GH 3CH1A 1HH9B 5F7KC 3M8OL 4QTIL 2JJSA 4OV6F 3BDBA 3VWKA 3TNNB 1G1YA 3LRGA 2XRAH 2PW1B 3DSFH 2WINB 4B53A 3LMJH 4GAFB 1NC4B 5IVXB 3CSPA 1DBJL 4MXQC 4E9LA 5IBLD 4KI5C 3MRMB 2AQ1A 2ZNXA 2P5ED 4KDVA 3ARGD 5DS8A 3QEUA 5IBTL 5B3NA 1X5GA 2ITCB 4I3GA 1INDH 2XN9A 4GKZB 1TNMA 5I1GL 1J8HA 1J0YA 5T5FL 5L88L 4HGMA 4Q2ZB 4P2QD 3C6LA 1NC2A 4LCYB 1DVFA 5DDHA 3EYOA 1TZHB 5A2FA 3MNVB 3BJLA 3ZHLA 3QHZH 4Z7VF 3ZYJA 5DRWB 3GSUA 3QDMD 5E8DL 3AU1A 4CADB 1KBGH 2XTJE 2BSSB 3F7VB 5IV2A 3NFPB 3FO9A 1QRND 3I6KA 1OAXH 4XCYB 1A7RH 2FJHB 2GIYA 5DLML 1ND0A 5TE4H 4EN3D 5D2LB 3NAAL 3SGKA 1N6VA 1SJVA 2EEBA 4ZFFB 2X1WL 2R0ZH 2JB5L 5IW6A 4JDZB 3ROOA 1N64L 4IMLB 4OI8A 3PWPA 4MA1B 1NGWB 2ED9A 5HHOB 1W72B 2GJ6B 2M2DA 4F33A 2VZSA 4RNRB 2E6JA 3NACL 1S9YA 1XIWC 4G9FD 4OZHF 2VXQH 3U4AA 4G80A 2D7MA 4PB0H 4QOKE 2GAZB 5I1AB 1T03L 4PTTB 4TSBL 4G6FB 4WI4A 3WNKA 3QIWA 5EO1A 4OCLC 3KPRD 3UAJC 5KANG 1MFEH 2EC8A 1RY7B 3N9GH 3RGVA 1NMCC 1FO0A 4G43B 4D0DA 2R29L 4S1RH 2Z31A 2DJUA 1XAUA 5A16A 5GGRB 3K8KA 1QSFE 2VDNH 5DJ2A 4H1LG 4FZ8H 4KRMB 1AKJA 4QHLB 2HJLA 4FQ2H 1RIUL 4NKOA 1Q8MA 3MJ9L 3B5TA 3DXAA 2E7CA 1O5DT 2C3VB 3RZCD 3C2AL 3VFWB 4X4ME 2HRPH 3TIEA 3NOIA 5DJXB 3RWEA 3MRGB 1WC7A 3WD5L 3C5SA 3QXDA 4NWTH 5BVJA 4K8RL 3NBNA 5F1OB 5FYLL 4Z9KB 3V79C 1MHPL 3TYGL 4PJ7F 4AQ1B 2W38A 2YRPA 3QZWG 3QEQB 2MPAH 1LK3H 3STLB 1BGXH 3BVNB 2V2TA 5ID1A 4M7JL 1OP3K 5FGBA 4K23L 5FUOH 1KPUB 2E8YA 4LLQA 4WW2B 3F5WA 4Q74A 1FORL 4FQHA 4O2CA 3UTQA 3QCUH 5J89A 4UT9L 3SDYL 2J8UF 2XZCH 3LH2H 1JGVH 5F6HI 3O41A 5AWNH 2FX9H 2V5SA 1JTTA 4ZPVB 1ADQL 4EBQL 2X4TB 5EA0L 3UTSE 2AVGA 2Y5EA 5E8NB 5EU6E 1QYGH 2ARJA 1OAYH 4U1NA 4AEIH 3HE7A 4LKCA 4KK9D 2DM7A 3UBXA 1MJUH 1R3HA 4Q6YA 5E4IA 5I71C 4CVZA 5MEPB 5LQBL 1MFDH 4HKBA 2B4CH 3SDCC 5CBEA 5IIEB 2Y07H 3OKDB 2Z92A 3KHQA 5I9QB 3VXSB 5K59F 5IJKC 3LQAC 2NNAB 4RX4D 1BQLH 4NQXA 4UTAH 2CXKA 3C5ZB 1QBLL 3L3DB 4LPWA 2Q8AH 4K71C 2J8HA 3MJ8B 5KSBF 25C8L 5LWYL 5L2KB 3NZHH 4N0UE 4FQ1L 1IAOB 5CEZD 3ZTJH 1AGFB 3OB8A 4Y5VA 1YNLL 2O93L 3U48A 1N6UA 4M1GH 1KXVC 2RJMA 3O8XB 4OCSH 1AI1L 3PG2A 4JM2F 1FSKC 3QWQB 1QA9A 3W2DL 3UPRB 4PJGB 2ENSA 4XVSL 1PGRB 4XC3H 3MRHA 5C9JB 2HWZL 1CLYH 3OJDA 5FCSH 1F4WL 4F9LC 3K80A 4MS8C 2ADGB 4R90L 3S35H 3QUMB 3HI1A 4MXQD 3FONB 1WT5A 4KI5D 2HA1A 4GS7B 4HS3B 2YWYA 5L2JB 4LAQH 3MUY1 4LVOB 3ZKMC 4UDTA 4IRJC 3VFVA 4XPHH 3VW3H 1RU9L 3E6FB 4JFQA 1NGPH 5J57B 4KTEH 5ICXA 4CVUA 3VFPA 2SEBA 4GRLB 4NZDA 1ZXQA 2EH8H 4FP8L 3FN0L 1Q9KB 2DQJL 5FECA 1D9KC 4R4FL 2F53B 1ZEAH 5EZOH 3RDTB 4WW1B 2H32A 2X4OA 3LN4A 5FO7A 3Q3GB 2CIIB 4PJFB 3P0YH 4WWKB 5DMGC 1Q9WA 3KYKH 1CD9B 2CLVA 3KLDA 4KVNL 3V6OC 3L6FB 5MENA 5EFIB 4ALAL 4KDWA 1IEAB 4M61A 3VXRA 3DPBA 1FGVL 5H94B 3U4EB 1BECA 2YK1L 5J56B 4KVCH 4X6FB 3UROR 5IB4B 4JRYA 4RQQB 1IAKA 1J1PH 4U6VL 1NCWL 3I85A 1P7QA 1NMAH 4YQXL 4Z7VE 4QNPF 4RGOL 2JKXA 1DBBL 2VZVA 3MR9A 1CF8L 2QQNH 2O5ZH 4MAUL 3UAJD 2DAVA 2WLYA 5DJDB 2AI0H 3ARBD 3KS0H 3EHBC 3GKZA 3HLAB 3QEGL 2BX5A 1GZPA 4ELMB 4ESKA 5HGGS 2EIEA 1RZJL 1F45A 4NNYA 3WXVL 3F7YB 2F19L 1HCFX 3ZSTA 4OBRA 3OKEA 4GRMA 5IR1A 3CCHA 4M1CD 4OLWL 1X9QA 3WFCL 4RFOH 3SE9H 1OW0C 4LHUG 4IBLT 4IIQC 4PJXB 5GRVK 4OZHE 4ZQKB 3ILQD 2QR0B 4OCWL 4WI5A 3Q6GL 1S5IH 3MV7A 2X2YA 2NX5D 5CILL 1NCNA 3LEVH 4ZFZA 4XGZA 3MNWB 4J3TA 1YECL 2VJXA 3ZLQC 1VHPA 3D0LA 3GSXA 4U3CA 4PBVC 2PW1A 4M7LH 4PYGA 3MCG1 4UT7H 4HPOL 4CU7A 3BP4A 2FH6A 1JN6A 4OI9A 4JHBA 1AC6A 2FIKB 1NJ9A 3DRTB 4BK4A 2WP3T 3VWKC 5JXAH 1T1XA 2ITCA 1Q1JL 3BGMA 3TBWB 3TO2B 4J8RB 4PV9A 1MH5B 4PJBB 1T0MB 5C0IA 4ZXBD 4X5WA 5T1KD 1YYLH 4HJ0C 3MNVA 3MRFB 4QHMB 5B8CA 5JOEA 5FYJD 3CAFA 5IK3A 1NDGB 4M7KL 1ZVSB 4PJ7E 2IF7A 1FLRL 3WXWH 1AJ7L 1UH3A 2FB4L 3QCTH 3S37X 3UCRA 1WGOA 1KPRB 2VLRE 1DL7H 5DFWH 1F4YH 3NFPA 3C6LC 4LLWB 4LQ1A 3CZJA 2DQEL 1DVFC 2LU4A 2FATL 3F6LA 1MCSA 3GKWL 1PDKA 4YDIH 1FH5L 2GSIB 2YN5A 4OD3H 4X6CB 4JDZA 1AXIB 3SDCD 5J11C 3D18B 1MUJB 5ACMA 3OKKB 2J8UE 1PG7W 2DTML 4ZD3H 2QHRH 4RNRA 1D5MB 3SGKC 4JAMA 1U3JA 5HVWA 1B0WA 3ORJA 2ZOLA 1IM3A 2QADB 2GAZA 4EI6B 1F90H 4LMQE 2BHUA 3F65A 3HG1A 4PTTA 4JLRB 2AJSH 4M5ZL 4NN5B 4OLYH 3EYFA 4HSQA 2R2HB 1KC5H 3RPIB 2EE2A 4YPGA 3FFCD 1DLHB 3GSNH 1HE7A 4DFIA 3EFDH 2ORBL 1MJJB 2JIXA 5EU3B 5GS0H 3D39B 1QFHA 2NW3B 2P8PA 1KJ2H 3O6KL 3QIWC 4RAUB 3B8YA 3U2SA 3LKSB 3RGVC 5K59E 3O6LH 2YD5A 3C8KA 5GIRA 2Z31C 2C9AA 4MS8D 3VFWA 1LEKB 3ARVA 2DQUH 2X1OA 1CXHA 3EOAA 2YD9A 2AEPH 2GJZA 1LVEA 5KSBE 3MRGA 4U1HB 5E8PB 1VPOH 1ORSB 2AQ2A 2DBLH 5HHVL 3C08H 2Z8SA 1MCOL 5T33H 3ZKMD 1JWUA 4IRJD 4JJ5A 5IFJB 3DVFA 1CLZH 1J0JA 3BVNA 4DCQA 4TTGA 4ODSL 5FUCC 1EGJH 1MLCB 4G42A 2A2QT 4EZMA 3E0GA 4Q9RH 4YE4H 4YO0A 5DHVA 4ZFGH 1CTOA 1D9KD 4UT6H 4RFEB 3TN0C 4G3YH 1RZ8B 2H45A 4H8WL 5EH1A 1BVLA 5FGBC 1BQSA 5DMGD 3GRWH 1BOYA 3G6DL 4ZPVA 2Y23A 3WN5A 3FT4B 4DGYL 4WHTA 3A6BL 4CU6A 2X4TA 4GBXB 5FIEA 4OZIB 1DQDL 2Q6WA 5C0AB 4M6OH 3THMH 1C8PA 3BE1L 2ZUXA 3MJGX 2J88H 4JPVH 5DURD 5KSUB 3GB7A 2ICCA 3QSKB 5MEPA 3BKML 4C4KO 3ULUH 2WLZA 3MBEC 4NRYB 4HD9A 5IIEA 1OTSC 4OCXH 3IDJB 4QLRA 3HE7C 3PDDA 1YEIL 3E1F1 3VXSA 3I9GL 1FYTE 4PRDA 4UAOB 3VCLB 2NNAA 2X4RB 1MIEH 2Q7NA 2VR4A 1OAKH 2MMXA 2B0SH 5DFTA 2MSPA 5C07D 3DSFL 2OCFD 1DBKH 5L2KA 1ACZA 3WHE0 1T4KA 1T2QH 5TJWK 1AXTH 3SKOB 2DDQL 1BBDL 5C6TH 2C1OB 2IH3B 2W9EH 1BQHG 2DWEB 3O8XA 1BAFH 3QH3B 2EDKA 2NXZD 1U2CA 4QNPE 2R39A 4HC1A 4KHTH 3UPRA 4TVSa 3QHFL 1CVSC 4KTDH 1NAMH 1REIA 2QSTA 4V1DA 2F5AH 2Z8RA 5C3TA 5AEAA 1YPZB 2ADGA 5AYUL 2VIRB 5E5RB 5GSVA 1RZIB 2R4SL 3MRRA 3P4NB 3QUMA 1KEGL 3DLQR 4WCYH 1KBGL 4CNIA 3EO9L 4P5TC 1OAXL 4NWUH 3MRPA 4HS3A 2WV3A 2XFXA 4Y5XB 5DD3L 3ZE0F 5EG6C 5DT1L 4ODXB 3VWKD 4Z0BH 5TE4L 2FX7L 3FQUB 3HTLX 1RUKL 1NBVH 3X3FH 1MFBL 1KB9J 4OKVB 3E6FA 1WT5C 5DVOA 2VITB 4BK5A 4HJ0D 1OD7A 1SHMA 1ZA6B 2VXQL 2FR4B 2F53A 3HC3H 2D7TH 1BEYL 4YHZL 4Y4HB 4HGKC 4JCLA 5GHWH 1S7QA 4WENB 2XQYG 2NY6B 3GI8L 4WWKA 1GGTA 3BT2H 3MJ7A 4F7PA 3C6LD 4HBCH 4PJ5E 1AGCB 3N9GL 2IMNA 4PPTA 1DVFD 2YUWA 4LSQL 5EFIA 1IE5A 4Y4FC 1IEAA 3LZFL 3WJLA 3OTTA 3RVTC 3U4EA 3ZKQD 2VDNL 3PDGA 4GMTH 4PB9H 5KVDL 3V4UH 1GVIA 4ERSH 2AJYH 5FKAB 2ZKHL 5GGVY 2VXVL 2ZCKH 4XP4H 2H26B 3V4PL 4KKCD 1JRHI 4XXDA 3PWPD 1QD0A 3S88L 4NIKB 4NWTL 5K9OB 3KPNA 3JWNC 5I1DA 4I77L 3SQOH 1EAPB 1UXSB 3HLAA 2I5YL 1VEPA 4ELMA 1DFBH 2BFVL 2Y6SD 3F7YA 1BGXL 3ZT6A 1KCLA 2PR4L 2YD7A 3EOTH 3VXOB 4ZOAA 3ZYZA 3RGVD 4BUGA 1CGUA 1IKFH 3VFMA 2Z31D 2R1XB 3BO8B 2VLMD 4MD5B 3V0WL 4LKXB 2CR3A 3LH2L 1ZWIB 3VMNA 2NTFA 2F9BT 3UJJH 1GHFL 1JRHH 1T0PB 3HMXH 3V52L 3PWLB 4P3CH 4U3XA 3C8DA 3KYOB 3QIUC 1JWSB 4LSUH 1UJ3B 3QJFB 4X7EC 3RJDA 2V9TA 3N1PC 3NCBB 4G7YH 3DRTA 1MJUL 4NZUL 4LPXA 4GOSA 4Q9CA 4QXGH 3HS0B 4IOIB 3TBWA 3LQZB 3TN0D 3OZ9H 1TTUA 1GC1H 2FZ3A 2Y07L 4PJBA 2ZCLH 5I15H 4P4RA 4XPAH 3VXNB 1S7XB 5F7DB 4QHMA 4U7SA 1LO4H 4UTAL 3N1GC 4EDWL 1T7ZA 4BH7B 4X9GA 2Y36H 2Q8AL 4P2OB 5F96L 4I9WD 4PG2C 4LLWA 3O4LB 4NRXB 5DYOB 3NZHL 3JXAA 1FFPA 5I75C 3O2VH 5B8CC 1C1EH 3H7LA 4K9EC 4M5YH 3TA3B 2PCPB 5C2BH 1NLDH 4PRBA 4UIMB 3MBED 3D18A 4JY6A 1KG0B 1OTSD 3OKKA 4HUWB 1YEGL 1JI2A 4XP1L 3H0TB 1N7MH 1BOGB 1KN2L 1LO0H 4U4BA 4XC3L 3TESA 4HUVB 3FB8A 5ACZB 3F58H 2PW2B 2KKQA 2VLKA 2P45B 3IJHB 1W0WA 1TJIH 4JLRA 4MA1C 5LAXB 4F57L 2VR5A 5HGDA 3ALWA 4G6JL 4HCRH 2VZTA 3DO7A 3BFOA 5EU3A 1UA6L 3D39A 2YPLB 1HK6A 4LQFH 4MNHB 1E4XI 2BNRE 4TNWK 2R2EB 2CUHA 3VW3L 5CJOH 2C3XA 4F9PA 1MRFL 5HHXL 4WTZG 1T5WA 3T1FB 4U1JB 3S34L 2BVQB 3MLXH 4N5UA 2GSGB 4BH8A 1FN4B 1UB5B 3MYJA 3VJ6A 2FWOB 5HXMA 5IMOA 4P5TD 3UTPD 1WIPA 3EO1B 4ETQB 4JFZH 1KPVB 4DVRH 2I07B 5JTWA 4L3CB 3S36H 2VLJB 3VFTA 1TPXB 5IFJA 1TITA 2IADB 3B6SB 3LPGA 3OR6A 1K85A 4ISVB 1TVBA 4KVCL 2HJFA 1P2CB 2CSPA 3TJEL 4CDGC 1OGAB 3QFJA 3G5XA 5KANI 5E5MB 5KJRH 1E4XH 1FFOA 4APQB 1EHLH 3G5VA 2ZSVB 2V2XB 4XCEB 1T66C 1PKQB 2XT1B 5IBUG 3V5KB 4AEHH 4LL9A 3QDGD 4YAQA 5I8KL 2D9CA 1G9NH 5KG9B 3LKOB 2OTUA 4WW2C 1I3VA 1J12A 4GBXA 3VXUA 4OZIA 4Y4FD 3O2DH 3OKOA 4PJDF 4HXBH 3CU7A 5T3XD 2XWTB 1UWXK 5KSUA 5EBLA 2PN5A 4DQOL 2IPTL 5MEND 4U0RB 3P3YA 1F4HA 1FNGA 1U8MB 3MA7B 3SKUD 1UENA 1C5CH 1RZKL 3G6AB 1MAKA 4MVBC 5SV3A 3VCLA 5EOQL 1EMTH 2YSSB 4Y19B 2Q76B 5JDSB 1CZ8H 1P7QD 4Y88A 3QDJB 2F8OA 5IQ9B 5A40E 1UCBL 3CLFH 4J1UB 5TE6L 3V5DB 5IOPA 4UT7L 4D9RD 1G7JA 3PXHA 4I4WA 1P4IH 5CUSH 2NY5H 1RIHH 3PDOB 4JKKA 3SKOA 2A77L 4M62H 3C5ZC 3OXSB 2C1OA 4XNYH 2CRYA 5D70L 5BRZA 3QCVL 4ENEC 3KYNA 5IGXH 1AD9B 3QH3A 4K7PH 4H5SB 1T1ZB 5BO1L 4WEBL 1FAIL 1NBYB 5ALBH 5GXBB 1V3LA 2X7LB 1EEZB 2BSTB 4ZO6A 2AXFA 3HI5H 1PZ5B 1QLFA 2AXGA 4Y8AA 1QZ1A 4XCCL 3WXWL 3O8XC 1DLFH 2XWBB 3FZUD 1GGIH 3P4NA 4Z7NF 3QIUD 1OGTB 4PGEA 1BIHA 1F4YL 1QO3B 3HFMH 4MB4A 3P73B 1MFCL 4A6YA 4R7NA 4MJIE 4XCNA 4PJIA 1EEUA 4HMDA 2BSRA 4MSWB 5CP7A 3V2AR 4OD3L 4OKVA 1NC4D 4MDJA 1A7NH 4PS4H 4Y2DA 3MRNB 4BA8A 32C2B 4GS7C 2VITA 2QJDA 4ZD3L 4O4YH 1BJ8A 2JF1A 2GI7A 4LSDA 4LVOC 5C0EB 2HLFD 1ZA6A 1FJ1A 3IFLL 5DVNA 2VUOA 4MJ2A 4QF1A 4CU8A 3P2TA 4FQJH 1YY8B 1VKXA 4LLDB 4LASH 1LP9B 1RK1B 4KK8C 1OB1B 3EYUH 5MHSE 3MJ9A 1IGCL 1K4CA 2VZ3A 3SKMA 5C0NC 1WFOA 2V17H 4FQPA 4OF5A 1YNKH 1C08A 1G0YR 3P30H 3OB0K 4GMSL 5EORH 4P2RE 4WWKC 4PLKC 4L8DA 1G7HA 5BS0E 5FKAA 1IL1B 3IJSA 4U6XA 4EIZC 2YN3A 2H26A 3O3DA 5DF0A 3BAEH 4M93B 4HF5H 3MV9B 1WJ3A 5HHOD 2ZUVA 2GJ6D 3SDXA 5JZ7C 3QJHB 3KR3H 1JYWA 1NCDH 3T77B 1UXSA 2Z4QB 2C4FT 4ZUSB 1I7RB 4ELKB 3NPSB 3OKNB 4HWUA 3SDDB 2DLFH 1HKLL 4G6FD 1CLZL 5IROA 3HZKB 4I3SH 5CMAA 1S8DB 2B1AL 4KPHH 3QQNA 1YC7A 1ADQA 2QL1A 2WNGA 4O9HH 4RDQF 1YY9C 3P4MB 1INEL 1I75A 2R1XA 3FMGH 5KSVB 3V7AG 4MD5A 4Z7OF 2VABB 4LKXA 5F7UA 1ACYH 1RI8A 2C4FU 3W0WE 3IFOB 3SE8H 4MAYA 2DWDA 5DK2B 1X4YA 5AZEH 1I1YB 1U8NB 5AYQA 2NQCA 4I18B 2HRLA 3TEUA 3KYOA 1WFNA 1FQ9C 1JWSA 3DGCR 4ORZC 5FO8B 1JF6A 1SYVB 4G8FB 4JPVL 3RUGA 3BWUC 4EQ3A 5BVPH 4GKOA 5E9DB 3VD5A 2PNDA 4NRZA 5ANMA 3ZKNC 4GAGL 4MJ5B 2IWGA 2BP3A 1QTYT 2A6KB 1KT2B 1A3LH 3QEQD 5JA8B 5JW4M 3LQZA 1SY6H 1MWAL 2RCSL 2LVCA 2VH5H 3O9WB 5GRJL 2OZ4H 3U9UA 5F7DA 3DURB 4U6YB 1FG2A 3PUCA 3QFDB 4DKFH 5TDOB 3RHWF 3W9EA 4JFOB 1MREH 1FNFA 2I9LB 4GG6B 2R0WL 3O0RL 4ZO8A 4PJ9B 3BDYH 3TM6A 3HCVB 1N8ZB 3K8MA 2WBJA 4FTVE 4P2OA 2JJTA 3O4LA 5DZNA 4F37K 1XT5A 2P43B 3H9SB 3MUJA 3D3VA 4J6RH 3TA3A 2PCPA 3SHSA 5KOVC 4UIMA 2UY7A 1CGVA 2HYMA 1KG0A 4ODWB 5CGMA 2DKMA 4MVBD 1A6VL 5EUOB 5HJ3B 3OAZK 4DJMA 1IGFH 3IU4L 4OGXH 4XNQB 4G6KL 3H0TA 1WBXA 5JO5A 4HUVA 4RGMB 1A1MA 3GZKA 5CS7A 2X4PA 2QHLA 4PJAB 2QSVA 3DECA 3IJHA 3I3DA 4PJDE 1U8HA 4WCYL 3VXSD 5E08L 3CX2A 1MHHB 3JVGA 1VFOA 3C5ZD 3LN5B 4Z0BL 3HC4H 2QADC 3AY4A 3WKNA 3X3FL 2I25N 2Z35B 2R2EA 2B1HH 2IPKB 2UUDK 2R2CA 4UILL 4ENED 3VG9C 2MCPH 1G0DA 3PE9A 4HS6B 5L2KD 1CD1B 3T65B 3V7AE 1UWGH 4KY1L 3ULVC 1B6DA 4NUGH 4PR5A 4JGJA 4NQTA 2BVQA 4Q0XL 3G5ZB 1P1ZB 5L9DH 3D5OF 1F4XH 2D7TL 5DMIH 3VMPA 1UB5A 2ZUYA 3CK0L 3O8XD 1HXMA 4V2CB 3KYAA 2ZZUT 1OSZB 4ETQA 4OZGF 1GXEA 1UM5H 1NDMB 2IADA 4PD4J 4ISVA 1ZLVH 4WFFD 2E6PA 3N1FC 1EXUA 1D5ZB 1BJMA 1P2CA 4OM1H 5HGAB 2ATPB 1A3RH 2X4NB 1CR9L 2AJYL 3BPNB 2D0HA 3H6JA 4ORGB 4RDQG 4JZNA 4RFNB 4M48H 4WV1A 5TPWL 1NUGA 3BMWA 4FQQB 1KCRH 5MI0C 1BBJA 2ZCKL 3BESR 3L5HA 2V2XA 4XCEA 4Z7UB 4PRAA 4NM8L 4Z7NE 4DEPB 4JRXB 3RQ3A 1TIUA 4ZSOE 5B39B 4KK8D 4KAQL 2EDEA 4GRLD 5KG9A 5EOCJ 3M45A 1PEWA 5ECJE 5C0ND 2G75B 2F53D 3RDTD 1DFBL 2CDFA 5GGQH 3WNMA 3RX7A 3BGAA 4HKXB 2XWTA 4WWKD 4HIXH 4PLKD 1CG9B 5GJTH 1JMZA 1KTDB 4JE4B 5EBMB 1U8KB 2R56H 3ZE2F 5GSRA 4GBXC 4OTXL 1U8MA 3VFUB 15C8L 3K2UL 4U7MA 3WFHA 4G8IB 2GEEA 4N1CA 1EO5A 4NOFA 2DLIA 1LE9B 4RBPH 1JNLL 5JZ7D 2YSSA 5I1EL 4Y19A 3B3IA 5MEQB 1X5YA 3TV3L 1CBVL 4KZEH 5ENWA 2J6EH 5DEGB 3NCFB 1QBBA 3JSSA 2A9MH 4XBEL 5I1JL 2QSQA 3CLEL 4UAOC 3MODL 1J18A 4UU9B 5DRZB 3PDOA 5A43C 1QFWM 1FNSL 4KI5F 4XP6L 3OXSA 1PLGL 1YY9D 1F5WA 4IRZH 4WUUE 3VXQB 5BCAA 4HULB 3QEHB 4DZBB 2ZCLL 4L3EA 5EZJA 3RIFK 2HTKC 1EAJA 4PFEA 1EEZA 3EJZC 5DMKB 1R3IL 4LOUC 4LSPL 4P0DA 1ERNA 1IAII 2HFGH 4JR9H 1ONQA 3X14B 5C86A 1QO3A 2EH7H 5CINL 4X6EB 2DQGL 2ZPKL 2NY7H 4YDJB 1C1EL 1ZLWH 3ZKND 1A7BA 1WCQA 5C0JB 1I7ZB 5HVGB 1FFNB 4X6BB 3SKJL 4HGWA 4OB5H 2VRAA 3S4SG 4Z7OE 3CVHH 4PY8I 3S5LB 1KIRB 4TVPL 32C2A 2W9LA 1S9XB 4LHJB 2GUOB 1N7ML 5C0EA 3BD5A 1CFNB 3I50L 2EIBA 2IBZX 1ZANL 2FCBA 3LRSB 3LKNB 3FB5B 3DO3A 1UM6H 5GGUB 5TH2A 1D7FA 4Y2DC 4HFUH 4LLDA 4C57C 2C1PB 2IFFL 1RK1A 4PTUB 1OB1A 3QDME 2CKNA 1IAIH 4KFZC 1QRNE 4V1DE 3S35X 3GNMH 5JA9A 4NNXB 4Y4HC 4M43L 5DQDL 1M1SA 2H6PB 2NY6C 2IGFH 4GRWB 4P23B 2AK1L 3L3HA 4EUPG 3QUYB 1N3NA 1JHKH 5CP3H 1U9KA 3HUJF 4NQVB 5HDQL 4HX1A 2PYEB 2CH8A 2R4RH 1SJEA 4UOJA 3MV9A 1W8OA 1JPSH 2Q3ZA 4G9FE 1OCWL 4K8RC 4JFZL 1UXWB 3T77A 4XPGH 1RZ7H 4JM4L 4JPWL 2QQQA 1BFVL 1T6WA 4LAJH 1KSRA 2QADD 3OKNA 2O5XL 5IB2A 1J0IA 3WIHL 1A6TB 5F1IA 5K9QI 3ES6B 5EC1B 5JHLL 4NO3A 1YN7A 2J8OA 1FDLL 5DK3A 4WI9A 2CDEA 5KJRL 3P4MA 5EOCH 4GSDL 3D39D 2GK0A 5J8OA 3VGBA 3VGGA 4NZJA 3MBXH 5IROC 2VABA 4M02A 4YXHL 3O4OB 1EERB 2WW8A 1DDHB 3SGJA 1H0DB 1Z9OA 1RURH 3IFOA 4U6TA 3TLRA 2CGRH 2W60B 4F7CB 4J3SA 2B7DT 1U8NA 4AIZA 1K2DA 4I18A 3B2VH 2DTSA 3FTGA 1MHCB 5IHZB 3PHOB 5DD6B 1WBYA 2BXYA 3UYRH 2XXMB 4YXKH 3BN9C 1PSKH 1ZHNA 1B0GB 5E9DA 2WBWB 5JW4N 2C3GA 1C16B 2ERJB 3HN3A 4P5MB 5DHXB 2K9UA 3D25A 3KPMA 1YMMB 3O9WA 4POZC 4PRPA 2YKLH 1JHLL 3DV6B 3CVIL 4NHCL 1ETZA 4JFOA 4OZGE 2XZQL 4N8CH 3HMWH 1R5VA 3FQNB 3HCVA 1N8ZA 5IB3B 4M1DL 1P4IL 3HAEH 2J1KA 2NY5L 3KWWA 4EIGB 1IBGH 4IRSA 4M62L 3PV6B 4GBXD 1UQSA 3FHAA 5HYSG 5C0AD 3QQ3A 4P2OC 2WBJC 4KUZL 4ODWA 3PP4H 2C7UB 2JJTC 5EUOA 1UCTA 4N1HB 1XH3A 5HY9B 1CFVL 2G60L 4XNQA 4E42A 2CRZA 4N90D 1E4WH 4QY8B 3TA3C 4U6HA 3RBSA 1QEWB 1FPTH 1DLFL 4LCWB 1GGIL 1M71A 2BOBA 4CVXB 1EFQA 4WFED 3HFML 3EJJX 2IQAB 2Z8VC 4S2SB 2EKJA 3X11B 1DUYB 1MHHA 1IGML 2VL5A 3ZE2E 4PRHB 2HG5B 3O3UN 5CZVH 2Z35A 2QEJA 4R3SB 2Q86A 2IPKA 1WBZB 1A7NL 1LO2L 2P5WE 4HS6A 2GITB 5DR5H 3BRDA 5T5NF 3VXMB 4WEMB 4YIQB 3JVGC 4POYA 3P4LA 1U36A 5I74B 3IGAB 3EJZD 1P1ZA 4LOUD 4TTDC 5D2NE 4H88L 3EYSL 3T4AB 3RWCB 4JFFA 3RZWA 4DK6A 4FQJL 1RJLB 3HZMB 2NY1C 2GY7B 2P44B 1OSZA 1C12B 2BNQA 5D8JH 1Q0YH 3R1GL 1A4KA 2EC9T 1Z9LA 3MLVL 2A83B 5D7LB 1H3PH 1T2JA 1BZ7B 3ARUA 1I4FA 2VL4A 1D5ZA 3WSQH 5HGAA 2BHYA 2ATPA 5DQJA 4ORGA 3MNZB 3X17A 5FHBL 4YNYB 4EI5A 1N0XH 2ZJSL 4FQQA 4WUKH 1HYRC 5C8JA 1WIUA 2BOCB 5C08A 5I19H 2DM3A 4G8GB 4Y2DD 4S10A 2EC9U 4JRXA 4X4XB 4Y1AE 3NA4A 5B39A 3HRZB 3U1SH 2OJEB 3MCKB 2EKSB 4APQC 4YFDB 2G75A 1RZJC 1MLBA 1T04A 1S7SB 6CGTA 2BC4B 4Y4HD 5MERA 5D9SA 2NY6D 5EBMA 3FOLA 3UJIH 5J1TC 3FT2A 4WU7B 4XP5H 3QP3A 2JCCF 4O9HL 4P5KB 4WY7H 4FQXB 1AR2A 1QPXA 4UNTA 5J06A 1N4XL 2PTTB 3SOBL 3VFUA 1SEBA 2XICA 4G8IA 1GIGL 4X6DA 1Q72L 1I7UB 4MMZC 1JP5A 3Q5YA 3MGTA 1CDCA 4L4TB 4P9MH 4K8RD 1LE9A 3MREB 3MRLB 5E4EB 5FYLD 4HWEL 3E6HB 3MRIB 1X6LA 2M1KA 5DEGA 4U1SB 1MWAB 3B5HA 1B4JL 3MLYL 1UZ8B 5FYKH 3QRGL 3D1MC 3B9DA 1UH4A 4P3DB 3OL2A 1IM9B 3VXUE 3HUJE 1FVCB 1CVRA 5I1HH 1FL6A 3QEHA 4OLXH 1M6OA 5INCA 2J3SA 5JOFB 4Y0GA 1KIPA 4WWID 5HHNA 5DJZB 1WF5A 3L1OH 3AMKA 3BH8B 1Q9OB 2EDTA 3MLTB 2ILLA 1MQKL 4YXLL 3BN9D 4NN6C 5J1AB 3CGTA 4J6RL 4X6BA 4BUHA 4F58L 3CC5B 1RZGB 3G6JA 4POZD 5HPOA 2IBZY 4F3FB 3BZ4A 3GMLB 2FEDC 1XF1A 3KDMB 2W0LA 4NBXB 2ZG3A 3MRDA 4MD0A 4PJHF 3T8XA 3LRSA 1SMAA 5IQ7L 3LKNA 2JTDA 3FB5A 5FO9A 5EO0A 3WYRA 2C1PA 3QO1B 3QNYB 4N0YH 4PTUA 2A74A 2LTQB 4FHBD 4M8QB 2F8VA 3QG6B 8FABA 5CKGA 3ILPA 1SEQH 3AREB 1T21A 1C5DA 3LS5H 4HQQL 4K3DH 2ID5A 3HC4L 1Z2KA 1BFOA 4NNXA 4MJ6A 4P2OD 1DUZA 2V7HB 2WBJD 3WO4B 1S9WB 2CO7B 4P23A 5BXFB 3CFKB 3O4LD 4GAJL 1NANI 1RSFA 1T5XB 1P7KA 3QUYA 3QWRA 2AK4B 1QSEB 1II4E 5I1CL 4PJIE 2WAHA 1QP1A 3PWNA 4OD1H 3LHPH 3GMQB 3TA3D 1NUFA 2PYEA 3TO4A 5DMIL 5EZLB 3O2WL 3PP3H 1FNEB 4HZLA 4L4VB 1HHGB 4F15B 4L8SB 4ZUVA 2X9XA 3KLAA 4NFDA 1FZOB 1QLEH 4KJWC 4K94H 1TZIA 4M93C 5ITFA 1O7VA 4FXGB 3JZ7A 4HIIB 5F9OH 1MFNA 2PYFB 4E41A 1A3RL 1AGEA 2WWKO 3BW9B 3V0AC 4AY0A 1BVKB 5CZXC 3ARDB 1MCHA 2EIZA 1CT8B 3FHQA 1TVDA 4TTDD 2YPLD 4NSKB 3U46B 3SDDC 2D03H 1NANH 3B9VA 1X44A 2AERT 4H8WC 4P46A 1LWRA 1HI6A 3TPKA 1DDHA 1H0DA 4TPRH 3T09A 4AEFA 5JPMA 4G8EB 3CFBB 3ZDXF 2Y7QA 5GS1A 1MHCA 2V2WB 3DOSA 4XX1G 5IHZA 1W0YT 1XCTB 1FL3B 2FGWH 5DD6A 3BEVB 1AD0B 5GJTL 5IUSA 1CE1H 1RFDH 3GFUA 5IF0B 2VLJD 4I18C 4P5MA 4JFHE 1A22B 4R7DA 3ZL4H 3N85L 1JV5A 1YMMA 1XGPA 5ETUB 3NCEB 4LPUA 4ZFOL 1JVKA 3DV6A 1OGAD 4MNGE 4APQD 3VGDA 4UNUA 4LSRH 3SY0B 2AJUL 5I73B 1Q38A 3O9WC 3T0WA 1NLBL 4MA3A 3HE6B 1JZ3A 3GJFH 1A7PH 1A6UL 2A6DA 3PGCB 1KTLB 4FOMA 4O5LL 4ZS7L 4DN4L 3PJSB 1T20B 3NCJH 2AGJL 3VH8B 4B5EA 1T2XA 5AZ2L 4QRUA 5IP4A 3FN3A 5BQ7A 3OXRA 1RUPH 2MNUA 3DVIA 3T2QA 4NHUB 4QY8A 4IRSC 1I9JH 2VDKL 3KPQB 5LBSL 2OL3L 5TQ2H 1JPST 1QEWA 4NCDA 3L7FB 5ESAB 4CJ1A 1MJ7H 4U3HA 3RRQA 5C07E 2NY7L 4QOKB 1BJ1H 4S2SA 5B38B 3WS3A 4Y19D 4RGMC 1XGRA 1PKOA 5LGJB 2JCCE 4I3RH 4QXUH 3QDJD 4PRHA 2HG5A 4G6MH 2HAZA 12E8H 2Z91B 4E0RA 5E7FA 1DSFH 4RWYH 4JHWH 8CGTA 2GITA 5TDPA 2VZ1A 3CVHL 1BM3H 3VXMA 3GSNA 1QSFB 2A1WL 2RIKA 2WP3O 2W9DH 4RRPG 1IC7L 3T4AA 1ZGLB 1KJ2A 2Q8BL 1U95B 1YJDL 5ID0A 3RWCA 1B0RA 2LU7A 2H9GA 3AXLB 3HZMA 2ESVA 1EUTA 2RGSA 5LGHH 4XX1E 4FZEL 2VKWA 5EWIL 1JPFB 1RVFH 1MCPH 1EEQA 5D7JB 4PGBA 2A83A 3TZVA 3GNML 5D7LA 4Q97A 3MFFA 2G9HB 5KW9L 1CIDA 4YHML 2D7QA 4TOYL 4L4JA 4R8WH 2XQBH 1UC6A 3MNZA 5ACLA 2FEDD 2ITDB 3REVB 4YNYA 4AM0B 4BJLA 3OGCB 3MRJA 2R4RL 3CXHK 4N5EC 3SBWC 4KJQC 4NDMB 4X4XA 4JRWA 3BPNC 5CJ8A 4HLJA 5TFSH 5SWSB 4RFNC 4EI5C 2OJEA 3MCKA 2EKSA 1GPOL 3R06B 1RIVL 5DJCB 5C0BA 1RUMH 1S7SA 2BC4A 3FRUA 5F89A 1U8IB 2X1PA 3FQRB 3UTSB 4GJTB 3GRWA 4WU7A 5EU6B 3S36X 4TUOA 1EFXA 4X7TA 4FQXA 4PJCF 1A0QL 5MEOA 2PTTA 5EOCL 4PJHE 5KS9B 1I7UA 3SEPA 4TN9A 5CFHA 4JFDB 5DJYB 3ARRA 3O6MH 1LE5B 3UTTE 3E6HA 4KJWD 5FB8B 3CFCL 2Q7YB 4HT1H 1ZLSL 1DP0A 3MV9D 2L4OA 3DRQB 3UYRL 4S0TD 5IEKB 5ISZA 4P3DA 5CZXD 3L9RA 2KBGA 3BUYB 3L3KB 4N0UB 5EPMB 3SDDD 4H1LB 4MA8L 5HYJB 3QULB 1I8LA 1GGUA 5IVXF 1UACH 2VLME 2GHWB 3RL2B 1B2WH 3IF1A 5JOFA 2AEQH 1L9MA 3K8LA 3MUGA 4HH9A 3PHSA 3OAUL 5HYFA 1ORQB 4YHYB 1N5AB 1Q9OA 4K3EH 3MLTA 3TP4A 4OGYL 1FIGH 1EVTC 3ARTA 4YK4B 3D87B 1EO8L 1IBGL 3QZWB 2F58L 4DAGH 1ZHKB 3H9HA 4TNWF 5FV2A 4C59B 4KC3B 1ZSDA 4Z18A 3TT1L 3Q1SH 4HKJB 4TQEH 2DQCH 2OR8A 2WUBH 1KEML 4ZO9A 4UIKH 5CBAA 4C56A 2HFEB 4KRNA 4R9HA 5IHUL 5E9DD 1HH6B 2EDXA 2E5EA 3ZDXE 1MCRA 2OQJB 4WU5B 4K7PX 1IT9H 1KCUH 1I9IH 2O5YH 4DK3A 3O9WD 4PRPD 4JO1H 1HNFA 3IDIB 2DOCA 3AM8A 3QNYA 1UVQB 1LO5A 4L3EE 4LVHB 2DS4A 4M8QA 4J3WA 4DKAA 3K1KC 2BRRL 2H1PH 4I9WE 1U58B 4Z0XB 1J7VR 3AREA 4W4NA 2VDPL 4FABH 4KJYB 2EYRB 5L7XH 3ARFB 4PJ9D 1RAMA 1JPTL 2P24B 3QAZB 1JNJA 2GKIA 4O2EB 5BXFA 5I17A 2AK4A 3H9SD 5TE7L 3P11L 4GQPH 1J5OH 4UB0L 3VFNB 2IC2A 1BD2A 4NNPH 1FNEA 1OAQH 1F3DJ 2C4XA 4L4VA 1CFBA 3M1BB 4JDVA 4Z95H 1HHGA 4P23C 3QUYC 2ZOKB 2AKRB 4Z7VB 1GH7A 1PY9A 5DUBB 3UZVB 1FZOA 4PRIA 2VQUA 4NFBA 3U6RB 1SBBA 2IBGA 1F11A 4DKEH 2ZG2A 2IH1A 4MD4B 4FXGA 1FVEB 2ZWLT 3JWDH 4HIIA 3D69B 3OAYK 3WSQL 5H8DA 1FO0L 3H8NA 3BIBX 4JY4B 1BVKA 3OQ3B 1LO3L 1RUQL 3HZVA 1MRDH 3KXFE 2X89D 3NMEA 4Y16B 5HI3D 4NSKA 2VTFA 3GMOA 1ZA3A 4X99B 1MIML 3WV0A 5CD5D 4BSJA 4XB8A 1YEJH 1Z6JT 1QSVA 5L0QC 1CXLA 1OAZH 1UKQA 2VXTL 5FA3B 4O02L 5TQ0H 5HVFB 3BN3B 5FYKU 3OJVC 2BCKA 1M4KA 4OZFB 3CX5J 3UTPE 4UV4H 3TFKD 3G04A 1HHHA 3HNVH 4WW2F 2V2WA 5CSBA 2JK5B 1F6FB 1XCTA 5EDXA 4P46C 1FL3A 3VI4F 4G6AC 1SMOA 3BEVA 1IC4L 1V3JA 2PUQT 4KKAC 1AD0A 5E2UH 4ZUUA 2MKLC 2BJMH 4OLVH 5DD5L 2B39A 2BNQD 2NMSA 3HMXA 4FQLH 3VXPB 4WY7L 4CN6A 5D1QB 1QBML 3GSWB 4GO6B 1KCSH 1G7IB 4BFIB 3QPXL 4C58B 2E7LA 2VWEC 4CAGA 1RZKC 1WISA 1Z5LB 1DN0B 1YN6B 4P9ML 3DUSB 2VDRL 5DK0A 1A4JB 3W5MA 4EI5D 2DQIH 1FNLA 2ERJC 3NCCB 3SY0A 4P99A 2NYYC 3HNTH 2FLBT 3O81A 4R96B 4EUPH 5JW5B 4JRXD 1NEUA 4XVUC 3CU1A 3PHQB 2F74B 3CFJB 2IANB 5T3XE 1KTLA 1F2QA 2EDBA 4S1DC 3S37H 1T20A 4I0PA 3VH8A 2IJ0C 4EVNB 3HPLA 4NP4L 3TBSA 5FDWA 5CJXC 3BKCL 3MCLH 2OP4H 2BHZA 2XA8H 3BIKA 2BY2A 5F9JB 4NHUA 4M7ZB 4K2UH 5C6WH 4N1EA 2GTWB 2AJ3A 5GGSB 4HWBH 3L7FA 5ESAA 4LNRB 2DI8A 1IGJA 4UDUA 3S9DB 1YEFH 5E2TL 1MCIA 4QOKA 5E2VH 5CEZH 3GBML 5CWSB 4HG4J 2YXMA 1A6WH 2FO4B 3QXUA 5EBGA 3MYZA 1VGEL 3WFDH 4PJCE 1T1WB 1F3JB 2Z91A 3D0VB 5D7SH 3TBTB 4DZ8B 3GO1L 3O45A 2XKSA 4TSCH 5FOBB 2EDLA 4HCRA 2BMKB 2WZPD 3RKPA 1S7RA 2XG5A 1DJSA 4EOWH 1ZGLA 1U95A 3Q48A 2YPVL 5ERWB 5SX5K 1XIWB 3AXLA 1VGKB 3L5WB 4X4MA 5HYEA 5JR1H 4AENA 5I74C 4LSTL 4YDKH 5DEZA 3EYQC 4WI6A 3GMMB 1Z0NA 4NQEB 3L3OA 4XNXH 2G9HA 4XPFH 1JJUA 3E3QC 1L9NA 1F3DH 3KPLA 4BFEA 4JCMA 4NO0B 4YFEA 1FV1B 4PJFF 5INDB 3REVA 4X5LA 2FL5B 5E1HB 5IVXE 5F1SA 4OD1L 2R0KL 3LHPL 3TZVC 4JM2B 3CDFA 3ELAT 2DQTL 3RX8A 3WIHA 3W11C 3EFFB 2HH0L 4OGAC 2QQLL 4GUPB 4JB9L 4NDMA 3EYVB 5EZIL 3MC0A 4WO4A 3BPCB 1PG7H 3SCMB 3MLZL 4M8VA 1EHAA 2B2XL 5DJCA 1KTKE 5IESL 2NPLX 1XGTB 4JFYB 4YHIB 1RD6A 1U8IA 4ZUWA 5JW3L 3ZTJG 5DD0L 3VU2A 5K9JH 3UTSA 5JUEH 3K4AA 4HDIB 5EU6A 2UV3A 1DCLA 1G7PB 5GJSL 5H2BB 5HHPA 4M6ML 4UTBH 4LCUA 1T89A 5IB1A 3O2DA 4PGZA 2P48B 3LEXB 3QWOB 1IEBB 2CLZA 2DYPB 2W1NA 5C0CE 4P23D 1ED3A 1MRCL 3QUYD 3QWRD 4NKQB 2FJGB 4G5ZL 3CFIC 1A7OH 4NM4H 4FQXC 3VD4A 4U1IA 2X5PA 5HHOE 1FYTB 2PYED 5DJ0B 1OP3H 3ZHKA 4Z8FH 2GFBB 4PJXF 1GZQB 4NGHH 4PP2B 3D6GA 3IDMA 5C08E 2AJVH 2FGWL 4JKLA 2R69L 1NH6A 3NN8A 1CE1L 5E4EC 3RVUC 4OLZH 1FNHA 5F8RC 2YEZB 3L3KA 1X3DA 1PY4A 4I2XA 4H1LA 2D4DA 5I71B 3U0PA 3QNXA 3PIQB 3QULA 3GSOB 3U4BH 3BYYA 3RL2A 1KJ3H 1D5XA 1U91A 3TBVB 5E6IB 4HEPG 4OM0H 2LU3A 3QXWA 4GW4A 3W5NA 4LEOA 4P46D 2X9YA 1I8LC 3QUXB 3BGFB 5DJ6B 4AMKH 4KKAD 3MRKA 1Y18B 2BVOA 1H3WM 2E7BA 4LCCA 2OL3B 3DNKA 1P6AB 3EDKA 3QZWA 4JDTL 1ZHKA 4LPCA 4W4OA 3U0WH 2DQDH 2HTLC 3NH7H 4ODTL 1W2KT 3WJJA 4RMSA 3OR7B 5IFHL 1T83A 3DWTA 1IQWH 1I3RB 3QEQE 2OTPA 2F54E 4K7PY 1FZKB 1RUPL 1AY1H 1BZ9A 5DC0A 3OWEA 4XZUB 5JOPE 2YRLA 3D2UB 4AL8L 1HH6A 5E95B 5I8OL 5FYJH 4PUBL 1I9JL 1QFUL 2YD6A 5DQ9B 4OCRH 3VDBA 1FSKB 4RAHA 4WU5A 3MXVL 4XNZB 1RQ5A 2DI9A 2NYYD 1YMMD 2X1XR 3T0EE 1AXSA 2V6HA 5FK9A 2OJZH 5SWZB 4X6CF 3VI4E 3VRIA 2PXYB 5I2IB 1UVQA 4XVUD 1CFSB 4NKMA 3VGHA 1U58A 3UX9B 3LEYL 1EA9C 4JZOB 4S1DD 4KJYA 5DMYA 1E4JA 5DUPH 1ZMYA 3ARFA 2NY2B 4KK5C 3SDAB 4PJ5B 4JN1L 2GT9B 4XPBH 4NZTH 5AD0B 4FMFA 4JHWL 3AM8C 2ZUSA 2CO6B 5ADOH 2VDLL 1WZMA 3AREC 1OVZA 3VFNA 4KKBC 3RWHA 4P59L 4YR6B 35C8H 3GMPA 1KIQA 1X7QA 1NGZB 4BQBA 3WO4C 1I1FB 1VFUA 4KRPB 3G6JE 1AIFB 2ZOKA 3VWJB 4Z7VA 5C0FB 5LGHL 1NMBH 1MCPL 1QLRB 3U6RA 2WQ8A 4LGPB 3QISA 2I60H 1CE6A 2BY3A 2YPKA 1RHHB 3D69A 4LCWD 3VFRB 4F15C 1BVZA 3C60B 4ZTPH 2XQBL 5I66B 4Q58C 3RTQA 4MNQE 4FNLH 2ADIB 4P2CG 3ULUF 1CXKA 2EE6A 4Y16A 4PRHD 3WDJA 3ISWA 1TJHL 3D9AH 4JHAL 3DX8A 4MYWB 5C7XL 2APVA 1AGDB 2R8SL 4D0CB 4OZHA 1KB5H 4NKIL 3MX0A 1JHTB 1NSNH 5TFSL 3VXMD 5ESVA 3MOAH 4HUNB 2LE9A 3EYQD 1A6ZA 1ZS8A 1J0ZA 2WMPA 4OQ1A 2JK5A 4XHJC 3QUKB 4GG8A 1BMGA 1TJGL 3DROB 3PGDB 4MLIA 4NQDB 1VB9A 2W92A 4JY5L 3SQBA 3RVVD 1NGXA 2CPCA 4BFIA 5D7LD 5GZOC 3BP5B 4DW2L 2GK2A 3W11D 3B9KB 1OT1A 4LSSH 4M9PA 4OGAD 3DGGA 1DN0A 2OI9B 3DUSA 5I1IH 2K7PA 3UXFA 3HA0A 1A1OB 3O6ML 2ICES 1A6AA 1X5FA 2FEEL 2W0FA 2E7LC 4N8VB 3MXWH 1SY6A 3WFBL 4R96A 4G8GD 2OZ4A 2OMNA 4PJ7A 3ZZ1A 3PHQA 1WWBX 5BZDA 1X5KA 2F74A 1NCAL 2AEIT 4PJFE 5I16B 3SE3A 4BFGA 4MHHI 2VLRA 1FC2D 5F1KC 5CIPB 1CFTA 5I73C 1YQVL 3OSKA 1G6RH 1WWWX 4ZODA 3C5JB 4WJ5B 4BZ1H 1B2WL 2XTJC 4FQXD 1TETH 2J8UA 2J5LB 5HGBB 2WUCL 1ZOXA 5L6YH 4D2NA 3OMZA 3QEUB 4OD2A 5E99L 4K3EL 4L4TD 4LNRA 1Q94A 4ZTOH 1LEIB 4XVJH 3S98A 2AP2A 3WIIL 2IEPA 2LAGB 2XN9B 1OWRM 5CWSA 1SQ2N 1J8HB 4RA3A 2VZUA 1S78D 2AJZB 3L5JA 1KFAH 1I3GH 4JFXA 1NC2B 2DM2A 3TBTA 1T80A 2P7TB 5DDHB 3EYOB 1AC0A 1YPZF 4MX7A 3GHBL 3RU8H 1KELH 5FOBA 2BMKA 4LGSB 1GOGA 4LHUA 4NJAL 2BNRB 3GSUB 5DRNB 4DGIL 1YNTA 1RULL 3QT2A 1WCBB 3E2HB 1IM9D 2NLJA 3I6KB 3FAXA 4HC1L 2V5YA 1I9IL 1ND0B 3I6LE 2APXA 3DX9A 3MA9H 3D85A 1VGKA 3OX8A 2R1WA 4EJ1C 5IW6B 3ROOB 5KSBA 4L3AA 1BF2A 5E70A 2OR9L 3UJTL 3IDYB 4F33B 1S9YB 3KJ4B 4G80B 5INDA 5JHDE 1N2RB 2FL5A 4KQ3H 5D7JC 3FB7A 1J5OL 3QIWB 5EO1B 3QXVA 5E94A 4JM2A 3VD3A 4TSAL 2D7OA 1F8TH 4QEGA 4NNPL 1E6OH 2Q87A 3T08A 3GBNH 3EJYC 4Z95L 1FO0B 1G0XA 4L5FH 2IG2L 4C56D 1KB9K 4JGMA 4UV7H 1N26A 5GGVL 3LOWA 1AKJB 1XGTA 3KJ6L 4KK5D 2HJLB 5KVGH 1XF2A 1YZZA 2A73A 1MCKA 4NKOB 3DXAB 1I9RH 4LHQB 1P53A 1G7PA 5H2BA 3TIEB 5F1NB 3RWEB 3ARED 4IDJL 2VXSH 1V7NL 4KKBD 4LLUA 3C5SB 3QXDB 5BVJB 5J1SC 4ODUA 1IEBA 5F3HA 1YEJL 3L5IA 1M05A 1EEYA 3MV8A 4G9DB 4XAWL 2F5BH 2HJKA 1OAZL 4QHKJ 4X6CE 2AK4D 5DWUH 1QSED 2FJGA 2YBRB 1ULVA 4XWGH 1S7WA 5I8EB 5TQ0L 4RIRB 1GL4B 1N5YL 1MCBA 2V2TB 1FYTA 2APWA 4OAWA 5ID1B 3LV3B 1IGTB 4WFGD 2GFBA 4ZAKA 3INUL 3FFDA 5I1LA 4L4VD 4FG6C 3Q6FA 4POUB 1G6VK 4ZFOA 5E2UL 4FQHB 4O2CB 3X13A 2BJML 3MACL 2VQTA 4F7MB 3UTQB 2YEZA 1WEJH 3O41B 2J6EA 4XWOC 4OJFH 1RHFA 4KMLB 5LCVL 5HYQB 2UZIL 1G7MA 3BHBA 1HHKB 3ARDD 1I1AB 1UGNA 1JZ5A 3HPJA 1I8IA 2DQIL 1JK8A 1J1XL 3HE7B 3TBVA 4GAYB 4LDOB 5E6IA 4LKCB 3PQYE 3UBXB 4U1KB 5DTFB 4XHJD 4Y7MA 3HNTL 4OFPA 4P49A 4YHLH 3QI9B 4CVZB 1G7LA 4HKBB 2NY5C 1JF1A 3H3KA 1QQDA 5DUMH 3RKDC 2Z92B 3S37L 3ULUE 3WFEH 3CMOH 5GZOD 4YHYC 1OARL 1PX4A 1HHJA 4NQXB 5E2WH 1CTNA 3MCLL 5HHME 3UC0L 1NBQA 1FZKA 4YK4C 3D2UA 4OLEA 4W4OC 1HXYB 4X80L 2YRZA 3WJJC 1XFPA 5IBUB 4R4BA 1AFVL 4HWBL 1MPAH 4YHNB 4J4PA 3CVHA 3EGSB 1OPGL 1PYWB 4Y5VB 5D1ZA 2XKNA 3S3JA 3ZKSD 5I2IA 4LFHD 5GGTL 2PTVA 3TWCH 5KTEL 3T3PF 1CFSA 4UMGA 5E2VL 1WZKA 3O6FB 1XGUB 4JZOA 4EKXA 1MVFA 1T1YA 2VNCA 1QA9B 1QNZL 2GT9A 4EQ2A 3MRHB 3FRPA 3HE6D 3OJDB 5C0AE 4TSCL 4R26H 4LVHC 4JQIH 1U3YA 4RZCB 1F6LL 3LKPA 1YEDA 2XTJD 4OF7A 5BS0B 4MB5A 3ARFC 4YR6A 1MELA 3KLHC 3VGAB 1I1FA 5FM4A 4HAFA 1A14L 4TUKL 1AIFA 1MNUH 1H3VA 2RFXA 4XT1C 3VWJA 1GGBL 2XXCB 1JFQL 3MLSH 5CP3A 3NA9H 2OSLA 3ZO0A 4WFEE 1CL7I 5D7IF 4JFQB 4LRIA 4CN1A 4XNXL 3ULVL 1RHHA 3I3EA 4JFPB 3C60A 4TVPD 5FECB 2PF6A 4X9FA 5I66A 1KN4L 1YYML 4QOKD 5DVLA 2H32B 2X4OB 3LN4B 5FO7B 2V7NA 4WI7A 1CDBA 4N8PA 1BQHA 4X7SH 2ICWI 4ACPA 4TULL 4WDIB 1GCFA 3ME0A 5GISH 4D0CA 4M61B 1MF2H 1QFOA 3VXRB 1QSFD 6FABL 3GHEH 3G5YB 3AVEA 4Y16C 3W0WB 1OSPH 4JRYB 1IC5L 3CZFB 1IAKB 3GUTA 3QUKA 1R3JA 1UWEL 1T7YA 1JGEB 1YPZE 1JWMA 3PGDA 1HIMH 3DIFA 1CL7H 5D7JD 2XZAH 2DL9A 3MRBB 2EXWC 5GRUL 1A5FH 2PO6B 1R5IA 2YD2A 4H26B 1KCVL 4KKLD 5IHBA 3EJYD 4KQ4H 4L1DA 1VDGA 3MMEA 1DQJA 4UI2A 1A1OA 4NNYB 3OKEB 4GRMB 4LCIH 2CUMA 2AS5M 4GXVL 5I1KL 4Z8FL 3L5XH 3EAKA 4JQXA 5T3XH 1KJVA 1QFWL 1TQBC 2KPNA 3ZTNL 3GIZL 4PYHA 5SWSD 2VDOH 1R24B 3FO0L 5BMFH 1EX0A 3HRPA 3MV7B 5CIPA 5DGQA 4C83B 4U49A 2HKFL 2HFTA 2ZUWA 4BZ2H 5E8EB 5FYJU 3A0OA 4HWZA 4ZFZB 4XGZB 3UEZA 3OHXA 3UTSD 3D0LB 3GSXB 3V0VA 4NZRL 5FM5M 3C5JA 5EU6D 3QUZB 4WJ5A 3SE3C 5HVHB 2CKBL 3BP4B 4HS8H 4YHPB 4AG4L 1JN6B 1IFHH 1NCCL 2VC2H 5HGBA 1RZFH 5FYLE 4OM0L 1NJ9B 1ZT7B 4FG6D 1T1XB 5JIIA 4AMKL 1LEIA 5F6HJ 1MJ8H 3BGMB 5JQ6L 3ARZA 3T0AA 4JFDD 1KLUA 5CJQH 3MFGB 2AJZA 4M7ZC 4PJDB 4PV9B 5C0IB 5LXGH 4X5WB 3VXTA 1DBAH 4XWOD 2NXYC 2P7TA 5I75B 2B20A 3EDJA 5B8CB 1NL0L 1Y6MR 4TNVK 5IK3B 4GFTB 5EC2A 2BNRA 4RMVA 4XPTL 5DRNA 3TIDA 1WCBA 4ZPTA 1OD9A 3U7WL 4XMPL 4OCRL 2YD3A 4HIEB 4OCYH 1U3HB 3UO1H 5HYJD 4HH8A 2JJWA 3PXJA 3NTCL 1CU4H 2EZ0C 4JG1H 3VMOA 3RKDD 1R0AH 1WAAF 2X4SA 2VDQH 3BJ91 4XRCA 3GK8H 5DUPL 4A6YL 4FFYL 4KJPC 5EIVA 4JAMB 3P9LB 3GIVA 2ZOLB 3IDGA 1IM3B 1N2RA 1N6QL 5ADOL 1KENL 1LP9F 3HG1B 4UINH 3HI6H 5KAQG 3EYFB 1LEGA 2XKUA 4HHAB 5D72H 4YPGB 4ODHH 2JIXB 3EIFA 1V05A 3T2OA 4NN7C 2P8PB 1GGCL 5C09E 2FLRT 4K9EH 4JM2C 1ZTXH 1CFQA 3U2SB 2CJUH 3W81A 2QLVB 4R2GB 3C8KB 4NJ9L 2ADFL 1F58H 5GIRB 3CUPA 2KZWA 1O7SA 3SCMC 3CSYA 3EOAB 3BPOB 5F1NA 5BV7L 2GJZB 5C0RH 3U82B 3P77B 5KVFH 3ARFD 4UUJA 3KPSE 3KLHD 4KKNA 1FGNH 1S3KH 4S1SL 4G9DA 1W72H 1JWUB 4H20H 1YEHH 2DQFB 2YBRA 4JJ5B 3T3PE 5I8EA 1MVUA 3BYTA 4RIRA 4DCQB 2D7PA 1AO7E 5HGHA 1JGLL 3KS0J 1IGTA 3LV3A 4G42B 4QO1A 4YO0B 2QSCH 5DHVB 4F7MA 5FM5O 3FJTA 3T2NH 3U7YH 1DTUA 5HBBA 5EBWA 1BVLB 4AQOA 4JREB 3R8BB 1FE8H 4WTZA 3WN5B 5D6DA 2N56A 3B4NA 1JNNL 4WHTB 5HYQA 3N0PB 1PBYA 4OQTL 1O0VA 3MLWH 1AQDB 1HHKA 2YUVA 4WUUB 4ZYKB 1IZKA 4LARH 2Q6WB 2DM4A 2R9HC 2LVEA 1I1AA 2EDRA 1UWXH 4Y16D 4GAYA 4JKPL 2DLEA 5D7IE 3MXWL 4XCFH 1A9EB 1PD6A 3GB7B 4U1KA 3B83A 5DTFA 3WBDA 2M26A 3QI9A 5E2JA 4J3VA 3K2MC 3LKRB 5GRVL 2E7HA 3UYPA 5JNYB 5E6IC 4OV5B 4PRDB 2EXWD 4CW1A 2VZOA 4MJIA 3CDYA 4LBEB 4GG6F 4PGDA 3QUXC 3BGFC 1YEEH 2VLJE 3MPCA 1XGYL 1K6QL 4OIIH 5D6CA 4M6NH 3K74B 2EIDA 2CLRB 4KDTA 4O58L 1HXYA 1TETL 5D1QD 1FFRA 1MCCA 1OGAE 1L7TH 2B5IB 1T4KB 4I2XE 3RPKA 4YHNA 3EGSA 5F7WC 1PYWA 1W8NA 1U42A 1NGQH 5DEFA 3O6FA 1FIEA 2AQ3A 2XOTA 1PKQE 1XGUA 2A6IB 1S9KC 4QTHB 4RSVA 1KFAL 1I3GL 4XNZC 1UYWH 4I5BA 2E8ZA 2P4AB 1GAFH 4J4PC 4PJAF 4V1DB 3TT3L 2PXYC 4Y89A 1HHIA 2FD6H 1BFTA 4RZCA 5GSVB 3MRRB 2IAND 2VLRD 4P2RA 3FCTA 4S1QL 1U41A 5JXEA 5BS0A 4CNIB 2NY2C 3SDAC 1YJDC 3WUWA 3MRPB 2XFXB 5C9KA 3QHTC 1F02I 1HSAA 5EN2B 4NBZB 3QO0B 1LQSR 4XNUH 4KU1A 5CJBA 3BZFA 1SVZA 3NPZB 4KMTH 4G7VH 5IMKA 3VFSB 4DFHA 1DN2A 4JFPA 5FHAH 4KRPC 3QDJE 2Y06H 3VWJC 2WQRA 1IKNA 3NZ8A 4OLUH 1S7QB 2R15A 4F7PB 3MJ7B 4DGVH 4JZJA 4LRIC 4HJJH 2J4WH 4WDIA 2N7AA 3GBNL 2OK0H 3BSZL 3C60C 3FOMA 4NQSA 4KUCD 5KOMC 1IAIM 1QKZH 4O2FB 2EZ0D 5C0DB 1NCBL 1WLHA 3H3PH 3OB0H 4JPKH 3G5YA 2A9NH 5FGCE 1OM3L 3W0WA 1MEXH 5DC9B 7FABL 3CZFA 4FFZL 2N7BA 3QUMH 1A7QH 2FDBP 3IKCB 1XIWD 3ABZA 1JGEA 3D85D 4Z7UF 3ESVF 1HZHL 3X3GL 4CBPA 1WSST 1HSBA 4XXDB 4YBLB 3E8UH 4XC1L 3MRBA 4F8TA 3P40A 4OT1H 4YHKH 1EUUA 1T0NA 4NQED 2PO6A 4ZS6C 2OMBA 4H26A 5HSFA 3OG6B 3KPNB 3S4SB 5I1DB 5T1LA 4X5XA 3H42L 4NO0D 2F5BL 4DTGH 5FDYA 2Y1VA 4C55A 5I18H 4PD4K 2FJFA 3O3BB 3EW3B 4QHNB 4XWGL 3CSBA 4JM2D 1WAAE 3BKYL 1AE6H 3FT3A 2JELH 3B9KC 4QRPE 2OI9C 3VA6A 3VFMB 2H41A 3SCMD 3FB6B 1R24A 3A6CH 4FTVA 2E27L 1LP9E 4C83A 4HPYL 5DVKA 2NTFB 5E8EA 4MQ7A 4JQXC 1A1NA 1U8OA 1KF9B 5IT2L 3QUZA 3IYLW 5FCUL 4AEEA 1UEMA 4YHPA 1FCCA 5I8CB 1VCAA 1TTGA 1C5BL 2DYPD 2JJSC 1P4BL 2DQHH 1ZT7A 4ODBD 1TVHB 1FRGL 1KYOJ 1YEKH 4Q9QL 3L3GA 1PZUB 5DUML 4PJDA 1J1OH 2FZ3B 1EBPA 1EHNA 2J5LC 1FYTD 4P4RB 3TBYB 3CMOL 1L0XA 5E2WL 4D9LH 4WI8A 2OTWB 2NR6C 2R9HD 4EDXB 1WZ1L 4IEFB 1FFPB 4HIEA 4I48A 4NCC2 1U3HA 1DQTA 4DKDC 4K3JL 4PREB 4LSVH 4PRBB 3MLRL 1Z9MA 3C87A 5ILTH 3IAGC 4JY6B 4DOHE 3E2HC 4XP9L 2VAAA 4AT6B 2DICA 1UM4L 5E6ID 3OAZH 5D71H 2VE6B 1OY3B 4O51B 3QUXD 3P9LA 3FB8B 3NGBB 3WL9A 1NFKA 2VLKB 1DBMH 1W0WB 4F80A 3GDBA 2OXGA 3VG9B 4Y5YB 3LKQB 2VDML 4HHAA 5HGDB 1CIUA 3IDYC 3U30B 2HKHH 3KJ4C 3DO7B 3S96B 2C3HA 3MLSL 4GRWF 3D2UD 2UUDH 3PL6A 1T5WB 4Y1AB 4ZSOA 3TVMB 4BELD 4ONFH 1MHEA 4YX2L 2K3TA 3TNMA 3OJ2C 5SWZD 2EICA 4GG6E 3IS0X 2PXYD 1U8LA 1L6XA 2CK0L 4YPJA 5F70A 3UPCA 4BH8B 2H2PC 4XNMA 3MYJB 3VJ6B 1TZGL 3P77A 1U8PB 4OFDA 5IMOB 2NY2D 3SDAD 3H9SE 4PJ5D 2ZCHL 4OSUH 1UEYA 1Z3GH 3JWOL 5AG9A 3STZA 4YEFA 5GISL 1TCRA 3UTOA 4BSWA 5MI0B 3VFTB 2DQFA 3BWAB 3OR6B 5F93C 4Y4KA 4XMKL 1QSZA 1TVBB 2HJFB 4A2MA 3NIGF 2AXJA 3QFJB 3G5XB 1B6UA 1OQOA 4KRPD 1FFOB 4PJAE 3VWJD 1PG7X 4XMLH 3G5VB 3MLUL 2NW2A 3I2CL 3EDFA 3TCXA 5TF1H 4YAQB 3U9PH 1S7TA 2OTUB 3GI9H 4RWHA 3C60D 1KXQE 2IPUG 3VXUB 1AQDA 3HUJB 4WUUA 4ZYKA 2FECI 3OKOB 1AGBA 4Q6IB 4MDIA 4W6XB 4HUXB 4LCIL 3GEWB 4JO3H 4H25B 3FRPG 3RAJH 1A9EA 5EBLB 3FKUS 3KVQA 4LLVB 3MV8E 3LKRA 1FNGB 2V5MA 2EXYC 1KLGA 4K3HA 2VISB 2CKBB 1I1AC 4P57A 1TLKA 2VDOL 5JNYA 2APTA 1CQKA 1QVOA 4LRNH 4OV5A 2IBBA 5D96C 3ULSA 4LBEA 1MAJA 4OIAA 3EHBD 3QI9C 4D8PB 5D93B 2P5EA 2XRAL 5IOPB 2BNUA 3LMJL 4NQDD 4UBDC 1UKTA 3BUTA 3OF6D 2CLRA 4JG0H 3S3PA 1G7JB 1VADA 2VC2L 4I4WB 1RZFL 1SBSH 3BDXA 1UADC 1SJXA 3B9KD 2E9WA 4WIQA 1A9BA 1OP9A 3GBLA 3S5LG 5BRZB 4DVBB 1INDL 4Z7UE 1J9CT 4E5XA 3KYNB 4GKSA 2A6IA 1BPVA 4KDTC 4QTHA 3GGWA 1RMFH 4ONGH 5LXGL 3QDMA 5IVZA 1YMHB 2GTZB 1QRNA 1ES0A 2X44D 4Y5VC 3IETA 3QHZL 3WDHA 3M8OH 2AXFB 4QTIH 2W91A 1QLFB 2AXGB 2FHBA 2KDGA 3O6FC 4BFBD 4PGEB 3H7BA 2CIKA 3SO3B 2BERA 4A6YB 4R7NB 1A7RL 1DBJH 4XCNB 4PJIB 3QNZA 5EN2A 4O00A 3QO0A 2BSRB 4LU5H 2R0ZL 5CP7B 3EDEA 5IBTH 3OBAA 4G9FA 4MDJB 3WFZA 1R0AL 5JXEC 4Y2DB 1IEHA 4D0BB 5CEXB 4Z7WF 5I1GH 2F8XC 3VFSA 4BQCA 3VGAC 5L88H 3KPRA 3O11B 1FJ1B 4MXVF 2XN9D 3IRPX 2NR6D 4PB0L 4QF1B 1J8HD 4QGYA 5K9QG 1S5HB 3HI6L 1VKXB 1NC2D 1MFEL 3S6CA 3PWUA 1K4CB 3SKMB 5D7KD 5EO9B 4S1RL 1IKNC 5DLMH 2BNRD 5HDOA 4IJ3B 4O2FA 1C08B 5C0DA 5HDBF 5BV7B 3NAAH 3IU3A 3RZCA 2JB5H 4FZ8L 4L8DB 5F9DC 4JZJC 3IS1X 1G7HB 1N64H 2C3WA 4FQ2L 3HAEG 3IKCA 1L7IH 1CCZA 3IJSB 4U6XB 2FNBA 3O3DB 5I30H 4U2YA 1XF3B 3NACH 2HRPL 3EOBB 5C0RL 1JYVA 1VERA 1T03H 4TSBH 3TC9A 3SDXB 1Y0LB 2RBLA 3S4SA 3MUHL 3CMGA 2BVUA 3VD9A 3PP3K 2MPAL 1LK3L 3O3BA 4QHNA 3QIWD 2L7JA 2PO6C 5CMAB 3QQ9C 3J8F7 5FUOL 4KK6C 4I8DA 1P84J 4OZGA 2EDYA 2HVKA 3I02B 3FB6A 3MJ9H 3QCUL 3LIZH 1L0QA 3C2AH 3U7YL 2XZCL 1JGVL 1PQZA 1AKJD 2NY0B 2IFGA 5AWNL 2FX9L 1OTTC 3V6ZA 4MAYB 2DWDB 4GW5B 4EUPA 3WD5H 3DXAD 4K8RH 3PF2A 5FYLH 1QYGL 1MHPH 5FGRA 3TYGH 1OAYL 3GMRA 2EEAA 4W6WB 4GRWE 3GJEB 4RGNE 4AEIL 5I8CA 3CPLB 4UQ3A 1ZLUK 5IB5B 4U7KA 3AROA 3RUGB 4XCFL 5H35A 1WZLA 4NRZB 5ANMB 1TVHA 4K23H 1PX3A 1MFDL 2KQMA 4PV8A 4RX4A 2B4CL 3QUZC 4TRPH 5HVHC 2A38A 4I0KA 3TBYA 3U9UB 3SDYH 4HWBA 1FG2B 1BQLL 2JCCB 3W9EB 1YEEL 5GGTA 2OTWA 1EH9A 2HVJB 2V5RA 5EA0H 2P5WA 2WBJB 5B21A 5IMLA 4EDXA 1MI5E 2IMMA 3AUVA 4J3OC 1L7TL 2OLDA 3NIGE 5IG7A 2MWCA 3D3VB 2D9QB 1B3JA 4PREA 1VFAA 5D2NA 3UTZA 3LRHA 2EXYD 4YFLI 4M1GL 1I1AD 4OCSL 4AT6A 3HE7D 1U3HC 1UYWL 4XAKE 3ZYIA 1WBXB 5JO5B 2VE6A 3T3MF 1KIUA 4O51A 1CLYL 3QI9D 1A1MB 2X4PB 5IW1A 4WFHE 3S35L 3TYFA 2FD6L 3RFZC 1BREA 4UBDD 4NC1E 5F9AC 2HMIC 2UZXB 1U8HB 4YBQC 1QBLH 4Y5YA 3LKQA 1X4XA 1X5HA 2AAVA 25C8H 5LWYH 4JN2B 5FUZH 4FQ1H 4LAQL 1JPGA 3S96A 3L3IA 4I13B 1XF4B 4RISH 1P7HL 2YZ1A 2P8LA 2X4QA 4XPHL 4Y1AA 3TVMA 3K3QA 2NY1B 1NGPL 4KTEL 1AI1H 3PABA 4PR5B 2EH8L 4ONOA 5EZOL 1ZEAL 3O6FD 2E9IA 1F4WH 4OLUL 5HYSA 1HXMB 3JBG7 1XR9A 1U8PA 3P0YL 3RY6A 1MY7A 2W59A 3KYKL 4R2GC 3UDWA 3TPUA 4PJHB 5KN5B 3BWAA 3LB6C 3SJVE 1QKZL 1HILA 3BPOC 4WHYG 4B7LA 1EXUB 3P0VH 5JXED 5BS0D 4Q7DA 1MEXL 4JFEE 4JZNB 1J1PL 1RU9H 3UTTB 4WV1B 2VQ1B 3RVWC 1NMAL 1BBJB 3ARBA 4FP8H 3FN0H 2VOTA 5HD8C 2DQJH 1VSCA 4PRAB 4R4FH 1BLNA 4LPTA 4OT1L 2QQNL 3L95A 1OP5K 2O5ZL 5J6HA 2AI0L 4YGVA 3ZE0E 4FN0A 3HUJA 4KVNH 5EIIB 2CDFB 3DETC 4X83A 4YDVA 3RVTD 3HB3C 4Q6IA 5I18L 1EDQA 4HUXA 2ED8A 3EKCA 4JREC 2YK1H 4H25A 4Z7WE 3WN5C 4RFOL 5DO2C 3SE9L 5GSRB 1E27B 4LLVA 4QRRE 2RHEA 2ATKB 4U6VH 3WHE1 2VISA 3VXRD 3TH2T 3WFHB 2CKBA 4MXVE 3U36B 3A6CL 1U8JA 3WUWG 4YQXH 1K8IA 3KHOA 1S5IL 3W0WD 4JRYD 3RX5A 4RGOH 1DBBH 3LEVL 1CF8H 3B3IB 4D8PA 3JTSA 4M7LL 5ENWB 1EO7A 3QEGH 4BKLB 5HDBE 4OF6A 4CGTA 1AHWB 2X09A 1RZJH 2PO6D 3WXVH 3QQ9D 3T0VA 5M7QA 4ZNEE 4KK6D 5T1KA 4ZXBA 4OLWH 5JXAL 5FYKE 2AXHA 3WFCH 4DVBA 1VEMA 3F7QA 3AAZA 1D5IH 1P6FA 3RY4A 5FFLA 2B5IC 4L3EB 5EZJB 4OCWH 4NKDA 1OTTD 1YYLL 3Q6GH 3BEWB 1YMHA 2GTZA 4NN6B 2H3NA 5CILH 4L29B 5SV4A 5CSZA 1CGTA 3GMNA 4TUJB 3QCTL 1ONQB 1DL7L 3MV7D 1I9EA 4HPOH 3RNKA 5FM8A 4YDIL 1Z0MA 5A2KH 4P4KB 5IJKA 4K3GA 5E5UB 1QR4A 5EUKB 3QUZD 5I6XB 4FFWC 4L4TE 1Q1JH 4HGWB 4B50A 4D0BA 5CEXA 4WRLA 2GCYB 3CFEB 2QHRL 1VACB 3O11A 3O3AB 1F90L 5CGYC 3P0GB 1S5HA 5TH2B 2AJSL 4M7KH 4OLYL 1PAMA 1FLRH 1AJ7H 2AJXH 2FB4H 3EZJB 1KC5L 1PW3A 3GSNL 3KXFB 1DEEB 3EFDL 2UWEF 4NYLA 5EO9A 2BK8A 5GS0L 1C7TA 2FATH 3JUZA 3GKWH 1KJ2L 3C8HA 1FH5H 1HKFA 4MWFA 1MCNA 3L3HB 1N3NB 1EV2E 3O6LL 1U3HD 4HLZH 3BRFA 5E00A 1ZVYA 3RI5K 3IVKA 3WJLC 3QR2A 4HX1B 1XF3A 2DKSA 2Y9RT 1SJEB 1B88A 2DQUL 4M4RA 3EOBA 3RZCC 2HMID 2AEPL 3RHWK 4YBQD 4PLOB 1VPOL 2DBLL 4L8CB 3C08L 2BDNH 4M5ZH 1KJMA 1Y0LA 2M8XA 1Z3GL 5DZOA 4NUJA 2RB8A 5T33L 3MZTA 1JYNA 5IB2B 3QDAA 4YBLC 3BZEA 1D6EB 3HG1D 4DUXA 2ORBH 1NUNB 5F1IB 5DJAA 1D9KA 1EGJL 4NO3B 1YN7B 3O6KH 4MNGA 2CDEB 4OQTA 1E6JH 4Q9RL 3T3ME 5KS9F 4YE4L 2JIXD 4ZFGL 2GK0B 4PG9A 4F7EA 3I02A 3V6OA 1ITCA 4UT6L 4G3YL 1CGSH 5DA4A 4ZOEA 4LF3A 5TF1L 3GRWL 4R2GD 3L7EA 4GW5A 1E28A 2X70B 5ICYA 1IRAY 3AFLA 1XGQA 4AIZB 1K2DB 5F88A 3FTGB 3LB6D 4M6OL 3THML 3K4DA 1VFBA 3GJEA 3LN9A 1WBYB 3CPLA 5IB5A 2J88L 1G6RA 1ZHNB 4HJGB 4LLAA 5JIKA 4IM8A 3RVWD 5TDNB 1ZHBA 5JORA 3ULUL 3D25B 3KPMB 4D9QE 5HD8D 1T66D 4OCXL 4PRPB 2FRGP 5C07A 2KL6A 1S9VB 3DBXB 1MIEL 1LDPH 4NQCE 4H8WH 4LLYA 1KXTB 2JCCA 1ETZB 2CDGB 1N59A 3G6DH 4PJCB 1OAKL 4NFCA 1JMXA 2CRIA 2B0SL 4DGYH 2HVJA 3DETD 5B38G 1R5VB 3HB3D 3U79A 1DBKL 4JG0L 4PLJC 3CFDB 4FS0A 1T2QL 3BE1H 1AXTL 3KWWB 5DO2D 4IRSB 5C6TL 1UQSB 4WUUD 1HDMB 4X8JA 2W9EL 3QQ3B 3ARXA 3WNPA 1BAFL 4MCZA 1WVZA 3BKMH 2LQRA 3BD3A 1XH3B 4KHTL 5F7NC 4KTDL 4E42B 1NAML 1YEIH 4MCYB 2F5AL 4DWHA 5D2NC 2FYYA 2YS4A 4U6HB 2H8PB 2HLAA 1T6VN 1EPFA 3Q2CA 1M71B 2BOBB 4ZO7A 3DYOA 1P4LA 3P4OA 4NC2B 3UMTA 4NWUL 3PWJA 4GQ9H 4JN2A 2VL5B 3MGOB 1J0KA 3NGBC 1XF4A 1NBVL 4LU5L 2DDQH 2Q86B 1BBDH 4Y5YC 1NFDF 4IDLA 4ONHA