1KZGB

Dbscdc42(y889f)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
total genus 63
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kzgB00
4GSYA 5KSPA 3AKCA 1M74A 5CK4A 2ZRKA 2D7CA 4MRRA 3Q72A 2WKPA 3AF4A 4PQRA 1G7RA 3H84A 4Q1FA 1DAKA 3TBKA 2NTYC 2CK3D 4UNSA 5FPTA 3VHXA 4KFRA 3GLHB 4DKXA 4D80A 3UK6A 4LV8B 1X3SA 2ZS9A 5EE5B 1WXQA 2GEDA 4HUQB 4DB2A 5EXSA 3Q5DA 1FMJA 1CEEA 3QVUA 2RCNA 3PXGA 1E2DA 4JZKA 4DDUA 1T5LA 4MGYR 4DDVA 4TYNA 1AA9A 1K6MA 4RKEA 2AL7A 4GFDA 1AKEA 4JVMA 4PSAA 4Q4HB 4B35A 1VPLA 1W4BA 5AJXA 1P2TA 5J4KA 2R6FA 4FMDF 3LX5A 3MG9A 2C03A 1QHXA 3D3QA 4TMKA 4BZPA 4PPGA 2VP4A 2JIZA 4Q9KA 1T3HA 1E2LA 3LRPA 3UMFA 5EP3A 3TKLA 1SXJC 4V02A 4MGKR 4PO8A 3RVBA 1R10A 2PX3A 2J7KA 3BORA 1S3GA 3TQCA 4A8JA 4DT1B 3FKQA 4IOMA 1W7AA 5FPKA 3IQWA 3E70C 1VKJA 1XMJA 3BB3A 3GFOA 2GKSA 2ZI4A 3BXZA 5UKDA 3DHWC 4JLAA 1BOFA 1LY1A 5SZIA 3NBYC 4CW7A 3LBIA 3AUYA 4YMTA 1PJRA 4F38A 3OEED 1UFQA 5DNYB 2QNRA 1NSTA 1NKSA 4IRUB 2B7BA 2MSCB 2QE7D 3WMEA 4KYUA 3Q85A 4O3MA 4BFZA 1OFUX 3QKUA 1RRCA 1DARA 2NO0A 4IEEA 1S1CA 2ZJZA 1RC8A 1AK2A 3UXMA 4G01B 1NF3A 1UKYA 3RHFA 1E9FA 1BYIA 4XWOA 4DLXA 1V5WA 3QNUA 2J0UA 3TLXA 3ADBA 2AK2A 3CX6A 3WNBA 721PA 3U60B 3AF1A 4OQXA 3EPKA 2WJIA 4LSGA 1FQJA 1XEXB 1SVLA 3IIKA 2GVDC 5GADl 2A5YB 4HSEA 2QMHA 4GDFA 2VL7A 1G9XA 2Z6VA 3WYAA 2BMEA 2J7PA 1EFCA 4D81A 5EP2A 1Q1BA 4YLGA 1KK2A 1XWIA 4URZR 3GLFB 2DWOA 2YYZA 4HZUB 5D3MA 4AI6A 3U7GA 2ZI9A 1WBBA 4MQBA 1IN8A 1VTKA 1U81A 4DSNA 1E2EA 2ZJ2A 1WCV1 2W2VA 3MUFA 4DLWA 2JLUA 3RSOA 1KIMA 1OXUA 2A2ZA 2GJ8A 2BDTA 4KHZA 3CRW1 2GEVA 1KOFA 1ODFA 3TW4A 5E4FA 4QJ4A 2BV3A 4EFNA 3AV0B 3QKRA 4YMSA 4AYXA 3H4MA 4FWTA 5FL7D 1WMSA 3FFBA 5E7JA 4L16A 1K5GA 1L7VC 3NC0C 3Q7QA 1NIJA 4BUJA 3U44A 1R4AA 2ZAMA 3SYKA 1F60A 1RW4A 5AJYA 4LWZA 1IN7A 1TNDA 2NG1A 5EE3A 2WJVA 4H9GA 2O8EB 4A92A 1YQTA 2GCOA 4GNKA 2UZ3A 3HJNA 4M8NE 1I2MA 4DDTA 2P6NA 4P32A 4R7ZA 2JLSA 2IXEA 4IVRA 4ERNA 4DIEA 2BMJA 3IPYA 3K0FA 4QBGB 2EWVA 3SS8A 4IVQA 1T4GA 5JLJA 4XD7A 4XTCS 3PUVA 1IN4A 4BLPA 1T0JB 2BM0A 1LNZA 3REGA 1GRNA 1OH6A 4RD4A 1QHIA 2ZE6A 2A5FA 3QQ5A 1JECA 3B1WA 4NH0A 1FP6A 1U2RA 2E9SA 1R5NA 2XTMA 3CRMA 4TLEA 3U3JA 5JJLA 2EU8A 2R62A 3C14C 2E87A 1Q44A 4MKGA 2ZANA 2JASA 2ZITA 1RJ9A 4A6XA 1U0LA 4RY2A 3WMGA 3U4QA 3CWQA 1P75A 5BW8A 1LF0A 1HTWA 1M34E 1G3MA 1XRJA 2LKCA 4B74A 2E1RA 1VYUA 1LS6A 1N5LA 4M9ZA 4ZI3A 2VHQA 1NKTA 3KXIA 1S4QA 2GJSA 1OW3B 1TUEA 4MUBA 3TW8B 2GF9A 2ZRJA 3QENA 5C46F 4HDQB 1Z22A 5HE8A 1P73A 1ZM4A 4AYWA 3AVPA 2R6GA 4ZPXA 4M1KA 3T1OA 3LVQE 1U0JA 1NY6A 1ZU5A 5JCPA 1E9DA 3T34A 4C0LA 4Q4JB 3SOPA 4UNNA 2MMGA 5CM9C 4CDGA 3QVVA 1B23P 2BWJA 4CF7A 2IS4A 4LJ7A 4OI4A 4TMXA 4KLZA 4AURA 2X1VA 1SXJD 4B48A 1FTSA 1NN0A 4P4SB 1X1SA 1F2UB 3DOEA 3DMDA 4BWYA 3NIBA 4NYIR 1VG8A 2Q9CA 4V0NA 1E1QD 4LJ5A 3WYGA 3AP3A 2ERYA 3F8TA 4Q4LA 2EFGA 1D2EA 3LV8A 1DAGA 3KB2A 2RHDA 4QRHA 4OL0A 1BYUA 4W5WA 4RFVA 3EASA 4ARZB 1FZQA 2WIBA 4A82A 2WSSA 1EFTA 4CIDA 4M1SA 2JLXA 2QE7A 4C2TA 3QKSA 3X1DA 2Q3HA 1SVWA 2CLDX 2VYFA 3V9PA 1Z2CA 2W6ID 2CE2X 1VHLA 3BFKA 2ZYVX 5DI3A 4AG6A 4HI0E 4LJ9A 2ZRLA 2ZRBA 3FB4A 1SVOA 1I4DD 2OCAA 4D4LA 1YHNA 3AVVA 2ANBA 5IRCD 1NBMA 5IHPA 1XPRA 1XEFA 5EJEA 3M1IA 2CLCX 4PAQA 5AWFC 3TE6A 2WMNB 3SYLA 1BKDR 4EDHA 2C78A 4GPTA 4JT2A 2B7CA 4IEIA 4MUAA 4PZYA 4TZ6A 2GCNA 3U4QB 3R20A 4FIDA 2Z0MA 2QENA 2GDJA 2QM7A 2G88A 2WPDA 4LY6A 1DTSA 2GWHA 1WB9A 1KDTA 4D0NA 4UNPA 1COWD 4Z8YA 4FMCB 5LD2B 4YONB 1UBGA 2PCLA 4PPNA 2FFHA 2V6IA 4G5GA 5EE9A 1ZCAA 2CVHA 1UF9A 2NGRA 1XP8A 4NCHA 3KTAA 5FPYA 3QBTA 1G5TA 4R2IA 1JAIA 4AY2A 1JPNA 3RS3A 2JLVA 2WV9A 3VR5A 1KK0A 3GEEA 5SZKB 2IYLD 2FFBA 2OG2A 2Q9AA 2VP2A 3AVYA 4E22A 3FHTA 1E9CA 3N5CA 2XXAA 4PHGA 2VHCA 3K53A 4CGZA 1DE0A 3OF5A 2NO1A 4KYIB 4LHYA 3LAWA 4MRNA 1MO4A 2OT3B 3PUXA 1FMLA 3QG1A 2Q6TA 4A0FA 2GXUA 2ZPTX 1D9ZA 1E2JA 4A9AA 4DCTA 3O8CA 1W49A 2B92A 2J5XA 4DSOA 1E4YA 1AQYA 2ZYWX 1Y3AA 2D2FA 3VTKA 1C9KA 4HAXA 4LJ4A 4O2RA 1KZGB 1D2NA 3WBJA 5KO2A 4GP6A 5CJPA 5CJ2A 4NHOA 5JJKA 2QTVB 2WVJA 1KJZA 1FOEB 1VG1A 1TPZA 3QXSA 4CEJA 5FOTA 2P5SA 2VF8A 2W00A 4A2PA 1E69A 1KNQA 2J7PD 1ZU4A 1Z6AA 2XTNA 2HJGA 4XSGA 4D25A 5D3MB 1CJMA 1GOTA 1KI3A 3RANA 4CZ2A 3GLFE 3MJRA 2XAUA 4DBLC 1UEJA 4PC1A 3CB4A 3CPEA 1JPJA 2Q3MA 1KAGA 3A36A 3BGWA 4ESHA 4HAYA 4RD2A 4HB2A 2YJTD 1SVMA 4Q1CA 5FTJA 1F2TA 4EQ6B 4C2UA 4PZLA 3B5JA 1EFHA 2JEOA 2NO7A 2YWFA 4NYJQ 3P26A 3ZZ0A 1E2MA 3UWKA 2IHBA 4W5JA 3KDSE 1KI2A 1MRSA 1M6NA 2KE5A 3FFAA 4M9QA 3VNVA 3K9HA 3EC2A 1XU4A 3WHKA 3IO3A 4MRPA 2VH5R 2QGNA 2JAQA 4AK9A 1DO0A 1II0A 3A1TA 4TLCA 4JL6A 1JAHA 3RABA 3UIEA 2FE4A 1JXMA 3FKSA 1NLFA 4MGZR 1IHUA 5G3YA 3SDZA 4HB3A 4AKEA 3GLGE 5F9FA 5GJWC 2W6JD 5DE3A 2YOFA 3V4RA 2ZTSA 1KI4A 2IL1A 4LK2A 4NCNA 4BZQA 3DDCA 2XXAB 1TAGA 5JRZA 1GNPA 2IYZA 2P6UA 4FMBB 2OCBA 3KKMA 4TYQA 3RLFA 2ZJOA 3ZLJA 4M1OA 3ZVRA 3FHCB 1Z28A 1Z29A 3I4LA 2QBYB 4C0HA 2CXXA 1TF7A 3AF3A 2QMUA 4IVPA 2W0MA 3LQRA 4KAXA 1YR9A 2ZETA 3MSXA 3O8RA 3KL4A 1CR0A 5KYKA 2JJ1A 4OQLA 1YZKA 5DGXA 2OLJA 3D6TB 1E99A 1J90A 5JMTA 4GL2A 1OSNA 1Z3IX 2HJVA 1VIAA 5BWMA 1G16A 3C16C 1TTTA 1U90A 4XVQA 3CRRA 2GILA 2J87A 5KHOC 1IXRC 4IOLA 4PC2A 5FUVA 1E2PA 1ZIOA 4TL6A 2WWGA 4V0ME 1W2GA 1RJ9B 3RRMA 3UMSA 1F3OA 2IYVA 4LYFA 2YC2C 1U9IA 2IS1A 4Q02A 2ZUCA 3KQHA 1G8YA 3K09C 2IXFA 1P4SA 4ZV4A 3QBVA 1GKIA 4FW9A 1P5ZB 3X1YA 1QHGA 3FDIA 1QG2A 3N2EA 4BE7B 5FOSA 2XNDD 4KV9A 4C0BA 2PEZA 3OE7A 4Q21A 2F1HA 3IPXA 4IHQA 5G40A 1E9EA 2VIIA 2QL6A 4D6PA 4X8OA 4D4KA 2IF0A 3I3SR 2Z43A 4BASA 2CLSA 3IIMA 3VKHA 2GCOB 1Z08A 1AS0A 1L4YA 4Q47A 1OH7A 1E3MA 2GHIA 4ASUA 3IBGA 4ZIRB 5KNDA 2I1QA 3KKPA 3RAPR 4A0GA 1US8A 4Q1BA 1Q1EA 4BFSA 4BLQA 2KI5A 1NMYA 1V43A 5FL7A 3GJ5A 3EPHA 2Y8EA 2HXYA 4GRAA 2EVWX 2ZJBA 4Q03A 1HQCA 2GCPA 4V0KA 3V4FA 4KO8A 4FCWA 1YZQA 4RZUA 2FZ4A 1P3JA 1KMHA 2IYTA 1KY2A 2ZR7A 4PPQA 3TSOA 5B30A 2G1JA 3CX8A 4NP6A 3JVVA 2YINC 3NBZC 2WJYA 1WA5A 2J41A 4AC9A 4D82A 1ZNZA 1U9IC 4BLRA 2WWYA 2YWEA 4UKDA 1ZVQA 2CJWA 1A7JA 2J45A 1JXOA 3A4LA 3G82C 4NU0A 3NWJA 4Q19A 2EFCB 2IEZA 3SQWA 1RVDA 2ZVPX 4A0RA 1XEXA 4UXHA 1R0WA 1N25A 3SZRA 1H8EA 2ZE8A 2AKYA 1JBKA 5BN3A 3I5XA 1CTQA 3B1VA 3AQ4A 3BOSA 4P33A 1G8PA 4I1VA 4UJ3A 1Q1ZA 2QPAA 2WPDD 1I4TD 3T1VA 3SFZA 1M8PA 2IYYA 1ZYUA 2JJ8A 4H1UA 1S2MA 3RWMB 4JT4A 4WZAE 4F93B 3KB1A 4BFYA 5KU1A 4LPSA 4DT1A 1ZNYA 1E1RA 2BIFA 4ACBA 2O8EA 1G7SA 1CIPA 1R8SA 4QBIA 2J3EA 3T61A 4M9SA 2C2HA 3TUIC 1AM4D 1XTKA 1BO6A 3HU1A 1KI8A 1H8HD 3I73A 2GTPA 3ASYA 1IXSB 3ICQB 1OHHD 1D8TA 1DVRA 3O47A 3KKQA 1LFDB 3TR5A 3L8ZA 3CF6R 3GJ0A 4TQ9A 3B9PA 5GVSA 3SE0A 4A15A 1DPFA 4LHWA 4HATA 2WJJA 5CYOA 4B47A 2QTFA 1ZUIA 2OAQ1 2YOHA 4M2LA 4OQFA 2AFIE 3WNDA 3THYA 4US0R 3K70D 5L3QB 3NBXX 2QORA 4L4UA 2GAOA 4B71A 2GA8A 2R9VA 3DPUA 1N0UA 5KUTA 4LYHA 4QFMA 4QBFA 5EQTA 3CF2A 4JIMA 3AVWA 4GBMA 1JQLB 3EIHA 1XJQA 1OH5A 1OKKA 2F9LA 1KMQA 2YVUA 4DLSA 1Z6GA 2C95A 2FGJA 1R8QA 3MJHA 4JJKA 4ARZA 3R8FA 2IYXA 5G3ZA 4US1R 4OHYA 3QOFA 2IA5A 2ZR0A 4C30A 1VCOA 3UPUA 5JJIA 5KTYA 4D2IA 1F48A 3WNCA 5HPYB 4TL9A 3AF0A 3W6PA 4P4SA 3RS2A 1KI1A 3LLMA 4RFSA 2VSOA 4RZ2A 3ONWA 1UJ2A 3B82A 3K0AB 4Q01A 3AP1A 4MGIR 4PQYA 2PL3A 2IBMA 1AS2A 1OIWA 4FI3C 4XWKA 3TVTA 4LC1A 4C0AC 3THWA 1DELA 1G7CA 1KJYA 3EPLA 1KO1A 1M2OB 2QSZA 4KODA 3TSZA 5FUXA 3C5HA 2BC9A 4N0DA 1GVNB 1ZM2A 4JBXA 2QA5A 3BRWD 2O5VA 2W0SA 1NN5A 2ZVQX 3MWKA 4TMWA 2R65A 1VDZA 4PANA 2DB3A 4IFBA 1YKSA 3QXHA 4KSBA 2IS6A 1RKBA 3T1QA 2EFDB 3QKTA 2IW3A 3RS7A 4LZZA 1U0HC 3BIFA 1U98A 1TMKA 1PV4A 3S1AB 1KNXA 1NIPA 2HF8A 2PMDA 4DUGD 1W36D 1VIYA 2FEOA 2DFNA 3TIFA 2OSBA 1BMFD 4Q7JB 4QHSA 1D5CA 1II8A 4JLNA 5EXTA 4NONA 1YR7A 3AVXA 5GVRA 1OYWA 2LKDA 1IJFA 2ODNA 1X8LA 1Z0FA 1XTSA 2DWQA 4D4JA 2IF2A 3VU9A 1G6OA 3QSYA 5ELXA 1LB1B 4LX0A 5KPDA 2W2XA 4HAVA 1YZLA 2GEUA 3BS4A 3BFVA 3U61B 1XDBA 3SR0A 4HAZA 4BZXA 4LBYA 3R9XA 5AJWA 1CBUA 1RYFA 2G3YA 4A2QA 4BFUA 2FWRA 1FNMA 2ZJAA 5TY0A 1EX6A 2ZS8A 1HE1C 1YR6A 4P0TA 3EPJA 2ZREA 1SXJA 4V0OA 3P27A 2ZRCA 2ZRFA 3KJIA 2PX0A 1RE0A 3BBPA 3QY0A 4NDZA 5GJCA 1ZC3A 4L5BA 1Z0IA 3G0HA 1QBKC 1ZJ6A 2RKOA 3FHOA 4Z1MD 3KQLA 3PJRA 5BXQC 4G0NA 1YRBA 1AKYA 2YHSA 1XF9A 2IT1A 1PVOA 3FWYA 1UKZA 3M0EA 2QPOA 4TMZA 4PC7A 2PT7A 4QGHA 1EFRD 4Y0VA 3KXLA 1E94E 1XD9A 3BB4A 1GSIA 1NJFA 1Z63A 2CHGA 3ZZTA 2D62A 1HEIA 2PCJA 4WXRA 4EPTA 1KKMA 3CNNA 2ORIA 3KQKA 4MRSA 3K0CA 3W9YA 4BFXA 1FP7A 2AD1A 1E2HA 2GRJA 4HLCA 3GQBA 2O8CB 1MR3F 3GPLA 1JJVA 5L3RA 4Q1AA 3OEEA 2O8FB 2YKGA 2ZJ5A 4JL8A 4BFTA 3A4NA 3AVQA 4TMVA 2PZGA 4JKIA 2V1UA 4G5OA 5D3QA 4GZMA 4E5UA 2IWHA 4KVGA 3D31A 4ZCIA 3GJ6A 3LY5A 1M7GA 1OIVA 1ZUHA 3BH0A 1Z0AA 3KKNA 3TSWA 1X86B 1M1YE 4OQMA 2JLQA 5DHFA 3THWB 4DCVA 2JA1A 2HCBA 2OCYC 3NDPA 3Q3JB 2ZSFA 4DDWA 3U6BA 2Q3FA 2GK6A 3K0AA 3MGCA 1S3SA 1JR6A 1E9RA 1NLZA 1S1MA 2A7QA 3B7GA 3FOZA 1P60A 3PEUA 4OBEA 4OJKA 1WE2A 2FF7A 2WOJA 4G5SA 4RKFA 4PHTA 2VP9A 4ON9A 4B2PA 2X2EA 4JBWA 4PR0A 4Q4AA 3R7WA 5EUQB 4ZKEA 3RS4A 4DLZA 1VG9B 1WF3A 2RGAA 3U3KA 1BIFA 4JLKA 5CDFE 2REBA 2ZS7A 4EJSC 4LPKA 2C77A 2XZPA 2V4ZA 4ZKDA 1HT2E 3LQQA 1CJTC 2BEKA 5LB2A 2JJ1D 1DADA 1KSHA 3PG5A 4C0QC 3WMFA 1KSFX 2RMKA 1KI7A 121PA 1AZTA 4NYIQ 2V1XA 3UMRA 4P3YA 4II7A 4A36A 1XD2B 3RS0A 2QAGA 1E1QA 4AG5A 2ZRPA 4OI2A 3M6AA 3W8NA 5EZ6B 2BJWA 1XJ0A 5DLQC 4YXWD 4WVFA 5KDOA 3ND8A 4RD1A 2H57A 3W90A 3CPJB 2RGNC 4F7WA 2V9PA 3HWSA 3A6PC 2W83A 2CE7A 2ZSAA 4HAUA 2AKAB 3K09A 1P6XA 4EPYA 3HP1A 1NLYA 1OXXK 3FGNA 3OIUA 2BHRA 3VR2A 2NPIA 5CB6A 2I1VB 2XNSA 1N6NA 4KU4A 3HYRA 4EFLA 1KJWA 3DMNA 3EZ9A 1XMVA 2N42A 3QF7A 4LHZA 4IOKA 3PUZA 1OJLA 4P4UA 2OEPA 3EXAA 1T8TA 3ZDQA 3ICEA 2V3CC 4PO1A 4TSFD 5K8IA 1TQ2A 1HA3A 1G21E 1E98A 3IO5A 4DJTA 2A5JA 1G8HA 1XTRA 3EAQA 4RFSB 4EKDA 3L2OB 2HV8A 3D7MA 4PZZA 4Q48A 2RGDA 2CNWD 2OZEA 2RGXA 1Z8FA 4PC6A 2RB4A 1XBTA 5P21A 2D74A 4JLBA 4XVRA 3CIOA 4D4MA 1IY2A 4MDFA 4LRWA 4MH0R 4UNRA 5FFMA 3MAAC 1JR3A 2F7SA 3EIEA 5JSZB 3SJAA 3QPUA 4AKIA 2P67A 2CJWB 4R98A 2ODWA 2ZIAA 4GI7A 4JL5A 3ZVNA 2P65A 4DLUA 1OIXA 3DZ8A 4EPVA 3FMIA 1CKEA 3VKWA 3QPVA 1GDDA 1N6HA 2VLIA 4OJQA 3OAAD 3BK7A 4QBHA 3LXXA 4I4LA 2IYRA 1BS1A 1CU1A 1G18A 4Q1DA 4CRWB 4M53A 1E79D 1M7HA 1J7KA 4M9XA 3ADDA 1E2KA 1HURA 1ETUA 4WZBE 1MO3A 1QHYA 3AUXA 4HDOB 5J5CA 2WM9B 4JVSB 3HU3A 1ZRHA 3ND9A 3NC1C 1GWNA 3NEYA 2OUKA 4LCBA 2FSHA 4UXJA 5K8TA 1F5NA 3PR1A 2WAYA 2VBCA 3NXSA 4ZIRA 1GM5A 1R5OA 2DBYA 4IDOA 4LI0A 1F6BA 3U2QA 5EUMA 3K9GA 3P1JA 3QF4B 5FPHA 1NY5A 3RWOA 4QXAA 1HE8B 1N3BA 3LFUA 1G3UA 3ASZA 4PPFA 4UJ5A 2H18A 2B8TA 4URVR 3B1YA 5FOUA 1XTQA 3IBYA 3THOA 4XTRA 2HUPA 3W5JA 1CP2A 4XWAA 4OHVA 2UKDA 2V7QA 2CHQA 1EK0A 5FTNA 2DFKB 3RRZA 1Q20A 3O8DA 5L3SB 3QG5A 3VAAA 5LB4A 3SQXA 4W5HA 1GNRA 2GNOA 2ZI7A 3IKJA 4Q00A 1RIFA 1XTIA 2QGZA 3I92A 2EQBA 1QRAA 1ZM3A 3EZ7A 1VYVA 2H92A 4Q9HA 3EW9A 1FQKA 2WAXA 2G77B 3C4JA 2R8RA 2JLYA 2XITA 3A1UA 3DOFA 5DYIA 2WWIA 3OFND 2FPKA 5KOYA 1E9SA 2FSGA 3KJEA 2DFLA 2XZOA 4WA7A 4JLPA 5H70A 3X2SA 1JJ7A 2DHRA 5FUWA 5JI2E 2YWHA 4PHFA 2LWIA 2Z4SA 1W0KD 3KTAB 4OHZA 2CL6X 1EG7A 1CR2A 3TAHA 1WBDA 1MOZA 1G17A 1EFRA 3THXA 4A0HA 1TADA 5K8UA 5TVKA 5JWRA 4TTQA 2IWRA 4DEXA 4NYJR 4QOSA 2MSEB 3T12A 1NP6A 1L2TA 1UDWA 3CW2A 1X8KA 2XSZA 5G41A 5JWOA 4Z1MA 3WBKA 3L0PA 1IXZA 1US8B 3IQXA 3MWYW 4LBWA 1G64A 1Q22A 1PUIA 1ZNXA 4KXFB 1FX0B 2GZDA 2ZEJA 2Q9BA 1MH1A 2KSQA 4CEHA 1GITA 2CHVA 3VR3A 1KMHB 1Q12A 2O8DB 5SZHB 4KVAA 1OB2A 4Q9JA 1E32A 2VTKA 2PJRA 5DI3B 1KO8A 3CRQA 4JLOA 1G1MA 1CULC 1G291 1QHHA 1W1WA 4IKEA 5EE0A 1R5BA 3EWAA 4ZDIA 2RAPA 4LBZA 3DM5A 4P4TA 1CR1A 3QXJA 3GLIB 5TDHA 1L4UA 4JBYA 3KJHA 1UEIA 4XH9B 1Q3TA 2ZAOA 2XTZA 1XCMA 3CUEF 2BCJQ 3KJGA 1KI6A 3FYHA 4FCVA 3NH9A 1DOAA 5L3VA 2V6JA 1TL7C 2H5EA 1P7CA 1JI0A 2NO9A 2YC4C 4POAA 5JFGA 3R9IA 4CEIA 1R0XA 1YZGA 2X19A 4OYHA 1W36B 2QP4A 2AFHE 1P2SA 4Z8XA 3VX3A 1FW6A 1XXHB 1OKKD 1Y63A 2OBNA 2AD5A 3B6EA 1A2KC 2X77A 4WZ6A 3ZYCA 1GUAA 2RGNA 2A30A 2JIZD 4GOKA 5LBIA 3W3ZB 2IUUA 2SHKA 3ZZUA 4I1SA 4M1MA 2Z5FA 4MKFA 3C7KA 3I1FA 2HYIC 1GKUB 3GEIA 4CT5A 1FFHA 3U3RA 1E6CA 3VR1A 2XEXA 4KJZA 4S35A 4TWZA 4ZCLA 4YMWA 3BH7A 5DN6D 3ADCA 3PUWA 2JDID 3KXKA 2KJQA 5C2JB 3TQFA 1HQYE 4P31A 5LPNA 1KHTA 4HEJA 1O3YA 5IDVA 1XFAA 1Z47A 1TQDA 2PEYA 3NBFA 3SJZA 1NSFA 2QTHA 4KFSA 5FBQB 3K8YA 2ZE5A 3W3AA 2QAGC 4MYCA 3L0OA 2DYKA 1XB2A 1O87A 1U94A 5HE9A 4EPRA 4XVUA 3U5ZB 3ZVMA 4NL4H 2GBLA 5AUPB 2XX3A 2Z4RA 2QEQA 1Q57A 3K0FB 4PFSA 4CEIB 3B8HA 1ZP6A 3GJ4A 4Q4AB 3R7WB 4NZYA 5FL3A 1CJKC 3SN6A 5E7IA 3C15C 4QM7A 2RGBA 3KZ1E 2IUSA 1CJUC 1H8ED 3TUJC 5FPSA 4LC0A 1LV7A 3FMFA 5HKKD 2QSYA 4DC9A 5FTKA 2C04A 2QROA 5JZVA 1KK1A 4UXIA 4Q7KA 1NVXQ 4Q4JA 2D7DA 1D2MA 2P2LA 2XSZD 2G1KA 4QG7A 4LJ6A 2D2EA 2ONJA 4B3CA 3GLFA 4OKSA 4ZDKA 3ETLA 5HCIA 2ZI5A 5JS8A 4IJMA 1VMAA 4A4DA 5JEDA 1G6HA 5JCZA 1E9AA 1IAQA 4ILEA 1OV4A 5KDLA 4B33A 3VR6A 4URYR 4DCNA 2NZJA 2FNAA 2V54A 1ZCBA 3PQCA 3P4YA 3VR4A 2ZJ8A 4RZ3A 2PZFA 2KWIA 5AK0A 1OXSC 2O8FA 3QPWA 4F4JA 4JLVA 2V8OA 2V55B 2AX4A 2AN9A 3UKDA 3RS5A 2OE2A 2VP6A 3QKSB 4PO9A 4U5XA 1W44A 1NVVQ 1T6NA 3H86A 4RCYA 1GL9B 1NG1A 2KBEA 3D8BA 1TEVA 2MMCA 4RCZA 1P62B 4ASUD 1U99A 2DY1A 3QIAA 3K0SA 1K8RA 1OT3A 4FINA 2R44A 5FTMA 4QGFA 3PEWA 3VX4A 3NTUA 5GJVC 3EZ2A 1KKLA 1GAJA 1XJCA 2H8KA 2JCSA 4FWIB 3H0KA 1Q21A 3BAFA 2RGCA 1E0SA 5FI1B 1ZC4A 4M21A 5KSZA 5FBWB 1CXZA 5JEEA 2A9KA 2VHTA 2J1LA 1DO2A 4JS0A 1PLLA 1E9BA 4B34A 4OK5A 2KBFA 1QG4A 3CR8A 4XOIA 4IDHA 3NHAA 3WP1B 3I62A 5J4VA 1IQPA 2C5LA 2W58A 3EA0A 1Q3HA 1ZIPA 1J2JA 1H65A 1GILA 4F4IA 1KGDA 4LJAA 4C3ZA 1HUQA 1QF9A 1R2QA 1RRGA 1HV8A 2VRWA 4OQNA 4TL7A 2XZLA 3CZQA 3LBNA 4DLRA 2OAP1 2GZAA 1ZNWA 2ZJYA 4PQFA 2C9YA 3ZIAA 2CL0X 1VYTA 3WY9A 4E07A 2GXSA 3CWZA 2F6RA 1YU9A 3DKVA 3WRYC 1PLKA 2WZQA 1N5JA 3I32A 4NCKA 2P3SA 1A2BA 2QRNA 1T5IA 2W2TA 3MCAA 4KFTA 4U02A 1EXMA 2F1RA 2XNDA 2FH5B 3GJXC 5CLQA 1UBFA 3IDQA 5C4GB 5JSZA 2BM1A 3ZQJA 4B43A 221PA 2BBWA 1Q0UA 1P2UA 4BEJA 5BYKA 2GJAA 4ABYA 1NN1A 3W8RA 1S96A 2ZI3A 1TUIA 4Q9LA 2ZSEA 4ZCMA 3GD7A 4B3XA 2BBOA 4B76A 5AR1A 4XIGS 3FMPB 2R6DA 3AVUA 3K9NA 5AJVB 5TARA 4YDHB 2D4HA 3AF2A 3U44B 1R6BX 4Q9IA 4J0QA 1R7RA 3F5FA 3U6KA 5BN5A 1HT1E 2ZU6A 2QG6A 4LJ8A 1TU4A 2CMKA 3IEUA 1YE8A 3PEVA 4Z51A 1P72A 4HAWA 3WYFA 4C9BA 4HLDA 1UBCA 1Z6TA 2IYWA 3O8BA 5FOVA 5FH9A 5HKKA 1N6IA 5E95A 1DAMA 2FX3A 3ZS9A 4YMUA 3L43A 3AKDA 3KQNA 4CT4B 2BBTA 1R0ZA 2GJ9A 1IN5A 2CBZA 2FPLA 1T3LA 2VP5A 4FXPA 1NI3A 3MWJA 1EWQA 3TNFA 5TMPA 1XD8A 1IBRA 4G3XA 5DYGA 3WHLA 3P4XA 4B2LA 3NEJA 3THXB 4IOJA 1LVGA 4NPHA 1W5TA 1CRQA 4WW0A 4I1OA 3LBHA 1KO4A 4V0LA 4Q5IA 8OHMA 1W46A 5K8LA 1Z83A 4X8HA 3K9LA 1YRAA 1W0KA 2WWXA 3ZJYA 4B3DA 2WHXA 1ZINA 5CITA 4LV5B 1E2NA 2OBMA 1L8QA 1NG9A 1N6PA 4HLUC 4LJYA 4UQOA 4YDSA 1N6RA 3WP0A 4A2WA 1UADA 5KNBA 1JNYA 2RH5A 5AJZA 4IW3B 4B6EA 5E3HA 4B73A 1K5DA 1IN6A 2NZ8A 2QMEA 1VG0B 3TJZA 4ZDJA 1QVRA 1FPMA 3BH6A 3EWSA 5SZJA 6Q21A 2ZM5A 5DH9A 621PA 3FE2A 2WICA 3EZFA 5DISB 2GF0A 3C5CA 5EP1A 2X8AA 1DG3A 2FU5C 2RHMA 1ESNA 2FOLA 1JALA 4FCTA 4PSKA 5A4JA 3PEYA 4FD2A 2C9CA 3PIRA 4DZZA 3T15A 2IUTA 1G4AE 3B13B 4HB0A 1IM2A 1M7BA 2O8CA 3PVSA 1W48A 3AGQA 1ZBDA 3Q5EA 1WQ1R 3QE0A 5JRJA 5FR1A 4S2EA 3NDBB 3S1AA 1SQ5A 4KSCA 3AKYA 1OE0A 2AXNA 2J59A 3CBQA 3M4YA 2WKQA 5F2EA 3U7EB 5JHHB 2QT1A 1TQ4A 4L9WA 3AVOA 3FVQA 4NMMA 3T5DA 3VQTA 3AM1A 3SYNA 1TQ6A 3CF0A 3EIQA 4MKHA 1UPTA 4B75A 4R9UC 1IONA 1ESMA 3OIVA 3OIWA 1J99A 2ZRAA 1SHZA 1OFTA 4M1TA 1ZMXA 4MYTA 2H17A 1KAOA 2ZU0C 1XCGB 4BQSA 3ADKA 3GP8A 1AN0A 1X8JA 2G0TA 4W9MC 2JATA 1MV5A 3B9QA 1SGWA 2ODBA 4A1FA 4LBVA 2JGNA 1E2IA 1WP9A 2ZR9A 3SJCA 3I8XA 5IK2A 2Q0HA 4XJXA 1ZW6A 3LW7A 1KSGA 3RC3A 2ZYTX 4GT1A 1HH4A 4HUTA 4JVLA 4NTZA 4PC3A 3E5HA 4EJSA 2ZRNA 2OCPA 3EA5A 3QXCA 1W4CA 1GTVA 1P9WA 3GFPA 2IC5A 2WMOB 3HYTA 4G5RA 1N5IA 4Y0AA 2BJVA 2FJUA 2N46A 1G3RA 2G83A 4QL3A 5A0FA 3TH5A 3X1WA 5KPJA 1GRQA 4GP7A 3X1ZA 4B6FA 1NVVR 3GMTA 4F92B 1OFIA 1OLOA 2J46A 1D9XA 2FFAA 3AKEA 1XPOA 1SZPA 4TYPA 3DVLA 1EWRA 2UVQA 3OHMA 2I3BA 4BLSA 5C4MA 1SXJB 2DCUA 2VHJA 4WIAA 4JVNA 5C18A 1EESA 3SU8A 4Q4HA 1D6JA 3I8SA 5DN6A 3P32A 4PAOA 1GP2A 4K46A 2X2FA 3AH8A 3C8UA 3THYB 1RPZA 4EUNA 3SHFA 2A5DA 1UDXA 2PLFA 1GFIA 1Z06A 2EFEB 3J81k 2D06A 3EC1A 1U8AA 3F3YA 2NOAA 1AJEA 2OV2A 2HDNB 4B44A 5KNCA 2OLKA 1DAEA 1C4OA 2BKEA 1IY1A 1PUJA 3ZQ6A 1CR4A 2GZHA 4TN1A 2FSFA 1XEWY 4HYYA 1E4VA 3R8CA 3MFYA 4Q7MB 2QAJA 4TL8A 3K0CC 4HZIA 4B3FX 3H2YA 4KITB 3VNUA 3CNLA 2WTUA 1ZD9A 1Z6XA 4N3NA 1XXHA 4QHYA 1G8FA 4WXPA 1N5KA 1VECA 1XXHE 4HLQB 1E79A 4OI1A 2IYUA 1P9RA 4LHVA 5KDDA 2JJ2D 3RC8A 2J9RA 4KBGA 3T1TA 1CS4C 3DKPA 2QY9A 2QZ4A 2R2AA 1WDTA 3E2IA 3GLHA 1GZSA 3LX8A 4DLTA 2JJ2A 1NVUQ 2F1JA 1ELOA 4K81B 5HCNA 3IUYA 2XGJA 2PH1A 4I81A 1DAIA 1Z07A 3EZ6A 4GMDA 1WRBA 1EGAA 1EX7A 2REOA 1LF5A 3DO6A 4JMPA 2NMVA 3W34A 2ZE7A 1XPUA 4JYBA 4MRVA 4C7OB 3VKGA 4RJLA 4URWR 5FBVB 3GLIA 1JR3D 3QJYA 2ASEA 2YZ2A 1XNJA 5TV2A 2F43B 4QNMA 1DEKA 4TLDA 2GXQA 4D0GA 3RYTC 2WWWA 2TMKA 1U8ZA 1YZUA 2I4IA 5L8VA 3QEJA 2WWHA 1RFLA 1XMIA 4XD7D 4EAQA 4EPWA 3I61A 3T06B 2XB2A 4HB4A 3AVTA 4NCJA 4PAMA 1TF5A 1X1RA 4DLVA 2PT5A 1G3IA 1CF4A 2JLZA 1DS6A 1COWA 4LYJA 2O0HA 3GFTA 2HT1A 4DLYA 1YZNA 4YMVA 1NNEA 2OO7A 1AIPA 2G6BA 2XJ4A 3AP2A 4AKGA 2K5UA 4NCIA 1MT0A 4U00A 1UM8A 5L3QA 3EX7C 2PLRA 2FV8A 3NHBA 4Q1EA 3NG1A 4AYTA 1XZPA 821PA 4TT3A 2GAAA 4QC2A 5DHAA 4AWXA 2QP9X 4DHEA 5CDFA 3KUCA 2ORVA 4NE2A 2O8BA 2W6IA 5EZ5A 3ZD7A 1MABA 2AHOA 3UG6A 1XEWX 3CX7A 3B1XA 5EXPA 1XMSA 3KQUA 3JVUA 5KSYA 4W7SA 5E7MA 1G20E 1MO6A 3ZD6A 1E2FA 4JLDA 1T0HB 2PMKA 1NJGA 3HU2A 3TVDA 1XCPA 2H7VA 3UG7A 4O25A 5L3SA 2ZI6A 3HPQA 4IDQA 2ZSDA 1U8YA 2OESA 1ZUNB 1Z0DA 1W5SA 1LTQA 1J8MF 1ONBA 3RRNA 5B57C 3K70B 3MMPA 1KDPA 1W4AA 4FN5A 5CIQA 4YXWA 1E2GA 3SJBA 3AB3A 1DBSA 4HLUA 1OYYA 3GLGB 3LD9A 3WXMA 421PA 4ZI2A 1R0YA 3QF4A 5JECA 2N1BA 4F91B 2P5TB 5ANRB 5B64A 2ODEA 1QHNA 2PJZA 2BEJA 3OZXA 4JJZA 4URUR 1VCNA 2C8VA 3OESA 2BMDA 2QRZA 4IXMA 1SVSA 1W36C 4DB4A 4BFWA 2F3TA 2HYDA 3TRFA 4KI0A 4DSTA 1A1VA 3NH6A 5CB8A 2GETA 5EE1A 2H16A 1OFHA 1OPXA 3W6OA 2JDIA 1XTJA 2KB0A 2CCJA 3CLVA 3VMFA 1B0UA 1CLUA 3A1SA 1JQJC 1FL9A 4X8LA 2FDCA 2EW1A 2IEYA 4V0MA 1LS1A 2WBLC 3MWLA 5M04A 3LWNA 3K70C 3FMOB 4MYHA 5G53C 2IK8A 2QPTA 4B3GA 5B58C 2OBLA 4NYMR 4MYUA 4U7DA 4QGGA 4GZLA 2F3RA 1JR3E 3CH4B 3MRSA 2CCKA 1KZ7B 3LA6A 3A58B 2ATXA 1NN3A 4RD6A 4L15A 4C0SA 1GG2A 2CNWA 1HYQA 1KO5A 2QT0A 1SKQA 3L0IB 3BFXA 3IHWA 1QHHB 1ZM7A 4B2IA 4IDNA 4YQFA 4C0JA 2DFTA 2HCJB 5JS7A 4CVNA 4WAUA 2OFXA 1KI6B 1AGPA 4TMTA 1N0VC 1DAHA 4KBFA 4CEHB 1T8UA 3QEOA 1AZSC 4QNRA 3QXXA 3GEHA 2CEAA 2CL7X 2EFHB 3HDTA 4M1YA 4L8GA 4LGMA 2VSXA 2ZRIA 3BJIC 3ZGXA 5JBQA 2EYUA 1RRPA 4OK3A 1VCMA 1Z6YA 3LVRE 5EP4A 3CZPA 1EFUA 3G5UA 4KLNA 1JEEA 4TZ0A 1SKYE 2OXCA 2ZRGA 1W47A 4OI0A 2GJKA 4TQUS 3I72A 2JLRA 3CO5A 1N6OA 3CKLA 1SVKA 3AEZA 1OXVA 1Z5ZA 3ECCA 5J47A 1TX4B 2QBYA 2F9MA 1C1YA 4WOPA 4O2LA 4RD0A 1P61B 4IXNA 1OF1A 2FG5A 3DL0A 1ZD8A 1N6LA 2AWOA 2R6AA 3Q7PA 3X1XA 1XZQA 4TTPA 1N2CE 2WJGA 2ZUBA 2W6JA 2A78A 1E2QA 1E0JA 4QKQA 4LOAA 1A82A 2MSDB 1ZAKA 2YNMA 3REFA 2OHFA 1OHHA 1G8GA 2BVNA 1H8HA 2ZRMA 3KFXA 4DSUA 2J0QA 4ITRC 2LCFA 4M4SA 4BECA 1GRRA 2QM8A 1KO7A 2C98A 1II9A 1YZTA 1X6VA 2QUZA 3TUZC 4BLTA 1E96A 3UWOA 1SKYB 2ORWA 1AGRA 4ZDWA 1P9NA 3F0TA 4BEBA 2ZROA 4DRZA 4GMXA 2H1LA 4D26A 2ECKA 2VPPA 3GLHE 3C41J 3T35A 5DIFA 5IT5A 5HZKA 1BH2A 1NMXA 3SFVA 5IK2D 2IXGA 1PZNA 5BQ5A 4K8OA 2D3WA 2O52A 1QVAA 2BCGY 4RZXA 4TTRA 2O0JA 3BB1A 3CM0A 2CCGA 1KI9A 1AQUA 4IFEA 2VEDA 3RRYA 3LLUA 4URXR 4N1AA 4MDEA 5BN4A 2QQ0A 2WWFA 1KYIA 3SNHA 4DXAA 1DAFA 4B3BA 3MLEA 4M1WA 3IIJA 2BBSA 2NIPA 1E0KA 5H68A 4AIIA 1YVDA 1T3SA 4KCGA 2HF9A 1SVIA 1QZXA 1NL3A 5CK5A 1J70A 2HLDA 4PX9A 1I2DA 5H1YA 2FMXA 3A1VA 3R9WA 2FFQA 3N70A 2QI9C 4US2R 3P20A 4LYAA 2OILA 1QDEA 2FPMA 1NRJB 4CEJB 2XOKA 4I99A 2ANCA 2IYQA 3B60A 5LDDC 1NVWQ 2ZRHA 3EARA 4FMDB 5CLLA 1F2UA 4TLBA 2ATVA 2IS2A 2F43A 2IHYA 3SBEA 1NBME 1AS3A 2AR7A 3OIYA 3W5IA 5J4HA 2OXRA 3DEFA 1S0UA 2J0SA 4AD8A 2A5GA 3TAUA 3QUSA 3RNLA 1TU3A 5BYJA 4DCSA 3ZS8A 4MA4A 2ZYUX 4UNQA 4H1VA 3OE7D 4N0EA 3U7HB 2JLWA 5AUNB 3LO5A 1VCIA 3TK1A 1UBEA 1MRNA 1J8YF 3LXRA 3SBDA 2VF7A 2FSIA 2HT6A 3GJ3A 5HR5A 1G5PA 5TB5A 4G5QA 3HR7A 1N0WA 2GBLC 1A5TA 3BERA 2A3RA 2CDNA 3L82B 1E1RD 1ZD1A 3B2EA 4AKHA 3HPRA 1W2HA 2ZRDA 4GOXA 3L8YA 5J4YA 1GIAA 2YOGA 4A8JC 3IILA 4ESVA 2GVZC 1NBMD 4DEYA 2P6RA 2RGEA 1CJVC 1KDRA 4CYMA 1W4RA 1E0AA 3DM9B 4JLMA 4WBSA 5C1BA 4JSYA 4HDCA 4ZO4A 1BMFA 1XD2A 4JYCA 1TF2A 3CPHA 4DUGA 5JI3E 1KY3A 3ZVLA 1JEDA 4C4PA 3TGPA 2FA9A 4E03A 1IY0A 1UKVY 2YV5A 2DR3A 2WJHA 5CIWA 4PHHA 5LD2C 2NQ2C 4QJ3A 1KDOA 4MITA 4FMCF 1G3QA 5AUOB 5HTKA 4EIWA 3K0EA 5EXXA 2QN6A 2AK3A 2C9OA 2RGGA 3B1ZA 3PENA 4MKIA 5JWHA 2UZIR 1MKYA 3CRVA 1PLJA 4DVGA 1FUKA 2XB4A 4RSGA 3ZH9B 5JHGB 4OK6A 2HEIA 5AUQA 3PUYA 3W6NA 1SHKA 1S8FA 3Q8XB 4TYYA 4TYWA 4BRUA 2VO1A 2B21A 4C0KA 3CH5A 2IX3A 4RVCA 3LNCA 4RD3A 1RYHA 5FOWA 4QJ5A 1Z0KA 2WSMA 3IHLA 1MABB 3CR7A 5DO9A 3UANA 5GJBA 1G7TA 5IF9A 3T5GA 1T91A 3A4MA 3H1TA 2WKRA 1F2TB 4EQ6A 4GOJA 2O8DA 4OHXA 1OB5A 2VHUA 1A4RA 3KUDA 2CK3A 1FX0A 2HLDD 1OXTA 521PA 2P0EA 2GK7A 3QI2A 4L9SA 5H8WA 4XSHA 4Q7LA 1FNNA 3Q9LA 4HZUA 4M22A 5A5GA 4JSTA 3NVAA 4DWJA 3PV0A 5F3WB 2ZUDA 3N2IA 4BFVA 5FBLB 3DZDA 3BD9A 1G5RA 1S9HA 1S9DA 5J40A 4D0LB 3U7FB 1Z2AA 2EWWA 1P2VA 2ERXA 3A8TA 4BRWA 2R6CA 2NO6A 2OFWA 4NKRA 1SULA 5DI9A 1KTVA 3KFVA 3GLGA 5FI0B 3IEVA 2J0UB 3VFDA 2WOOA 4JKYA 5J4LA 1GL6A 2V7QD 1IJEA 4O0MA 3BE4A 2ONKA 2Z83A 3K1JA 3LW8A 3BC1A 3SC3A 1QHSA 1YJ5A 3ZIAD 3FPAA 4I1UA 2J0VA 1W0JA 4LHXA 2FZLA 4BPBA 4DIDA 2QAGB 3AGPA 3LH5A 1GL7A 2XOKD 4R71A 2G9NA 2C96A 1KSJA 2O0KA 2CVFA 1I4LD 3BWDD 3E1SA 4NBSA 1HY3A 4PSVA 2GXAA 2GESA 4M0LA 5B2ZA 1G19A 3TMKA 2VQSA 4B32A 4DCUA 1JB1A 3FTQA 2B6HA 3PCRB 4E09A 1MO5A 2FN4A 2HXSA 5F98A 2OM2A 1N6KA 4LDJA 5CYPA 2AXPA 2F1IA 3VHLB 3OEHA 1NMZA 2ZXUA 1KK3A 1OH8A 2O8BB 2NPFA 2DWPA 3QKRB 1FUUA 4QHTA 5TXGA 4V03A 1GKYA 4G1UC 3UATA 3WRXC 2PBRA 2IYSA 4Q66C 2OFOA 2AWNA 3PITA 3V00A 4BLOA 4EFMA 2WIAA 1SXJE 1G4UR 3A37A 3GJ8A 3B78A 1YR8A 5FOXA 4A6PA 4IDPA 4A8JB 2VSFA 4JLJA 1VHTA 3RSLA 1IOZA 3OAAA 3B85A 1RRFA 4Q18A 3VU9B 3FKSD 2BKUA 5KSOA 3U3MA 1FTNA 3MD0A 4NYMQ 3EG5A 2BOVA 2L0XA 4TLAA 3SEAA 2F55A 5FBRB 1UKEA 5FR2A 1II8B 1UAAA 2B8WA 3RDPA 4PXAA 3LDAA 4X8MA 3SHWA 3TR0A 3SI7A 2QMOA 3KKOA 3OEHD 3PFIA 2QP3A 5FUYA 3L0SA 2REXB 3KX2A 1T9HA 4TQAA 4TT3D 1ZM9A 4HUQA 2VP0A 1LW7A 4BGDA 2EYQA 1CRPA 3A1WA 3HR8A 3OFNA 2QQEA 5FTLA 1TEXA 2XJ9A 4LV6A 3GCGA 4Z54A 3CONA 3GLIE 2C99A 1W0JD 3NKVA 3JZMA 4TSFA 2FEMA 5HZHA 3IGFA 5F9HA 4LUCA 4YC7A 1ANKA 4C7OA 5CM8B 2ZSBA 3GJ7A 1G41A 1Q1QA 1GNQA 1RZ3A 4QGAA 5DSZA 4F4CA 4PTLA 2WSSD 2G0NA 3CNOA 4KFUA 4R2HA 2FGKA 1DG1G 2VA8A 2YWGA 2BMFA 2QU8A 4EJSB 4QM6A 4EPXA 3I5YA 2DPXA 3U3OA 2PZEA 3JZAA 4ACAA 4OHWA 1Z0JA 2Q21A 1XX6A 2ZQ5A
chains in the Genus database with same CATH superfamily
4TSKA 3IAHA 1KFKB 2DM6A 1IFXA 3CLTD 2FQWA 1VE5A 3FGPA 4JJGA 1VPWA 4UTVA 1XI2A 2WKPA 3TTSA 3HJAA 1QH1B 4MI6A 3AF4A 4UZSA 4PQRA 1G7RA 5AKGA 1CUBA 1TUBB 1CQJB 1LX7A 3HCDA 4KQ1A 4Q1FA 3TOVA 3BMNA 4UNSA 1SG9A 3LT1A 4P83A 2M9MA 3G2KA 1CW2B 4O2BB 3UAWA 3UK6A 4CKCA 2IY7A 4LF9B 5EE5B 5B2EA 1G5IA 2CL5A 1HF3A 2OHJA 3N76A 2D0PB 4YVFA 2QW1A 1FMJA 4ICIA 2Y6VA 4KDEA 4LF6B 1LDBA 1JKFA 2RCNA 3F4LA 5FV4A 1DUVG 1E2DA 4JZKA 4M0KA 2IGTA 1LV8A 4MGYR 3W3AH 3U7RA 3TYXA 3FG9A 4M0EA 1GUZA 3DZHA 3EH2A 5LP6F 4GFDA 1ISPA 1AKEA 1QIDA 1V6CA 2Q8PA 2REQB 3G23A 1VPLA 1B8UA 3C3CA 4JVMA 5TQ2A 5AJXA 2XA1A 4BU0A 1SU8A 5J4KA 1FP4B 3NEPX 4YT8A 1T5BA 1W0CA 1QHXA 1M1UA 3KIPA 3AL3A 3STXA 3IAEA 3ZY5A 1AGNA 3FPBA 3QTTA 2JIZA 4FC7A 1E2LA 3CG4A 3DEIA 3ETHA 3GX1A 4LDRA 3UMFA 4K6CA 3AXSA 4N8EA 5H5JA 5JFOA 4X6XA 1KP2A 3IH5A 4V02A 4A8JA 4FUTA 2PX3A 2A94A 2J7KA 1EGHA 2OFPA 5HP4A 3HKBA 1ZGHA 2B82A 5FPKA 3WL7A 3ZNOA 4ZHSA 4EMTA 1RXYA 2CSUA 4MUXA 2HMUA 4TOIA 2HZ7A 5AQ1A 2WJAA 3BXZA 2DZDA 5UKDA 3PFKA 4JLAA 5ICCA 1QH1A 2X5XA 4PZUA 1YI8A 2J9FA 1PJRA 2XNHA 2YR0A 1U7DA 1H4SA 1MC4A 1UFQA 1W5BA 4B6SA 1PW5A 2QNRA 5FX2A 3TI7A 1YRWA 2V7VA 2MSCB 2QE7D 3WMEA 2BRUC 1X1QA 3G2OA 4I55F 5KOJA 1TMYA 2NO0A 2DP4E 1LC0A 3DFZA 4IEEA 4H6XA 2HNBA 4M88A 5E3JA 3UXMA 4G01B 5AKEA 2NV6A 1NU8A 2VFAA 1VHQA 4YQZA 1W59A 3W9SA 4XWOA 2JFHA 3PQ3A 3G0GA 4DLXA 3EGDB 1WVIA 4BO9A 2AUMA 3QNUA 3TLXA 5THXA 1TEZA 4Y1RA 1P1JA 2PKRA 3CX6A 3WNBA 3JWIA 4WLEA 1RWMA 4OQXA 4EVQA 4NBKA 4QYMA 1URPA 3EPKA 4EY8A 1FQJA 1XEXB 2IEDA 4MULA 1XCOA 3IIKA 5GADl 4D42A 2ENWA 2RHTA 3NUQA 1X80B 4ZHQF 2JFXA 2C5FA 2W2KA 3MYYA 1P31A 1ZI9A 2BMEA 2VF4X 4D81A 4IVNA 3IE0A 3UJ6A 2UUPA 3W78A 4OLBA 2DBRA 3K1AB 3GLFB 4KR9A 2VP3A 4AI6A 2VWHA 2NZ2A 4CLDA 3K73O 2Z57A 2ZI9A 1Y8CA 2FB9A 1IN8A 1GYRA 2RHOA 2WYWA 3MTBA 1UPCA 1VLZA 4JQSA 3OQBA 5JZSA 3KLMX 1NYQA 3CMMA 2ZJ2A 3BE5A 2W2VA 3DO8A 3MUFA 2VF5X 4YA6A 4DLWA 2QOEA 1JDSA 1Y5IA 2BY4A 1JZQA 1YTLA 2R3SA 2V5VA 3JD3A 3OBIA 1NHWA 4HCJA 4UM8B 5A7GA 3SZ3A 1SCQA 5IS2A 2GEVA 1KOFA 1G8SA 1ODFA 3MT8A 4WLFA 1YU6A 3S2IA 7MHTA 5AHWA 2CVZA 2QRLA 1M1ZA 2PKQO 2XUZA 3G2JA 4FWTA 4HYQA 5FL7D 2AEEA 4KNYA 1XLWA 5JPDA 1Z4QA 2WHPA 3A9UA 3DZIA 1KH3A 5LYJB 2CKMA 1BGWA 3I04A 3V4OA 5CDGA 1K7YA 1NIJA 3JYLA 1PZHA 1R4AA 1HDIA 2XKKA 1F60A 3QU4A 5I7OA 4L4RA 4LWZA 1IN7A 3I39X 4JX9A 3A2LA 2LCIA 5EE3A 1UH5A 4F5EA 3VUEA 1E4EB 2ZOSA 1DQRA 3MRTA 1M83A 1YOVB 1QVWA 2GDZA 5GINE 2GN1A 2AX3A 4P32A 4R7ZA 1I8TA 4ERNA 3BIWA 4LHSA 2YN2A 3K0FA 1PS9A 4FSHA 1ZK4A 4QBGB 3EE6A 1AV6A 2GZ1A 4D9NA 4BBJA 4GLFA 5JLJA 2GEBA 4KGZA 4XD7A 1XT6A 3PUVA 3TTYA 4EECA 1SC3A 2BGIA 3DP7A 1YL5A 3MCTA 1LNZA 4P0QB 4O4HB 1UJ4A 5DHSA 1YGYA 1WQ3A 2IDZA 2ZE6A 2C29D 5AD1A 5JSHA 2FRXA 1RM3A 3UZUA 3K20A 4E2YA 1U2RA 3RSGA 4ER3A 2PLNA 2HO4A 4YJFA 4XUGB 2I7VA 1IXYA 2DULA 2R62A 3C14C 4L74A 1Q44A 4MKGA 4R51A 4ENUA 2ZITA 4BB5A 1DX6A 1JT2A 3KOYA 5C8VA 4ZVVA 1T25A 1Y8QB 3D1VA 5BW8A 4EUKA 4FYKA 3V8PA 3AR7A 3K2QA 4NENA 1XVLA 3G2NA 1XMPA 1N5LA 4IIGA 5EHGA 4ZCQA 1H4QA 1C8KA 3TW8B 1OW3B 4MUBA 1SZCA 4ARCA 4PZEA 5AI6A 4B80A 1E7SA 1PT9A 5JYDA 1ND6A 4OHRA 3F9IA 5JXWA 5E9QA 3UUEA 1DDOA 3JAKA 3MK31 3S1SA 2CJPA 4BNTA 2VJOA 1C8BA 4ZPXA 1J0AA 3FB1A 1CEQA 1ZA2A 5FEMA 4M7RA 5T8KA 3H3FA 4FFOA 1NA5A 5GPBA 2GO7A 4C0LA 2X40A 4A0SA 3UA4A 3SOPA 4EMUA 3VGJA 3FJYA 3KJXA 3QVVA 1ILWA 1B23P 2ZAGA 1VKOA 4U6NA 4LJ7A 4OI4A 4TMXA 2OQVA 1UDRA 2O8VA 4AMBA 1Y3HA 5GY7A 1SXJD 1V4BA 4QEDA 4Z2YA 1QQBA 1MPTA 3EVZA 1N1GA 1TQHA 2A9FA 2FWNA 4FBGA 4N49A 4P4SB 3J80A 2VS1A 3NIBA 1X15A 2EZUA 3VMMA 2QLTA 4BMCA 1VE7A 4V0NA 4BLVA 3U1BA 2CWWA 3AKZA 3FTFA 3AP3A 2ERYA 5A5FA 3ESQA 3BHJA 1G21A 1SXIA 4K9MA 3DYBA 5KOIA 5L45A 1DAGA 1WNTA 2GAFA 2RHDA 1BYUA 4QRHA 4W5WA 2RD2A 1M72A 3HKEB 4MIKA 5EG5A 4ARZB 1FZQA 2AG5A 1VLVA 2HRBA 2WIBA 4LYEA 1LI5A 1IY8A 2QE7A 1N2BA 3KQPA 4MHSA 5E2BA 1E59A 3V6MA 5HIJA 4CMEC 1AXGA 4C2TA 5BOSB 2Q8NA 3T9EA 3F9CA 3GLVA 3V9PA 1LQUA 1IBMB 3L1UA 3P4UA 3W7BA 3FSRA 4LJ9A 4PZ0A 5F2KA 2FPIB 2JW5A 1C0PA 2V7TA 2ZRBA 3R7BA 1U0GA 4D4LA 5K2OA 3DCIA 1H6DA 1AQJA 1MC8A 2ANBA 1FFXB 1SUIA 2KLBA 3KWMA 2R8ZA 4OJNA 1XPRA 5EJEA 3OPMA 3DPIA 2CLCX 5AWFC 1QB7A 3Q7RA 2GN8A 3S40A 2VNHA 4U3JA 4HRVA 2HSGA 2H00A 4CFSA 5K0SA 3KWFA 5K3FB 4X62B 2I3DA 3OPYB 5KYVA 4CIYA 5DWDA 4FIDA 3U4QB 5G0TA 2QM7A 2WPDA 1ZESA 3E9YA 2GWHA 3IJEB 3QLUC 4HPWA 4WFIA 3SIXA 3VPAA 1KDTA 2LPMA 3ZZ1A 1A9XA 5DHPA 4D0NA 4GLJA 3ZX5A 1ZK0A 3FVTA 2PA0A 4QDKA 5LD2B 5BOVA 1SAYA 2GM3A 4YONB 4X64B 1UBGA 1CUWA 1QRRA 2PCLA 3CX3A 2BKXA 3M6IA 4PPNA 3T41A 1MD9A 4BV2A 4N7BA 5DEIA 5BVGB 4JP8A 4RK4A 2NGRA 1UZUA 2C42A 3REQA 5AHXA 5FPYA 2FMUA 2JEZA 2IIPA 3WGVA 4V1CA 4AY2A 1VL5A 2JLVA 3VR5A 2G5CA 3BK2A 2OG2A 1ZN2A 2FFBA 2XCQA 3G1WA 4IL5A 1NVEA 2QTGA 4QO8A 2Y0DA 1Y1PA 2I3GA 5CAEA 1ZUNA 5KCZA 1OGIA 1ZLXA 3DE7X 3E3OA 3LS2A 1DE0A 1MNAA 2NO1A 2NWQA 1IUNA 1P1RA 3IUJA 2OT3B 4ND8A 4YRRA 5CA0B 1FMLA 1XROA 3UJBA 2I5PO 2GXUA 3DC2A 3JATB 1E2UA 3L5OA 4MGEA 5DNVA 5F33A 2OQRA 2HCTA 4IZHA 4DCTA 5BORA 5I5EA 1A5SB 3PXAA 2JRCA 3HNRA 3SEZA 3RQIA 4DSOA 3GFSA 1KIFA 5EI5A 4COOA 2ZYWX 2V0NA 1OFUA 1C8LA 2D2FA 4R40A 3SYTA 2IBSA 1KEWA 1G9TA 3TX6A 3UOAB 5GZ3A 5JJKA 4NOJA 2QTVB 3FPHA 4FFNA 1HOXA 3GRVA 4U9HS 4FSXA 1KJZA 1FOEB 1DMSA 1VG1A 3IV6A 5A6VA 3R3ZA 4CEJA 3L6DA 4IBOA 2ATEA 1EVIA 5KNLA 3WJ7A 3AB7A 4LJSA 1NTOA 2D1YA 4H35A 2W00A 3WX0A 1BXKA 5HJEA 3EX7C 1XJ5A 4UU1A 2FJ0A 2F00A 2VAVA 4Q93A 5E6RA 1ZJYA 4HV4A 4UM7A 1IZZA 5ICGA 1I7QB 4O6VA 1RC0A 4N41A 2HJGA 4DR6B 1U2EA 4XYGA 5EUBA 1A69A 3IKMB 4M7OA 3MJRA 3C3PA 2O2SA 2NXEA 1GZUA 4GUDA 3NV7A 1ZJWA 3A3YA 4OGWA 4KUGA 6NULA 1WDKA 4MB6A 3TZ6A 5JU6A 1XAIA 3ZU5A 4CCYB 1L3IA 3RSQA 4HAYA 3FUCA 1WMBA 1EXNA 2WG0A 3STWA 1TM2A 2XUOA 4HB2A 1ZHOA 3DULA 1DQPA 4C2UA 3UO8B 3DNMA 1TVKA 1YVUA 3NWBA 4WERA 4AJ1A 3SQMA 3IT1A 3QJGA 4GX0A 3UWKA 2BONA 1R6XA 3EXHB 3KDSE 4W5JA 2RAUA 3L1VA 4M9QA 3TZEA 4AMGA 4COKA 2B9VA 4MRPA 3NEAA 2Z30A 4LDQA 2QGNA 3DV0A 5K0ZA 1G20A 1C1DB 3A1TA 2QW8A 4TLCA 4HXGA 3UIEA 2G0AA 4HTFB 1JXMA 1IHUA 5G3YA 2P79A 3WYDA 4M60A 3FTPA 3RE1A 3W9UA 4V2IA 1RWBA 2YOFA 5DE3A 2AVNA 1KI4A 1TEHA 4KQ2A 4MWZA 3DDCA 4OKNA 3RU7A 1ZH0A 3KJNA 2P6UA 4NEGA 2FMIA 2MYTA 3KKMA 2C00A 3DKKA 4M0UA 5TQ0A 1KJ8A 3VZSA 3GW8A 4MV7A 3FHCB 1Z28A 5EPOA 2QBYB 4I6JA 1WETA 3HXKA 3HUFA 5CDHA 3CN9A 3EQ7A 3BBLA 2R68A 3ELYA 5EIAA 2DQSA 3M9XA 1R15A 2CHEA 2PO7A 3AUSA 4KAXA 2A33A 3JRWA 2IPOA 1SUAA 2ZBGA 3O8RA 2GZMA 5B4UA 1FW8A 1V95A 3IKLA 2JJ1A 3EGVA 5KX5F 5HQ3B 5IZCA 3WAKA 4B83A 2ID4A 3HA2A 1J90A 5CBPB 4OUDB 4GKAA 1WCYA 4AUMA 1OSNA 4EHLA 1M2VA 1J1UA 2VDKB 5BWMA 2OBBA 1QQAA 2AOXA 3L4EA 2FQXA 4I4NA 3DSRA 3CRRA 5DWVA 2GILA 3RT7A 4V1CI 1E3DA 1IXRC 4PC2A 4RWZA 1E2PA 2WWGA 4L02A 4WOKA 4YRGA 3RRMA 1L8AA 3KSMA 1QZZA 1U6KA 4S1PA 2YC2C 4RZHA 1U9IA 4RA9B 5AI4A 1WSWA 3X44A 5MN6A 1Y6QA 2ZUCA 4D8UA 2CJFA 3K09C 2IXFA 1P4SA 3LLVA 2DQYA 1NQUA 4PNHA 4CCAA 3X1YA 1ORHA 1MOSA 4YHBA 3WV5A 2ZBDA 3M6MD 3V1TC 1TRKA 3F5SA 3C7TA 3IQHX 1SEPA 4BE7B 1JWAB 4ER5A 5I4BA 5C52B 4YRJA 3KJQA 3ZEAA 4Q21A 3ZWWA 1SHJA 2F1HA 4C0BA 4DABA 1Y3FE 3CG0A 4JP5A 4IHQA 4LTNA 3FNGA 4R9VA 4M38A 2O9JA 4Y0NA 3T9DA 5TF4A 4NHEA 3TLJA 1QBGA 4JODA 2D59A 4JXJA 3K0HA 1BA2A 2MYNA 3C3MA 2IF0A 2Z43A 5KYUA 1WU8A 3VKHA 2VZEA 5DYYA 4JB2A 1JIKA 4Q47A 1OH7A 4KH0A 2FZ5A 3ADPA 4EEKA 5JTUA 3F1LA 1HTBA 3HVJA 1I7LA 3KKPA 4J3FA 4MYSA 2DFVA 4OU4A 1JQKA 4ADSG 2ZVDA 2LE0A 3EMBA 1AZLA 1SU6A 1AKQA 4BFSA 4OMUA 3RBZA 2YMQA 4JQOA 3JQ8B 5EPUA 2FR8C 3GFRA 2Y8EA 2HXYA 1ZISA 3AJRA 1VJ1A 5BV1A 2PKYX 3QWAA 1YNOA 3JZIA 5JARA 2CZGA 1WUIS 2GCPA 1NXOA 2Z8YM 5EJ6A 4BY9E 1Y34E 1P3JA 5E0OA 1KY2A 4PVDA 4D99A 1BC5A 2XHZA 2I6TA 1B3BA 4HUJA 1M8JA 4ESEA 1MXFA 5FOQA 3NHMA 1NUTA 1JAYA 3NBZC 4MYDA 3TRDA 1WA5A 2E7ZA 4LISA 1DXOA 3JZFA 1TXGA 3IELA 4YCMA 2KQUA 3BF7A 1JKIA 2WABA 2WWYA 1TZMA 2I0FA 3C7AA 4DTCA 3OZTA 2WIJA 3FYSA 4P93A 3V5NA 3BA1A 2D1SA 4RDXA 5EL0A 2SKEA 4PX2A 1A7JA 1FRVA 5L4SA 3R0IA 4H4DA 4HDKB 3NWJA 4Q19A 1RHMA 2EFCB 2IEZA 4MXDA 4CIVA 4D3DA 3UWSA 5JAMA 2ZVPX 4A0RA 3KFLA 4ZYWA 2B78A 2K7ZA 1H8EA 3NBAA 4WCFA 3CVYA 2C3YA 3H05A 3DHVA 2OUIA 1H6CA 4PIVA 3I5XA 4MJLA 1SUWA 1CTQA 1G8PA 4BBAA 4I1VA 2WQ6A 3BA6A 1QP4A 2WPDD 4K8RB 5C8YA 5FNVF 4A8PA 4FB5A 3ILHA 3SFZA 3RPEA 3SJUA 1P39A 1CE8B 1ZYUA 2JJ8A 3K0KA 5BO5A 1JEYA 4F93B 4BFYA 3HBLA 3TX2A 1UK6A 2OSVA 1QG6A 4JUAA 4ND3A 1ONPA 4ZD6A 1ZNYA 3ZWVA 4KE7A 2BIFA 5AJTA 1XRMA 4YAOA 2JGFA 1G7SA 3ZDZB 3AJ8A 1R8SA 4DV5B 3OM8A 4EZBA 3GMIA 4M9SA 3OSUA 1XTKA 4U63A 1QLHA 1TZCA 1VI5A 1H8HD 3DL7A 3UKOA 1XZGA 2QQGA 1IM8A 2GTPA 3OWOA 4OQQA 3SS9X 1VI6A 4OAOA 5KNCH 2I6UA 1Z26A 4YI5A 4XVCA 1EBBA 4XDGA 2OC9A 1H93A 1LFDB 1I4WA 3EUFA 4D5EA 4YCLA 1B8VA 3CF6R 3IEKA 3GJ0A 3RRBA 1NT4A 1L4NA 3CPSA 3SE0A 4FVTA 1RBQA 1SG6A 3DBLB 3GA5A 3PC6A 5CYOA 4B47A 3F73A 2HW8A 2QTFA 2JCVA 2X5JO 1ZUD1 2OAQ1 3M89A 4OXNA 4X45A 3WNDA 4CT0A 3V8EA 3AHIA 5LNK1 6ABPA 3NBXX 1QC5B 3TQQA 4B71A 3HCBA 2D8AA 2YJ6A 4YP6A 1NXWA 5KUTA 1N0UA 4UU8A 4Q16A 3BE8A 1KYWA 4QFMA 1JQ3A 2C5SA 4GBMA 4J2TA 1KVRA 1WUHS 1WL8A 4YJ2B 1NYTA 2F9LA 2FTKE 1PJBA 4DBVO 4KO2S 1Y5LA 2I29A 4DLSA 4LFBB 4E5KA 1R8QA 3MJHA 3IT0A 2A57A 4YUWA 1L5LA 4ARZA 4OXQA 2NSDA 4ZC1A 4F8EA 5LL6P 3AU8A 2ZULA 2WYOA 3ES9A 5G3ZA 3WWOA 4US1R 5DV9A 3WZMA 3C3YA 3JASA 5HILA 2ILVA 2ZR0A 1NLMA 3LXMA 5IVHA 1F48A 4MQ4A 4IQGA 1VLHA 4EGSA 4YMLA 1V2GA 4WDRA 2ZJ1A 1LGYA 5KYTA 2WTBA 2NUPA 1EE9A 4P4SA 4CMEA 1W87A 4NV1A 3IDSA 3RARA 3IEIA 3LLMA 3G2LA 4RZ2A 3OPQA 3ONWA 4DQLA 2X4GA 1YRHA 4Q01A 5DXFA 5KMGA 4FNOA 4MGIR 4U5QA 4PQYA 3VKGA 1H4TA 3KZCA 4RPIA 1JSZA 1OIWA 4K5QA 4XWKA 1QZUA 3TVTA 5ITVA 4LC1A 1QTQA 1KHHA 3THWA 1K8ZB 4ZT3A 1KO1A 3FFXA 4JB0A 4XKJA 5CB4B 1CYEA 4A23A 2ISSD 1H0SA 1RWOA 2WLSA 5DJ5A 5BRAA 5C1PA 1UT5A 3BDIA 4HX9A 3MLBA 1VRCA 4X7BA 4HH3C 1JF8A 1DBIA 1NN5A 4YHHB 1RI1A 9ATCA 2R65A 1VDZA 2AN3A 4LYGA 3U81A 1YZVA 3I37X 1C3EA 1YKSA 4Y2JA 1THMA 4QZVA 3RS7A 2Z2YA 4MSUA 1K4YA 1PK9A 3WB9A 1EK2A 1QE0A 4Q4CA 1PV4A 1KNXA 2HF8A 5CDSA 2ADMA 2FEOA 4XR9A 3TIFA 5JXIA 4HGNA 2OBFA 2ZBEA 1PEYA 1E60A 2J31A 2WNHA 5KYNA 4ZOCA 5EXTA 5C9ZA 1HL7A 4NONA 3Q11A 4ZI7A 2AUTA 1KP9A 3GELA 5SYNA 2DWQA 1OPRA 2X0JA 4Z49A 1S2OA 3DDOA 2Q1WA 4IHJB 3SLKA 3FZGA 3BS4A 5AICA 4FGSA 4QQ8A 2HRRA 4WQMA 1ZAYA 1ZL0A 4HAZA 1GUYA 2VUUA 3RCBA 3ISVA 4BZXA 3D02A 4LBYA 4NPAA 5BNIA 2VJBA 4CE6A 1FFBA 1IMOA 1H85A 2FRVA 1XKXA 2DUMA 2I1WA 2Q4DA 3VPHA 4BFUA 5EKXA 1ORIA 1YMQA 5CVCA 4DV1B 2GFQA 3PNYA 5D7NA 5C7IO 1LZKA 2B36A 2OA0A 3TRKA 1SXJA 4A73A 1PR1A 2AHRA 2OD7A 2VJQA 3DTVD 4KH1A 4WECA 2VNSA 3QMMA 4NDZA 2G25A 3N3BC 1FMCA 5LJLA 1QBKC 5LQMA 1M2NA 3PJRA 3D3WA 3E03A 1JYSA 1OILA 2I8CA 2I62A 4UAGA 3ULKA 1AKYA 3MGKA 2ISCA 2YHSA 3REOA 4E4YA 5BPHA 2EF0A 2FG7C 4R2MA 1UKZA 3GJZA 3ONDA 4B85A 1ZLYA 2BW0A 2G71A 3E61A 1BHQ1 2JK0A 1O54A 1QRUA 1XD9A 3TBHA 2WIFA 1FDOA 5EOVA 2LNDA 2QN8A 1RQPA 4DWWA 3P2MA 1MAWA 3P7MA 1P6UA 1S3IA 3CRNA 4BQNA 4D41A 4IZIA 4UCXA 1HEIA 2FG6C 3DFFA 2KMLA 3I01M 1T36B 2OORC 4IYRA 2E85A 1DNPA 1LC3A 3LM8A 1Y4ZA 4N3CA 5TGZA 5LXTF 3T0GA 1Q0ZA 1C4XA 1V5IA 3CNNA 5DM60 3ZWNA 2R66A 1LK5A 4XEUA 5IT4A 2B25A 4MRSA 3EDOA 3K0CA 4BFXA 1KFJB 4MS1B 3MERA 4P08A 4RTNA 1E2HA 2GRJA 2Z4TA 2GB4A 3L8HA 5KNDD 3KB6A 2OAEA 1QO9A 1EVEA 3L8DA 3RIYA 2YKGA 4JL8A 4BFTA 2O1XA 4JSRA 4NE9A 2R79A 1T8SA 5JYBA 3LF2A 4D8WA 1DOZA 3M6UA 4A10A 4WN3A 3S5JA 1WXIA 2DBVO 5EIBC 2TECE 4ZCPA 3SD7A 4M6WA 2NU6B 1FY2A 3L4BC 2FPOA 1O5IA 5KTNA 1YI1A 3FPGA 3D31A 1RLIA 1Y7LA 3T0IA 1J0CA 1KEKA 5ER9A 1SD2A 1N4AA 1WXEA 3OZ7A 2WJWA 3TSWA 4INAA 1M1YE 4JIGA 1YV9A 1CDEA 2JK1A 3PNVA 3T7DA 4L51A 3G59A 5JMOA 1P5RA 1Y1TA 3HVHA 2OCYC 1UP6A 4QAQA 1GXSB 4NV3A 3GAFA 1Q83A 2GK6A 3K0AA 2AJCA 5BP7A 3FOZA 4UOZA 3ITDA 3C6KA 5EC8A 4OBEA 4OJKA 1WE2A 4WPGA 2FF7A 1PZFA 3QPCA 4PLVA 3HDVA 4H0NA 2PMWB 1MRZA 3FLMA 4ON9A 3RVNA 3TEMA 2X2EA 4PR0A 4LDZA 4ZKEA 2DT8A 2QU7A 4UAVA 5ALWA 4F3CA 2GPJA 4XM1A 3C5WP 4BMXA 2VSNA 2CVOA 1A88A 2XE4A 2XZPA 3NVMB 3QU9A 4JI7B 3M5WA 4RBNA 4CPDA 4JP2A 4CG0A 1CJTC 1U4SA 3RTEA 2HFJA 1DADA 3BD7A 3N2ZB 3STVA 5CURA 4C0QC 1MTOA 2O7QA 3KBOA 3P0IA 3H6HA 4HN9A 1WPXA 121PA 1QKJA 1QX4A 2BFWA 1HFEL 4EY3A 2RH8A 4K9PA 5IUJC 1EH5A 1Y7HA 2XUJA 3BQNB 3PNBA 2J85A 3H2SA 3NTRA 1U8CB 4OI2A 3UAOA 2ZYHA 4EFKA 1J24A 2WYUA 4Q3OA 4WVFA 2VZ0A 4BVEA 5CHYA 1IBCA 1NBOA 1U28C 1A76A 2J3IA 4RANA 3LZCA 3Q7EA 1JDTA 1V8DA 2W83A 1NLUA 4LF5B 1SBZA 4HAUA 2AKAB 1R9JA 2WUDA 1RXWA 3TM5A 3HP1A 3HBMA 1OXXK 1UANA 1YDFA 3OIUA 4XYMA 2K87A 2NPIA 3E4DA 2BDUA 4ZPJA 3T38A 2XNSA 3VR2A 1N6NA 2P8SA 1RPAA 5C4IA 2ZRQA 3T3EA 1TB4A 1GR1A 2VK1A 4HDSA 2AI2A 1YTUA 2JHAA 3UHAA 2N42A 2BAGA 2I1LA 1THGA 2VAXA 2VUIB 4GC5A 1UWLA 1GGNA 2H0AA 1WTAA 4X1KA 1QP7A 4MHTA 2D7JA 3ICEA 4BUCA 1XDGA 3UCXA 1Y81A 4ZOAA 3U1TA 2XY4A 3FNBA 3IPCA 1CZHA 3PFBA 1FFCA 3IO5A 4DJTA 3NBKA 4UE3S 3S81A 2HSJA 2DF8A 2R7MA 2HV8A 3L2OB 4FQ7A 1WULS 3MAJA 1UBUS 4ZTZB 1TGVA 1Z8FA 4PC6A 2RB4A 4WNCA 4BATA 1XBTA 4B3HA 4TKVB 2QJRA 1BX3A 3AONB 3F6CA 2VKTA 3O1JC 3IESA 3P2EA 4FEEA 4WNIA 2I3ZA 4MH0R 1VBKA 2GSWA 1GG5A 2GLXA 4LCEA 3MAAC 3ZE7A 1JLKA 1TJPB 4UUPA 2F7SA 4CQLA 4NBRA 4AKIA 2CJWB 2QR5A 3FFTA 3A32A 3HRIA 3HV0A 4J0JA 2ZIAA 1C3XA 1R6AA 2F90A 1D6SA 3LYUA 4DLUA 2JZCA 1YR1A 2QRUA 2Y1CA 4FGZA 4K7JA 1EVZA 1DPGA 3FY4A 4QBKA 2GI4A 1WIWA 3VKWA 4ZI7F 1AV7A 1ARZA 2FXVA 2VLIA 4OJQA 5FNVA 2I8LA 1XZHA 1QYXA 3BK7A 5A02A 3FNHA 4EG8A 2F4VB 2OHHA 1A7AA 1AURA 2W6OA 4UREA 4CCYA 1TUGA 4ND6A 1ZD4A 1ULAA 1QOQB 1E79D 3A4IA 1W6UA 1YSCA 3JW8A 2X8WA 1HNWB 2FLWA 1Q91A 1ETUA 1M2VB 2K4MA 1NW5A 2VDPB 4M87A 4HDOB 1QHYA 1QP8A 2QHXA 3BQ9A 4RX1A 4AX4A 5I6DA 1D5WA 5FYDA 1ZRHA 2VK2A 4YDQA 1X1DA 3ND9A 3NC1C 4IQFA 1IZ8A 4LCBA 4UFOA 2FSHA 1PZEA 3AM5A 3MGBA 5JPCA 1GM5A 3ZIDA 4ZIRA 1E3IA 3BL8A 1R5OA 3N75A 4IDOA 4HFJA 4ZOQI 3U2QA 3U5TA 4KP7A 5CMLA 1UXGA 3PLNA 1Z5WA 2IZZA 3ASZA 4S1WA 3HDYA 2B8TA 1D6NA 2QTVA 4I66A 3AIOA 4WKNA 5FOUA 3IBYA 2DBZA 1SQ6A 1Q0PA 3W5JA 5ALRA 1DC3A 1CP2A 2VZLA 3R3SA 2UKDA 1YHYA 4D9KA 3S7TA 3O8DA 3FVVA 3WGZA 5HA5A 5EA2A 1JR2A 4WCVA 4F3YA 3SQXA 4I46A 3W9BA 1MORA 1B16A 1AUVA 5B1YA 4KC0A 3I92A 1N1MA 2GX6A 3WRXA 1YBMA 4BTLA 3EW9A 1XTPA 2XDWA 4PGHA 4ARAA 4DJEC 3A1UA 3DOFA 3EGXB 3LKZA 3RVOA 2FPKA 1C1HA 1Q7RA 4KMMA 1X2EA 3OTOB 4CKBB 1NI4A 2B2XA 4C2AA 1F2DA 1KVTA 2DFLA 2LW7A 2YHIB 3KJEA 4WA7A 1SVUA 1JJ7A 1V7QA 3NI2A 5FUWA 2YWHA 4YV2A 2ZUFA 2LWIA 5H80A 1W0KD 4XQGA 1T3ZA 2WFLA 2FCAA 1P81A 2YV1A 4RYDA 1XRLA 2VDVE 5EIWA 1A9PA 2H1RA 1WXHA 1JQEA 2WTXA 5TVKA 2QMZA 4MS4A 3RF6A 4EI8A 5K8UA 5KWIA 3C70A 4TTQA 2IWRA 5LPNA 4QOSA 3S68A 1JNXX 1BFUA 1NP6A 1UDWA 1D8AA 2HSDA 2RB5A 4X97A 5CTAA 1EB9A 1X8KA 2MHCA 5D1NA 5G41A 5A4IS 4XJVA 2DWCA 3E7DA 5JWOA 3L0PA 1IXZA 1US8B 5FDFA 4LBWA 1X7GA 1XL1A 2B4AA 3R5XA 2YXNA 1G64A 3L77A 4DQVA 1FX0B 3NU1A 3OWHA 4UHEA 5JMWA 2KSQA 1GITA 3OD1A 1IOWA 1WB5A 4O8CA 1T6YA 5C3MA 1FFXA 1Q12A 5L6MB 4QYIA 2MIIA 3SXUA 4GUAA 3W8DA 3WIUA 1SXQA 2Q3LA 2EZTA 1XVTA 3IXQA 3WIEA 3VO2A 4Y2QA 3JAWB 3T7JA 4MAFA 4J4HA 4JLOA 3OQPA 5EE0A 1W1WA 2IHJA 1PK7A 2R00C 3H1FA 4GF5A 4IKEA 4K0RA 2ALJA 4ZTBA 4WXMA 2RAPA 4LBZA 5AOVA 3DM5A 1FNDA 3B6KA 3R5HA 5AK5A 1AN9A 1PGPA 2EEPA 1WLYA 1VIDA 3DFKA 3HKEA 4KJXA 4K6HA 2IOYA 4RPLA 1UEIA 4YDRA 2EX4A 2WAOA 2WF7A 3GVPA 4GMFA 1DG9A 5EKTA 5FLEX 5FWXB 2AC2A 3B9BA 4ARBA 5LU9A 5BSUA 5ESRA 4ZQFA 2ECPA 2FPRA 4CG3A 2ZYGA 1LWOA 3V8BA 1PJTA 4DV0B 4LY9A 2NO9A 5AHRA 2BFPA 5HS6A 1IBKB 5DXAA 3WIOA 2W43A 3O82A 4A27A 1I0ZA 5LKRA 1TYZA 4KNVA 3EQ9A 4WEOA 2GZ3A 4Y6QA 1T5DX 3V8MA 3FUTA 4GI1A 3UB3A 4Z8XA 4Z3KA 1BWRA 2BELA 3R5TA 4DIKA 5A3JA 3W05A 5BRJA 2AD5A 1IULA 1QIEA 4MWBA 4WZ6A 1OAOA 3VOBA 2OECA 5JAUA 3GUCA 3VZCA 2XBMA 1HDYA 1TA9A 2CWDA 4GOKA 3MZ0A 1X94A 1A9XB 4AZSA 3AILA 3D3JA 5H83A 4M1MA 4RTPA 4QUEA 2ID9A 3FCYA 4MVJG 2HYIC 1GKUB 2V74B 3GEIA 5CXXA 1FFHA 2ZP1A 2WFLB 3U3RA 5ALSA 3VR1A 1YS9A 4S35A 4ZCLA 4H0CA 4C3UA 4NENB 5E1DA 4K3UA 1T3GA 3D8HA 3ZBQA 5A05A 4AMZA 4CKBA 4DM4A 2HWWA 5DB4A 3UJNA 4LKOA 4HWGA 1D1QA 1HQYE 1RPNA 1KHTA 2H5IA 3EJ6A 1ZGZA 3EPRA 3JALA 3KYDB 4OGKA 1Z47A 2XR1A 4OJMX 2R5NA 1NSFA 1XK7A 3I9LA 4LZJA 4AQDA 4MYCA 2JVJA 2QAGC 1QGOA 5JATA 4DLKA 1XB2A 3B36A 4XVUA 3PRHA 2B0JA 2O06A 3U5ZB 3SFTA 4JEHA 1FXWA 2G9UA 4KRYA 3K7EA 3ZE6A 3GGSA 1JG6A 3UWDA 2CXSA 2PSSA 2A9VA 2XX3A 4I9GA 5LQJA 1BG6A 4WOJA 4E08A 2DLDA 3K0FB 3OICA 4I55A 4CEIB 1N34B 2P3LA 1CJKC 4XGRA 3BWXA 5BR7A 2C2BA 1M2GA 1HT3A 4G0VA 5C1OA 4XA8A 3ZW9A 1FU4A 5LYJF 5IWCA 4REOA 1JHUA 5FPSA 5K51A 4MLCA 4J3NA 4KO3S 3PS9A 1MC5A 2QSYA 4HQKA 2C04A 3BUSA 3C4QA 2VHVA 3F7TA 1C7QA 1NVXQ 1VE3A 3E9NA 3PTAA 1VJ0A 4QG7A 4YPFA 4LJ6A 1B6GA 3D4IA 2GS9A 3I9V6 4HL6A 5EWMB 1SA0B 3TLGA 4RLSA 3FDFA 1NULA 2NVOA 1Z8NA 3OHPA 2PXHA 4J3JA 1TAQA 1RRCA 3JQAA 1NQXA 3AO0B 4D96A 4Z86A 2HCFA 2NVUA 2YJ5A 4PLPA 2QKYA 3C8ZA 2ICAA 3HWX1 1AKRA 2FNAA 2R84A 4YTEA 1ZCBA 1T0IA 3OEWA 3P4YA 1MA0A 1IHDA 2ZWIA 2NZXA 2PZFA 5AK0A 4F4JA 1FLDA 4FJ0A 4GO1A 4GOMD 3RS5A 5H59A 2OE2A 3QKSB 3ROQA 1D1SA 3N3AC 4C04A 3T1YB 1NG1A 3V8VA 2KBEA 4MDYA 1TEVA 3ZUPA 2P7HA 3OJEA 2BE7A 2FQ1A 4G1MB 1XSEA 4J0KA 2XUFA 3DOCA 3H9UA 3QIAA 4UW9A 1KR5A 2Y1DA 3PEWA 2R44A 3F6YA 4QGFA 4LCJA 4P8RA 1JSCA 5JASA 4WMLA 3AZPA 4S12A 1H9CA 5GJVC 3NKFA 3RVSA 3WKDA 3G9QA 2PHZA 1E3EA 1Q21A 2A0FA 1E8MA 2Q7XA 1UQRA 2R1VA 2VSQA 3AIIA 1ZUWA 3BAFA 3ECSA 1ZC4A 2GKOA 4I5EA 4MJXA 5F7ZA 5H9VA 5HWSA 2V58A 2PUDA 3ODPA 1HFWA 1WWKA 2AJ8A 2VHTA 5KOJB 1JQBA 3PTZA 4JS0A 1PLLA 3CA8A 4N18A 3ZU2A 3MS4A 2KBFA 1YCFA 1QG4A 3QOXA 4BNXA 1V4NA 2QRHA 2DJIA 4PG4A 3RFCA 3WP1B 5J4VA 3BKWA 2M6LA 2FFRA 2BMWA 5I4IA 1PNVA 4G8BA 4TYMA 1CK4A 1Q3HA 1V1RB 5DLDA 5ITZA 4F2PA 2J9FB 1KBQA 1KGDA 5DP1A 4C3ZA 4HDSB 1HV8A 2PRKA 4CLXA 4OQNA 2BRUA 3DZGA 2X1MA 3QVGA 2D0IA 1WZEA 1Z6PA 2FR1A 2PRJA 3DEYX 3FRHA 3K1ZA 3KQSA 3R7SA 5HIAA 4P98A 1TZ2A 3TIIA 4DLRA 4W5TA 3FCEA 9ABPA 5LP1A 2YVKA 4KPUA 3GJRA 3KOMA 3ZCQA 3R9XB 3JYNA 4QTZA 4WT7A 3VO8A 1RLTA 3X2EA 2DUWA 1PD1A 2BDEA 2B3DA 2Q5JA 4BCBA 1JVNA 1A5BB 2FSVA 3BCHA 4R4JA 1D7AA 2UZ1B 2PX4A 4U8GA 4U2FA 2EKPA 1U9CA 2I7CA 3SPXA 4X6UA 3ZDBA 4FYVA 1ADBA 2V7BA 2C5GA 2P3S