1KYSA

Crystal structure of a zn-bound green fluorescent protein biosensor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
225
structure length
224
Chain Sequence
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSGNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green Fluorescent Protein
publication title Structural chemistry of a green fluorescent protein Zn biosensor.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 64
structure length 224
sequence length 225
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 1kysA00
1Q4AA 2A48A 3LA1A 1YJ2A 2ZMUA 1YHHA 3SS0A 4KGFA 3ZUJA 4HQ8A 5LK4A 3U0LA 2A54B 1QY3A 4IK5A 2EMNA 2ZO7A 2H5RA 4KW4A 3IR8A 3LF3A 2WIQA 3DQ3A 4XL5A 3EVRA 2Z1OA 3SVDA 3P28A 3DQ2A 3ED8A 3IP2A 3DQ8A 3E5VA 4W6GA 1ZUXA 2GX2A 1KP5A 3I19A 4ORNA 2DD9A 5AQBB 4W7FA 4GF6B 4J88A 4ANJA 4PFEA 2HQKA 3DQ9A 2WHTA 4LJDC 4W73A 1MOVA 3WLDA 4U2VA 3DQEA 5EJUA 2AWJA 3SVOA 3GEXA 4HVFA 4LJCA 2G6XA 2C9JA 1GL4A 4EULA 3VICA 3LVAA 4Q7UA 4IK3A 3M24A 2B3PA 4IK9A 2QRFA 3DQ4A 4W6RA 4OGSA 4EN1A 3PJBA 4B5YA 3CFAA 4Q7RA 1EMFA 1EMGA 1HCJA 3AKOA 3LS3A 3KCSA 5HZUA 2QT2A 5J2OA 4W77A 3NT9A 3CB9A 3CFFA 1KYSA 5BT0A 2FWQA 3DQLA 4PPJA 3SG2A 2G3DB 4IK1A 4W74A 2IB5A 4ZBLA 3DPXA 4W6CA 2QLIA 3ST4A 1Z1PA 2GX0A 3GJ2A 5DPHA 3SG5A 3DQFA 3SVSA 2PXSA 4R6BA 5EHUA 2AWKA 3VHTA 1RM9A 3DQIA 1Q4CA 2JADA 4W7EA 2V4EA 2Y0GA 4W76A 3DQ1A 2HRSA 4LQUA 2Q57A 2QU1A 5H87A 3W1DA 3DQUA 3PJ7A 4W7CA 3DPZA 4Q9WA 1Z1QA 4KAGA 1GGXA 4XOVA 4GESB 3DQJA 1YFPA 4PPLA 3SVCA 3EVVA 5EXCI 5H88A 4L12A 2HGDA 1HUYA 1MYWA 3ST0A 4B30B 2V4EB 4I2YA 3ZTFA 2RH7A 4JEOA 4P76A 3BXCA 3K1KA 1Q4EA 2OTBA 4W7DA 1OXDA 2EMDA 2H6VA 3AI5A 1YHGA 5DTLA 5F9GA 3SRYA 2GW4B 4W7AA 5LTPA 3U0KA 1BFPA 2OGRA 5DPIA 5HZOA 4DXPA 2A47A 4W6NA 4ZFSA 5HBDA 1QYFA 2C9IA 1Q4BA 2POXA 3U0MA 3H1RA 2OKWA 4KF5A 1W7TA 4KW8A 5LTQA 2HJOA 2DUEA 2DDDA 4LW5A 1YHIA 3GB3A 1XQMA 2VVHA 1YZWA 1H4UA 3OSRA 2OKYA 4H48A 4ZB1A 4ZF3A 3G9AA 1W7UA 1H6RA 2G5ZB 4KEXA 5T3IA 4XGYA 4W6FA 2O24A 5DTXA 4ZINA 5HW9A 4UTSA 4OY4A 4R6DA 5DY6A 4RYWA 4JF9A 2WURA 3ST3A 4BDUA 1QXTA 4W7XA 5DU0A 2H5OA 3PIBA 2DUHA 2G16B 5DQMA 3M22A 4JGEA 5HGEA 2OJKA 3KCTA 1EMCA 3WLCA 3EKHA 3O77A 1GFLA 1EMAA 3SSVA 3NEDA 4DKNA 1EMEA 4LJDA 1OXFA 4AS8A 4DXMA 3ZULA 2H9WA 4ZF4A 4KPIA 3EK4A 3NEZA 3BX9A 3PJ5A 4Z4MA 3SG3A 4W72A 3CD1A 3O78A 4H3LA 5DTYA 2YE1A 5EB6A 4IZNA 4JRBA 1EMKA 1Q73A 3NT3A 1C4FA 3DPWA 2H8QA 5LTRA 3ST2A 4LQTA 3U8CA 4DXNA 3SSYA 4B30A 2P4MA 5H89A 2QLEA 2VVJA 3BXBA 3MGFA 4IK4A 2ARLA 4L1IA 2DUGA 2HFCA 2QLGB 3LVCA 3CFHA 2DDCA 4HE4A 4DXQA 4EDSA 5HZTA 2FL1A 4W6MA 2WSOA 1W7SA 1EMMA 3E5TA 3E5WA 3CBEA 4W7RA 2H5QA 2VAEA 2DUIA 4AR7A 4XOWA 1ZGQA 3EK7A 1MOUA 3EVPA 1XSSA 4W69A 4DKMA 5DPJA 5DTZA 1RMOA 3SG4A 1KYRA 3U8PA 1ZGOA 2B3QA 3OGOA 4Q9XA 1XMZA 4GOBA 3S05A 1S6ZA 4Z4KA 1KYPA 2VVIA 1YJFA 3EKJA 4OJ0A 3UFZA 3AI4A 1EMLA 3SVEA 2HQZA 4N3DA 2HGYA 1QYOA 2HPWA 3SSKA 3DQNA 3A8SA 1RMPA 3DQKA 1JC1A 5FHVA 1JBYA 2EMOA 4H3NA 2WSNA 3U8AA 2Q6PA 3DQMA 4J89A 2G6EA 4JC2A 2IB6A 4NWSA 5BQLA 5FVIA 3GL4A 3SV5A 4H47A 4HQCA 4P1QA 2A56B 4KGEA 2O2BA 2OTEA 4W6KA 2G6YA 2AH8A 2HCGA 4TZGA 4IK8A 2Z6YA 4W6AA 5DRGA 5FVGA 3SSLA 3SG6A 4H3MA 4W6SA 3EVUA 3W1CA 5EXUA 1XA9A 3SSPA 4JFGA 3SVBA 2QLHA 2AHAA 3VK1A 3U0NA 4KW9A 2WISA 2VZXA 4J8AA 3DQDA 3OSQA 5FVFA 3WCKA 2O29A 4W6JA 3ZUFA 2BTJA 2A46A 2FZUA 4W6HA 4W6TA 3DQ5A 3CD9A 3DQAA 4W6LA 4RYSA 4OHSA 2DD7A 5DRFA 2H5PA 4W75A 3SSHA 5DPGA 3LVDA 1F09A 2QLGA 3BXAA 5EBJA 2ZMWA 2Z6ZA 5DQBA 4W6UA 5HZSA 3V3DA 5EXBA 3TMTA 1G7KA 5BTTA 2A53B 5KTGA 3SVUA 3DQCA 2Z6XA 1EMBA 3GJ1A 2V4EC 3TMRA 2ZO6A 3EK8A 5EB7A 1JC0A 4W6IA 4ZIOA 3SSTA 1B9CA 3SG7A 2ICRA 2VADA 5BTTB 4W6DA 1RMMA 2G3OA 4ZF5A 3DQ6A 4KA9A 2PXWA 2IE2A 3LSAA 4TZAA 3RWAA 4W6BA 4OQWA 3DQHA 3UG0A 2A50B 1OXEA 3DQ7A 1JBZA 3SVNA 3H1OA 2YE0A 3DQOA 2DUFA 4HQ9A 3VHTB 2AWLA 4Q7TA 1CV7A 1UISA 3CGLA 3RWTA 4L13A 4DXOA 3LF4B 4W6OA 4KF4A 4RTCA 2A52B 2QZ0A 2G2SB 2IOVA 4KF5C 1QYQA 1RRXA 3SVRA 4LJBA 4PPKA 4DXIA 1F0BA 4W6PA 2AWMA 2YFPA 2WHSA 3P8UA 3ADFA 1ZGPA 1Q4DA 2WHUA 2YDZA 4EMQA 4EDOA 2GW3A 1XAEA 3NF0A 4XVPA
chains in the Genus database with same CATH superfamily
1Q4AA 2A48A 3LA1A 1YJ2A 2ZMUA 1YHHA 3SS0A 4KGFA 3ZUJA 4HQ8A 5LK4A 3U0LA 2A54B 1QY3A 4IK5A 2EMNA 2ZO7A 2H5RA 4KW4A 3IR8A 3LF3A 2WIQA 3DQ3A 4XL5A 3EVRA 2Z1OA 3SVDA 3P28A 3DQ2A 3ED8A 3IP2A 3DQ8A 3E5VA 4W6GA 1ZUXA 2GX2A 1KP5A 3I19A 4ORNA 2DD9A 5AQBB 4W7FA 4GF6B 4J88A 4ANJA 4PFEA 2HQKA 3DQ9A 2WHTA 4LJDC 4W73A 1MOVA 3WLDA 4U2VA 3DQEA 5EJUA 2AWJA 3SVOA 3GEXA 4HVFA 4LJCA 2G6XA 2C9JA 1GL4A 4EULA 3VICA 3LVAA 4Q7UA 4IK3A 3M24A 2B3PA 4IK9A 2QRFA 3DQ4A 4W6RA 4OGSA 4EN1A 3PJBA 4B5YA 3CFAA 4Q7RA 1EMFA 1EMGA 1HCJA 3AKOA 3LS3A 3KCSA 5HZUA 2QT2A 5J2OA 4W77A 3NT9A 3CB9A 3CFFA 1KYSA 5BT0A 2FWQA 3DQLA 4PPJA 3SG2A 2G3DB 4IK1A 4W74A 2IB5A 4ZBLA 3DPXA 4W6CA 2QLIA 3ST4A 1Z1PA 2GX0A 3GJ2A 5DPHA 3SG5A 3DQFA 3SVSA 2PXSA 4R6BA 5EHUA 2AWKA 3VHTA 1RM9A 3DQIA 1Q4CA 2JADA 4W7EA 2V4EA 2Y0GA 4W76A 3DQ1A 2HRSA 4LQUA 2Q57A 2QU1A 5H87A 3W1DA 3DQUA 3PJ7A 4W7CA 3DPZA 4Q9WA 1Z1QA 4KAGA 1GGXA 4XOVA 4GESB 3DQJA 1YFPA 4PPLA 3SVCA 3EVVA 5EXCI 5H88A 4L12A 2HGDA 1HUYA 1MYWA 3ST0A 4B30B 2V4EB 4I2YA 3ZTFA 2RH7A 4JEOA 4P76A 3BXCA 3K1KA 1Q4EA 2OTBA 4W7DA 1OXDA 2EMDA 2H6VA 3AI5A 1YHGA 5DTLA 5F9GA 3SRYA 2GW4B 4W7AA 5LTPA 3U0KA 1BFPA 2OGRA 5DPIA 5HZOA 4DXPA 2A47A 4W6NA 4ZFSA 5HBDA 1QYFA 2C9IA 1Q4BA 2POXA 3U0MA 3H1RA 2OKWA 4KF5A 1W7TA 4KW8A 5LTQA 2HJOA 2DUEA 2DDDA 4LW5A 1YHIA 3GB3A 1XQMA 2VVHA 1YZWA 1H4UA 3OSRA 2OKYA 4H48A 4ZB1A 4ZF3A 3G9AA 1W7UA 1H6RA 2G5ZB 4KEXA 5T3IA 4XGYA 4W6FA 2O24A 5DTXA 4ZINA 5HW9A 4UTSA 4OY4A 4R6DA 5DY6A 4RYWA 4JF9A 2WURA 3ST3A 4BDUA 1QXTA 4W7XA 5DU0A 2H5OA 3PIBA 2DUHA 2G16B 5DQMA 3M22A 4JGEA 5HGEA 2OJKA 3KCTA 1EMCA 3WLCA 3EKHA 3O77A 1GFLA 1EMAA 3SSVA 3NEDA 4DKNA 1EMEA 4LJDA 1OXFA 4AS8A 4DXMA 3ZULA 2H9WA 4ZF4A 4KPIA 3EK4A 3NEZA 3BX9A 3PJ5A 4Z4MA 3SG3A 4W72A 3CD1A 3O78A 4H3LA 5DTYA 2YE1A 5EB6A 4IZNA 4JRBA 1EMKA 1Q73A 3NT3A 1C4FA 3DPWA 2H8QA 5LTRA 3ST2A 4LQTA 3U8CA 4DXNA 3SSYA 4B30A 2P4MA 5H89A 2QLEA 2VVJA 3BXBA 3MGFA 4IK4A 2ARLA 4L1IA 2DUGA 2HFCA 2QLGB 3LVCA 3CFHA 2DDCA 4HE4A 4DXQA 4EDSA 5HZTA 2FL1A 4W6MA 2WSOA 1W7SA 1EMMA 3E5TA 3E5WA 3CBEA 4W7RA 2H5QA 2VAEA 2DUIA 4AR7A 4XOWA 1ZGQA 3EK7A 1MOUA 3EVPA 1XSSA 4W69A 4DKMA 5DPJA 5DTZA 1RMOA 3SG4A 1KYRA 3U8PA 1ZGOA 2B3QA 3OGOA 4Q9XA 1XMZA 4GOBA 3S05A 1S6ZA 4Z4KA 1KYPA 2VVIA 1YJFA 3EKJA 4OJ0A 3UFZA 3AI4A 1EMLA 3SVEA 2HQZA 4N3DA 2HGYA 1QYOA 2HPWA 3SSKA 3DQNA 3A8SA 1RMPA 3DQKA 1JC1A 5FHVA 1JBYA 2EMOA 4H3NA 2WSNA 3U8AA 2Q6PA 3DQMA 4J89A 2G6EA 4JC2A 2IB6A 4NWSA 5BQLA 5FVIA 3GL4A 3SV5A 4H47A 4HQCA 4P1QA 2A56B 4KGEA 2O2BA 2OTEA 4W6KA 2G6YA 2AH8A 2HCGA 4TZGA 4IK8A 2Z6YA 4W6AA 5DRGA 5FVGA 3SSLA 3SG6A 4H3MA 4W6SA 3EVUA 3W1CA 5EXUA 1XA9A 3SSPA 4JFGA 3SVBA 2QLHA 2AHAA 3VK1A 3U0NA 4KW9A 2WISA 2VZXA 4J8AA 3DQDA 3OSQA 5FVFA 3WCKA 2O29A 4W6JA 3ZUFA 2BTJA 2A46A 2FZUA 4W6HA 4W6TA 3DQ5A 3CD9A 3DQAA 4W6LA 4RYSA 4OHSA 2DD7A 5DRFA 2H5PA 4W75A 3SSHA 5DPGA 3LVDA 1F09A 2QLGA 3BXAA 5EBJA 2ZMWA 2Z6ZA 5DQBA 4W6UA 5HZSA 3V3DA 5EXBA 3TMTA 1G7KA 5BTTA 2A53B 5KTGA 3SVUA 3DQCA 2Z6XA 1EMBA 3GJ1A 2V4EC 3TMRA 2ZO6A 3EK8A 5EB7A 1JC0A 4W6IA 4ZIOA 3SSTA 1B9CA 3SG7A 2ICRA 2VADA 5BTTB 4W6DA 1RMMA 2G3OA 4ZF5A 3DQ6A 4KA9A 2PXWA 2IE2A 3LSAA 4TZAA 3RWAA 4W6BA 4OQWA 3DQHA 3UG0A 2A50B 1OXEA 3DQ7A 1JBZA 3SVNA 3H1OA 2YE0A 3DQOA 2DUFA 4HQ9A 3VHTB 2AWLA 4Q7TA 1CV7A 1UISA 3CGLA 3RWTA 4L13A 4DXOA 3LF4B 4W6OA 4KF4A 4RTCA 2A52B 2QZ0A 2G2SB 2IOVA 4KF5C 1QYQA 1RRXA 3SVRA 4LJBA 4PPKA 4DXIA 1F0BA 4W6PA 2AWMA 2YFPA 2WHSA 3P8UA 3ADFA 1ZGPA 1Q4DA 2WHUA 2YDZA 4EMQA 4EDOA 2GW3A 1XAEA 3NF0A 4XVPA
chains in the Genus database with same CATH topology
1Q4AA 2A48A 3LA1A 1YJ2A 2ZMUA 1YHHA 3SS0A 4KGFA 3ZUJA 4HQ8A 5LK4A 3U0LA 2A54B 1QY3A 4IK5A 2EMNA 2ZO7A 2H5RA 4KW4A 3IR8A 3LF3A 2WIQA 3DQ3A 4XL5A 3EVRA 2Z1OA 3SVDA 3P28A 3DQ2A 3ED8A 3IP2A 3DQ8A 3E5VA 4W6GA 1ZUXA 2GX2A 1KP5A 3I19A 4ORNA 2DD9A 5AQBB 4W7FA 4GF6B 4J88A 4ANJA 4PFEA 2HQKA 3DQ9A 2WHTA 4LJDC 4W73A 1MOVA 3WLDA 4U2VA 3DQEA 5EJUA 2AWJA 3SVOA 3GEXA 4HVFA 4LJCA 2G6XA 2C9JA 1GL4A 4EULA 3VICA 3LVAA 4Q7UA 4IK3A 3M24A 2B3PA 4IK9A 2QRFA 3DQ4A 4W6RA 4OGSA 4EN1A 3PJBA 4B5YA 3CFAA 4Q7RA 1EMFA 1EMGA 1HCJA 3AKOA 3LS3A 3KCSA 5HZUA 2QT2A 5J2OA 4W77A 3NT9A 3CB9A 3CFFA 1KYSA 5BT0A 2FWQA 3DQLA 4PPJA 3SG2A 2G3DB 4IK1A 4W74A 2IB5A 4ZBLA 3DPXA 4W6CA 2QLIA 3ST4A 1Z1PA 2GX0A 3GJ2A 5DPHA 3SG5A 3DQFA 3SVSA 2PXSA 4R6BA 5EHUA 2AWKA 3VHTA 1RM9A 3DQIA 1Q4CA 2JADA 4W7EA 2V4EA 2Y0GA 4W76A 3DQ1A 2HRSA 4LQUA 2Q57A 2QU1A 5H87A 3W1DA 3DQUA 3PJ7A 4W7CA 3DPZA 4Q9WA 1Z1QA 4KAGA 1GGXA 4XOVA 4GESB 3DQJA 1YFPA 4PPLA 3SVCA 3EVVA 5EXCI 5H88A 4L12A 2HGDA 1HUYA 1MYWA 3ST0A 4B30B 2V4EB 4I2YA 3ZTFA 2RH7A 4JEOA 4P76A 3BXCA 3K1KA 1Q4EA 2OTBA 4W7DA 1OXDA 2EMDA 2H6VA 3AI5A 1YHGA 5DTLA 5F9GA 3SRYA 2GW4B 4W7AA 5LTPA 3U0KA 1BFPA 2OGRA 5DPIA 5HZOA 4DXPA 2A47A 4W6NA 4ZFSA 5HBDA 1QYFA 2C9IA 1Q4BA 2POXA 3U0MA 3H1RA 2OKWA 4KF5A 1W7TA 4KW8A 5LTQA 2HJOA 2DUEA 2DDDA 4LW5A 1YHIA 3GB3A 1XQMA 2VVHA 1YZWA 1H4UA 3OSRA 2OKYA 4H48A 4ZB1A 4ZF3A 3G9AA 1W7UA 1H6RA 2G5ZB 4KEXA 5T3IA 4XGYA 4W6FA 2O24A 5DTXA 4ZINA 5HW9A 4UTSA 4OY4A 4R6DA 5DY6A 4RYWA 4JF9A 2WURA 3ST3A 4BDUA 1QXTA 4W7XA 5DU0A 2H5OA 3PIBA 2DUHA 2G16B 5DQMA 3M22A 4JGEA 5HGEA 2OJKA 3KCTA 1EMCA 3WLCA 3EKHA 3O77A 1GFLA 1EMAA 3SSVA 3NEDA 4DKNA 1EMEA 4LJDA 1OXFA 4AS8A 4DXMA 3ZULA 2H9WA 4ZF4A 4KPIA 3EK4A 3NEZA 3BX9A 3PJ5A 4Z4MA 3SG3A 4W72A 3CD1A 3O78A 4H3LA 5DTYA 2YE1A 5EB6A 4IZNA 4JRBA 1EMKA 1Q73A 3NT3A 1C4FA 3DPWA 2H8QA 5LTRA 3ST2A 4LQTA 3U8CA 4DXNA 3SSYA 4B30A 2P4MA 5H89A 2QLEA 2VVJA 3BXBA 3MGFA 4IK4A 2ARLA 4L1IA 2DUGA 2HFCA 2QLGB 3LVCA 3CFHA 2DDCA 4HE4A 4DXQA 4EDSA 5HZTA 2FL1A 4W6MA 2WSOA 1W7SA 1EMMA 3E5TA 3E5WA 3CBEA 4W7RA 2H5QA 2VAEA 2DUIA 4AR7A 4XOWA 1ZGQA 3EK7A 1MOUA 3EVPA 1XSSA 4W69A 4DKMA 5DPJA 5DTZA 1RMOA 3SG4A 1KYRA 3U8PA 1ZGOA 2B3QA 3OGOA 4Q9XA 1XMZA 4GOBA 3S05A 1S6ZA 4Z4KA 1KYPA 2VVIA 1YJFA 3EKJA 4OJ0A 3UFZA 3AI4A 1EMLA 3SVEA 2HQZA 4N3DA 2HGYA 1QYOA 2HPWA 3SSKA 3DQNA 3A8SA 1RMPA 3DQKA 1JC1A 5FHVA 1JBYA 2EMOA 4H3NA 2WSNA 3U8AA 2Q6PA 3DQMA 4J89A 2G6EA 4JC2A 2IB6A 4NWSA 5BQLA 5FVIA 3GL4A 3SV5A 4H47A 4HQCA 4P1QA 2A56B 4KGEA 2O2BA 2OTEA 4W6KA 2G6YA 2AH8A 2HCGA 4TZGA 4IK8A 2Z6YA 4W6AA 5DRGA 5FVGA 3SSLA 3SG6A 4H3MA 4W6SA 3EVUA 3W1CA 5EXUA 1XA9A 3SSPA 4JFGA 3SVBA 2QLHA 2AHAA 3VK1A 3U0NA 4KW9A 2WISA 2VZXA 4J8AA 3DQDA 3OSQA 5FVFA 3WCKA 2O29A 4W6JA 3ZUFA 2BTJA 2A46A 2FZUA 4W6HA 4W6TA 3DQ5A 3CD9A 3DQAA 4W6LA 4RYSA 4OHSA 2DD7A 5DRFA 2H5PA 4W75A 3SSHA 5DPGA 3LVDA 1F09A 2QLGA 3BXAA 5EBJA 2ZMWA 2Z6ZA 5DQBA 4W6UA 5HZSA 3V3DA 5EXBA 3TMTA 1G7KA 5BTTA 2A53B 5KTGA 3SVUA 3DQCA 2Z6XA 1EMBA 3GJ1A 2V4EC 3TMRA 2ZO6A 3EK8A 5EB7A 1JC0A 4W6IA 4ZIOA 3SSTA 1B9CA 3SG7A 2ICRA 2VADA 5BTTB 4W6DA 1RMMA 2G3OA 4ZF5A 3DQ6A 4KA9A 2PXWA 2IE2A 3LSAA 4TZAA 3RWAA 4W6BA 4OQWA 3DQHA 3UG0A 2A50B 1OXEA 3DQ7A 1JBZA 3SVNA 3H1OA 2YE0A 3DQOA 2DUFA 4HQ9A 3VHTB 2AWLA 4Q7TA 1CV7A 1UISA 3CGLA 3RWTA 4L13A 4DXOA 3LF4B 4W6OA 4KF4A 4RTCA 2A52B 2QZ0A 2G2SB 2IOVA 4KF5C 1QYQA 1RRXA 3SVRA 4LJBA 4PPKA 4DXIA 1F0BA 4W6PA 2AWMA 2YFPA 2WHSA 3P8UA 3ADFA 1ZGPA 1Q4DA 2WHUA 2YDZA 4EMQA 4EDOA 2GW3A 1XAEA 3NF0A 4XVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4A A;  2A48 A;  3LA1 A;  1YJ2 A;  2ZMU A;  1YHH A;  3SS0 A;  4KGF A;  3ZUJ A;  4HQ8 A;  5LK4 A;  3U0L A;  2A54 B;  1QY3 A;  4IK5 A;  2EMN A;  2ZO7 A;  2H5R A;  4KW4 A;  3IR8 A;  3LF3 A;  2WIQ A;  3DQ3 A;  4XL5 A;  3EVR A;  2Z1O A;  3SVD A;  3P28 A;  3DQ2 A;  3ED8 A;  3IP2 A;  3DQ8 A;  3E5V A;  4W6G A;  1ZUX A;  2GX2 A;  1KP5 A;  3I19 A;  4ORN A;  2DD9 A;  5AQB B;  4W7F A;  4GF6 B;  4J88 A;  4ANJ A;  4PFE A;  2HQK A;  3DQ9 A;  2WHT A;  4LJD C;  4W73 A;  1MOV A;  3WLD A;  4U2V A;  3DQE A;  5EJU A;  2AWJ A;  3SVO A;  3GEX A;  4HVF A;  4LJC A;  2G6X A;  2C9J A;  1GL4 A;  4EUL A;  3VIC A;  3LVA A;  4Q7U A;  4IK3 A;  3M24 A;  2B3P A;  4IK9 A;  2QRF A;  3DQ4 A;  4W6R A;  4OGS A;  4EN1 A;  3PJB A;  4B5Y A;  3CFA A;  4Q7R A;  1EMF A;  1EMG A;  1HCJ A;  3AKO A;  3LS3 A;  3KCS A;  5HZU A;  2QT2 A;  5J2O A;  4W77 A;  3NT9 A;  3CB9 A;  3CFF A;  1KYS A;  5BT0 A;  2FWQ A;  3DQL A;  4PPJ A;  3SG2 A;  2G3D B;  4IK1 A;  4W74 A;  2IB5 A;  4ZBL A;  3DPX A;  4W6C A;  2QLI A;  3ST4 A;  1Z1P A;  2GX0 A;  3GJ2 A;  5DPH A;  3SG5 A;  3DQF A;  3SVS A;  2PXS A;  4R6B A;  5EHU A;  2AWK A;  3VHT A;  1RM9 A;  3DQI A;  1Q4C A;  2JAD A;  4W7E A;  2V4E A;  2Y0G A;  4W76 A;  3DQ1 A;  2HRS A;  4LQU A;  2Q57 A;  2QU1 A;  5H87 A;  3W1D A;  3DQU A;  3PJ7 A;  4W7C A;  3DPZ A;  4Q9W A;  1Z1Q A;  4KAG A;  1GGX A;  4XOV A;  4GES B;  3DQJ A;  1YFP A;  4PPL A;  3SVC A;  3EVV A;  5EXC I;  5H88 A;  4L12 A;  2HGD A;  1HUY A;  1MYW A;  3ST0 A;  4B30 B;  2V4E B;  4I2Y A;  3ZTF A;  2RH7 A;  4JEO A;  4P76 A;  3BXC A;  3K1K A;  1Q4E A;  2OTB A;  4W7D A;  1OXD A;  2EMD A;  2H6V A;  3AI5 A;  1YHG A;  5DTL A;  5F9G A;  3SRY A;  2GW4 B;  4W7A A;  5LTP A;  3U0K A;  1BFP A;  2OGR A;  5DPI A;  5HZO A;  4DXP A;  2A47 A;  4W6N A;  4ZFS A;  5HBD A;  1QYF A;  2C9I A;  1Q4B A;  2POX A;  3U0M A;  3H1R A;  2OKW A;  4KF5 A;  1W7T A;  4KW8 A;  5LTQ A;  2HJO A;  2DUE A;  2DDD A;  4LW5 A;  1YHI A;  3GB3 A;  1XQM A;  2VVH A;  1YZW A;  1H4U A;  3OSR A;  2OKY A;  4H48 A;  4ZB1 A;  4ZF3 A;  3G9A A;  1W7U A;  1H6R A;  2G5Z B;  4KEX A;  5T3I A;  4XGY A;  4W6F A;  2O24 A;  5DTX A;  4ZIN A;  5HW9 A;  4UTS A;  4OY4 A;  4R6D A;  5DY6 A;  4RYW A;  4JF9 A;  2WUR A;  3ST3 A;  4BDU A;  1QXT A;  4W7X A;  5DU0 A;  2H5O A;  3PIB A;  2DUH A;  2G16 B;  5DQM A;  3M22 A;  4JGE A;  5HGE A;  2OJK A;  3KCT A;  1EMC A;  3WLC A;  3EKH A;  3O77 A;  1GFL A;  1EMA A;  3SSV A;  3NED A;  4DKN A;  1EME A;  4LJD A;  1OXF A;  4AS8 A;  4DXM A;  3ZUL A;  2H9W A;  4ZF4 A;  4KPI A;  3EK4 A;  3NEZ A;  3BX9 A;  3PJ5 A;  4Z4M A;  3SG3 A;  4W72 A;  3CD1 A;  3O78 A;  4H3L A;  5DTY A;  2YE1 A;  5EB6 A;  4IZN A;  4JRB A;  1EMK A;  1Q73 A;  3NT3 A;  1C4F A;  3DPW A;  2H8Q A;  5LTR A;  3ST2 A;  4LQT A;  3U8C A;  4DXN A;  3SSY A;  4B30 A;  2P4M A;  5H89 A;  2QLE A;  2VVJ A;  3BXB A;  3MGF A;  4IK4 A;  2ARL A;  4L1I A;  2DUG A;  2HFC A;  2QLG B;  3LVC A;  3CFH A;  2DDC A;  4HE4 A;  4DXQ A;  4EDS A;  5HZT A;  2FL1 A;  4W6M A;  2WSO A;  1W7S A;  1EMM A;  3E5T A;  3E5W A;  3CBE A;  4W7R A;  2H5Q A;  2VAE A;  2DUI A;  4AR7 A;  4XOW A;  1ZGQ A;  3EK7 A;  1MOU A;  3EVP A;  1XSS A;  4W69 A;  4DKM A;  5DPJ A;  5DTZ A;  1RMO A;  3SG4 A;  1KYR A;  3U8P A;  1ZGO A;  2B3Q A;  3OGO A;  4Q9X A;  1XMZ A;  4GOB A;  3S05 A;  1S6Z A;  4Z4K A;  1KYP A;  2VVI A;  1YJF A;  3EKJ A;  4OJ0 A;  3UFZ A;  3AI4 A;  1EML A;  3SVE A;  2HQZ A;  4N3D A;  2HGY A;  1QYO A;  2HPW A;  3SSK A;  3DQN A;  3A8S A;  1RMP A;  3DQK A;  1JC1 A;  5FHV A;  1JBY A;  2EMO A;  4H3N A;  2WSN A;  3U8A A;  2Q6P A;  3DQM A;  4J89 A;  2G6E A;  4JC2 A;  2IB6 A;  4NWS A;  5BQL A;  5FVI A;  3GL4 A;  3SV5 A;  4H47 A;  4HQC A;  4P1Q A;  2A56 B;  4KGE A;  2O2B A;  2OTE A;  4W6K A;  2G6Y A;  2AH8 A;  2HCG A;  4TZG A;  4IK8 A;  2Z6Y A;  4W6A A;  5DRG A;  5FVG A;  3SSL A;  3SG6 A;  4H3M A;  4W6S A;  3EVU A;  3W1C A;  5EXU A;  1XA9 A;  3SSP A;  4JFG A;  3SVB A;  2QLH A;  2AHA A;  3VK1 A;  3U0N A;  4KW9 A;  2WIS A;  2VZX A;  4J8A A;  3DQD A;  3OSQ A;  5FVF A;  3WCK A;  2O29 A;  4W6J A;  3ZUF A;  2BTJ A;  2A46 A;  2FZU A;  4W6H A;  4W6T A;  3DQ5 A;  3CD9 A;  3DQA A;  4W6L A;  4RYS A;  4OHS A;  2DD7 A;  5DRF A;  2H5P A;  4W75 A;  3SSH A;  5DPG A;  3LVD A;  1F09 A;  2QLG A;  3BXA A;  5EBJ A;  2ZMW A;  2Z6Z A;  5DQB A;  4W6U A;  5HZS A;  3V3D A;  5EXB A;  3TMT A;  1G7K A;  5BTT A;  2A53 B;  5KTG A;  3SVU A;  3DQC A;  2Z6X A;  1EMB A;  3GJ1 A;  2V4E C;  3TMR A;  2ZO6 A;  3EK8 A;  5EB7 A;  1JC0 A;  4W6I A;  4ZIO A;  3SST A;  1B9C A;  3SG7 A;  2ICR A;  2VAD A;  5BTT B;  4W6D A;  1RMM A;  2G3O A;  4ZF5 A;  3DQ6 A;  4KA9 A;  2PXW A;  2IE2 A;  3LSA A;  4TZA A;  3RWA A;  4W6B A;  4OQW A;  3DQH A;  3UG0 A;  2A50 B;  1OXE A;  3DQ7 A;  1JBZ A;  3SVN A;  3H1O A;  2YE0 A;  3DQO A;  2DUF A;  4HQ9 A;  3VHT B;  2AWL A;  4Q7T A;  1CV7 A;  1UIS A;  3CGL A;  3RWT A;  4L13 A;  4DXO A;  3LF4 B;  4W6O A;  4KF4 A;  4RTC A;  2A52 B;  2QZ0 A;  2G2S B;  2IOV A;  4KF5 C;  1QYQ A;  1RRX A;  3SVR A;  4LJB A;  4PPK A;  4DXI A;  1F0B A;  4W6P A;  2AWM A;  2YFP A;  2WHS A;  3P8U A;  3ADF A;  1ZGP A;  1Q4D A;  2WHU A;  2YDZ A;  4EMQ A;  4EDO A;  2GW3 A;  1XAE A;  3NF0 A;  4XVP A; 
#chains in the Genus database with same CATH topology
 1Q4A A;  2A48 A;  3LA1 A;  1YJ2 A;  2ZMU A;  1YHH A;  3SS0 A;  4KGF A;  3ZUJ A;  4HQ8 A;  5LK4 A;  3U0L A;  2A54 B;  1QY3 A;  4IK5 A;  2EMN A;  2ZO7 A;  2H5R A;  4KW4 A;  3IR8 A;  3LF3 A;  2WIQ A;  3DQ3 A;  4XL5 A;  3EVR A;  2Z1O A;  3SVD A;  3P28 A;  3DQ2 A;  3ED8 A;  3IP2 A;  3DQ8 A;  3E5V A;  4W6G A;  1ZUX A;  2GX2 A;  1KP5 A;  3I19 A;  4ORN A;  2DD9 A;  5AQB B;  4W7F A;  4GF6 B;  4J88 A;  4ANJ A;  4PFE A;  2HQK A;  3DQ9 A;  2WHT A;  4LJD C;  4W73 A;  1MOV A;  3WLD A;  4U2V A;  3DQE A;  5EJU A;  2AWJ A;  3SVO A;  3GEX A;  4HVF A;  4LJC A;  2G6X A;  2C9J A;  1GL4 A;  4EUL A;  3VIC A;  3LVA A;  4Q7U A;  4IK3 A;  3M24 A;  2B3P A;  4IK9 A;  2QRF A;  3DQ4 A;  4W6R A;  4OGS A;  4EN1 A;  3PJB A;  4B5Y A;  3CFA A;  4Q7R A;  1EMF A;  1EMG A;  1HCJ A;  3AKO A;  3LS3 A;  3KCS A;  5HZU A;  2QT2 A;  5J2O A;  4W77 A;  3NT9 A;  3CB9 A;  3CFF A;  1KYS A;  5BT0 A;  2FWQ A;  3DQL A;  4PPJ A;  3SG2 A;  2G3D B;  4IK1 A;  4W74 A;  2IB5 A;  4ZBL A;  3DPX A;  4W6C A;  2QLI A;  3ST4 A;  1Z1P A;  2GX0 A;  3GJ2 A;  5DPH A;  3SG5 A;  3DQF A;  3SVS A;  2PXS A;  4R6B A;  5EHU A;  2AWK A;  3VHT A;  1RM9 A;  3DQI A;  1Q4C A;  2JAD A;  4W7E A;  2V4E A;  2Y0G A;  4W76 A;  3DQ1 A;  2HRS A;  4LQU A;  2Q57 A;  2QU1 A;  5H87 A;  3W1D A;  3DQU A;  3PJ7 A;  4W7C A;  3DPZ A;  4Q9W A;  1Z1Q A;  4KAG A;  1GGX A;  4XOV A;  4GES B;  3DQJ A;  1YFP A;  4PPL A;  3SVC A;  3EVV A;  5EXC I;  5H88 A;  4L12 A;  2HGD A;  1HUY A;  1MYW A;  3ST0 A;  4B30 B;  2V4E B;  4I2Y A;  3ZTF A;  2RH7 A;  4JEO A;  4P76 A;  3BXC A;  3K1K A;  1Q4E A;  2OTB A;  4W7D A;  1OXD A;  2EMD A;  2H6V A;  3AI5 A;  1YHG A;  5DTL A;  5F9G A;  3SRY A;  2GW4 B;  4W7A A;  5LTP A;  3U0K A;  1BFP A;  2OGR A;  5DPI A;  5HZO A;  4DXP A;  2A47 A;  4W6N A;  4ZFS A;  5HBD A;  1QYF A;  2C9I A;  1Q4B A;  2POX A;  3U0M A;  3H1R A;  2OKW A;  4KF5 A;  1W7T A;  4KW8 A;  5LTQ A;  2HJO A;  2DUE A;  2DDD A;  4LW5 A;  1YHI A;  3GB3 A;  1XQM A;  2VVH A;  1YZW A;  1H4U A;  3OSR A;  2OKY A;  4H48 A;  4ZB1 A;  4ZF3 A;  3G9A A;  1W7U A;  1H6R A;  2G5Z B;  4KEX A;  5T3I A;  4XGY A;  4W6F A;  2O24 A;  5DTX A;  4ZIN A;  5HW9 A;  4UTS A;  4OY4 A;  4R6D A;  5DY6 A;  4RYW A;  4JF9 A;  2WUR A;  3ST3 A;  4BDU A;  1QXT A;  4W7X A;  5DU0 A;  2H5O A;  3PIB A;  2DUH A;  2G16 B;  5DQM A;  3M22 A;  4JGE A;  5HGE A;  2OJK A;  3KCT A;  1EMC A;  3WLC A;  3EKH A;  3O77 A;  1GFL A;  1EMA A;  3SSV A;  3NED A;  4DKN A;  1EME A;  4LJD A;  1OXF A;  4AS8 A;  4DXM A;  3ZUL A;  2H9W A;  4ZF4 A;  4KPI A;  3EK4 A;  3NEZ A;  3BX9 A;  3PJ5 A;  4Z4M A;  3SG3 A;  4W72 A;  3CD1 A;  3O78 A;  4H3L A;  5DTY A;  2YE1 A;  5EB6 A;  4IZN A;  4JRB A;  1EMK A;  1Q73 A;  3NT3 A;  1C4F A;  3DPW A;  2H8Q A;  5LTR A;  3ST2 A;  4LQT A;  3U8C A;  4DXN A;  3SSY A;  4B30 A;  2P4M A;  5H89 A;  2QLE A;  2VVJ A;  3BXB A;  3MGF A;  4IK4 A;  2ARL A;  4L1I A;  2DUG A;  2HFC A;  2QLG B;  3LVC A;  3CFH A;  2DDC A;  4HE4 A;  4DXQ A;  4EDS A;  5HZT A;  2FL1 A;  4W6M A;  2WSO A;  1W7S A;  1EMM A;  3E5T A;  3E5W A;  3CBE A;  4W7R A;  2H5Q A;  2VAE A;  2DUI A;  4AR7 A;  4XOW A;  1ZGQ A;  3EK7 A;  1MOU A;  3EVP A;  1XSS A;  4W69 A;  4DKM A;  5DPJ A;  5DTZ A;  1RMO A;  3SG4 A;  1KYR A;  3U8P A;  1ZGO A;  2B3Q A;  3OGO A;  4Q9X A;  1XMZ A;  4GOB A;  3S05 A;  1S6Z A;  4Z4K A;  1KYP A;  2VVI A;  1YJF A;  3EKJ A;  4OJ0 A;  3UFZ A;  3AI4 A;  1EML A;  3SVE A;  2HQZ A;  4N3D A;  2HGY A;  1QYO A;  2HPW A;  3SSK A;  3DQN A;  3A8S A;  1RMP A;  3DQK A;  1JC1 A;  5FHV A;  1JBY A;  2EMO A;  4H3N A;  2WSN A;  3U8A A;  2Q6P A;  3DQM A;  4J89 A;  2G6E A;  4JC2 A;  2IB6 A;  4NWS A;  5BQL A;  5FVI A;  3GL4 A;  3SV5 A;  4H47 A;  4HQC A;  4P1Q A;  2A56 B;  4KGE A;  2O2B A;  2OTE A;  4W6K A;  2G6Y A;  2AH8 A;  2HCG A;  4TZG A;  4IK8 A;  2Z6Y A;  4W6A A;  5DRG A;  5FVG A;  3SSL A;  3SG6 A;  4H3M A;  4W6S A;  3EVU A;  3W1C A;  5EXU A;  1XA9 A;  3SSP A;  4JFG A;  3SVB A;  2QLH A;  2AHA A;  3VK1 A;  3U0N A;  4KW9 A;  2WIS A;  2VZX A;  4J8A A;  3DQD A;  3OSQ A;  5FVF A;  3WCK A;  2O29 A;  4W6J A;  3ZUF A;  2BTJ A;  2A46 A;  2FZU A;  4W6H A;  4W6T A;  3DQ5 A;  3CD9 A;  3DQA A;  4W6L A;  4RYS A;  4OHS A;  2DD7 A;  5DRF A;  2H5P A;  4W75 A;  3SSH A;  5DPG A;  3LVD A;  1F09 A;  2QLG A;  3BXA A;  5EBJ A;  2ZMW A;  2Z6Z A;  5DQB A;  4W6U A;  5HZS A;  3V3D A;  5EXB A;  3TMT A;  1G7K A;  5BTT A;  2A53 B;  5KTG A;  3SVU A;  3DQC A;  2Z6X A;  1EMB A;  3GJ1 A;  2V4E C;  3TMR A;  2ZO6 A;  3EK8 A;  5EB7 A;  1JC0 A;  4W6I A;  4ZIO A;  3SST A;  1B9C A;  3SG7 A;  2ICR A;  2VAD A;  5BTT B;  4W6D A;  1RMM A;  2G3O A;  4ZF5 A;  3DQ6 A;  4KA9 A;  2PXW A;  2IE2 A;  3LSA A;  4TZA A;  3RWA A;  4W6B A;  4OQW A;  3DQH A;  3UG0 A;  2A50 B;  1OXE A;  3DQ7 A;  1JBZ A;  3SVN A;  3H1O A;  2YE0 A;  3DQO A;  2DUF A;  4HQ9 A;  3VHT B;  2AWL A;  4Q7T A;  1CV7 A;  1UIS A;  3CGL A;  3RWT A;  4L13 A;  4DXO A;  3LF4 B;  4W6O A;  4KF4 A;  4RTC A;  2A52 B;  2QZ0 A;  2G2S B;  2IOV A;  4KF5 C;  1QYQ A;  1RRX A;  3SVR A;  4LJB A;  4PPK A;  4DXI A;  1F0B A;  4W6P A;  2AWM A;  2YFP A;  2WHS A;  3P8U A;  3ADF A;  1ZGP A;  1Q4D A;  2WHU A;  2YDZ A;  4EMQ A;  4EDO A;  2GW3 A;  1XAE A;  3NF0 A;  4XVP A; 
#chains in the Genus database with same CATH homology
 1Q4A A;  2A48 A;  3LA1 A;  1YJ2 A;  2ZMU A;  1YHH A;  3SS0 A;  4KGF A;  3ZUJ A;  4HQ8 A;  5LK4 A;  3U0L A;  2A54 B;  1QY3 A;  4IK5 A;  2EMN A;  2ZO7 A;  2H5R A;  4KW4 A;  3IR8 A;  3LF3 A;  2WIQ A;  3DQ3 A;  4XL5 A;  3EVR A;  2Z1O A;  3SVD A;  3P28 A;  3DQ2 A;  3ED8 A;  3IP2 A;  3DQ8 A;  3E5V A;  4W6G A;  1ZUX A;  2GX2 A;  1KP5 A;  3I19 A;  4ORN A;  2DD9 A;  5AQB B;  4W7F A;  4GF6 B;  4J88 A;  4ANJ A;  4PFE A;  2HQK A;  3DQ9 A;  2WHT A;  4LJD C;  4W73 A;  1MOV A;  3WLD A;  4U2V A;  3DQE A;  5EJU A;  2AWJ A;  3SVO A;  3GEX A;  4HVF A;  4LJC A;  2G6X A;  2C9J A;  1GL4 A;  4EUL A;  3VIC A;  3LVA A;  4Q7U A;  4IK3 A;  3M24 A;  2B3P A;  4IK9 A;  2QRF A;  3DQ4 A;  4W6R A;  4OGS A;  4EN1 A;  3PJB A;  4B5Y A;  3CFA A;  4Q7R A;  1EMF A;  1EMG A;  1HCJ A;  3AKO A;  3LS3 A;  3KCS A;  5HZU A;  2QT2 A;  5J2O A;  4W77 A;  3NT9 A;  3CB9 A;  3CFF A;  1KYS A;  5BT0 A;  2FWQ A;  3DQL A;  4PPJ A;  3SG2 A;  2G3D B;  4IK1 A;  4W74 A;  2IB5 A;  4ZBL A;  3DPX A;  4W6C A;  2QLI A;  3ST4 A;  1Z1P A;  2GX0 A;  3GJ2 A;  5DPH A;  3SG5 A;  3DQF A;  3SVS A;  2PXS A;  4R6B A;  5EHU A;  2AWK A;  3VHT A;  1RM9 A;  3DQI A;  1Q4C A;  2JAD A;  4W7E A;  2V4E A;  2Y0G A;  4W76 A;  3DQ1 A;  2HRS A;  4LQU A;  2Q57 A;  2QU1 A;  5H87 A;  3W1D A;  3DQU A;  3PJ7 A;  4W7C A;  3DPZ A;  4Q9W A;  1Z1Q A;  4KAG A;  1GGX A;  4XOV A;  4GES B;  3DQJ A;  1YFP A;  4PPL A;  3SVC A;  3EVV A;  5EXC I;  5H88 A;  4L12 A;  2HGD A;  1HUY A;  1MYW A;  3ST0 A;  4B30 B;  2V4E B;  4I2Y A;  3ZTF A;  2RH7 A;  4JEO A;  4P76 A;  3BXC A;  3K1K A;  1Q4E A;  2OTB A;  4W7D A;  1OXD A;  2EMD A;  2H6V A;  3AI5 A;  1YHG A;  5DTL A;  5F9G A;  3SRY A;  2GW4 B;  4W7A A;  5LTP A;  3U0K A;  1BFP A;  2OGR A;  5DPI A;  5HZO A;  4DXP A;  2A47 A;  4W6N A;  4ZFS A;  5HBD A;  1QYF A;  2C9I A;  1Q4B A;  2POX A;  3U0M A;  3H1R A;  2OKW A;  4KF5 A;  1W7T A;  4KW8 A;  5LTQ A;  2HJO A;  2DUE A;  2DDD A;  4LW5 A;  1YHI A;  3GB3 A;  1XQM A;  2VVH A;  1YZW A;  1H4U A;  3OSR A;  2OKY A;  4H48 A;  4ZB1 A;  4ZF3 A;  3G9A A;  1W7U A;  1H6R A;  2G5Z B;  4KEX A;  5T3I A;  4XGY A;  4W6F A;  2O24 A;  5DTX A;  4ZIN A;  5HW9 A;  4UTS A;  4OY4 A;  4R6D A;  5DY6 A;  4RYW A;  4JF9 A;  2WUR A;  3ST3 A;  4BDU A;  1QXT A;  4W7X A;  5DU0 A;  2H5O A;  3PIB A;  2DUH A;  2G16 B;  5DQM A;  3M22 A;  4JGE A;  5HGE A;  2OJK A;  3KCT A;  1EMC A;  3WLC A;  3EKH A;  3O77 A;  1GFL A;  1EMA A;  3SSV A;  3NED A;  4DKN A;  1EME A;  4LJD A;  1OXF A;  4AS8 A;  4DXM A;  3ZUL A;  2H9W A;  4ZF4 A;  4KPI A;  3EK4 A;  3NEZ A;  3BX9 A;  3PJ5 A;  4Z4M A;  3SG3 A;  4W72 A;  3CD1 A;  3O78 A;  4H3L A;  5DTY A;  2YE1 A;  5EB6 A;  4IZN A;  4JRB A;  1EMK A;  1Q73 A;  3NT3 A;  1C4F A;  3DPW A;  2H8Q A;  5LTR A;  3ST2 A;  4LQT A;  3U8C A;  4DXN A;  3SSY A;  4B30 A;  2P4M A;  5H89 A;  2QLE A;  2VVJ A;  3BXB A;  3MGF A;  4IK4 A;  2ARL A;  4L1I A;  2DUG A;  2HFC A;  2QLG B;  3LVC A;  3CFH A;  2DDC A;  4HE4 A;  4DXQ A;  4EDS A;  5HZT A;  2FL1 A;  4W6M A;  2WSO A;  1W7S A;  1EMM A;  3E5T A;  3E5W A;  3CBE A;  4W7R A;  2H5Q A;  2VAE A;  2DUI A;  4AR7 A;  4XOW A;  1ZGQ A;  3EK7 A;  1MOU A;  3EVP A;  1XSS A;  4W69 A;  4DKM A;  5DPJ A;  5DTZ A;  1RMO A;  3SG4 A;  1KYR A;  3U8P A;  1ZGO A;  2B3Q A;  3OGO A;  4Q9X A;  1XMZ A;  4GOB A;  3S05 A;  1S6Z A;  4Z4K A;  1KYP A;  2VVI A;  1YJF A;  3EKJ A;  4OJ0 A;  3UFZ A;  3AI4 A;  1EML A;  3SVE A;  2HQZ A;  4N3D A;  2HGY A;  1QYO A;  2HPW A;  3SSK A;  3DQN A;  3A8S A;  1RMP A;  3DQK A;  1JC1 A;  5FHV A;  1JBY A;  2EMO A;  4H3N A;  2WSN A;  3U8A A;  2Q6P A;  3DQM A;  4J89 A;  2G6E A;  4JC2 A;  2IB6 A;  4NWS A;  5BQL A;  5FVI A;  3GL4 A;  3SV5 A;  4H47 A;  4HQC A;  4P1Q A;  2A56 B;  4KGE A;  2O2B A;  2OTE A;  4W6K A;  2G6Y A;  2AH8 A;  2HCG A;  4TZG A;  4IK8 A;  2Z6Y A;  4W6A A;  5DRG A;  5FVG A;  3SSL A;  3SG6 A;  4H3M A;  4W6S A;  3EVU A;  3W1C A;  5EXU A;  1XA9 A;  3SSP A;  4JFG A;  3SVB A;  2QLH A;  2AHA A;  3VK1 A;  3U0N A;  4KW9 A;  2WIS A;  2VZX A;  4J8A A;  3DQD A;  3OSQ A;  5FVF A;  3WCK A;  2O29 A;  4W6J A;  3ZUF A;  2BTJ A;  2A46 A;  2FZU A;  4W6H A;  4W6T A;  3DQ5 A;  3CD9 A;  3DQA A;  4W6L A;  4RYS A;  4OHS A;  2DD7 A;  5DRF A;  2H5P A;  4W75 A;  3SSH A;  5DPG A;  3LVD A;  1F09 A;  2QLG A;  3BXA A;  5EBJ A;  2ZMW A;  2Z6Z A;  5DQB A;  4W6U A;  5HZS A;  3V3D A;  5EXB A;  3TMT A;  1G7K A;  5BTT A;  2A53 B;  5KTG A;  3SVU A;  3DQC A;  2Z6X A;  1EMB A;  3GJ1 A;  2V4E C;  3TMR A;  2ZO6 A;  3EK8 A;  5EB7 A;  1JC0 A;  4W6I A;  4ZIO A;  3SST A;  1B9C A;  3SG7 A;  2ICR A;  2VAD A;  5BTT B;  4W6D A;  1RMM A;  2G3O A;  4ZF5 A;  3DQ6 A;  4KA9 A;  2PXW A;  2IE2 A;  3LSA A;  4TZA A;  3RWA A;  4W6B A;  4OQW A;  3DQH A;  3UG0 A;  2A50 B;  1OXE A;  3DQ7 A;  1JBZ A;  3SVN A;  3H1O A;  2YE0 A;  3DQO A;  2DUF A;  4HQ9 A;  3VHT B;  2AWL A;  4Q7T A;  1CV7 A;  1UIS A;  3CGL A;  3RWT A;  4L13 A;  4DXO A;  3LF4 B;  4W6O A;  4KF4 A;  4RTC A;  2A52 B;  2QZ0 A;  2G2S B;  2IOV A;  4KF5 C;  1QYQ A;  1RRX A;  3SVR A;  4LJB A;  4PPK A;  4DXI A;  1F0B A;  4W6P A;  2AWM A;  2YFP A;  2WHS A;  3P8U A;  3ADF A;  1ZGP A;  1Q4D A;  2WHU A;  2YDZ A;  4EMQ A;  4EDO A;  2GW3 A;  1XAE A;  3NF0 A;  4XVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...