1KYRA

Crystal structure of a cu-bound green fluorescent protein zn biosensor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
224
Chain Sequence
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSGNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green Fluorescent Protein
publication title Structural chemistry of a green fluorescent protein Zn biosensor.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 62
structure length 224
sequence length 225
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 1kyrA00
1W7UA 5DY6A 3DQCA 4H3MA 4BDUA 3I19A 3GB3A 4KGEA 2HRSA 4DXOA 2QLGB 3SG5A 4H48A 3DQAA 4JC2A 2A46A 3PJ7A 2ZO6A 1UISA 2GX2A 4H47A 3SSLA 3DQEA 2DUHA 4W6AA 3SVEA 1XMZA 2H9WA 3TMTA 3DQDA 1W7TA 3SSTA 2WISA 2FZUA 3H1OA 5EBJA 4JFGA 3SG4A 4DXQA 3VHTB 3CFFA 5HGEA 3U0KA 2C9JA 3LVDA 5EB6A 1KYPA 4ZF4A 2FL1A 2HPWA 1H6RA 3GJ1A 4W6KA 4RYSA 2EMNA 5LTRA 4PPJA 2G6YA 2AWJA 3ZTFA 4EN1A 3GEXA 3LF3A 3CB9A 1EMEA 5DPGA 3U0LA 1EMKA 5DQBA 3SSVA 2H6VA 2HCGA 3RWAA 2QU1A 5DRFA 2O2BA 3DQ3A 2A48A 2G5ZB 5DPIA 4W6CA 3PJBA 2OKYA 3NEZA 2A52B 4B30B 1YFPA 1RRXA 4IK1A 2G16B 3DQKA 2BTJA 4UTSA 2V4EB 2QRFA 2DUFA 2AWLA 1KP5A 3M24A 4W6PA 2DUEA 4W6HA 4W7DA 2G3DB 2H5OA 2POXA 3PJ5A 2Y0GA 4W6LA 1JC1A 3ST4A 3EKHA 3WLCA 4JEOA 3U8CA 2YE1A 5EXUA 4LJDA 4W6IA 2A47A 4OHSA 5H87A 4KEXA 2QLGA 3SVUA 5HZSA 4HVFA 4H3NA 4ZFSA 3O77A 5DQMA 3OSRA 4OGSA 2B3QA 3DQIA 3LSAA 4GF6B 4W7XA 2GW4B 4HQCA 4W7FA 5DTLA 3KCSA 3ED8A 2DD7A 2Z6YA 4R6BA 4DXIA 3DPWA 1W7SA 1ZGPA 4J89A 3ST3A 3NEDA 3VHTA 1EMBA 3LA1A 1EMFA 2H8QA 2Q57A 5DTYA 3ST0A 2H5RA 2QLEA 2WSOA 5BQLA 5BTTB 3EK4A 1OXDA 4P1QA 4Q9WA 4Z4MA 4Z4KA 4R6DA 3AKOA 1XSSA 1YHHA 2QT2A 2GW3A 4W6RA 3SG3A 5DPJA 3NF0A 2A54B 4ORNA 3WLDA 4L12A 2QZ0A 4OQWA 4IK5A 4GESB 1QXTA 4LJDC 3VK1A 3SSYA 2ZO7A 3A8SA 4B30A 4ZINA 2VVJA 5HZOA 2AH8A 2V4EA 3W1CA 2JADA 3CFHA 4DXNA 2EMDA 5F9GA 1MOUA 2WSNA 2O24A 1RMPA 4LQTA 2OTEA 4OJ0A 2Q6PA 5HW9A 3DQ6A 1Q4AA 4DKNA 1Q4BA 4W6BA 4W73A 1F09A 1XQMA 2WHUA 4L1IA 4H3LA 3DQ1A 4XGYA 4W6MA 1H4UA 4EDOA 2DDDA 1XA9A 4ANJA 3ADFA 1Q4EA 1HUYA 1S6ZA 1QYQA 2G2SB 3E5TA 2O29A 1ZUXA 2OTBA 1F0BA 4W6DA 2DDCA 3SVOA 4B5YA 1RMMA 4W69A 3LVAA 5HZTA 2ZMWA 3U0NA 4ZF5A 1Q4CA 3ST2A 2WURA 4XVPA 4EDSA 5LTQA 5BTTA 3DPXA 2V4EC 4HQ8A 3E5VA 4OY4A 2A56B 2WHTA 3SRYA 4TZAA 4DKMA 4W72A 4W6UA 1YHGA 4HE4A 3EK8A 3DQ5A 4EMQA 2VVHA 4PFEA 1B9CA 4IK3A 3DPZA 2HQZA 2YDZA 3NT9A 2DUIA 2QLIA 3V3DA 3OSQA 4EULA 2IB6A 4JGEA 2IB5A 3NT3A 4KF4A 5AQBB 1OXEA 3WCKA 4Q7TA 4W6TA 3IP2A 4I2YA 2IE2A 1QYOA 3E5WA 4W7RA 4W6JA 2Z1OA 4AS8A 1YJFA 4NWSA 1ZGQA 3SSKA 3S05A 4P76A 3RWTA 2QLHA 3DQ8A 3DQMA 1JBZA 3W1DA 4PPLA 1Q4DA 1G7KA 3P28A 3ZULA 3SS0A 3DQUA 3CD9A 1OXFA 4W74A 4Q7UA 4U2VA 4KF5A 1MYWA 2PXSA 3SVNA 1EMCA 1EMMA 3M22A 3K1KA 3DQJA 4J8AA 5BT0A 3CBEA 5EXBA 4ZBLA 4IK4A 2OKWA 3UFZA 4W7EA 3SVSA 3SVDA 4W75A 2IOVA 5FHVA 2VAEA 2HFCA 1XAEA 5FVGA 1QY3A 5HBDA 4KA9A 4KW8A 1YJ2A 2OGRA 3EVVA 4KPIA 3LF4B 3BX9A 3UG0A 3VICA 1BFPA 4LJBA 3EVRA 1EMGA 2GX0A 1KYRA 2G3OA 2RH7A 2DUGA 4LW5A 5FVIA 4N3DA 3SG2A 5J2OA 1YZWA 3DQOA 5EJUA 2H5QA 4PPKA 3U8PA 2HQKA 4KF5C 2AHAA 3O78A 2WIQA 4W7AA 4HQ9A 4IK8A 4AR7A 5FVFA 2VZXA 4W6OA 4W6FA 3TMRA 1CV7A 4RYWA 2A50B 4Q7RA 2ARLA 3SSPA 3SV5A 4L13A 2ZMUA 2AWMA 2PXWA 3PIBA 5H88A 3LVCA 5DTXA 3SVBA 5H89A 3GL4A 1JBYA 3DQLA 5EHUA 2C9IA 1RM9A 2AWKA 4ZIOA 5DRGA 3AI5A 1Z1QA 3BXAA 4KW9A 3H1RA 4W6SA 4DXMA 3BXBA 4RTCA 1MOVA 2OJKA 3DQ7A 2G6XA 2HGDA 3IR8A 3CD1A 2VADA 5EXCI 3ZUFA 1YHIA 2VVIA 3OGOA 2ICRA 3CGLA 3AI4A 3DQ2A 1GFLA 1QYFA 2YFPA 3MGFA 4W77A 4W7CA 3KCTA 2DD9A 4GOBA 2YE0A 3EKJA 1JC0A 2FWQA 1KYSA 2Z6ZA 3LS3A 4ZB1A 4DXPA 5LK4A 4W6GA 3U8AA 2WHSA 4JF9A 4IZNA 3SVCA 4J88A 2B3PA 3DQFA 1Q73A 4KAGA 2P4MA 4LQUA 3SG6A 3EVUA 3BXCA 4KGFA 1HCJA 1EMLA 4XOVA 4W76A 1Z1PA 4ZF3A 3DQ9A 5DPHA 3SVRA 1EMAA 3P8UA 2HJOA 2A53B 4JRBA 3SG7A 2EMOA 4LJCA 5EB7A 4XOWA 1GL4A 4TZGA 3GJ2A 4IK9A 4XL5A 3EVPA 5KTGA 2H5PA 5HZUA 4KW4A 3CFAA 1RMOA 5T3IA 1GGXA 3U0MA 3ZUJA 3EK7A 3G9AA 5LTPA 2Z6XA 5DU0A 1C4FA 3DQHA 4W6NA 2HGYA 5DTZA 3SSHA 4Q9XA 1ZGOA 2G6EA 3DQ4A 3DQNA
chains in the Genus database with same CATH superfamily
1W7UA 5DY6A 3DQCA 4H3MA 4BDUA 3I19A 3GB3A 4KGEA 2HRSA 4DXOA 2QLGB 3SG5A 4H48A 3DQAA 4JC2A 2A46A 3PJ7A 2ZO6A 1UISA 2GX2A 4H47A 3SSLA 3DQEA 2DUHA 4W6AA 3SVEA 1XMZA 2H9WA 3TMTA 3DQDA 1W7TA 3SSTA 2WISA 2FZUA 3H1OA 5EBJA 4JFGA 3SG4A 4DXQA 3VHTB 3CFFA 5HGEA 3U0KA 2C9JA 3LVDA 5EB6A 1KYPA 4ZF4A 2FL1A 2HPWA 1H6RA 3GJ1A 4W6KA 4RYSA 2EMNA 5LTRA 4PPJA 2G6YA 2AWJA 3ZTFA 4EN1A 3GEXA 3LF3A 3CB9A 1EMEA 5DPGA 3U0LA 1EMKA 5DQBA 3SSVA 2H6VA 2HCGA 3RWAA 2QU1A 5DRFA 2O2BA 3DQ3A 2A48A 2G5ZB 5DPIA 4W6CA 3PJBA 2OKYA 3NEZA 2A52B 4B30B 1YFPA 1RRXA 4IK1A 2G16B 3DQKA 2BTJA 4UTSA 2V4EB 2QRFA 2DUFA 2AWLA 1KP5A 3M24A 4W6PA 2DUEA 4W6HA 4W7DA 2G3DB 2H5OA 2POXA 3PJ5A 2Y0GA 4W6LA 1JC1A 3ST4A 3EKHA 3WLCA 4JEOA 3U8CA 2YE1A 5EXUA 4LJDA 4W6IA 2A47A 4OHSA 5H87A 4KEXA 2QLGA 3SVUA 5HZSA 4HVFA 4H3NA 4ZFSA 3O77A 5DQMA 3OSRA 4OGSA 2B3QA 3DQIA 3LSAA 4GF6B 4W7XA 2GW4B 4HQCA 4W7FA 5DTLA 3KCSA 3ED8A 2DD7A 2Z6YA 4R6BA 4DXIA 3DPWA 1W7SA 1ZGPA 4J89A 3ST3A 3NEDA 3VHTA 1EMBA 3LA1A 1EMFA 2H8QA 2Q57A 5DTYA 3ST0A 2H5RA 2QLEA 2WSOA 5BQLA 5BTTB 3EK4A 1OXDA 4P1QA 4Q9WA 4Z4MA 4Z4KA 4R6DA 3AKOA 1XSSA 1YHHA 2QT2A 2GW3A 4W6RA 3SG3A 5DPJA 3NF0A 2A54B 4ORNA 3WLDA 4L12A 2QZ0A 4OQWA 4IK5A 4GESB 1QXTA 4LJDC 3VK1A 3SSYA 2ZO7A 3A8SA 4B30A 4ZINA 2VVJA 5HZOA 2AH8A 2V4EA 3W1CA 2JADA 3CFHA 4DXNA 2EMDA 5F9GA 1MOUA 2WSNA 2O24A 1RMPA 4LQTA 2OTEA 4OJ0A 2Q6PA 5HW9A 3DQ6A 1Q4AA 4DKNA 1Q4BA 4W6BA 4W73A 1F09A 1XQMA 2WHUA 4L1IA 4H3LA 3DQ1A 4XGYA 4W6MA 1H4UA 4EDOA 2DDDA 1XA9A 4ANJA 3ADFA 1Q4EA 1HUYA 1S6ZA 1QYQA 2G2SB 3E5TA 2O29A 1ZUXA 2OTBA 1F0BA 4W6DA 2DDCA 3SVOA 4B5YA 1RMMA 4W69A 3LVAA 5HZTA 2ZMWA 3U0NA 4ZF5A 1Q4CA 3ST2A 2WURA 4XVPA 4EDSA 5LTQA 5BTTA 3DPXA 2V4EC 4HQ8A 3E5VA 4OY4A 2A56B 2WHTA 3SRYA 4TZAA 4DKMA 4W72A 4W6UA 1YHGA 4HE4A 3EK8A 3DQ5A 4EMQA 2VVHA 4PFEA 1B9CA 4IK3A 3DPZA 2HQZA 2YDZA 3NT9A 2DUIA 2QLIA 3V3DA 3OSQA 4EULA 2IB6A 4JGEA 2IB5A 3NT3A 4KF4A 5AQBB 1OXEA 3WCKA 4Q7TA 4W6TA 3IP2A 4I2YA 2IE2A 1QYOA 3E5WA 4W7RA 4W6JA 2Z1OA 4AS8A 1YJFA 4NWSA 1ZGQA 3SSKA 3S05A 4P76A 3RWTA 2QLHA 3DQ8A 3DQMA 1JBZA 3W1DA 4PPLA 1Q4DA 1G7KA 3P28A 3ZULA 3SS0A 3DQUA 3CD9A 1OXFA 4W74A 4Q7UA 4U2VA 4KF5A 1MYWA 2PXSA 3SVNA 1EMCA 1EMMA 3M22A 3K1KA 3DQJA 4J8AA 5BT0A 3CBEA 5EXBA 4ZBLA 4IK4A 2OKWA 3UFZA 4W7EA 3SVSA 3SVDA 4W75A 2IOVA 5FHVA 2VAEA 2HFCA 1XAEA 5FVGA 1QY3A 5HBDA 4KA9A 4KW8A 1YJ2A 2OGRA 3EVVA 4KPIA 3LF4B 3BX9A 3UG0A 3VICA 1BFPA 4LJBA 3EVRA 1EMGA 2GX0A 1KYRA 2G3OA 2RH7A 2DUGA 4LW5A 5FVIA 4N3DA 3SG2A 5J2OA 1YZWA 3DQOA 5EJUA 2H5QA 4PPKA 3U8PA 2HQKA 4KF5C 2AHAA 3O78A 2WIQA 4W7AA 4HQ9A 4IK8A 4AR7A 5FVFA 2VZXA 4W6OA 4W6FA 3TMRA 1CV7A 4RYWA 2A50B 4Q7RA 2ARLA 3SSPA 3SV5A 4L13A 2ZMUA 2AWMA 2PXWA 3PIBA 5H88A 3LVCA 5DTXA 3SVBA 5H89A 3GL4A 1JBYA 3DQLA 5EHUA 2C9IA 1RM9A 2AWKA 4ZIOA 5DRGA 3AI5A 1Z1QA 3BXAA 4KW9A 3H1RA 4W6SA 4DXMA 3BXBA 4RTCA 1MOVA 2OJKA 3DQ7A 2G6XA 2HGDA 3IR8A 3CD1A 2VADA 5EXCI 3ZUFA 1YHIA 2VVIA 3OGOA 2ICRA 3CGLA 3AI4A 3DQ2A 1GFLA 1QYFA 2YFPA 3MGFA 4W77A 4W7CA 3KCTA 2DD9A 4GOBA 2YE0A 3EKJA 1JC0A 2FWQA 1KYSA 2Z6ZA 3LS3A 4ZB1A 4DXPA 5LK4A 4W6GA 3U8AA 2WHSA 4JF9A 4IZNA 3SVCA 4J88A 2B3PA 3DQFA 1Q73A 4KAGA 2P4MA 4LQUA 3SG6A 3EVUA 3BXCA 4KGFA 1HCJA 1EMLA 4XOVA 4W76A 1Z1PA 4ZF3A 3DQ9A 5DPHA 3SVRA 1EMAA 3P8UA 2HJOA 2A53B 4JRBA 3SG7A 2EMOA 4LJCA 5EB7A 4XOWA 1GL4A 4TZGA 3GJ2A 4IK9A 4XL5A 3EVPA 5KTGA 2H5PA 5HZUA 4KW4A 3CFAA 1RMOA 5T3IA 1GGXA 3U0MA 3ZUJA 3EK7A 3G9AA 5LTPA 2Z6XA 5DU0A 1C4FA 3DQHA 4W6NA 2HGYA 5DTZA 3SSHA 4Q9XA 1ZGOA 2G6EA 3DQ4A 3DQNA
chains in the Genus database with same CATH topology
1W7UA 5DY6A 3DQCA 4H3MA 4BDUA 3I19A 3GB3A 4KGEA 2HRSA 4DXOA 2QLGB 3SG5A 4H48A 3DQAA 4JC2A 2A46A 3PJ7A 2ZO6A 1UISA 2GX2A 4H47A 3SSLA 3DQEA 2DUHA 4W6AA 3SVEA 1XMZA 2H9WA 3TMTA 3DQDA 1W7TA 3SSTA 2WISA 2FZUA 3H1OA 5EBJA 4JFGA 3SG4A 4DXQA 3VHTB 3CFFA 5HGEA 3U0KA 2C9JA 3LVDA 5EB6A 1KYPA 4ZF4A 2FL1A 2HPWA 1H6RA 3GJ1A 4W6KA 4RYSA 2EMNA 5LTRA 4PPJA 2G6YA 2AWJA 3ZTFA 4EN1A 3GEXA 3LF3A 3CB9A 1EMEA 5DPGA 3U0LA 1EMKA 5DQBA 3SSVA 2H6VA 2HCGA 3RWAA 2QU1A 5DRFA 2O2BA 3DQ3A 2A48A 2G5ZB 5DPIA 4W6CA 3PJBA 2OKYA 3NEZA 2A52B 4B30B 1YFPA 1RRXA 4IK1A 2G16B 3DQKA 2BTJA 4UTSA 2V4EB 2QRFA 2DUFA 2AWLA 1KP5A 3M24A 4W6PA 2DUEA 4W6HA 4W7DA 2G3DB 2H5OA 2POXA 3PJ5A 2Y0GA 4W6LA 1JC1A 3ST4A 3EKHA 3WLCA 4JEOA 3U8CA 2YE1A 5EXUA 4LJDA 4W6IA 2A47A 4OHSA 5H87A 4KEXA 2QLGA 3SVUA 5HZSA 4HVFA 4H3NA 4ZFSA 3O77A 5DQMA 3OSRA 4OGSA 2B3QA 3DQIA 3LSAA 4GF6B 4W7XA 2GW4B 4HQCA 4W7FA 5DTLA 3KCSA 3ED8A 2DD7A 2Z6YA 4R6BA 4DXIA 3DPWA 1W7SA 1ZGPA 4J89A 3ST3A 3NEDA 3VHTA 1EMBA 3LA1A 1EMFA 2H8QA 2Q57A 5DTYA 3ST0A 2H5RA 2QLEA 2WSOA 5BQLA 5BTTB 3EK4A 1OXDA 4P1QA 4Q9WA 4Z4MA 4Z4KA 4R6DA 3AKOA 1XSSA 1YHHA 2QT2A 2GW3A 4W6RA 3SG3A 5DPJA 3NF0A 2A54B 4ORNA 3WLDA 4L12A 2QZ0A 4OQWA 4IK5A 4GESB 1QXTA 4LJDC 3VK1A 3SSYA 2ZO7A 3A8SA 4B30A 4ZINA 2VVJA 5HZOA 2AH8A 2V4EA 3W1CA 2JADA 3CFHA 4DXNA 2EMDA 5F9GA 1MOUA 2WSNA 2O24A 1RMPA 4LQTA 2OTEA 4OJ0A 2Q6PA 5HW9A 3DQ6A 1Q4AA 4DKNA 1Q4BA 4W6BA 4W73A 1F09A 1XQMA 2WHUA 4L1IA 4H3LA 3DQ1A 4XGYA 4W6MA 1H4UA 4EDOA 2DDDA 1XA9A 4ANJA 3ADFA 1Q4EA 1HUYA 1S6ZA 1QYQA 2G2SB 3E5TA 2O29A 1ZUXA 2OTBA 1F0BA 4W6DA 2DDCA 3SVOA 4B5YA 1RMMA 4W69A 3LVAA 5HZTA 2ZMWA 3U0NA 4ZF5A 1Q4CA 3ST2A 2WURA 4XVPA 4EDSA 5LTQA 5BTTA 3DPXA 2V4EC 4HQ8A 3E5VA 4OY4A 2A56B 2WHTA 3SRYA 4TZAA 4DKMA 4W72A 4W6UA 1YHGA 4HE4A 3EK8A 3DQ5A 4EMQA 2VVHA 4PFEA 1B9CA 4IK3A 3DPZA 2HQZA 2YDZA 3NT9A 2DUIA 2QLIA 3V3DA 3OSQA 4EULA 2IB6A 4JGEA 2IB5A 3NT3A 4KF4A 5AQBB 1OXEA 3WCKA 4Q7TA 4W6TA 3IP2A 4I2YA 2IE2A 1QYOA 3E5WA 4W7RA 4W6JA 2Z1OA 4AS8A 1YJFA 4NWSA 1ZGQA 3SSKA 3S05A 4P76A 3RWTA 2QLHA 3DQ8A 3DQMA 1JBZA 3W1DA 4PPLA 1Q4DA 1G7KA 3P28A 3ZULA 3SS0A 3DQUA 3CD9A 1OXFA 4W74A 4Q7UA 4U2VA 4KF5A 1MYWA 2PXSA 3SVNA 1EMCA 1EMMA 3M22A 3K1KA 3DQJA 4J8AA 5BT0A 3CBEA 5EXBA 4ZBLA 4IK4A 2OKWA 3UFZA 4W7EA 3SVSA 3SVDA 4W75A 2IOVA 5FHVA 2VAEA 2HFCA 1XAEA 5FVGA 1QY3A 5HBDA 4KA9A 4KW8A 1YJ2A 2OGRA 3EVVA 4KPIA 3LF4B 3BX9A 3UG0A 3VICA 1BFPA 4LJBA 3EVRA 1EMGA 2GX0A 1KYRA 2G3OA 2RH7A 2DUGA 4LW5A 5FVIA 4N3DA 3SG2A 5J2OA 1YZWA 3DQOA 5EJUA 2H5QA 4PPKA 3U8PA 2HQKA 4KF5C 2AHAA 3O78A 2WIQA 4W7AA 4HQ9A 4IK8A 4AR7A 5FVFA 2VZXA 4W6OA 4W6FA 3TMRA 1CV7A 4RYWA 2A50B 4Q7RA 2ARLA 3SSPA 3SV5A 4L13A 2ZMUA 2AWMA 2PXWA 3PIBA 5H88A 3LVCA 5DTXA 3SVBA 5H89A 3GL4A 1JBYA 3DQLA 5EHUA 2C9IA 1RM9A 2AWKA 4ZIOA 5DRGA 3AI5A 1Z1QA 3BXAA 4KW9A 3H1RA 4W6SA 4DXMA 3BXBA 4RTCA 1MOVA 2OJKA 3DQ7A 2G6XA 2HGDA 3IR8A 3CD1A 2VADA 5EXCI 3ZUFA 1YHIA 2VVIA 3OGOA 2ICRA 3CGLA 3AI4A 3DQ2A 1GFLA 1QYFA 2YFPA 3MGFA 4W77A 4W7CA 3KCTA 2DD9A 4GOBA 2YE0A 3EKJA 1JC0A 2FWQA 1KYSA 2Z6ZA 3LS3A 4ZB1A 4DXPA 5LK4A 4W6GA 3U8AA 2WHSA 4JF9A 4IZNA 3SVCA 4J88A 2B3PA 3DQFA 1Q73A 4KAGA 2P4MA 4LQUA 3SG6A 3EVUA 3BXCA 4KGFA 1HCJA 1EMLA 4XOVA 4W76A 1Z1PA 4ZF3A 3DQ9A 5DPHA 3SVRA 1EMAA 3P8UA 2HJOA 2A53B 4JRBA 3SG7A 2EMOA 4LJCA 5EB7A 4XOWA 1GL4A 4TZGA 3GJ2A 4IK9A 4XL5A 3EVPA 5KTGA 2H5PA 5HZUA 4KW4A 3CFAA 1RMOA 5T3IA 1GGXA 3U0MA 3ZUJA 3EK7A 3G9AA 5LTPA 2Z6XA 5DU0A 1C4FA 3DQHA 4W6NA 2HGYA 5DTZA 3SSHA 4Q9XA 1ZGOA 2G6EA 3DQ4A 3DQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7U A;  5DY6 A;  3DQC A;  4H3M A;  4BDU A;  3I19 A;  3GB3 A;  4KGE A;  2HRS A;  4DXO A;  2QLG B;  3SG5 A;  4H48 A;  3DQA A;  4JC2 A;  2A46 A;  3PJ7 A;  2ZO6 A;  1UIS A;  2GX2 A;  4H47 A;  3SSL A;  3DQE A;  2DUH A;  4W6A A;  3SVE A;  1XMZ A;  2H9W A;  3TMT A;  3DQD A;  1W7T A;  3SST A;  2WIS A;  2FZU A;  3H1O A;  5EBJ A;  4JFG A;  3SG4 A;  4DXQ A;  3VHT B;  3CFF A;  5HGE A;  3U0K A;  2C9J A;  3LVD A;  5EB6 A;  1KYP A;  4ZF4 A;  2FL1 A;  2HPW A;  1H6R A;  3GJ1 A;  4W6K A;  4RYS A;  2EMN A;  5LTR A;  4PPJ A;  2G6Y A;  2AWJ A;  3ZTF A;  4EN1 A;  3GEX A;  3LF3 A;  3CB9 A;  1EME A;  5DPG A;  3U0L A;  1EMK A;  5DQB A;  3SSV A;  2H6V A;  2HCG A;  3RWA A;  2QU1 A;  5DRF A;  2O2B A;  3DQ3 A;  2A48 A;  2G5Z B;  5DPI A;  4W6C A;  3PJB A;  2OKY A;  3NEZ A;  2A52 B;  4B30 B;  1YFP A;  1RRX A;  4IK1 A;  2G16 B;  3DQK A;  2BTJ A;  4UTS A;  2V4E B;  2QRF A;  2DUF A;  2AWL A;  1KP5 A;  3M24 A;  4W6P A;  2DUE A;  4W6H A;  4W7D A;  2G3D B;  2H5O A;  2POX A;  3PJ5 A;  2Y0G A;  4W6L A;  1JC1 A;  3ST4 A;  3EKH A;  3WLC A;  4JEO A;  3U8C A;  2YE1 A;  5EXU A;  4LJD A;  4W6I A;  2A47 A;  4OHS A;  5H87 A;  4KEX A;  2QLG A;  3SVU A;  5HZS A;  4HVF A;  4H3N A;  4ZFS A;  3O77 A;  5DQM A;  3OSR A;  4OGS A;  2B3Q A;  3DQI A;  3LSA A;  4GF6 B;  4W7X A;  2GW4 B;  4HQC A;  4W7F A;  5DTL A;  3KCS A;  3ED8 A;  2DD7 A;  2Z6Y A;  4R6B A;  4DXI A;  3DPW A;  1W7S A;  1ZGP A;  4J89 A;  3ST3 A;  3NED A;  3VHT A;  1EMB A;  3LA1 A;  1EMF A;  2H8Q A;  2Q57 A;  5DTY A;  3ST0 A;  2H5R A;  2QLE A;  2WSO A;  5BQL A;  5BTT B;  3EK4 A;  1OXD A;  4P1Q A;  4Q9W A;  4Z4M A;  4Z4K A;  4R6D A;  3AKO A;  1XSS A;  1YHH A;  2QT2 A;  2GW3 A;  4W6R A;  3SG3 A;  5DPJ A;  3NF0 A;  2A54 B;  4ORN A;  3WLD A;  4L12 A;  2QZ0 A;  4OQW A;  4IK5 A;  4GES B;  1QXT A;  4LJD C;  3VK1 A;  3SSY A;  2ZO7 A;  3A8S A;  4B30 A;  4ZIN A;  2VVJ A;  5HZO A;  2AH8 A;  2V4E A;  3W1C A;  2JAD A;  3CFH A;  4DXN A;  2EMD A;  5F9G A;  1MOU A;  2WSN A;  2O24 A;  1RMP A;  4LQT A;  2OTE A;  4OJ0 A;  2Q6P A;  5HW9 A;  3DQ6 A;  1Q4A A;  4DKN A;  1Q4B A;  4W6B A;  4W73 A;  1F09 A;  1XQM A;  2WHU A;  4L1I A;  4H3L A;  3DQ1 A;  4XGY A;  4W6M A;  1H4U A;  4EDO A;  2DDD A;  1XA9 A;  4ANJ A;  3ADF A;  1Q4E A;  1HUY A;  1S6Z A;  1QYQ A;  2G2S B;  3E5T A;  2O29 A;  1ZUX A;  2OTB A;  1F0B A;  4W6D A;  2DDC A;  3SVO A;  4B5Y A;  1RMM A;  4W69 A;  3LVA A;  5HZT A;  2ZMW A;  3U0N A;  4ZF5 A;  1Q4C A;  3ST2 A;  2WUR A;  4XVP A;  4EDS A;  5LTQ A;  5BTT A;  3DPX A;  2V4E C;  4HQ8 A;  3E5V A;  4OY4 A;  2A56 B;  2WHT A;  3SRY A;  4TZA A;  4DKM A;  4W72 A;  4W6U A;  1YHG A;  4HE4 A;  3EK8 A;  3DQ5 A;  4EMQ A;  2VVH A;  4PFE A;  1B9C A;  4IK3 A;  3DPZ A;  2HQZ A;  2YDZ A;  3NT9 A;  2DUI A;  2QLI A;  3V3D A;  3OSQ A;  4EUL A;  2IB6 A;  4JGE A;  2IB5 A;  3NT3 A;  4KF4 A;  5AQB B;  1OXE A;  3WCK A;  4Q7T A;  4W6T A;  3IP2 A;  4I2Y A;  2IE2 A;  1QYO A;  3E5W A;  4W7R A;  4W6J A;  2Z1O A;  4AS8 A;  1YJF A;  4NWS A;  1ZGQ A;  3SSK A;  3S05 A;  4P76 A;  3RWT A;  2QLH A;  3DQ8 A;  3DQM A;  1JBZ A;  3W1D A;  4PPL A;  1Q4D A;  1G7K A;  3P28 A;  3ZUL A;  3SS0 A;  3DQU A;  3CD9 A;  1OXF A;  4W74 A;  4Q7U A;  4U2V A;  4KF5 A;  1MYW A;  2PXS A;  3SVN A;  1EMC A;  1EMM A;  3M22 A;  3K1K A;  3DQJ A;  4J8A A;  5BT0 A;  3CBE A;  5EXB A;  4ZBL A;  4IK4 A;  2OKW A;  3UFZ A;  4W7E A;  3SVS A;  3SVD A;  4W75 A;  2IOV A;  5FHV A;  2VAE A;  2HFC A;  1XAE A;  5FVG A;  1QY3 A;  5HBD A;  4KA9 A;  4KW8 A;  1YJ2 A;  2OGR A;  3EVV A;  4KPI A;  3LF4 B;  3BX9 A;  3UG0 A;  3VIC A;  1BFP A;  4LJB A;  3EVR A;  1EMG A;  2GX0 A;  1KYR A;  2G3O A;  2RH7 A;  2DUG A;  4LW5 A;  5FVI A;  4N3D A;  3SG2 A;  5J2O A;  1YZW A;  3DQO A;  5EJU A;  2H5Q A;  4PPK A;  3U8P A;  2HQK A;  4KF5 C;  2AHA A;  3O78 A;  2WIQ A;  4W7A A;  4HQ9 A;  4IK8 A;  4AR7 A;  5FVF A;  2VZX A;  4W6O A;  4W6F A;  3TMR A;  1CV7 A;  4RYW A;  2A50 B;  4Q7R A;  2ARL A;  3SSP A;  3SV5 A;  4L13 A;  2ZMU A;  2AWM A;  2PXW A;  3PIB A;  5H88 A;  3LVC A;  5DTX A;  3SVB A;  5H89 A;  3GL4 A;  1JBY A;  3DQL A;  5EHU A;  2C9I A;  1RM9 A;  2AWK A;  4ZIO A;  5DRG A;  3AI5 A;  1Z1Q A;  3BXA A;  4KW9 A;  3H1R A;  4W6S A;  4DXM A;  3BXB A;  4RTC A;  1MOV A;  2OJK A;  3DQ7 A;  2G6X A;  2HGD A;  3IR8 A;  3CD1 A;  2VAD A;  5EXC I;  3ZUF A;  1YHI A;  2VVI A;  3OGO A;  2ICR A;  3CGL A;  3AI4 A;  3DQ2 A;  1GFL A;  1QYF A;  2YFP A;  3MGF A;  4W77 A;  4W7C A;  3KCT A;  2DD9 A;  4GOB A;  2YE0 A;  3EKJ A;  1JC0 A;  2FWQ A;  1KYS A;  2Z6Z A;  3LS3 A;  4ZB1 A;  4DXP A;  5LK4 A;  4W6G A;  3U8A A;  2WHS A;  4JF9 A;  4IZN A;  3SVC A;  4J88 A;  2B3P A;  3DQF A;  1Q73 A;  4KAG A;  2P4M A;  4LQU A;  3SG6 A;  3EVU A;  3BXC A;  4KGF A;  1HCJ A;  1EML A;  4XOV A;  4W76 A;  1Z1P A;  4ZF3 A;  3DQ9 A;  5DPH A;  3SVR A;  1EMA A;  3P8U A;  2HJO A;  2A53 B;  4JRB A;  3SG7 A;  2EMO A;  4LJC A;  5EB7 A;  4XOW A;  1GL4 A;  4TZG A;  3GJ2 A;  4IK9 A;  4XL5 A;  3EVP A;  5KTG A;  2H5P A;  5HZU A;  4KW4 A;  3CFA A;  1RMO A;  5T3I A;  1GGX A;  3U0M A;  3ZUJ A;  3EK7 A;  3G9A A;  5LTP A;  2Z6X A;  5DU0 A;  1C4F A;  3DQH A;  4W6N A;  2HGY A;  5DTZ A;  3SSH A;  4Q9X A;  1ZGO A;  2G6E A;  3DQ4 A;  3DQN A; 
#chains in the Genus database with same CATH topology
 1W7U A;  5DY6 A;  3DQC A;  4H3M A;  4BDU A;  3I19 A;  3GB3 A;  4KGE A;  2HRS A;  4DXO A;  2QLG B;  3SG5 A;  4H48 A;  3DQA A;  4JC2 A;  2A46 A;  3PJ7 A;  2ZO6 A;  1UIS A;  2GX2 A;  4H47 A;  3SSL A;  3DQE A;  2DUH A;  4W6A A;  3SVE A;  1XMZ A;  2H9W A;  3TMT A;  3DQD A;  1W7T A;  3SST A;  2WIS A;  2FZU A;  3H1O A;  5EBJ A;  4JFG A;  3SG4 A;  4DXQ A;  3VHT B;  3CFF A;  5HGE A;  3U0K A;  2C9J A;  3LVD A;  5EB6 A;  1KYP A;  4ZF4 A;  2FL1 A;  2HPW A;  1H6R A;  3GJ1 A;  4W6K A;  4RYS A;  2EMN A;  5LTR A;  4PPJ A;  2G6Y A;  2AWJ A;  3ZTF A;  4EN1 A;  3GEX A;  3LF3 A;  3CB9 A;  1EME A;  5DPG A;  3U0L A;  1EMK A;  5DQB A;  3SSV A;  2H6V A;  2HCG A;  3RWA A;  2QU1 A;  5DRF A;  2O2B A;  3DQ3 A;  2A48 A;  2G5Z B;  5DPI A;  4W6C A;  3PJB A;  2OKY A;  3NEZ A;  2A52 B;  4B30 B;  1YFP A;  1RRX A;  4IK1 A;  2G16 B;  3DQK A;  2BTJ A;  4UTS A;  2V4E B;  2QRF A;  2DUF A;  2AWL A;  1KP5 A;  3M24 A;  4W6P A;  2DUE A;  4W6H A;  4W7D A;  2G3D B;  2H5O A;  2POX A;  3PJ5 A;  2Y0G A;  4W6L A;  1JC1 A;  3ST4 A;  3EKH A;  3WLC A;  4JEO A;  3U8C A;  2YE1 A;  5EXU A;  4LJD A;  4W6I A;  2A47 A;  4OHS A;  5H87 A;  4KEX A;  2QLG A;  3SVU A;  5HZS A;  4HVF A;  4H3N A;  4ZFS A;  3O77 A;  5DQM A;  3OSR A;  4OGS A;  2B3Q A;  3DQI A;  3LSA A;  4GF6 B;  4W7X A;  2GW4 B;  4HQC A;  4W7F A;  5DTL A;  3KCS A;  3ED8 A;  2DD7 A;  2Z6Y A;  4R6B A;  4DXI A;  3DPW A;  1W7S A;  1ZGP A;  4J89 A;  3ST3 A;  3NED A;  3VHT A;  1EMB A;  3LA1 A;  1EMF A;  2H8Q A;  2Q57 A;  5DTY A;  3ST0 A;  2H5R A;  2QLE A;  2WSO A;  5BQL A;  5BTT B;  3EK4 A;  1OXD A;  4P1Q A;  4Q9W A;  4Z4M A;  4Z4K A;  4R6D A;  3AKO A;  1XSS A;  1YHH A;  2QT2 A;  2GW3 A;  4W6R A;  3SG3 A;  5DPJ A;  3NF0 A;  2A54 B;  4ORN A;  3WLD A;  4L12 A;  2QZ0 A;  4OQW A;  4IK5 A;  4GES B;  1QXT A;  4LJD C;  3VK1 A;  3SSY A;  2ZO7 A;  3A8S A;  4B30 A;  4ZIN A;  2VVJ A;  5HZO A;  2AH8 A;  2V4E A;  3W1C A;  2JAD A;  3CFH A;  4DXN A;  2EMD A;  5F9G A;  1MOU A;  2WSN A;  2O24 A;  1RMP A;  4LQT A;  2OTE A;  4OJ0 A;  2Q6P A;  5HW9 A;  3DQ6 A;  1Q4A A;  4DKN A;  1Q4B A;  4W6B A;  4W73 A;  1F09 A;  1XQM A;  2WHU A;  4L1I A;  4H3L A;  3DQ1 A;  4XGY A;  4W6M A;  1H4U A;  4EDO A;  2DDD A;  1XA9 A;  4ANJ A;  3ADF A;  1Q4E A;  1HUY A;  1S6Z A;  1QYQ A;  2G2S B;  3E5T A;  2O29 A;  1ZUX A;  2OTB A;  1F0B A;  4W6D A;  2DDC A;  3SVO A;  4B5Y A;  1RMM A;  4W69 A;  3LVA A;  5HZT A;  2ZMW A;  3U0N A;  4ZF5 A;  1Q4C A;  3ST2 A;  2WUR A;  4XVP A;  4EDS A;  5LTQ A;  5BTT A;  3DPX A;  2V4E C;  4HQ8 A;  3E5V A;  4OY4 A;  2A56 B;  2WHT A;  3SRY A;  4TZA A;  4DKM A;  4W72 A;  4W6U A;  1YHG A;  4HE4 A;  3EK8 A;  3DQ5 A;  4EMQ A;  2VVH A;  4PFE A;  1B9C A;  4IK3 A;  3DPZ A;  2HQZ A;  2YDZ A;  3NT9 A;  2DUI A;  2QLI A;  3V3D A;  3OSQ A;  4EUL A;  2IB6 A;  4JGE A;  2IB5 A;  3NT3 A;  4KF4 A;  5AQB B;  1OXE A;  3WCK A;  4Q7T A;  4W6T A;  3IP2 A;  4I2Y A;  2IE2 A;  1QYO A;  3E5W A;  4W7R A;  4W6J A;  2Z1O A;  4AS8 A;  1YJF A;  4NWS A;  1ZGQ A;  3SSK A;  3S05 A;  4P76 A;  3RWT A;  2QLH A;  3DQ8 A;  3DQM A;  1JBZ A;  3W1D A;  4PPL A;  1Q4D A;  1G7K A;  3P28 A;  3ZUL A;  3SS0 A;  3DQU A;  3CD9 A;  1OXF A;  4W74 A;  4Q7U A;  4U2V A;  4KF5 A;  1MYW A;  2PXS A;  3SVN A;  1EMC A;  1EMM A;  3M22 A;  3K1K A;  3DQJ A;  4J8A A;  5BT0 A;  3CBE A;  5EXB A;  4ZBL A;  4IK4 A;  2OKW A;  3UFZ A;  4W7E A;  3SVS A;  3SVD A;  4W75 A;  2IOV A;  5FHV A;  2VAE A;  2HFC A;  1XAE A;  5FVG A;  1QY3 A;  5HBD A;  4KA9 A;  4KW8 A;  1YJ2 A;  2OGR A;  3EVV A;  4KPI A;  3LF4 B;  3BX9 A;  3UG0 A;  3VIC A;  1BFP A;  4LJB A;  3EVR A;  1EMG A;  2GX0 A;  1KYR A;  2G3O A;  2RH7 A;  2DUG A;  4LW5 A;  5FVI A;  4N3D A;  3SG2 A;  5J2O A;  1YZW A;  3DQO A;  5EJU A;  2H5Q A;  4PPK A;  3U8P A;  2HQK A;  4KF5 C;  2AHA A;  3O78 A;  2WIQ A;  4W7A A;  4HQ9 A;  4IK8 A;  4AR7 A;  5FVF A;  2VZX A;  4W6O A;  4W6F A;  3TMR A;  1CV7 A;  4RYW A;  2A50 B;  4Q7R A;  2ARL A;  3SSP A;  3SV5 A;  4L13 A;  2ZMU A;  2AWM A;  2PXW A;  3PIB A;  5H88 A;  3LVC A;  5DTX A;  3SVB A;  5H89 A;  3GL4 A;  1JBY A;  3DQL A;  5EHU A;  2C9I A;  1RM9 A;  2AWK A;  4ZIO A;  5DRG A;  3AI5 A;  1Z1Q A;  3BXA A;  4KW9 A;  3H1R A;  4W6S A;  4DXM A;  3BXB A;  4RTC A;  1MOV A;  2OJK A;  3DQ7 A;  2G6X A;  2HGD A;  3IR8 A;  3CD1 A;  2VAD A;  5EXC I;  3ZUF A;  1YHI A;  2VVI A;  3OGO A;  2ICR A;  3CGL A;  3AI4 A;  3DQ2 A;  1GFL A;  1QYF A;  2YFP A;  3MGF A;  4W77 A;  4W7C A;  3KCT A;  2DD9 A;  4GOB A;  2YE0 A;  3EKJ A;  1JC0 A;  2FWQ A;  1KYS A;  2Z6Z A;  3LS3 A;  4ZB1 A;  4DXP A;  5LK4 A;  4W6G A;  3U8A A;  2WHS A;  4JF9 A;  4IZN A;  3SVC A;  4J88 A;  2B3P A;  3DQF A;  1Q73 A;  4KAG A;  2P4M A;  4LQU A;  3SG6 A;  3EVU A;  3BXC A;  4KGF A;  1HCJ A;  1EML A;  4XOV A;  4W76 A;  1Z1P A;  4ZF3 A;  3DQ9 A;  5DPH A;  3SVR A;  1EMA A;  3P8U A;  2HJO A;  2A53 B;  4JRB A;  3SG7 A;  2EMO A;  4LJC A;  5EB7 A;  4XOW A;  1GL4 A;  4TZG A;  3GJ2 A;  4IK9 A;  4XL5 A;  3EVP A;  5KTG A;  2H5P A;  5HZU A;  4KW4 A;  3CFA A;  1RMO A;  5T3I A;  1GGX A;  3U0M A;  3ZUJ A;  3EK7 A;  3G9A A;  5LTP A;  2Z6X A;  5DU0 A;  1C4F A;  3DQH A;  4W6N A;  2HGY A;  5DTZ A;  3SSH A;  4Q9X A;  1ZGO A;  2G6E A;  3DQ4 A;  3DQN A; 
#chains in the Genus database with same CATH homology
 1W7U A;  5DY6 A;  3DQC A;  4H3M A;  4BDU A;  3I19 A;  3GB3 A;  4KGE A;  2HRS A;  4DXO A;  2QLG B;  3SG5 A;  4H48 A;  3DQA A;  4JC2 A;  2A46 A;  3PJ7 A;  2ZO6 A;  1UIS A;  2GX2 A;  4H47 A;  3SSL A;  3DQE A;  2DUH A;  4W6A A;  3SVE A;  1XMZ A;  2H9W A;  3TMT A;  3DQD A;  1W7T A;  3SST A;  2WIS A;  2FZU A;  3H1O A;  5EBJ A;  4JFG A;  3SG4 A;  4DXQ A;  3VHT B;  3CFF A;  5HGE A;  3U0K A;  2C9J A;  3LVD A;  5EB6 A;  1KYP A;  4ZF4 A;  2FL1 A;  2HPW A;  1H6R A;  3GJ1 A;  4W6K A;  4RYS A;  2EMN A;  5LTR A;  4PPJ A;  2G6Y A;  2AWJ A;  3ZTF A;  4EN1 A;  3GEX A;  3LF3 A;  3CB9 A;  1EME A;  5DPG A;  3U0L A;  1EMK A;  5DQB A;  3SSV A;  2H6V A;  2HCG A;  3RWA A;  2QU1 A;  5DRF A;  2O2B A;  3DQ3 A;  2A48 A;  2G5Z B;  5DPI A;  4W6C A;  3PJB A;  2OKY A;  3NEZ A;  2A52 B;  4B30 B;  1YFP A;  1RRX A;  4IK1 A;  2G16 B;  3DQK A;  2BTJ A;  4UTS A;  2V4E B;  2QRF A;  2DUF A;  2AWL A;  1KP5 A;  3M24 A;  4W6P A;  2DUE A;  4W6H A;  4W7D A;  2G3D B;  2H5O A;  2POX A;  3PJ5 A;  2Y0G A;  4W6L A;  1JC1 A;  3ST4 A;  3EKH A;  3WLC A;  4JEO A;  3U8C A;  2YE1 A;  5EXU A;  4LJD A;  4W6I A;  2A47 A;  4OHS A;  5H87 A;  4KEX A;  2QLG A;  3SVU A;  5HZS A;  4HVF A;  4H3N A;  4ZFS A;  3O77 A;  5DQM A;  3OSR A;  4OGS A;  2B3Q A;  3DQI A;  3LSA A;  4GF6 B;  4W7X A;  2GW4 B;  4HQC A;  4W7F A;  5DTL A;  3KCS A;  3ED8 A;  2DD7 A;  2Z6Y A;  4R6B A;  4DXI A;  3DPW A;  1W7S A;  1ZGP A;  4J89 A;  3ST3 A;  3NED A;  3VHT A;  1EMB A;  3LA1 A;  1EMF A;  2H8Q A;  2Q57 A;  5DTY A;  3ST0 A;  2H5R A;  2QLE A;  2WSO A;  5BQL A;  5BTT B;  3EK4 A;  1OXD A;  4P1Q A;  4Q9W A;  4Z4M A;  4Z4K A;  4R6D A;  3AKO A;  1XSS A;  1YHH A;  2QT2 A;  2GW3 A;  4W6R A;  3SG3 A;  5DPJ A;  3NF0 A;  2A54 B;  4ORN A;  3WLD A;  4L12 A;  2QZ0 A;  4OQW A;  4IK5 A;  4GES B;  1QXT A;  4LJD C;  3VK1 A;  3SSY A;  2ZO7 A;  3A8S A;  4B30 A;  4ZIN A;  2VVJ A;  5HZO A;  2AH8 A;  2V4E A;  3W1C A;  2JAD A;  3CFH A;  4DXN A;  2EMD A;  5F9G A;  1MOU A;  2WSN A;  2O24 A;  1RMP A;  4LQT A;  2OTE A;  4OJ0 A;  2Q6P A;  5HW9 A;  3DQ6 A;  1Q4A A;  4DKN A;  1Q4B A;  4W6B A;  4W73 A;  1F09 A;  1XQM A;  2WHU A;  4L1I A;  4H3L A;  3DQ1 A;  4XGY A;  4W6M A;  1H4U A;  4EDO A;  2DDD A;  1XA9 A;  4ANJ A;  3ADF A;  1Q4E A;  1HUY A;  1S6Z A;  1QYQ A;  2G2S B;  3E5T A;  2O29 A;  1ZUX A;  2OTB A;  1F0B A;  4W6D A;  2DDC A;  3SVO A;  4B5Y A;  1RMM A;  4W69 A;  3LVA A;  5HZT A;  2ZMW A;  3U0N A;  4ZF5 A;  1Q4C A;  3ST2 A;  2WUR A;  4XVP A;  4EDS A;  5LTQ A;  5BTT A;  3DPX A;  2V4E C;  4HQ8 A;  3E5V A;  4OY4 A;  2A56 B;  2WHT A;  3SRY A;  4TZA A;  4DKM A;  4W72 A;  4W6U A;  1YHG A;  4HE4 A;  3EK8 A;  3DQ5 A;  4EMQ A;  2VVH A;  4PFE A;  1B9C A;  4IK3 A;  3DPZ A;  2HQZ A;  2YDZ A;  3NT9 A;  2DUI A;  2QLI A;  3V3D A;  3OSQ A;  4EUL A;  2IB6 A;  4JGE A;  2IB5 A;  3NT3 A;  4KF4 A;  5AQB B;  1OXE A;  3WCK A;  4Q7T A;  4W6T A;  3IP2 A;  4I2Y A;  2IE2 A;  1QYO A;  3E5W A;  4W7R A;  4W6J A;  2Z1O A;  4AS8 A;  1YJF A;  4NWS A;  1ZGQ A;  3SSK A;  3S05 A;  4P76 A;  3RWT A;  2QLH A;  3DQ8 A;  3DQM A;  1JBZ A;  3W1D A;  4PPL A;  1Q4D A;  1G7K A;  3P28 A;  3ZUL A;  3SS0 A;  3DQU A;  3CD9 A;  1OXF A;  4W74 A;  4Q7U A;  4U2V A;  4KF5 A;  1MYW A;  2PXS A;  3SVN A;  1EMC A;  1EMM A;  3M22 A;  3K1K A;  3DQJ A;  4J8A A;  5BT0 A;  3CBE A;  5EXB A;  4ZBL A;  4IK4 A;  2OKW A;  3UFZ A;  4W7E A;  3SVS A;  3SVD A;  4W75 A;  2IOV A;  5FHV A;  2VAE A;  2HFC A;  1XAE A;  5FVG A;  1QY3 A;  5HBD A;  4KA9 A;  4KW8 A;  1YJ2 A;  2OGR A;  3EVV A;  4KPI A;  3LF4 B;  3BX9 A;  3UG0 A;  3VIC A;  1BFP A;  4LJB A;  3EVR A;  1EMG A;  2GX0 A;  1KYR A;  2G3O A;  2RH7 A;  2DUG A;  4LW5 A;  5FVI A;  4N3D A;  3SG2 A;  5J2O A;  1YZW A;  3DQO A;  5EJU A;  2H5Q A;  4PPK A;  3U8P A;  2HQK A;  4KF5 C;  2AHA A;  3O78 A;  2WIQ A;  4W7A A;  4HQ9 A;  4IK8 A;  4AR7 A;  5FVF A;  2VZX A;  4W6O A;  4W6F A;  3TMR A;  1CV7 A;  4RYW A;  2A50 B;  4Q7R A;  2ARL A;  3SSP A;  3SV5 A;  4L13 A;  2ZMU A;  2AWM A;  2PXW A;  3PIB A;  5H88 A;  3LVC A;  5DTX A;  3SVB A;  5H89 A;  3GL4 A;  1JBY A;  3DQL A;  5EHU A;  2C9I A;  1RM9 A;  2AWK A;  4ZIO A;  5DRG A;  3AI5 A;  1Z1Q A;  3BXA A;  4KW9 A;  3H1R A;  4W6S A;  4DXM A;  3BXB A;  4RTC A;  1MOV A;  2OJK A;  3DQ7 A;  2G6X A;  2HGD A;  3IR8 A;  3CD1 A;  2VAD A;  5EXC I;  3ZUF A;  1YHI A;  2VVI A;  3OGO A;  2ICR A;  3CGL A;  3AI4 A;  3DQ2 A;  1GFL A;  1QYF A;  2YFP A;  3MGF A;  4W77 A;  4W7C A;  3KCT A;  2DD9 A;  4GOB A;  2YE0 A;  3EKJ A;  1JC0 A;  2FWQ A;  1KYS A;  2Z6Z A;  3LS3 A;  4ZB1 A;  4DXP A;  5LK4 A;  4W6G A;  3U8A A;  2WHS A;  4JF9 A;  4IZN A;  3SVC A;  4J88 A;  2B3P A;  3DQF A;  1Q73 A;  4KAG A;  2P4M A;  4LQU A;  3SG6 A;  3EVU A;  3BXC A;  4KGF A;  1HCJ A;  1EML A;  4XOV A;  4W76 A;  1Z1P A;  4ZF3 A;  3DQ9 A;  5DPH A;  3SVR A;  1EMA A;  3P8U A;  2HJO A;  2A53 B;  4JRB A;  3SG7 A;  2EMO A;  4LJC A;  5EB7 A;  4XOW A;  1GL4 A;  4TZG A;  3GJ2 A;  4IK9 A;  4XL5 A;  3EVP A;  5KTG A;  2H5P A;  5HZU A;  4KW4 A;  3CFA A;  1RMO A;  5T3I A;  1GGX A;  3U0M A;  3ZUJ A;  3EK7 A;  3G9A A;  5LTP A;  2Z6X A;  5DU0 A;  1C4F A;  3DQH A;  4W6N A;  2HGY A;  5DTZ A;  3SSH A;  4Q9X A;  1ZGO A;  2G6E A;  3DQ4 A;  3DQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...