1KZ7B

Crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
total genus 61
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kz7B00
2W00A 2NMVA 1VPLA 3ONWA 2Q3HA 2MMGA 1K6MA 1KJWA 3DOFA 3SFVA 2CBZA 3AP3A 1KO7A 3RYTC 4EQ6B 4LHVA 3KXIA 3ZIAA 3OIYA 2RGNC 3KJHA 3OEHD 1SXJE 3GP8A 1GUAA 2WWGA 3AF3A 5EXXA 2ZR0A 3SHWA 3AVPA 3QXXA 4BLSA 2WJVA 4Q01A 2R6CA 4M8NE 2B92A 2IL1A 4YC7A 1OXXK 4MH0R 4FMCB 4BLRA 5KOYA 1E9SA 3OEEA 3LBHA 1VMAA 2IEYA 1E4YA 3NWJA 3Q5EA 4MKIA 1HE8B 5FR2A 4KXFB 2RB4A 1US8A 4KFTA 4PAOA 2D7DA 3BAFA 5FBWB 3AF2A 1KGDA 1RKBA 4YMWA 1VIYA 3CUEF 1CLUA 2Q9BA 1PUJA 1SVKA 3W8RA 1NG1A 4RVCA 4A4DA 4A15A 5GJBA 3PUVA 5J5CA 1MABB 1SHKA 4ASUD 1TEXA 2RGEA 3I8SA 5C18A 4JLNA 3B60A 4PZZA 1RYHA 3I61A 1ZMXA 4QGHA 1N0UA 1GIAA 1Y63A 2DWQA 2G83A 2I3BA 4PANA 3T5DA 2P0EA 3C8UA 3K0EA 4PO8A 1Z47A 1AM4D 1EG7A 4X8HA 4Q00A 4DJTA 5CITA 1NMZA 2QN6A 1NVWQ 2ZSEA 4IEEA 1LF5A 5CLLA 1E9BA 3HR8A 3LRPA 2IYLD 3CF0A 1NBMA 1DG3A 2QNRA 3QKRA 4G5SA 2RCNA 1SKQA 2BWJA 4LJ6A 1W0JD 1WF3A 4C0QC 3SR0A 2V9PA 2ODWA 3MFYA 2KJQA 1X6VA 2GRJA 3D8BA 5JWOA 5FH9A 3GLGA 2O0HA 4MDFA 2NIPA 3H0KA 4RSGA 1VCMA 1G16A 1OXTA 3RRNA 5FTLA 3VKWA 4ABYA 1V5WA 4HZIA 4L9SA 1RYFA 2P2LA 1ZM4A 4EKDA 5AK0A 4XOIA 1CJVC 1EFRA 1OXVA 5IK2A 3RABA 3RC3A 2XITA 2ZRFA 5FUYA 2GZAA 3LX8A 4GBMA 3IPXA 2JA1A 2W2TA 2IS6A 2ZI7A 3GJ6A 2ZANA 4ZI3A 1CF4A 4LV8B 1NIJA 1KTVA 2JJ1A 3B1YA 4ARZA 1AS2A 3RLFA 2QENA 1XBTA 4OYHA 3PEWA 1YZUA 2ODNA 1T8UA 4PO9A 4PPQA 2YC4C 5AJWA 3NDBB 5CYPA 5KU1A 3WBJA 4C7OB 2G0TA 4CEIA 2Z5FA 2GZHA 3MG9A 2PX0A 4C0AC 3WYAA 4N3NA 3U4QB 2PZGA 4MYCA 3GLHB 3TSWA 1W4AA 1E94E 4F4CA 1FUKA 1XTJA 3EZ9A 1VG1A 3GLFE 3GPLA 3KKOA 2J0SA 3R7WB 3CIOA 2ZSAA 1CXZA 3VR4A 5CK4A 2P6RA 1UBFA 5IT5A 1E2FA 4G1UC 4RKEA 1NSTA 4U00A 3T61A 4NYJR 2HXSA 4U02A 4WAUA 4EFNA 2ZEJA 1FX0A 1XJQA 4LV6A 4F93B 3DMNA 5HCIA 1CJTC 2WKQA 1KAGA 2EWVA 3WXMA 2NZ8A 3TJZA 4M1KA 4XH9B 4PX9A 1G5PA 4KO8A 2IS4A 2WHXA 1TUIA 2GTPA 4JYCA 3A36A 2IUUA 2VHCA 1Z6AA 5CYOA 1NMYA 5SZJA 1QG2A 4RCZA 4BPBA 1OIVA 3X1DA 3THWA 1HV8A 4E07A 2J3EA 1BH2A 1KDPA 3F8TA 1II9A 4ZKEA 4D4JA 2OFWA 2ZXUA 2O5VA 5H68A 3EZ2A 4P0TA 2X77A 4DC9A 3CPHA 3LW8A 3ADBA 1P2SA 3BWDD 3LDAA 3MCAA 3V00A 3BK7A 4DSOA 4FMBB 1KK1A 1S1CA 2QMEA 1ZNYA 4PHTA 4RD4A 1WE2A 2W2VA 3I8XA 2CL0X 1LW7A 5C1BA 5KSZA 4DHEA 1Z6YA 2YKGA 2HYIC 3FVQA 3DVLA 2OILA 4Q4AA 4HI0E 4AG6A 4EPYA 1MRSA 1ZBDA 3UPUA 3DOEA 2OXCA 3TBKA 4JKYA 5FR1A 1Z29A 4QNRA 2CHVA 4B3FX 4CT4B 1HH4A 1ONBA 2FA9A 3CR7A 2D4HA 3U6KA 1OFTA 2OM2A 2IYSA 3OIUA 1COWA 5DI9A 4NYMR 3BJIC 3U44A 1Q12A 4IOJA 2RMKA 4DSUA 1P2UA 1F2TB 2CL6X 2GVDC 1P9NA 3A4MA 2R6AA 4P4UA 3NTUA 2BMJA 5H1YA 1J99A 5LBIA 5JSZA 4TMVA 4Q66C 3W34A 1OYWA 4A8JA 4YMSA 1Z0JA 1OHHD 2V7QA 2AK3A 2ZUBA 3FPAA 2ZYTX 1ZYUA 4OHYA 5KHOC 3LX5A 1B0UA 4R2IA 3K70B 3R9XA 4EJSB 3GMTA 3LQQA 1ZC3A 1XEXB 1BMFD 1YZLA 1X8JA 3IIMA 4JL8A 1SQ5A 2WWIA 4LHYA 3P4XA 3RAPR 1J7KA 3QPUA 5G3ZA 2XTMA 2REBA 4KSBA 2ZI3A 2ZRNA 1KNQA 4UNQA 1NLZA 2H18A 1E0JA 3EWSA 4QOSA 5DISB 5FL3A 1W7AA 3ICEA 221PA 1DELA 1N5IA 2OFXA 1OV4A 2A30A 1JALA 1TMKA 2P6NA 2WJHA 2WMOB 2F43B 4Q18A 4CEHB 4LCBA 3L0OA 2VPPA 4NH0A 5KPDA 1JAIA 3KL4A 2ZRAA 2O8FA 1G19A 3AVXA 1OF1A 4L15A 4CEJA 2QPAA 1G7SA 5EUMA 3F5FA 1KMHA 2ZITA 3PEYA 2YVUA 5KSOA 3PQCA 3SDZA 2A9KA 2ZR7A 1E96A 1Q3TA 4HZUB 4KFSA 2IYVA 4TL8A 4IDNA 1U90A 5FBVB 3CZQA 3TUIC 2ZM5A 3U3MA 3CH4B 1GAJA 2YWGA 3EC1A 1G18A 3ZZUA 5JJIA 1ZIOA 5FFMA 4NYIR 1NN3A 4I1VA 4V02A 1P7CA 1T8TA 3T35A 1ZIPA 3CRVA 1T5IA 4D80A 1OXUA 5D3MB 1P60A 2Z43A 2CLCX 3ETLA 3NXSA 1DS6A 4ZO4A 2FJUA 3RSOA 4DZZA 2ERYA 1VIAA 3CR8A 4OI0A 4LJ7A 3ZD7A 3QKRB 2PCJA 1WCV1 1E79A 1IY1A 4B3GA 1IXRC 2FGKA 2GXSA 2NO7A 2TMKA 5AJYA 5KTYA 3EPKA 1E1QD 1CR2A 4XVUA 1QHIA 3REGA 3GLHE 1KI8A 3I1FA 1QRAA 5FOVA 4HB2A 1RPZA 2VP0A 3AP2A 5LDDC 3B9PA 2OZEA 4URYR 5L3RA 3QXJA 1U0JA 2GDJA 2XSZD 1II8B 5ANRB 3U7HB 1X3SA 3THXA 2YOGA 3RWMB 4M9SA 4GMDA 4NHOA 4OL0A 3DKVA 1GM5A 5DO9A 4BLPA 4A2QA 3QF4B 3FDIA 1KSJA 4BFWA 2FH5B 3KQHA 2BCJQ 3PXGA 1UBEA 4OI2A 2IUSA 3GFTA 3A4NA 3R8CA 3EXAA 1E9RA 2XOKA 2GAAA 1X8KA 4NP6A 4B2IA 1RJ9B 5DN6D 2HDNB 5GJWC 3AUYA 1G7TA 3GEEA 4B32A 2WSSD 1NVXQ 4DLSA 2B7BA 2WWFA 1U98A 4QJ4A 4L8GA 4QBHA 3KXKA 4JT2A 3KB1A 4PPNA 1KO5A 2F1RA 3U7FB 2J7KA 3CWZA 3S1AB 1XMJA 4D81A 1IM2A 3SJCA 4G3XA 3OE7D 4TYNA 1GKIA 3VAAA 5CB8A 3LVRE 5EXSA 3VNUA 2HF9A 3U61B 4D0GA 2NPFA 5J4HA 3LFUA 3RRMA 4HDQB 1PJRA 2JLRA 2VSFA 4PHHA 3T34A 3VR6A 4B74A 3BH7A 3VTKA 1YZTA 2AFHE 2ZJ8A 2PLFA 4JL5A 3WBKA 1W2GA 4NCNA 4OK6A 3CPEA 1KOFA 5FOTA 4XJXA 4YLGA 3W3AA 4IFBA 4LYAA 3QEJA 3WMFA 3NH9A 4DSTA 4V0OA 1NI3A 3TLXA 1E2JA 1KDTA 2B21A 1KY3A 821PA 2QGNA 1Q1ZA 2FSHA 2QE7D 1ZUIA 3IGFA 3ZS9A 5AR1A 4ACBA 721PA 5CJPA 3BGWA 4B47A 2JATA 4DLWA 4CEHA 4OJKA 1VYTA 1KYIA 3AM1A 2FFAA 1SVMA 1P5ZB 1Z5ZA 2ZSDA 4IDHA 2VO1A 4JSYA 5BQ5A 2H92A 4V0NA 2BEJA 3U6BA 4MKGA 4WVFA 2XTNA 3KJEA 4LX0A 4RZUA 5CLQA 4BFVA 3U5ZB 4QBIA 3MWKA 2GF0A 1OFUX 2RGXA 3QXHA 2XEXA 2XJ9A 3QENA 1PZNA 3RS5A 3LXRA 5C2JB 2UZ3A 1AKEA 1E2NA 1ZRHA 3FKSA 2RHDA 1HYQA 4TSFA 1VCNA 4R98A 2KB0A 2NO9A 3DM9B 2H7VA 3HDTA 5EE3A 3PV0A 4DT1B 3ASYA 4PO1A 2B6HA 1OKKD 4M2LA 1S3SA 5AUQA 1ESNA 5KNDA 2HUPA 3QJYA 5FUXA 4TQUS 2P67A 1UBGA 2UZIR 4NKRA 3IPYA 2VH5R 3AVYA 4H1UA 2OESA 4NE2A 1TF2A 2R6GA 3D31A 4MGYR 2B8WA 2ZRJA 2R6FA 3QEOA 1EX7A 5JS8A 1G3IA 4A0GA 4JKIA 4ZDKA 2ZS7A 1NJGA 2WSSA 1OE0A 4Q4HB 4BRWA 2HEIA 2WAYA 4Q1DA 5C46F 1MABA 4C0HA 4EAQA 4GOJA 4G01B 3AH8A 2FZLA 3D6TB 2WWHA 3B6EA 3D3QA 3GJ5A 3IBGA 1W4RA 4IXMA 1HURA 4OQMA 5IDVA 4YQFA 4A36A 4ILEA 4Q21A 1XEWY 2OAP1 1H8HD 1FUUA 1OFIA 3LVQE 3ND8A 3KXLA 4DCVA 3VU9A 1IJFA 4N0EA 4Q7LA 3NHAA 1QHSA 1ZM7A 4PR0A 4CW7A 3AV0B 2ZS9A 2QEQA 1YJ5A 2HV8A 4B35A 1XZPA 3M6AA 1XD9A 4MUBA 3KX2A 3LH5A 4AC9A 3T1VA 1US8B 2BCGY 1AS0A 1W5SA 1Z07A 4PQFA 2REOA 1DVRA 1KI6A 1SVLA 3TQCA 2V8OA 2QE7A 2C99A 2CMKA 4B44A 1NKTA 5H70A 5KDOA 1IN7A 1VHLA 5GADl 1G8GA 2ZTSA 3QKUA 2FG5A 1NVUQ 2GZDA 2MSDB 3KKPA 2P65A 1E2QA 1L7VC 4IXNA 3W5IA 2BEKA 3W8NA 2A5JA 1GL9B 4NMMA 1BIFA 4XWAA 1N6RA 4BRUA 4AK9A 3CRMA 4B2LA 4EPVA 3CPJB 4Q4LA 2IWRA 5JRZA 1XEWX 4N0DA 3AP1A 4LI0A 3FHTA 1SXJD 2X19A 1CR1A 1UM8A 1AA9A 1XZQA 2IUTA 2YOFA 3FMPB 4PPFA 4IOKA 1Z6XA 3Q7QA 2WV9A 4A82A 1KDRA 3UXMA 4CEIB 3KUCA 4A1FA 2P5TB 4B76A 1N5KA 4HEJA 2OHFA 4XWKA 1XP8A 4LYHA 2V55B 2DPXA 1ODFA 2FSFA 3AEZA 3WMGA 2IA5A 1FP7A 3SQXA 3VNVA 4TTPA 3ECCA 3C5HA 1HA3A 1MO5A 4W5HA 4R71A 3RRYA 4B3DA 3ADCA 2O52A 4OHVA 2OUKA 2X1VA 1YZQA 2D3WA 2QG6A 4BZXA 2XZOA 4LK2A 2YJTD 4ESHA 5JBQA 2JLVA 1PLLA 1Z2CA 3QG1A 4C9BA 4DEYA 2VA8A 1XXHE 2PCLA 4JBXA 5FBLB 5L3SA 4JLKA 1U81A 3TAHA 4GFDA 5JJKA 4YMVA 5L3SB 1JJVA 2CJWA 4M9XA 4DCNA 1N6OA 2ZRDA 1XXHB 2UVQA 1KJZA 3A4LA 1KZ7B 3GJ4A 1Z0KA 1FNMA 4WOPA 4HUQA 4UQOA 2O8BA 3LA6A 1N3BA 1E3MA 5FUWA 3N70A 5FBRB 3AQ4A 3THWB 3V4RA 2EQBA 2GNOA 4DT1A 2OSBA 2QT0A 4UXIA 2XB4A 4GP6A 3SJBA 4IVRA 3MAAC 4CGZA 2VL7A 4Q19A 1CJKC 2DB3A 1CJUC 1SXJB 3V4FA 4LJ5A 5EE0A 1C1YA 4RCYA 3TVDA 2HYDA 3AKDA 4U5XA 1Q21A 4BFTA 2V1UA 3FMFA 1E98A 1OYYA 2CE7A 1QHXA 2ZE6A 4AY2A 4NONA 3EG5A 5HZKA 2AXPA 3AVVA 4AIIA 1Z28A 521PA 2XAUA 3CRRA 1E2PA 4XD7A 4FMCF 5BXQC 4TTQA 1TQ2A 3WYGA 1R8QA 4ZDJA 2W6JA 4DCSA 5SZKB 2JAQA 3BH6A 4IJMA 4URWR 4MYUA 5CIWA 1SZPA 2W2XA 3C7KA 4PTLA 3EWAA 3UIEA 4AYXA 1Q1EA 4TLBA 4A0RA 3AKCA 3HU2A 2ATVA 1HQCA 5E7JA 4TT3D 1A82A 1LS6A 1XPUA 1Z3IX 3EPLA 2PJRA 2WWYA 2ZRHA 4WIAA 2IYUA 4GNKA 2O0JA 3T06B 5DE3A 4KCGA 1NF3A 2XTZA 2DFTA 2AKYA 1GITA 1N6KA 1R5BA 3QOFA 5A4JA 4IW3B 1II8A 1J8YF 3GLIB 3U7EB 1F5NA 3NG1A 4LYFA 3SFZA 2R9VA 2CCGA 4ERNA 5FPSA 1CRQA 1M2OB 1R0ZA 2OFOA 2BBOA 4OQLA 1KI2A 3KZ1E 6Q21A 4PZLA 2ZQ5A 1E2KA 5JI2E 5DYGA 4ZI2A 2VRWA 3FGNA 4DVGA 1W36B 3TE6A 1E2GA 2H8KA 1LFDB 3OFND 3B1WA 1ZW6A 4Q48A 3TUZC 5JCPA 3ASZA 2QM8A 4QM7A 1UKYA 4URXR 1KDOA 1F2TA 2F43A 3F3YA 4UNSA 5FOSA 1E1QA 3K0SA 1ZVQA 1KI1A 1SVIA 2PL3A 3VR1A 4FMDF 1I4DD 2PH1A 5EP3A 1D2NA 3UWKA 2MMCA 1QBKC 3ZH9B 3C4JA 4MQBA 4ASUA 2YINC 3DEFA 1UADA 3RVBA 2JLUA 2YWEA 1XMVA 1Q3HA 2YHSA 2ZJYA 1VDZA 3IQXA 2IYXA 1WB9A 2A2ZA 2IF2A 3QIAA 2WPDD 4O2LA 1CTQA 1L4UA 3LBIA 5FL7D 2DY1A 2QAGB 4AURA 4CDGA 3GEHA 5JWRA 2CDNA 4MKFA 4KVGA 2W6JD 4JL6A 3BB3A 2FV8A 2W6IA 3IEUA 2GILA 2VF7A 5FI0B 5TXGA 3SYKA 5CDFA 1AN0A 3MJRA 5P21A 1YHNA 2XJ4A 5JHGB 4MRSA 4BUJA 4PC1A 4LBZA 3QNUA 3EZ7A 3TR5A 1MO4A 4M0LA 1A5TA 3K09A 1P2TA 3QI2A 4B3CA 3U2QA 4I81A 3CF2A 2EU8A 4MITA 4MGIR 1ZD8A 3BH0A 4LJ9A 2VHUA 1GNRA 2EFEB 1EK0A 2CCKA 2OCBA 3ZYCA 1VG9B 1F2UB 4BFSA 3KQUA 2ZSBA 5K8LA 1VG8A 3F0TA 5FPKA 2O8CA 4HAUA 3CB4A 3K70C 1DTSA 2X2FA 1P9RA 2RGAA 4PAMA 1MRNA 1VECA 4BLTA 5LB4A 2ONJA 1KO1A 2O8EA 3L8ZA 1T0HB 1YE8A 2HJGA 2DFNA 1D9ZA 4HLUA 4F7WA 4WXRA 2OBLA 5FI1B 1EFRD 4A92A 2QROA 1HY3A 3TSOA 2GEVA 2YWHA 2VHJA 3K0AB 3KKMA 1DAFA 1N6LA 4B75A 2PMDA 4DLXA 1G6HA 4DLRA 2BIFA 1HUQA 2WJIA 4LZZA 1KKLA 4DCUA 1N5LA 4B73A 1RW4A 2FEOA 4PHFA 4QC2A 4TLCA 2YV5A 1SVOA 1V43A 5EE9A 1EESA 2G88A 2BJVA 1P6XA 5KNCA 1DAGA 2PT5A 2ZYUX 3FB4A 1M7GA 1KSGA 3SYLA 4R7ZA 4EDHA 2G9NA 1NG9A 2CE2X 4P32A 1BMFA 5B2ZA 5KDDA 2QA5A 4M9QA 2NG1A 3GJ8A 3KKQA 2ZE5A 3OIWA 4JZKA 2GWHA 1JEDA 1C9KA 3RS0A 1DO0A 1TF7A 2ZRKA 3L8YA 3ZD6A 1H65A 4JT4A 2IC5A 4C0LA 4DEXA 2C2HA 1RRCA 2IYTA 4Q4JB 3JZAA 1E2DA 4OQNA 1ETUA 4HZUA 3MRSA 1R6BX 5JECA 3IILA 1BS1A 1N6HA 3I73A 4DLZA 2GCOB 4CIDA 4NTZA 2CEAA 4Q1BA 1H8ED 4Q1CA 3QKSB 4IFEA 2QQ0A 3LAWA 3CWQA 5AWFC 2PZFA 1P4SA 2Q3FA 2NZJA 3WNCA 4ESVA 1EXMA 1GP2A 5GJCA 3CNLA 1ZM2A 4DDUA 2WVJA 3AVWA 1NP6A 2OLKA 4LY6A 4C2TA 3L0IB 3LLMA 421PA 4TSFD 2G6BA 4V0ME 1Q22A 3W3ZB 3BB4A 2VYFA 4FD2A 4JMPA 3G5UA 1KI6B 2AR7A 2CHGA 3QVUA 4M1MA 1DO2A 3RS7A 3A1UA 1IXZA 2ZU6A 3OEHA 4GPTA 5GJVC 5DIFA 3DZ8A 4RY2A 3TK1A 1G17A 2QSYA 3PG5A 2C78A 2FE4A 4C7OA 2AX4A 2F1JA 3W9YA 3N2EA 4FIDA 3EPJA 2JIZA 4TMTA 3THYA 2OLJA 2YC2C 2O8DB 4IOLA 4BFZA 1E1RD 3PEUA 1U94A 4IDPA 3LWNA 3FWYA 3B13B 3P26A 1JJ7A 4KBGA 3TW8B 2ZS8A 2J7PD 2L0XA 2ZUDA 4NCKA 1Y3AA 4RZ2A 1VKJA 1A2BA 2BBSA 2HCBA 2ZRBA 3GFPA 1JI0A 1W0JA 4HAVA 2XNSA 2Z83A 1U8AA 3TAUA 2WIBA 1XTSA 1A2KC 2FFHA 621PA 1UPTA 2BKUA 1UF9A 3M1IA 2XOKD 1SKYE 4B3XA 3VHLB 2GCPA 3AKYA 4FCTA 1F6BA 4UJ3A 3EPHA 2AWOA 1Z6GA 1XD2A 4P33A 1XXHA 1WP9A 2UKDA 3SI7A 1ZNXA 1SKYB 1NLYA 1F2UA 2QPTA 1E0AA 2XNDA 5EXTA 4F38A 4BGDA 1KO4A 1ZJ6A 2AHOA 3SJZA 1NLFA 2JASA 3HJNA 4DB2A 3BOSA 2FU5C 2ZE7A 3Q7PA 3D7MA 4GI7A 5TV2A 2VTKA 3U3OA 4KITB 4J0QA 3PJRA 1R5OA 1U8ZA 4KFUA 1E9DA 5CB6A 4Z8XA 4LBYA 4PZYA 2LWIA 3K53A 2GJ9A 4LJ8A 2V6IA 4Z1MA 4C3ZA 4DXAA 1KAOA 1HQYE 1KJYA 2GK6A 3H84A 3VMFA 3O8CA 3WHKA 1E9FA 1GZSA 1LB1B 3EASA 3CX6A 4QG7A 4Q4AB 1DG1G 4Q02A 4NBSA 3KJGA 1AQUA 1Z0IA 1TNDA 3H2YA 2FPKA 5CDFE 2JJ1D 2Q21A 2PJZA 5HKKA 2ANCA 2R65A 3W90A 5KUTA 5A0FA 3KTAB 1NVVQ 1DARA 2IXEA 4IHQA 4X8OA 3LLUA 3SU8A 3T1TA 4JS0A 3B8HA 4G5OA 2FPMA 3ZDQA 1B23P 5EP2A 3BS4A 1G6OA 4AWXA 1OB5A 5EZ6B 1U0HC 4PXAA 5LD2C 4QFMA 3UANA 1D5CA 3CM0A 3HPRA 4XVRA 3B2EA 1U9IA 1Z8FA 1ZP6A 4KODA 1O3YA 2A5GA 1IXSB 1DAKA 3GLFB 3NBYC 3MGCA 3VR2A 4DLTA 3AVQA 4TZ0A 1ZU4A 4LSGA 2QZ4A 2YOHA 3NIBA 1WDTA 2LKCA 2BV3A 1IOZA 2GCOA 2FFBA 3B7GA 1T9HA 2JDID 2XZPA 4AYTA 1JR3E 3FFAA 2ODEA 3MWYW 2OCAA 4JBYA 4Q9HA 3B5JA 3GQBA 5DI3A 1N2CE 3RC8A 1OKKA 2BHRA 1GG2A 1G3UA 4W7SA 3I5XA 1S4QA 5JEDA 4XTCS 2I1VB 3TH5A 1ZUNB 1MO3A 2GCNA 3DKPA 4HLUC 4GOKA 4YONB 4Z54A 2VHTA 2WJJA 2RGNA 4D4LA 4DKXA 1GDDA 2C04A 2IWHA 3PITA 2JEOA 1QHGA 1MH1A 1E2EA 1G8PA 3UG7A 1ESMA 5DH9A 5HR5A 3QE0A 3QPWA 4IVPA 4HSEA 3CONA 1KK2A 4Q9LA 1LV7A 3I92A 1GVNB 3VFDA 4IKEA 3THYB 4BE7B 1D2EA 2O8FB 2C9OA 4ZPXA 2XB2A 2W0SA 1W44A 2H57A 2QPOA 4Z1MD 5DNYB 3WRXC 4ARZB 2Q9AA 4MRNA 2FSGA 3UKDA 4LBVA 5TVKA 2ZI9A 3JZMA 3K8YA 3GD7A 3SS8A 1AK2A 5FPYA 4M9ZA 4F4IA 3GCGA 2FGJA 5FOUA 5JCZA 1P62B 4FCVA 3KFVA 4M22A 3E5HA 1AGPA 2OXRA 2F7SA 5E7MA 3X1XA 3AF1A 2A7QA 2ZVQX 4JLPA 2IYYA 1S3GA 4RKFA 3RWOA 3X1ZA 4A6XA 5KSPA 4F92B 4AKHA 2WAXA 3O8RA 2IYZA 4LOAA 1OH7A 1KY2A 3R9IA 1TTTA 3EIHA 4TQAA 3REFA 2G77B 1IHUA 4JIMA 1XTIA 1W4BA 4QJ3A 2CLDX 4JVNA 1Q1QA 1JAHA 3EAQA 3Q5DA 5IHPA 3OIVA 2F9LA 2ZI4A 3GFOA 5E95A 1E9AA 1N6PA 2VP6A 4WXPA 3B1VA 4E22A 1P72A 1G20E 1M6NA 2HF8A 2ZAOA 4GMXA 3K9NA 1JECA 4KU4A 3B82A 4QJ5A 2NPIA 4B34A 1CP2A 2H17A 1F60A 1QVAA 4ZIRA 3EIEA 1N5JA 4NYIQ 5FTNA 4YXWA 4BEJA 2IS1A 1AQYA 2WPDA 3DDCA 4TLDA 5FL7A 1OW3B 1T91A 2CK3D 4MRPA 3C14C 4P31A 3QQ5A 1N6NA 2A5YB 3OAAA 4FWIB 1MV5A 2FFQA 2D06A 4IOMA 4US1R 4FN5A 2JGNA 4B43A 1JR3A 1XCPA 4TZ6A 1PLKA 2W6ID 3B9QA 1YRAA 5L3QA 3I4LA 4JLBA 2BJWA 2OAQ1 2H16A 4L16A 1KIMA 1W4CA 4N1AA 4TL9A 5B64A 1DE0A 2HJVA 2E87A 3Q8XB 1C4OA 4LUCA 4M21A 5KSYA 2J45A 4LJ4A 4KVAA 4C0BA 3SYNA 4KYUA 2N46A 2Y8EA 1ZD1A 2WZQA 4JYBA 4ZCMA 2AKAB 5DLQC 3U3KA 8OHMA 2JLXA 5IF9A 3AVUA 3SHFA 5IRCD 1EGAA 1G64A 1NSFA 1CR4A 2CXXA 3GLFA 3UATA 4D26A 3QKTA 4CT5A 1LY1A 2ZRPA 4QGAA 4X8LA 1FQKA 2H5EA 2G3YA 1W46A 5J4VA 1WA5A 2IF0A 4YDSA 2WWWA 3MLEA 3TQFA 3B85A 4ZV4A 3T1QA 2QI9C 2A3RA 2BOVA 3K0FA 3RNLA 2CK3A 4B2PA 2V1XA 4BECA 4HB4A 1FW6A 4EPWA 3VKHA 1J90A 1XTKA 2VP4A 4BFYA 5HTKA 4C30A 5B30A 2ECKA 2FPLA 2ZROA 1GWNA 4OK3A 3LXXA 2JJ2A 3THOA 4O3MA 2QM7A 2ZJOA 1OSNA 2R8RA 5BYKA 2QBYA 4QBFA 2OEPA 1OJLA 2CVFA 3BORA 2FWRA 3BBPA 3OEED 4DLUA 4MYHA 4W5WA 5DYIA 4NCJA 1KK3A 4GP7A 2WICA 3QY0A 4IDQA 3I5YA 2SHKA 1NNEA 1ZD9A 3OAAD 4XTRA 1AS3A 4DCTA 1E2HA 3O8BA 5EZ5A 3CO5A 1W0KA 2QMUA 5UKDA 1CRPA 5FOXA 3C5CA 4II7A 3TNFA 4EJSA 3L2OB 3FHCB 3NEJA 3DO6A 1A4RA 1X1RA 4M1SA 4LHWA 5JS7A 1MR3F 2F3RA 3BIFA 3K9HA 2JLZA 2V6JA 2ZUCA 2VP9A 2WMNB 3VX4A 4A9AA 4YMTA 1D2MA 4AI6A 1SVSA 3FMIA 4RZ3A 4HLQB 2XSZA 3VKGA 3AB3A 3K9GA 4KSCA 3H86A 1WQ1R 2QMHA 1OIXA 3BFXA 4PC7A 1XPOA 3SZRA 2F3TA 2VP2A 4FXPA 1TQ6A 3CLVA 1KMHB 1NRJB 1S1MA 4GZMA 4HAXA 3WMEA 2BMDA 3ZVMA 3JVVA 1BYIA 2XX3A 5BWMA 3GJXC 5F3WB 4L5BA 5FUVA 2RKOA 2YYZA 1E69A 1I4LD 4C0JA 2EW1A 2VHQA 4Q1FA 5DN6A 2ATXA 1L8QA 2QORA 1DPFA 5FOWA 2JIZD 2BM1A 2PBRA 1CEEA 4GDFA 5JZVA 1E0SA 2ODBA 3VR5A 3H1TA 4TYWA 1XNJA 4GZLA 1G3RA 3U7GA 4ACAA 4B3BA 5J4YA 4HYYA 5SZHB 1M7HA 3PVSA 3RRZA 5JMTA 2JLWA 1X86B 2ASEA 3Q72A 4A0HA 4F91B 2VBCA 2G1KA 4MRVA 4W5JA 4XIGS 4V0MA 1RIFA 3K0AA 2OCYC 4JVMA 1VHTA 4ZIRB 1SXJC 3RS4A 5L3QB 4TLAA 1KKMA 4L4UA 2R62A 1BKDR 2QAGA 4R9UC 1II0A 5KO2A 2J59A 5K8TA 3EARA 3MD0A 2ZREA 3MWLA 1R0WA 4BWYA 3LNCA 1IBRA 1E2IA 2HT6A 2ZYVX 1UBCA 3K09C 3UMSA 5B58C 4P4SA 1YQTA 3BB1A 5D3QA 1YR8A 1YKSA 2XNDD 3EC2A 4GOXA 3MSXA 4IVQA 1SHZA 4BZQA 4PSKA 2WWXA 2DWOA 1ELOA 3BC1A 3BRWD 4TMXA 3K70D 3IBYA 3UMFA 1ZAKA 2YWFA 1D9XA 4ZKDA 4H9GA 2DCUA 1H8HA 4UKDA 2ZIAA 5BN5A 1RRFA 3MWJA 3P32A 2QP4A 2GKSA 2WJYA 4LDJA 1T3SA 2AL7A 2KSQA 3S1AA 2MSEB 1JQJC 1O87A 4BFXA 3SBDA 2XXAB 5HZHA 3ZGXA 2GA8A 2ORWA 3O8DA 3I62A 2X2EA 1DAHA 3IHLA 3CNNA 1IONA 4JVLA 1NIPA 3SEAA 3VX3A 4KHZA 2C77A 2QRNA 3LV8A 4KFRA 2ZJ2A 1XMSA 1P61B 3OHMA 1Q44A 3SE0A 3QG5A 2QU8A 2ZAMA 3WHLA 2KBFA 1Z63A 4Q47A 3TGPA 4Q9IA 4CZ2A 1E9CA 1BYUA 1JB1A 1S0UA 2FX3A 2GJSA 1G3MA 2P3SA 1G21E 4POAA 3IDQA 4A2WA 4C0SA 2J46A 3HU3A 1G8YA 4M1YA 4CYMA 3P20A 1KZGB 4LHZA 2K5UA 4CEJB 4P3YA 3VQTA 2DFKB 4HUTA 5KNBA 4JLDA 1RC8A 2NGRA 3QUSA 1NY5A 2QSZA 4JLVA 1BOFA 4KBFA 2EFDB 2Q9CA 2FF7A 2I1QA 4D4KA 4DSNA 1MOZA 4GSYA 1QDEA 3DPUA 4I1UA 3K0CA 1UEIA 4D82A 1S9DA 2J5XA 1IN6A 4L9WA 4HAYA 2XZLA 1RRPA 2E1RA 5F2EA 5FTKA 1XJCA 5EUQB 1XDBA 2QY9A 2ZJAA 2ZU0C 2QL6A 4JVSB 1XD2B 2AFIE 3Q3JB 3KB2A 1W2HA 1UDWA 4QBGB 1K5GA 1OHHA 4KI0A 5K8UA 2W0MA 2GXAA 2GF9A 2ZI6A 2JDIA 3RDPA 3T15A 1M34E 2J87A 1MKYA 1VG0B 4RFSA 1WRBA 1JBKA 2RH5A 3KQKA 3RS2A 5GVRA 3EIQA 5M04A 2ERXA 2OG2A 4LRWA 1NL3A 1P75A 1GL7A 2W58A 5FTJA 2GVZC 1E9EA 1EWQA 1SXJA 4NCIA 3P27A 1QVRA 3NHBA 5G41A 2C9YA 4KLZA 1NBMD 3G0HA 2J0QA 1ZM3A 2ZE8A 4UNPA 2ZETA 1COWD 3T12A 4DB4A 5TMPA 2RGCA 3B1XA 4ZCIA 1R10A 4Y0VA 3U4QA 4QHSA 4Q7MB 3SBEA 1T4GA 2PLRA 1XRJA 3C41J 1AKYA 4GRAA 3ZS8A 1L4YA 3NKVA 2BDTA 2FN4A 3KFXA 4HB0A 4P4TA 1VYUA 2EWWA 4HAZA 1WMSA 3GJ7A 1W48A 3KDSE 5G53C 1NMXA 3MMPA 4O0MA 4D2IA 5G3YA 4TMZA 2IXGA 3THXB 3ZQJA 2VLIA 1NN5A 5KPJA 1WBDA 4M1WA 2GESA 2PEYA 1R8SA 3EA5A 2ZR9A 3BD9A 3PCRB 3NEYA 3QF4A 1CS4C 5HE9A 5EE1A 3SQWA 1HE1C 1EFCA 1TU4A 5BN4A 4KV9A 1I2DA 1GRQA 2OBMA 2QRZA 4AD8A 1YU9A 1RE0A 3ZZTA 4RD6A 3EZ6A 4DDVA 4PSAA 4Q4HA 1TF5A 5LD2B 1LS1A 1TADA 2ZPTX 1NY6A 5AJVB 4A2PA 1FPMA 1R0YA 1Z22A 1VCOA 1LNZA 4D0NA 4TMKA 2WOJA 1GTVA 3CF6R 2QAGC 4M1TA 2GXQA 2I4IA 4OI1A 4HLDA 3HPQA 1FMJA 2B7CA 2P6UA 3NC0C 1KO8A 2H1LA 5DSZA 2VF8A 4CRWB 1WXQA 2FMXA 3NH6A 3CX8A 2WSMA 4V0LA 2Z6VA 2AWNA 4RFVA 1G1MA 1Z0DA 4HLCA 4XD7D 4B48A 3ZIAD 3L82B 3LQRA 1XWIA 1JR6A 5JLJA 1X1SA 2IEZA 1T5LA 1RRGA 5J4LA 3AUXA 5TARA 4YMUA 2OE2A 1RZ3A 2EVWX 2PT7A 3TKLA 3U44B 3NBXX 1G8FA 3TUJC 4D25A 1I4TD 2WOOA 4WZ6A 3WNDA 4K46A 1FL9A 2BM0A 2F6RA 5JI3E 5L3VA 1ZC4A 4M53A 4Q9JA 1GILA 2BKEA 4XSGA 2XXAA 1S2MA 1AGRA 1GRRA 2ZRCA 2B8TA 1DAIA 1M8PA 4B33A 5KYKA 1I2MA 1YR6A 4FW9A 3C16C 1PVOA 3A58B 4NDZA 1D8TA 3A1TA 4NPHA 2ZSFA 2DWPA 1XB2A 1UKEA 3QF7A 2N1BA 2NTYC 2HT1A 2QP9X 1IN8A 4JSTA 3ZQ6A 4AKEA 4PQRA 1ZU5A 3T1OA 2GXUA 4TYPA 1ZINA 4TN1A 5FBQB 2O8CB 4HATA 3BERA 5TDHA 4KLNA 4QL3A 3T5GA 4C2UA 3K1JA 3RSLA 5H8WA 4UJ5A 4ZDIA 4LHXA 3GLIE 2KI5A 1XF9A 1X8LA 3UMRA 3A1WA 1RVDA 4NL4H 3HR7A 3QBVA 5AUPB 2V4ZA 1XEXA 2R44A 5CM9C 1W36D 4IDOA 4TT3A 3L0PA 5AJXA 2FDCA 5BN3A 2CCJA 1KI9A 3EW9A 2OT3B 3HP1A 4K81B 5LB2A 1QHYA 2ANBA 4YDHB 2QBYB 1IQPA 2RHMA 5L8VA 1E2MA 2O8EB 1N0VC 1GNPA 2IBMA 5EE5B 4DLYA 1PV4A 2D2FA 3PUXA 3GLGB 3IHWA 4I1SA 4D6PA 3A8TA 4LWZA 5JWHA 1IAQA 1XFAA 2QUZA 4JLJA 2EFGA 3OESA 1EFHA 1VTKA 2CJWB 2IX3A 2D62A 3P4YA 2GHIA 5TB5A 3O47A 3TR0A 2J0UA 3OE7A 2GJAA 2ZJBA 2BBWA 4E03A 1G7RA 1VCIA 4RJLA 3FFBA 2VSXA 2AXNA 1T0JB 4BASA 3N5CA 1ZCBA 1CR0A 4URZR 4BLQA 3UWOA 3CKLA 4NYMQ 4TL7A 2Q3MA 2DBYA 4DUGD 1JEEA 2J0VA 1N25A 3TRFA 1TAGA 5DHFA 1Q57A 1Z6TA 3VU9B 2J7PA 2AD1A 3X1WA 2IK8A 1HT2E 2JLQA 3JVUA 5BYJA 2EYUA 3LO5A 3NVAA 3ND9A 2ZVPX 2EFHB 3OFNA 3EZFA 1OXSC 2JJ2D 2JLSA 2JJ8A 3RANA 1NJFA 3KKNA 3IEVA 3WP0A 1GKYA 5SZIA 3ZLJA 4MGKR 1UJ2A 1P3JA 3DM5A 4LJAA 1FQJA 3U3JA 3SN6A 4LC0A 2FSIA 2CL7X 2KBEA 4QM6A 4EFLA 3NBZC 1Z08A 4UXJA 2WIAA 3WYFA 1XPRA 4W9MC 1OH6A 1KI7A 2A5DA 2IYQA 2KE5A 5CJ2A 4QGFA 1NN1A 3IO3A 4E09A 4QHYA 4B6FA 4MRRA 2BMEA 1W0KD 3CRQA 4LC1A 1XTQA 4PQYA 4BZPA 5FPHA 3W6OA 2IYWA 2D2EA 4O2RA 4DIDA 4EPTA 5HPYB 1FTSA 1FX0B 1W49A 1OPXA 1XMIA 2RGGA 3K0FB 3L43A 3M4YA 4WZAE 5B57C 2GEUA 4TLEA 1WBBA 3QXSA 3FYHA 3WNBA 3J81k 3BFKA 5F9HA 2OO7A 5K8IA 1TU3A 2WKPA 3CRW1 4US0R 3BFVA 4US2R 1ANKA 3CBQA 2R6DA 3GLIA 1CU1A 3W5JA 4OBEA 1DAEA 5FPTA 4HDOB 4OHWA 1K5DA 3GEIA 5F98A 1N6IA 4ON9A 3PEVA 2GAOA 3CW2A 4URUR 2CHQA 1L2TA 3OF5A 1J2JA 3FKSD 4C4PA 5JJLA 3AF4A 3AKEA 5J4KA 3TSZA 5HKKD 3QPVA 1HT1E 1OIWA 1P2VA 2FZ4A 2FNAA 4TWZA 4TYQA 2ZYWX 1G5RA 2D74A 2F9MA 1QZXA 2QT1A 1XU4A 3K9LA 4Q03A 5AUOB 2GJ8A 4P4SB 2ZRLA 4DLVA 4AKIA 4EFMA 2DFLA 3LD9A 3BE4A 1HTWA 4E5UA 4RD2A 1E0KA 1OT3A 2WBLC 4WZBE 1NKSA 2O8DA 3GLHA 3FHOA 1M74A 1KMQA 2J41A 1JNYA 1DADA 3DZDA 1W36C 1UEJA 2X8AA 2IXFA 1G4UR 2D7CA 1YZGA 4NCHA 3IUYA 1R7RA 3A1SA 4Z51A 1S96A 3V9PA 4OJQA 1W5TA 5EJEA 2C98A 1GNQA 3Q85A 4JLOA 1M7BA 3ZVLA 3ADDA 4O25A 4OKSA 1XD8A 4RZXA 4EQ6A 2WJGA 4BLOA 3QXCA 3EA0A 2CVHA 3AGPA 3H4MA 4UNRA 1RFLA 4FWTA 4FMDB 2YZ2A 5EXPA 4ZCLA 3SJAA 4URVR 1VYVA 4KAXA 4MGZR 1SULA 2GBLA 2MSCB 2QTHA 2Z4RA 4IRUB 1ZNWA 5JSZB 4XSHA 1MO6A 4S2EA 3CX7A 4QXAA 3TMKA 2FOLA 5LPNA 4GL2A 2C5LA 5HCNA 1GSIA 3AVOA 2BVNA 3LW7A 5E3HA 4LGMA 4Y0AA 4A8JC 2ZJZA 3MJHA 3Q9LA 3KQNA 3N2IA 1FNNA 3FMOB 4Z8YA 1U9IC 3VR3A 1KHTA 1U8YA 4LJYA 2JLYA 3SOPA 1P73A 2DHRA 5JFGA 2V3CC 4I99A 3KTAA 1TUEA 4WA7A 1UKVY 2NO6A 1H8EA 3QVVA 5G40A 3W6PA 4JJKA 1FFHA 1W47A 1AIPA 4X8MA 121PA 1EWRA 1G41A 1JPJA 4OK5A 1IJEA 3HU1A 1YRBA 1Q1BA 3L0SA 1Q20A 3W6NA 1FTNA 3NC1C 3R8FA 5JRJA 4KJZA 2LCFA 3WY9A 4CVNA 1FP6A 1AJEA 4QHTA 4M1OA 3CNOA 3HYRA 4OHXA 1Z0AA 5CK5A 4TMWA 5C4GB 3OZXA 4FCWA 1QF9A 1T3LA 5IK2D 4MKHA 2AN9A 4PC2A 3DHWC 3ADKA 2KWIA 1CKEA 1LTQA 1TQ4A 4EUNA 2IS2A 2HLDD 1GL6A 4TTRA 1J70A 1FZQA 3G82C 2NO0A 1KK0A 3CZPA 1Z83A 3C15C 3HWSA 1G8HA 3EX7C 4MYTA 3AVTA 1E79D 2NO1A 4NZYA 3A37A 4NYJQ 3E1SA 4AG5A 3P1JA 2F1HA 2VSOA 1E1RA 3PIRA 3WRYC 1J8MF 1EFTA 4B6EA 1A1VA 2QQEA 1Z2AA 5C4MA 4MA4A 4DBLC 4A8JB 2YNMA 4HB3A 4S35A 3CH5A 4V03A 2EFCB 2VIIA 2QMOA 2J9RA 2GBLC 2GEDA 1YVDA 3FKQA 2WKRA 2VEDA 2ZRIA 4OI4A 1K8RA 2CNWD 1TQDA 2PMKA 4JLMA 5A5GA 1CBUA 2IW3A 3R7WA 4BFUA 3U60B 4IEIA 3IIJA 5CM8B 4Q4JA 1IY0A 4DRZA 4A6PA 1A7JA 1GOTA 3U3RA 3ZJYA 1OB2A 3KUDA 3PENA 2QAJA 1T6NA 2N42A 3A6PC 1TL7C 1QG4A 4QRHA 1HEIA 1JXMA 4AYWA 1JPNA 2DR3A 1JXOA 4RFSB 2XGJA 1NBME 1LVGA 1QHHA 4FI3C 1NVVR 3LY5A 4TL6A 4JBWA 1DEKA 3PUYA 1Q0UA 1KSFX 1RJ9A 2QP3A 3IO5A 3TVTA 3I32A 1SVWA 3FE2A 1R0XA 2QTFA 1CIPA 4NU0A 5CIQA 2GK7A 4OHZA 1E6CA 4QKQA 4CF7A 1DOAA 2BBTA 5EP4A 4XWOA 2JCSA 3FOZA 3VHXA 4OQFA 1E32A 3KQLA 4K8OA 4D4MA 1DAMA 4Q7JB 2AK2A 3LBNA 3X1YA 3FTQA 3WP1B 4QGGA 4V0KA 1E2LA 1ZUHA 4EPRA 2J1LA 4G0NA 4WBSA 1KI4A 4RD1A 4D0LB 4XVQA 5EP1A 4JJZA 2O8BB 4FINA 1SGWA 2FEMA 1ZM9A 4LPKA 5AJZA 3IQWA 3GLGE 5J40A 1R5NA 2O0KA 3R20A 2Q0HA 3ZVNA 1MT0A 3E2IA 1YR7A 2ZI5A 1XCMA 3A1VA 4EPXA 2HLDA 4Q1EA 3QBTA 3NBFA 2IT1A 2P5SA 1IY2A 1S9HA 1UFQA 1KSHA 1W1WA 4Q1AA 2WTUA 2CNWA 2C9CA 3PUZA 4M4SA 3UG6A 2RGBA 4PC6A 4Q5IA 4RD0A 4EIWA 4LPSA 1U2RA 2DYKA 2REXB 4RD3A 1OH5A 4QNMA 2BMFA 1G5TA 4U7DA 1OLOA 2V7QD 4JLAA 4KYIB 5ELXA 3E70C 4PAQA 4G5GA 1UKZA 2IHYA 2OV2A 5GVSA 1G3QA 1AZSC 1TEVA 2C8VA 1R2QA 2IYRA 1YR9A 5E7IA 3DL0A 2C95A 3ICQB 1IN5A 1G9XA 2F1IA 1TX4B 2E9SA 3X2SA 3QSYA 2ORIA 2RAPA 4DIEA 2ONKA 2PX3A 1LF0A 4LBWA 1UAAA 3R9WA 3QKSA 1GRNA 3TIFA 1OFHA 1AZTA 1R4AA 1ZCAA 2A5FA 2W83A 5FTMA 3UK6A 1GFIA 1YZKA 5TY0A 1G4AE 1U0LA 4G5RA 4PPGA 2G1JA 2GJKA 1BO6A 4R2HA 4DDTA 3MUFA 5BW8A 3NDPA 4MUAA 2ZJ5A 5HE8A 2VP5A 5E4FA 4YXWD 1NN0A 1E4VA 2PZEA 3SC3A 1E99A 4WW0A 2AD5A 2C03A 3B78A 1OH8A 3BXZA 3PUWA 1EFUA 2ZRMA 4PC3A 4EJSC 4I1OA 2IHBA 1T3HA 1D6JA 4PSVA 4DWJA 2HXYA 1TPZA 5JHHB 4Q7KA 1YZNA 4DDWA 5EQTA 3RS3A 1GKUB 1M1YE 3IIKA 5AUNB 2F55A 5JEEA 4OQXA 4C0KA 4Q9KA 5F9FA 2OCPA 4HDCA 4B71A 2Q6TA 1QHNA 4F4JA 2Z4SA 3SNHA 4HUQB 4DUGA 1U99A 3GJ0A 1UDXA 1JQLB 3ZVRA 4HAWA 1Z0FA 4A0FA 4ITRC 4UXHA 2LKDA 1ZNZA 3I3SR 2V54A 4GT1A 2Z0MA 2R2AA 4I4LA 1F3OA 3TW4A 1G7CA 3AGQA 2VQSA 3HYTA 4TQ9A 4BEBA 2EYQA 3KJIA 4MDEA 1F48A 1XEFA 1PLJA 4BQSA 1KI3A 5DHAA 2QGZA 5DI3B 3K0CC 4G5QA 2C96A 4PFSA 4LV5B 2ORVA 1QHHB 3ZZ0A 1XTRA 4AKGA 1KNXA 5DGXA 1EX6A 3DMDA 2ZRGA 1XCGB 1S8FA 3B1ZA 5KDLA 4ZDWA 1N0WA 2J0UB 5D3MA 4UNNA 1CJMA 1CULC 2GETA 1P9WA 2NOAA 1PUIA 1G291 3AF0A 2BC9A 2PEZA 2A78A 2G0NA 1IN4A 2QTVB 1DBSA 3PFIA 2HCJB 4H1VA 2OBNA 3IKJA 1JR3D 2CLSA 3I72A 5J47A 4TYYA 3RHFA 2WM9B 1FOEB 3GJ3A 4PHGA 3PR1A 2NQ2C 3M0EA 1Z06A 1FMLA 1XJ0A 2RGDA 1XX6A 4LYJA
chains in the Genus database with same CATH superfamily
1NDQA 1VPLA 2LRHA 2MMGA 1KJWA 1RR6A 2Q3HA 2WABA 3IUBA 3ONWA 4HR7A 4JA2A 4LVCA 4OHMA 5B2EA 5IWCA 1EUYA 5K51A 3FROA 3OPVA 4R1LA 2B3TA 5LMNB 1P8AA 2A6PA 5HS6A 2GPYA 1G98A 3M49A 1GUYA 3OIYA 3QX7A 3PX2A 2RGNC 3KJHA 4FI3F 4CI9A 1QV6A 5KOJB 2WWGA 3Q11A 3CLSD 3SHWA 1SR8A 2OAGA 3H11B 4BLSA 2WJVA 1IEQA 2R6CA 5KREA 4M8NE 2B92A 2YIDA 4UPVA 4FMCB 4CMIA 1SXQA 1NVBA 1E9SA 2MR5A 2X6QA 3NPAA 3RM3A 3RR2A 3P2JA 3ST7A 3LBHA 3WBBA 4WBNF 3TECE 2IEYA 1W85A 1YRQA 3BIJA 1H0HA 1ZI8A 3FDJA 2BGKA 3NWJA 3DVRX 3PXDA 1PR9A 4MKIA 4KXFB 3WA6A 6ABPA 1IBLB 3CKMA 1US8A 2WJZB 1SUWA 4BP9A 4GX5A 4Z6KA 3UVEA 4PNPA 4ZT7A 1E0DA 2Q9BA 2H2GA 2WHQA 5IVIA 3EXG2 1PUJA 3TBFA 1NG1A 2Q3BA 2QVGA 4JCOA 2O3QA 4RVCA 2NN3C 2D8AA 1JKFA 3PUVA 3EE6A 4L76A 5D7NA 2G7MC 1TEXA 5J5CA 5AOAA 4ZK2A 3C3KA 3HR4A 4JEMA 1W4ZA 3AV3A 4O59O 4P3PA 1Y7LA 1RYHA 3PEFA 5F73A 4DRYA 5KWSA 1H1LB 1LFAA 2DWQA 2QRGA 2BFFA 3A6JA 3G2NA 4K7JA 2FZGA 2Z08A 3LP6A 4BKOA 1M2KA 4GPAA 1UJ5A 3WQBA 3F73A 5C8DA 2WHRA 4DLNA 4MROA 1GAEO 1EG7A 1SZCA 3E6AA 3Q8MA 1NP7A 1HKUA 1NMZA 5G0TA 1BWQA 2C3YA 1J0CA 1RWNA 2ZSEA 1HOTA 2W2LD 4JITA 4BU0A 3JVEA 2AV6A 1VI5A 4GLLA 1Q17A 3PLRA 4KEAA 3BXGA 1ZH2A 3CF0A 3V32A 1NBMA 1U6IA 4ARBA 2RCNA 3B2NA 4Z4GA 4CKWB 4X3CA 2QS9A 2VDQB 2V9PA 1JFRA 3MFYA 4LKRA 2DFPA 3H8VA 5DT9A 3DV0B 3VR4D 4DR1B 3CEMA 3GYBA 5F3DA 2I55A 3DAFA 5FH9A 1ULHA 1JX6A 3KT3A 3ORYA 1RWQA 4OXIA 4XJVA 1F1BA 1S3FA 3O03A 4UPDA 3ZCSA 1FMFA 3AXTA 4RSGA 2XUOA 3DA8A 3HS3A 1WUTA 1RM3A 1TUGA 3I64A 2OLEA 1U65A 1OXTA 4YAGA 2QVYX 3SLKA 3L1VA 3VKWA 1TIPA 4GXNA 4IFIA 3MT7A 1HLPA 3P4UA 3K3PA 5AK0A 5LQKA 2JG3A 2I65A 4QOGA 5IK2A 4PGMA 1SPBS 3RC3A 2OMEA 2GZAA 4Y9RA 3B2QA 4H7KA 2QPLA 3AI2A 1CZUA 4EY7A 3AR3A 1MU0A 3NT2A 1FQWA 5C4IA 1VFPA 2HHAA 3F9CA 3GRYA 4XFKA 4GRIA 4HSGA 1ES9A 5AYVA 1TAHA 2H63A 4LHSA 5D51S 1XBTA 3FZEA 2FMKA 4OYHA 4W8OA 4Q6WA 2YUTA 4GZ3A 3SQDA 2FRXA 1BU5A 1EA7A 5KU1A 1VSVA 4N6OA 1SBCA 4NBVA 1D09A 4UOZA 3WYAA 3IAHA 3DB1A 4Y6GB 3C3BA 1KAHA 1RQXA 1W4AA 1WZCA 2AHRA 3EY4A 4UUQA 3ESAA 3ZI7A 1FUKA 3JQ8B 1VG1A 1J8VA 1JE1A 1S01A 2AB0A 1ZMOA 5C37A 3R0IA 3ZWMA 3CIOA 2ZSAA 3VR2D 4RHEA 4EM6A 4B5KA 5JSUA 2E4ZA 5NLLA 1NLMA 2GM4A 2P27A 3MTEA 1CQIB 1E6LA 5DCWA 1Q0ZA 1WP4A 2FPXA 5IT5A 1BXRB 1OAAA 4MEBA 2QLFA 4Y2JA 3I6YA 3OSZA 5L6MB 1Q1GA 3OICA 3I9NA 2ZEJA 4OLAA 2HKIA 4MCAA 1IZ9A 4U6QA 2ZT8A 3M4NA 3I23A 3WLJA 4F93B 4ZAFA 3PNPA 3EH2A 4B40A 4DV7B 1N2EA 1CJTC 2C54A 2ZWOA 4QU0A 5ALSA 2WKQA 3RYFB 3WXMA 1YBVA 3TZKA 3TJZA 4U63A 2DRIA 3EGEA 5FLKA 5K01A 1XPJA 1GDHA 1MIOA 3OI7A 3PUHA 1CUWA 2HRBA 4EK9A 5EWLB 4KO8A 1KYZA 2WHXA 4MYSA 3SJUA 5IBRA 2BEWA 3M1LA 1ZH6A 3DLCA 1NURA 4N5IX 3MXOA 4QTXA 1VMIA 2VHCA 1Z5WA 2P9JA 3MMNA 1CUUA 4I4CA 1NMYA 1RI4A 4OSOA 1YIAA 4RCZA 4DMMA 4IPTA 4BPBA 1ZGHA 1CUEA 2PSEA 1CR6A 3HJRA 4JJ4A 4MW2A 1GTSA 1XNRB 1LH0A 3DJFA 1MX9A 1LTKA 2H5JA 4ZRNA 2O7SA 3R3WA 3NBQA 1AO3A 2JANA 2ZXUA 4CLDA 3P9ZA 4GAEA 3EZ2A 1B76A 2I7XA 4P0TA 4RXUA 4BMCA 1GXSA 4HRVA 1QH9A 1WEKA 3LW8A 4HYEA 4CF6A 3VO9A 1J33A 3CZRA 1NXVA 1BVRA 3VPXA 1B8UA 1GG8A 1S1CA 2QMEA 1JDTA 2QTCA 3RSFA 5LC1A 5BMVA 2W2VA 3U09A 2BONA 3I8XA 3OLQA 5KSZA 1AV6A 1MAVA 2HYIC 3FVQA 3DVLA 1JIVA 4HI0E 4RVOA 4EPYA 5KVQA 4DMKA 1ZBDA 2YWDA 2JK0A 3UPUA 2Y1KA 4EVQA 1QKKA 3QX9A 1ACJA 3JV7A 4WN9B 4UUNA 1LTHR 3CINA 5FR1A 1K8ZB 3V8MA 1V96A 1ZRNA 1TGVA 3R3UA 4QBTA 2CHVA 4QNRA 3O82A 1PE0A 4CT4B 1ONBA 2AKEA 1PJSA 4MV8A 3VUFA 1X19A 4HBZA 3A6FA 1OFTA 1CF2O 3KPJA 5AVKA 1YS1X 5BN1A 3GLQA 3BRSA 3HBJA 1F12A 3KTDA 2B1GA 3Q6IA 3RVDA 1RP7A 2G08A 3NS7A 3LC1O 2G5GX 1DUSA 4IJKA 4C3VA 4ALKA 4INPA 4W63A 5E9JA 5KAMA 1I3NA 2R6AA 3MIIA 2CFRA 3ZTYA 2OB1A 5H1YA 3NTQA 3MS2A 4Z0HO 3A2MA 4TMVA 4EW6A 3IOCA 4NDAA 3LPAA 5HUQA 4YMSA 1AUQA 4N3CA 2CD9A 3H5LA 1T1SA 2O1WA 1OHHD 4C76A 4DEVA 3D2AA 3FPAA 4INJA 2GF2A 1ZYUA 2ZYTX 3WRVA 4DA8A 1M1YB 3UB4A 1B0UA 1UBKS 3HKEB 3AMVA 4DMCA 1W19A 1X1DA 3R9XA 4EJSB 2B4KA 1F0KA 2H1IA 1KXZA 4HV4A 3NHPA 5EWMB 4DZRA 1T3ZA 5FOQA 5C8XA 3Q10A 4MMZB 2PRSA 1SQ5A 3T38A 1NATA 1PN3A 4G0PA 2ZWIA 2XTMA 3KG2A 2CVZA 2ZI3A 4O4JB 4B6PA 1RP1A 2OCGA 3G9TA 3NNNA 2OFXA 1OV4A 2A30A 1BHJA 1I33A 1IEVA 1TMKA 2VWQA 1BU8A 1E1NA 1QBGA 1WDKA 4KQEA 4B46A 4CEHB 3IESA 2XCLA 4LCBA 7REQA 4NH0A 4GX1A 5B55A 5KPDA 3IFSA 3ZQ4A 1GZ7A 4KE7A 4H18A 3N59A 4TXHA 2CV0A 1J5PA 3AJDA 3DDUA 4IIXA 3PC3A 1G7SA 5EUMA 3F5FA 3HY4A 1Y4UA 3G68A 4GYKA 1UODA 4AX8A 2WFLA 4QRDA 1E6UA 4CKEB 2OHIA 4C2UA 3JAWB 1EHYA 2WZDA 2X5KO 2IYVA 3HVJA 4KFSA 3VVBA 1C8KA 3D3NA 5CTAA 3DNFA 4AIRA 3G0DA 3UJPA 3EDMA 3CFYA 4I55B 1X7DA 1ULSA 1ZN7A 2EJCA 3SVZA 5KZMB 2YWGA 1M2VB 1MC8A 1AKMA 4RVHA 5TS3A 2Q0QA 4YAJA 1PT7A 4D5GA 3NHUA 3GOQA 4M54A 4PLVA 5ALEA 5JJIA 3LWDA 2JIQA 2RGRA 3UKOA 4DTIA 3RIEA 1PJAA 4TTJA 5JFOA 5JZSA 1P2FA 2DC1A 4J0CA 5C0OE 3CRVA 1PS0A 5F7OA 1T5IA 1OVGA 4G26A 2HIMA 4GS5A 4Y0NA 2SCUB 1OXUA 2Z43A 1KEUA 4MUNA 1OZFA 2WRZA 4ZO4A 3ZCXA 4M0FA 1PJ2A 4J0GA 4N8SA 2ERYA 3NJ4A 1ORRA 4MDHA 3CR8A 4DZZA 2V7EA 2HDWA 3TGLA 3SICE 1ZO8A 1WCV1 2ECFA 4FS3A 2C7GA 2NO7A 4XFDA 3TX6A 1VLHA 3K5PA 4CL0A 2PYDA 5AJYA 1U2GC 4AP5A 3LHFA 4ALIA 5KTYA 1QHIA 2NYAA 1N7GA 3MFQA 3TZ6A 1M2OA 3DFKA 3WMWA 1MOQA 3QH4A 3GU3A 1W1UA 5BPHA 3DE7X 1FLAA 2LVBA 3I0ZA 4O4HB 3UV3A 3O1JC 1EYZA 1LPNA 4J16A 5LDDC 4FK8A 1EWYA 5TPZA 4DCMA 1MF7A 1Y5IA 5ANRB 4B84A 4F06A 1TZCA 1NUTA 1WDLA 4DCOA 5JADA 3THXA 1V71A 1WXXA 3K4HA 4NHOA 4OL0A 2OZLB 4UMFA 4CM4B 4N7MA 5COQA 1YGYA 4E30A 2PWYA 3DBIA 5DO9A 4LOLA 3H7IA 1MB2A 1JWAB 4A2QA 4ZV9A 3QF4B 4RPCA 3FDIA 3ZHYA 4BFWA 3VYSB 4Y18A 3ZX4A 1MQAA 3RSSA 5B3JC 4LC9A 3SPXA 5A4DA 4J4HA 3KHKA 2V6MA 4IF6A 1T5BA 1BCRB 3C1OA 5KVVA 5J2TF 3GFTA 4EJMA 4FYHA 4QQNA 3EXAA 4BIIA 4EJ2A 3AR6A 2X0JA 2X6RA 4RCVA 3A4VA 1WSBA 5DN6D 5GJWC 1GZ5A 1CEXA 2WSSD 5HBRA 1TLTA 5F77A 1J0XO 3EQ6A 3T3OA 1NMEA 4AUNA 3NRJA 3DW1X 4AZ3B 5DGDA 4G36A 2EV9A 4Z4CA 4HDNB 1L4BA 1XMJA 2HPZA 4MR9B 3S1AB 4Z4FA 2YVAA 4F3RA 4MRAA 2AYXA 1BD3A 2ZBFA 3VAAA 1TVEA 1X7ZA 2REQB 3LVRE 5EXSA 4F97A 3GUHA 4A8PA 2HF9A 1J2TA 3HZZA 3C6MA 4M7RA 4D0GA 1PVVA 1O6BA 3C8HA 2QN3A 1DX6A 2JLRA 4HDQB 3VR6A 4KITB 1IPHA 1ZG3A 2E7ZA 2JFGA 3BH7A 2ZT7A 3A6EA 1KFKB 1Z34A 2PL9A 4DA6A 3AM5A 4XARA 2XXJA 3ZJUA 4TWRA 4UTOA 3DLTA 4YLGA 3KALA 4LYAA 4CM6A 2AQ8A 3WMFA 1GQSA 1CS0A 2RH8A 1LKZA 4RE5A 5EJ7A 1YBAA 4YR9A 5AD1A 1NI3A 4OJNA 3TLXA 1E2JA 4FDTA 3O3NB 3GUVA 1L4EA 3OJEA 1KY3A 821PA 2Z6UA 1LPAB 1UJMA 2FSHA 3DEYX 3E4DA 1R8JA 2NU6A 3KHTA 3PT9A 4HYQA 4DYHA 1JVSA 3NHWA 3L7AA 2FZEA 1RKVA 2JATA 1JLMA 3ZDDA 5GGXA 5KC9A 2JGAA 5IFKA 1VYTA 3A6DA 4P35A 4N48A 2L18A 1SVMA 3UBMA 1ICIA 1Z5ZA 2ZSDA 4IFTA 4L22A 3DE1X 3JQEA 3BXOA 2ZBQA 1N1EA 3P9XA 3S2ZA 2X42A 5DV9A 3U6BA 2Y4NA 4WVFA 2JHCA 4A0SA 2JRCA 1VSQA 3CNEA 3KJEA 2R751 4H31A 4LX0A 3HV2A 4ZQEA 4RVSA 5BQPA 3VHRA 3ZY3A 4BFVA 3U5ZB 5CTJA 3KSAC 1E60A 1XYYA 4BLVA 4JKOA 3UXYA 5I7WA 2GD0A 1OFUX 3QE2A 4KLRA 1XQWA 1XNQB 1MBZA 1D07A 2JD1A 3AEXA 3T52A 1AKEA 3IMKA 3R6WA 5IJ9A 2I2FA 4KNYA 2R00A 1HYQA 2JI7A 2XKAA 5FRDA 3V48A 4WOKA 3PZBA 4CODB 2NO9A 3HDTA 5EE3A 2GH1A 4UTVA 3KR0A 4FTWA 4DMLA 4EG3A 5AUQA 1OKKD 1S3SA 5KHAA 5HJ5A 4G0VA 5PGMA 5DHPA 3THRA 1TEHA 4H7FA 4BXOB 3CZCA 4KQCA 3QJYA 1F0NA 4N0MA 5FUXA 3U7IA 4DM4A 4Z9XA 4K2HA 5EKUA 1UBGA 2UZIR 1K86A 2VH5R 2J3QA 1CUVA 4NE2A 2R6GA 2XUDA 3MYRA 4WKBA 1G3IA 3RQIA 3HCBA 4PBTA 1TLFA 1Z4PX 2P79A 2RCYA 4B31A 2VZ0A 2ISSD 3R6LA 1DFGA 2FR0A 4Q4HB 2BY4A 2G6TA 4BRWA 4JJFA 1RPTA 1XZ8A 1PKEA 4EAQA 5T57A 2L17A 2NV6A 3EMDA 3F6EX 2R6R1 1LK0A 4H1HA 3AH8A 5A6VA 3D6TB 6PFKA 1A8IA 3ZGYA 3D0OA 3B6EA 3KL2A 4Q3OA 4YAWA 5C7OO 2PKQO 1QIIA 2IY8A 1W4RA 3GJ5A 1HURA 4LZWA 2I80A 4WTOA 4A36A 3MW8A 1PJLA 5A9RA 1XEWY 3GPDG 2KHZA 2WSIA 1BHSA 3GFRA 4F5EA 5FPPA 1AGXA 2DQYA 1YONA 3VU9A 3TDNA 3K0BA 2XLBA 3HCDA 1C1DB 3I2KA 4R5MA 4ZRDA 4OJMX 4B8ZA 5BORA 2YW9A 2XOXA 3COPA 5TIIA 1B0PA 6REQB 1I36A 2Z1NA 1CDOA 1Z39A 3K2BA 3PFCA 5A4FS 3KX2A 2PRKA 3LH5A 4BN0A 4UBJA 3ND6A 2BCGY 1P0QA 2BFAA 3OEWA 3PQ6A 2LE0A 2P2CA 1AS0A 1Z07A 1W5SA 2HJ9A 2IP4A 2REOA 1EXVA 1EEHA 1F9EA 4K86A 3TG8A 2OO5C 1QQ7A 2WJ6A 4L0DA 2C99A 4BNTA 1K5HA 3E9ZA 4LOIA 5EWLA 3E2MA 3GN2A 1UZNA 3OPYA 3SIWA 3DDSA 3WISA 3IQEA 2NV2B 1VHLA 1U8FO 3EBLA 3ELBA 4NFYA 1E3DA 1RHRA 2HK8A 4RANA 3QKUA 2CDBA 1GPBA 1EZ1A 3CA8A 5HHTA 1J2RA 1E2QA 1T0PA 1L7VC 4OXYA 1X1EA 3W8NA 3H19A 5FV7A 2A5JA 1H2ZA 1OLSB 1XQ1A 2X9QA 3AJ9A 5DRYA 3BSFA 1MZVA 1NVTA 1UXJA 2D1RA 4EPVA 5A7FA 3L01A 2QVZX 1NYTA 3DXZA 3CRZA 4WUVA 2IWRA 5K0JA 1IHXA 1A5BB 4MVCA 4LI0A 5D3ZA 3PQ7A 1GGVA 2FG7C 4IQFA 1UM8A 1U04A 3S29A 1INLA 3D8HA 3H3XA 3FMPB 3HCAA 3E4CA 3U26A 1Z6XA 3HN6A 5HOQA 1H4QA 4A82A 1XROA 1U4OA 2F9FA 3KJZA 1PWEA 3VR4H 4A1FA 1IZ7A 3TNYA 5E7QA 4Z7NB 1Z5PA 4HEJA 3UM9A 3Q6NA 4U4AA 1EINA 1DHRA 1KIFA 5D1NA 4ALNA 3UMVA 1I6LA 1HNZB 3PQ3A 2RK3A 2ATIA 1D7OA 4NNJA 1FP7A 3EBOA 3SQXA 3VNVA 4LE2A 3P71T 1GGJA 3FNBA 4W5HA 1MO5A 2WLSA 4CV0A 4R71A 5HW0A 2Q07A 4P84A 4ZJZA 4K9NA 3ADCA 3F74A 3S4YA 2VK1A 4AMVA 3UYLA 4X7PA 4DA4A 4OHVA 3PNLA 2FDRA 1JLRA 3EZXA 1XE3A 2D3WA 4Z7OB 3WB9A 1MXFA 1YBHA 2IPXA 3ICWA 3N3AC 1PLLA 1V7ZA 1XZLA 4IUCS 4RMGA 1KZ6A 4J3FA 3T99A 3PRKE 1VIVA 2G9RA 2M98A 5ESDA 2UUBB 1L4NA 2PCLA 4M6WB 4KPYA 4JXJA 2SECE 2NYUA 4JLKA 2Z8YM 4NCBA 4YMVA 3PDCA 4DCNA 1U2DC 5EKXA 2Q1YA 1GTZA 1UBOS 5F2KA 5AXAA 5JQWA 3ZLBA 3K1AB 2NYVA 1YR1A 4BMSA 1AMOA 1FNMA 5F1PA 4YUZA 3KR2A 2Y1DA 1DKRA 1N3BA 2QRMA 4R41A 5FUWA 3VVMA 1KEEB 3K6RA 3L9XA 2GNOA 5A6SA 1ZMRA 3JZDA 3INRA 3FCOA 4PYIA 3GGCA 1QS0A 1IQRA 2VL7A 1LBSA 4Q19A 4NF2A 3SJ7A 5C5IA 3MAGA 4LMAA 1XDDA 5H4GA 3IVGA 5EE0A 1C1YA 3TVDA 4JC8A 2JH8A 4FXOA 2A1UB 1M6VA 2JFYA 3DVQX 3GGPA 1GQYA 2FK7A 4MR8B 4BFTA 1LDBA 4X5OA 3FMFA 3IRUA 4EG8A 5FWXB 1OYYA 4YRNA 1CYDA 1B73A 1OTYA 1GZVA 2P0AA 1XRQA 5EJGA 1EFPB 1R4MA 1SUBA 4NONA 3EG5A 3Q15C 4EG4A 2FMTA 521PA 3CRRA 4XD7A 5JNSA 4OIFA 4IGAA 4QULA 2PZKA 2HDHA 4ZDJA 1EHIA 3KT8A 3O2SB 3W77A 2YVKA 4Q82A 4DCSA 4RC9A 4XCQA 5CFNA 3I05A 1QQAA 3QJGA 5FBHA 2C5HA 3O4IA 4MYUA 3GB9A 1V16B 2UVPA 5CIWA 5BUZA 2J9ZB 4AULA 3GJRA 4L0CA 3HU2A 1HQCA 1Z4LA 5E7JA 5KJFA 4TKMA 4TT3D 2FPGB 4LCEA 3EPLA 2WWYA 1AY0A 2BFCA 4TT8A 2IFTA 1ZOOA 2IYUA 3VOSA 2FW1A 2HLHA 1OX5A 1VLLA 3DOOA 2ZR8A 4KCGA 4UE6A 4D1YA 1XFDA 3OU7A 1U2GA 2DFTA 1RXVA 2AKYA 1GITA 4IW3B 1PQUA 2JEYA 3KWJA 2ZAIA 2H1CA 2XCSB 4Y2UA 2NQTA 4GSLA 4BAZA 3LWZA 3WKCA 3NG1A 2HW8A 2B98A 5FA6A 2CCGA 1WXGA 2HUNA 4LY0A 1CRQA 1R0ZA 2I3ZA 1NE2A 1PTJC 5IC5A 2BBOA 2NU8B 1EK5A 4I9NA 1KDYA 4LNUA 1M8GA 3FGNA 1K97A 3G89A 2DPLA 3L4BA 1YFZA 4MWBA 4OFWA 5AJUA 4IG4A 4MAFA 2CLIB 2XTAA 5DPMA 2W93A 1ZW6A 2JFFA 1SG6A 1QZTA 3QM1A 2HMVA 5JCPA 1C8VB 1BDIA 5BWLA 1LWNA 1F2TA 1T35A 2FTKE 2FRVA 2RHWA 5FOSA 2RHTA 5JC8A 3COVA 5C5CA 3IXLA 4MVJI 3ZK7A 5BT8A 2PL3A 4UUMA 4FMDF 1A2QA 2NT4A 3UWKA 3FF1A 1QBKC 4X3OA 4ASUA 3NP9A 1FFEA 3GNLA 4RZHA 3RVMA 1Z5VA 3EZGA 1XMVA 1Q3HA 4IRXA 4CUKA 1VDZA 5BQ3A 2DWCA 4XQ0A 4RADA 1AO0A 3E7WA 3OX3A 4OFBA 3QIAA 1CTQA 1L4UA 1A9PA 4M0MA 1U0FA 1EEXB 1NAHA 2WYUA 1T2VA 1YDHA 3EWNA 4REQB 3A05A 4E3ZA 4ZQHA 5TPWB 2A9VA 3OTQA 4ZEWA 3P0EA 5IAKA 3SYKA 4C89A 3KE8A 4LGVA 3KKEA 3IYLW 4CU2A 2OBBA 1PWXA 4MRSA 4BUJA 4PC1A 4LBZA 3N5KA 5CB0A 4Y1RB 1XCJA 2DTXA 4HDSB 4Y6OA 2JFVA 2NVOA 2VCEA 4ZOLF 3U31A 4LF6B 5T3UA 3GNQA 3K09A 2ZTUA 5JPCA 2WE7A 5CDHA 1EXNA 2Q2OA 3ZZMA 1OX6A 1QM5A 5E0KB 3QA3E 3L4KA 2BTEA 1RYDA 4MMXB 4OXKA 4I1RA 2J4FA 3O8QB 3BRCA 2D1SA 4NEHB 5I9SA 3QUBA 1EK0A 2CCKA 4ZZ1A 5JARA 4FOLA 2B78A 4PG4A 2X40A 3FB1A 3HUTA 3QVMA 3UYKA 4L6IA 2ZSBA 3SC6A 2EP7A 1CWUA 1ULUA 1VG8A 1DC4A 1V8ZA 2BSXA 3PICA 1A7UA 1H5UA 5HYVA 1J97A 1C3LA 4XYGA 4ZI7A 2HF2A 3JYLA 2X2FA 3KKLA 2EKDA 4PAMA 3SS7X 4JJGA 2IIPA 4QXPA 1KO1A 2WM2A 2GD6A 3FUVA 1LZLA 1UFKA 3WZ2A 1O54A 3L8ZA 4EEXA 3KYIB 2IVZA 3OOYA 1FA9A 4KPGA 2ZPUA 1H6BA 4R2XA 4R31A 4WXRA 2OBLA 3DKRA 2PVSA 4A92A 2AC4A 3R0QA 1BJRE 1RJGA 3WGMA 5DM70 4DADA 3TSOA 5JALA 3K0AB 4DLXA 1N6LA 5G0UA 4RIHA 1UAGA 3KK0A 3FIJA 5CPBA 1JHAA 1OA0A 1HYHA 1QGOA 3O93A 1O08A 2TMGA 3BQMB 4K88A 4YUXA 3AF6A 4B73A 5ERXA 4QC2A 2YV5A 1SVOA 1TRKA 1V43A 4RBNA 3PPWA 2XF8A 3ZGVA 3C6KA 3D6HA 4GI1A 1OROA 3AR8A 4ZEMA 4YFVA 4AB1A 4P93A 1RCFA 5KNCA 1X7YA 1DAGA 1DMRA 4RQUA 4TUYA 2VA9A 2N0SA 2E85A 4H35A 3WR5A 2EL7A 1VE6A 3S40A 4R7ZA 4BV8A 3C7CB 4XQCA 2G9NA 3UA3A 4YUWA 4P32A 3Q8LA 2Y71A 1JDJA 5B2ZA 2QA5A 4PGGA 1IWOA 2X1MA 2NG1A 2X5OA 1CE8A 2CZGA 5I7EA 3KYBA 5KYXA 1S5PA 3MTBA 4HDRB 4JZKA 4N8DA 1SKMA 3ECSA 1PV2A 3EIUA 3I0MA 2AW3A 2HWXA 3Q1KA 3TLCA 1DO0A 3V2GA 4EB0A 2VCHA 3R7AA 4ND8A 4JT4A 1JKXA 4DEXA 5IF3A 1ONNA 2C2HA 1MOPA 4Q4JB 2KS6A 1GTL1 2WFZA 3PT5A 4FFWA 2PO7A 3LT5A 1GCUA 2BMAA 4OP2A 2QR3A 3RSGA 1N6HA 3I73A 1SIWA 3QVXA 5ALUA 3T4PA 5B6IA 4DLZA 1SO8A 4N3AA 2CLKB 4CIDA 2FXIA 4B09A 1H8ED 1AC5A 4Q1CA 1ID8A 3E8MA 3QKSB 2CW5A 3OCXA 1FDWA 2QD2A 1PQ4A 1WMDA 2NZJA 4MI3A 3TZEA 3UJBA 3WNCA 1EXMA 4DUZB 1WMFA 2J9GA 3FXAA 4UQLA 3CNLA 4DDUA 5I9TA 3KM0A 1Y9JA 3EULA 6REQA 2Q1UA 2W6MA 1WULS 4I4NA 2OPBA 4L8FA 1MAUA 3WYCA 3HCEA 4DNFA 421PA 3DTTA 4TSFD 4YO8A 5HM8A 4HADA 1OXBB 2YUIA 3JAKB 3LECA 1YL7A 4WFKA 4QDZA 4HNUA 1P3DA 5DHTA 4JMPA 4HGQA 5DHRA 4F2GA 1S2GA 2CHGA 2AR7A 3D1VA 4RESA 3DV9A 1B42A 1M6EX 1DO2A 1SUCA 5HEKA 3RS7A 3STTA 3UGQA 2L82A 2ZYHA 3OEHA 3BX1A 5DIFA 1VSUA 3M5PA 3TL2A 5BWBA 3TK1A 1G17A 1JQDA 2BKVA 2Y1XA 1NF9A 2Q1WA 4HX5A 3OT5A 2FE4A 3PQ5A 2C82A 4JBHA 4C7OA 2ZDQA 1P8JA 2PWZA 3NATA 3PYLA 4FIDA 3W9YA 1NHWA 3EPJA 4P34A 3GNSA 3SKYA 2O8DB 4O0LA 1L4KA 1L7MA 1G20B 1NT4A 3ODGA 2Q5OA 4AZSA 4FM9A 2OQ2A 2B1QA 2QZJA 4JN6B 3CVJA 1A50B 1N3YA 4HTFA 5JNUA 3P26A 4R9SA 1RABA 2J7PD 3PGJA 4L3WA 4UASA 1E8MA 4KBYA 4NESA 4NCKA 1FYDA 4XD2A 4EY4A 5F7XA 1Y3AA 3M6XA 4IM7A 4BMPB 1NXOA 2GZSA 1VJ5A 3GFPA 1L8LA 4UCXA 3RI3A 3SXPA 2ZFUA 2XT0A 4QLOA 1U8AA 3A27A 1ZI9A 4Q05A 5AJTA 4AN1A 2ZSKA 2A8YA 4L74A 3OQJA 621PA 1UMCB 2PXHA 5T3YA 3NT5A 2BGTA 3BJMA 4MB0A 1KOJA 3T0IA 3M4XA 1RQRA 3GAFA 1JG7A 1SKYE 4MKXA 4UVIA 5SV2A 2GCPA 3EPHA 5HIKA 1XD2A 1LD3A 2OGWA 5KYWB 1RLJA 2UKDA 1CQPA 3ENVA 2GN1A 4F11A 1PG2A 1H23A 2YNMD 1E0AA 4F38A 2CUKA 3KV1A 4DG9A 4BGDA 1IG3A 1KO4A 4MUGA 3E9EA 3IUEA 1ZJ6A 2AHOA 5I6DA 2CSXA 3DVSX 4Z3DA 6GPBA 3HJNA 2WNIA 3GF4A 3BOSA 4ENWA 4WGFA 2VTKA 1JS1X 1IXKA 3HSYA 2ZYAA 4UEJA 3UMGA 4Q9NA 4HNHA 3D81A 4BNGA 3O9VA 4PZYA 2EL9A 2GJ9A 4LZNA 1U8EA 2GLXA 4B7ZA 4KVFA 2VXCA 3RTGA 1HQYE 4DG5A 1YQXA 2GK6A 2O4UX 4ISCA 1B1AA 4CLHA 3E22B 3FWPA 3O8CA 1L7XA 3UCFA 5CW2A 3EASA 4I4IA 1DG1G 1FFSA 2VWPA 1JMKC 2PY6A 1PNQA 3AOEC 1AQUA 3NJRA 1O57A 4G5XA 3T9DA 1TNDA 3H2YA 3OX2A 3V6LA 3DLHA 2FPKA 5B5SA 1NW8A 2GLUA 1A2OA 4U7TB 2ANCA 3W90A 4W1QA 1GQRA 1I8TA 4TRNA 3WOVA 3KTAB 3RU3A 1DARA 1C7ZA 3AM4A 5FJIA 3SU8A 2WZBA 1S89A 4R1PA 3ZE2B 2C7BA 3ZG6A 3AIKA 3B8HA 3F6BX 1B23P 2O2HA 2X14A 3Q8WA 1GAXA 5KU7A 4BNHA 4AWXA 3GT3A 5E38A 1U0HC 5EZ6B 4PXAA 5LD2C 1D5CA 2MIIA 4JB3A 4XVRA 2X9VA 4Z86A 1IY9A 1Z8FA 1UC4B 1JVNA 1DAKA 2YJNA 2JBHA 1YTUA 2I5PO 4Y6SA 1N1MA 2V7WA 3H5VA 3NBYC 1Z13A 1KVTA 2TMYA 1QH0A 3DE6X 1J09A 5AH0A 5KQGA 2X0DA 3T1HB 4HN4B 3TTWA 4LSGA 4LWPA 4ND8B 4JSRA 3OLCX 3RUDA 1R88A 2W4MA 4YRKA 5CEEA 2QN2A 3HHPA 1R6DA 1KJ9A 2GCOA 3KSDO 3BSSA 1H1DA 1T9HA 1UZAA 1ADYA 2R7NA 3VNBA 9ABPA 2EARA 4HWSA 3MWYW 16PKA 5ECWA 4DR3B 3G2IA 2VWGA 4N9WA 2DM6A 4BEBA 3RC8A 1L3BA 1A9YA 4E6EA 2RHCA 3SYRA 3I5XA 1S4QA 1ML3A 3A31A 5AESA 2OV8A 2CT8A 2I1VB 4N54A 1L7EA 3DKPA 2GCNA 3ICPA 4Z54A 4ZYUA 2WJJA 3EOZA 4MWSA 4DKXA 1W35A 2MJLA 1OGIA 1QFMA 5MF6A 2CXSA 1MH1A 1B3BA 3DCIA 4FD3A 1IMJA 3U1BA 2WWRA 4TV9F 2E21A 3QE0A 3X2EA 3QPWA 4IVPA 3CX3A 4WFIA 2X4IA 3SS9X 4E2ZA 1Q77A 3UT6A 4MZXA 3B1JA 2Q2NA 2Q5CA 4Z1MD 3ICVA 3LCCA 4LAFA 3D3EA 3ZHTA 3X44A 5DNYB 4PINA 4MRNA 1IOLA 2YMQA 2YJGA 3CB2A 1XZGA 3YASA 1KS2A 3OKCA 1YBFA 2HMUA 5TVKA 5A5FA 4F45A 2PG3A 3JZMA 1COZA 3K8YA 3ZU4A 1N9GB 2WTAA 5DBHX 2QE6A 4AS1A 3R0XA 2H2AA 1AK2A 4CV1A 5KVAA 4FDMA 3STUA 4NV0A 1M6VB 1P62B 4MR8A 2P2DA 4K9OA 2ECOA 2ORED 4WE3A 4AF7A 2OXRA 2Z9BA 4XKJA 2HOQA 1I14A 3BWCA 3QVSA 3MWDB 2A0FA 4B0OA 2NSHA 4CDNA 5E7MA 3WL6A 2QIPA 3MTDA 3HJTA 3QSGA 2WAXA 5FLYA 4IQ8A 4LOAA 2R8ZA 1KY2A 3GCDA 3JYQA 1FYFA 4F6LA 4EZBA 4JXZA 3EIHA 1AUPA 3D59A 1QH1B 2ZW9A 3D3WB 3KO8A 3MMZA 5JPIA 1LBHA 3WRYA 4JIMA 1RBMA 4X45A 1CUJA 1W4BA 1OC4A 1QC5B 4IYJA 1XZHA 5IJAA 3G88A 4JVNA 1PG0A 4AG3A 1ZONA 1JAHA 3Q5DA 4ZOAA 3D0QA 3OIVA 4RNCA 5KQRA 2F9LA 4J4BA 3H8SA 1PWYE 5E95A 1ENPA 1N6PA 4JBIA 3ZE1B 4MKZA 4B3HA 2AZDA 2IHUA 1P72A 2A88A 1ATZA 1G20E 3QE3A 4FYMA 5F78A 1XG5A 3G2QA 1JECA 5BNIA 1QG0A 3LY7A 2O0LA 4WLUA 5E4JA 4BBZA 3CLTC 2FQWA 5ER9A 1PAUA 2NPIA 3Q3CA 4HRAA 4ZTBA 5KCZA 5KNCH 4F1KA 1QVAA 1ZLXA 2PGAA 4ZIRA 1FNDA 1KPHA 1VRWA 2MWMA 2IS1A 5JTUA 3OZDA 4TLDA 1EP3B 1J7JA 4YEDA 1OW3B 1T91A 5FL7A 3KOZA 1V5EA 1TM1E 4NCAA 3QEMB 4HEHA 3QQ5A 2PM8A 3PQ8A 4E31A 2A33A 2A5YB 1XRPA 2ZIXA 3ROMA 1ZSVA 1SQSA 1DXQA 2FFQA 2PKCA 3OAAA 4FWIB 2A9OA 2ZM6B 4FN5A 3WLFA 3AESA 1I5EA 1Z4MA 1WD5A 1MDBA 1QFZA 2O05A 4IDFA 3I83A 1MIHA 2WR8A 4XYMA 1BDBA 1AMUA 1QIKA 3B6JA 1CDZA 3SBOA 1XJ5A 1Y37A 1SIBE 1F20A 2X5NA 2ZDGA 2R25B 2RH4A 4JLBA 1CJSA 3L04A 2VRCA 2AJLI 2OAQ1 4ZI7B 1W4CA 3DLIA 3MEQA 3PQEA 4NS1A 2NSLA 5B64A 5CXUA 2HJVA 5BT9A 5C7YA 2E87A 3NIDB 4QPNA 1HK7A 2OO5A 2RGUA 1K9VF 2XY4A 3E9QA 3RC2A 2J45A 3WLRA 1P6QA 2QRLA 4CV3A 2BGWA 4A0RA 4C0BA 1IWBB 2HJHA 3V4PB 5AI5A 4D0SA 2N46A 3HKDB 2QDXA 1I6WA 3N39C 1AA6A 1CS0B 1TZMA 3OZVA 2XODA 1ECLA 3CJRA 4UEKA 4XYEA 1UR5A 5DLQC 3U3KA 5IF9A 3HDGA 3N7UA 4D98A 1YVUA 1TJ5A 3GELA 1Y6ZA 2XE8A 2XQVA 3ZCTA 1OOEA 3L7JA 3KFLA 3P9RA 4XLZA 4P3XA 5AOBA 2CXXA 2PYIA 3L4BC 1NFRA 2Y6UA 3TOZA 4D26A 4CT5A 3LIIA 3HWRA 3FUXA 1FQKA 2H5EA 5DTQA 4RSRA 5HQ3B 4GO1A 1UM9B 4YJFA 3U39A 2AFRA 2G82A 2IF0A 1OAOC 2WWWA 4ARVA 3VPGA 1A9TA 2XYHA 5AMXA 3B85A 3VR5D 1RCUA 1WHSB 1WWKA 3VXKA 3T7TA 3BMXA 3K0FA 4EHFA 5IBCA 1ZZGA 1QGDA 1XAIA 2ZZMA 2WVGA 5ER6A 4BO7A 1NBIA 3VKHA 3A0UA 1KE1A 2V8BA 2RC5A 5SY9A 3TG2A 4BO8A 4QJIA 5MN4A 3QQPA 1RYYA 4KB5A 5JVDB 1Q0TA 5B30A 1O5TA 1KEVA 2ZROA 5IHXA 1GWNA 1V0JA 2QNIA 4GX0A 4OK3A 2JW5A 3EQ8A 4ZD6A 5IDYA 4QXOA 1OSNA 2R8RA 2OC9A 2WP8J 4L95C 4OGLA 3DMHA