1KZGB

Dbscdc42(y889f)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
b'MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
molecule tags Signaling protein
source organism Mus musculus
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
total genus 63
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kzgB00
4YMSA 4IHQA 1T91A 2QUZA 5G3YA 1II8A 1YRBA 3LVRE 5M04A 4Q48A 5KSPA 3P20A 3AKEA 1KNQA 4RJLA 5FOXA 5EE5B 3A58B 3FMPB 1G18A 2CL7X 3LD9A 4NONA 2VSFA 5JSZA 3ZQJA 4TYPA 2ZYUX 4XVRA 1XEXA 2SHKA 3U7GA 4EKDA 5G41A 4ZKEA 3W3ZB 2F1JA 2OG2A 2PZFA 5B58C 2Y8EA 1XMIA 1LNZA 1HURA 3K9HA 4HAWA 3TBKA 2DBYA 3RS0A 2NO1A 2Z43A 1G3RA 2ZRBA 2C95A 2LWIA 3CIOA 4AG5A 3SYLA 1U9IA 4FINA 3ZIAA 2XSZD 3AF1A 2DWPA 4PFSA 2RKOA 4CVNA 1X6VA 1NSTA 2R6GA 4A6PA 2Z83A 1HT1E 3TH5A 3TSWA 2FMXA 5E95A 3T12A 2FZLA 1L4YA 1QG2A 3ASYA 2ZR9A 1M2OB 1SHZA 3P32A 1CR0A 2IS1A 3UWKA 3WRXC 1ANKA 5GJVC 1XXHA 1HA3A 2IYYA 4C0JA 4AKIA 4MKHA 5FOWA 1TEVA 1HYQA 2DFTA 4QXAA 3K09C 4NPHA 4D81A 4OL0A 2ZVQX 3DPUA 4L9WA 3UXMA 2OCYC 1W48A 4IOLA 1Z0KA 3B1ZA 5TDHA 3RS5A 4DDWA 1M7GA 2QROA 2HT6A 1XNJA 4Q1AA 3UG7A 4DXAA 1GNRA 3W5IA 1KO7A 2IHYA 2J7KA 2QMHA 1RYHA 2ZTSA 5HCNA 4KODA 3AVVA 4AI6A 1UADA 2C9YA 2V6JA 1W4RA 4BFTA 5HE9A 3LRPA 3LDAA 2DR3A 4C0HA 3VKHA 5EP1A 3EC1A 4MKIA 2YOHA 4XSGA 4EQ6B 3A4LA 1SVKA 2EFEB 2H57A 3RNLA 3AF4A 3I61A 1H65A 4UNNA 2OO7A 4A2WA 1VCMA 3GJ0A 4PC7A 4Q18A 4RD1A 2GBLC 5CM9C 1WBDA 2O8BB 4YLGA 3VKGA 2BIFA 3PG5A 1AJEA 2GEDA 1XTIA 2VEDA 4DLUA 3U44B 3GLHA 3REFA 4RD4A 2ZRGA 2ANBA 3RS7A 5FUYA 3VTKA 1R0XA 4JLMA 4DEYA 3D6TB 3IBYA 4KLNA 2WICA 5JS8A 4AD8A 1S1CA 2XXAB 4D4JA 3IO5A 3QXCA 1P2TA 4LCBA 3UG6A 4QKQA 1NVVR 4WAUA 2IS2A 3TUIC 2FX3A 2DFNA 4BLTA 2VP9A 4F38A 4A0HA 1E2GA 1N6IA 3T15A 3ZD7A 4DZZA 3E2IA 1UM8A 2XTMA 1SXJC 1OH7A 1YR7A 4TT3A 4BLQA 2RGCA 4EPXA 4DLZA 4TMWA 5C46F 1DE0A 3N70A 5GJBA 2OV2A 1EXMA 1AS3A 2HUPA 1E1RA 2I1VB 3KUDA 4LJ9A 2JIZD 3WMGA 3CNLA 5KHOC 4NTZA 3DVLA 2FWRA 4GNKA 1MABA 5CK4A 1Q1QA 1YZLA 1Q3HA 4HEJA 421PA 5DGXA 4D25A 4QL3A 4R2IA 1UFQA 3WY9A 1UDWA 2OXRA 1BO6A 3GD7A 2FA9A 4W9MC 1UPTA 1PLKA 2ZI3A 4KU4A 1SXJB 1X1RA 3FE2A 2EFHB 3BB4A 3RYTC 3Q9LA 5EZ6B 4XWKA 2OFOA 3L43A 2PL3A 5E3HA 4LZZA 4NBSA 2AXPA 1VYVA 3PEUA 3I73A 1KSJA 2AX4A 3TAHA 3K0AB 1DAMA 3M0EA 2ODNA 4JLOA 2BM1A 1CRPA 3BH6A 1N6KA 1OYYA 1ZNZA 4HAXA 3NBFA 5K8IA 4Z51A 2WTUA 1D8TA 3TSOA 4HDQB 3OIWA 2ZUBA 1KAGA 4RVCA 3C5HA 3C14C 4CT5A 4YXWA 2IS4A 4HYYA 4I1SA 1WRBA 3KZ1E 3GPLA 4OHXA 2QU8A 3I5YA 1RJ9A 3LO5A 1Z6YA 4AKGA 2RGGA 1YRAA 2W6IA 2NO0A 3SZRA 1QVRA 5KU1A 4FW9A 2VP4A 5JCPA 2V7QA 1XZQA 1OH6A 2RGDA 4IDQA 2QAGB 4RD3A 1VG9B 2AFHE 3GMTA 4NU0A 2QM7A 5CK5A 3GEEA 4R7ZA 4ZKDA 1IJEA 1F60A 2ZE7A 2O8CA 3PUVA 2A5DA 3BFKA 4PR0A 1MO3A 5FH9A 1TQ2A 3E5HA 1AZSC 2Q9BA 2NPIA 4A15A 4ABYA 3EA5A 5KTYA 1Z0FA 4OI0A 2H7VA 2BJWA 2VTKA 5G40A 1C9KA 1MOZA 1D6JA 1ZNXA 3BB1A 4QHYA 1FZQA 1R2QA 1IXZA 4PANA 2JLSA 2ZI6A 5AUPB 3AQ4A 1G1MA 1VG8A 2A3RA 5FI0B 4URYR 3ICEA 5KNCA 3CR7A 1A82A 1UJ2A 3LQQA 4WZBE 2O5VA 3L0SA 3C41J 4X8LA 5AR1A 1G6OA 4H1VA 4KYUA 4AG6A 3THYA 1XD2A 2GCNA 2F9LA 4M1MA 3HU1A 4B76A 4JYCA 1ZNWA 1R5NA 2GVDC 3SHFA 1GITA 4TL6A 2OXCA 3SFZA 3RAPR 4JVSB 2CHVA 4RSGA 4URUR 4UXJA 1XJ0A 2DPXA 4JJZA 3KTAB 4GFDA 1ZUHA 4DLWA 1ZIOA 2PJRA 2VYFA 3OIVA 2OCPA 2D62A 4ZI2A 4QC2A 1GNPA 2IUTA 4LHYA 3ZQ6A 3VNVA 1A4RA 1G4UR 3THWB 1CRQA 3QJYA 3K0SA 1Q22A 3CPJB 1DG1G 4IVRA 1TUIA 1W1WA 1WQ1R 2ZRKA 3THXB 2QI9C 3ZZUA 1XEFA 2YC2C 2VO1A 4OI4A 1GWNA 5J4KA 1NVUQ 2MMCA 3LH5A 3GFOA 3Q7PA 3QKRA 3Q7QA 1SKYB 3PJRA 1Z6GA 4C9BA 5BN5A 3X1XA 3NKVA 2OEPA 1OPXA 2KWIA 4MYCA 1D9ZA 4W5HA 3I62A 4R2HA 1Q1BA 3Q5DA 1W4BA 3P27A 5DYIA 3NIBA 2C8VA 2DWOA 1G291 1AS0A 4A0FA 5DE3A 3TQCA 2CL6X 1C1YA 4QM7A 2NTYC 1P75A 1BMFD 4Q7MB 1WE2A 1XCGB 3GJ8A 4CGZA 3KKOA 1H8HD 1IY1A 3MFYA 2A5JA 5SZIA 4ZDWA 3AVWA 4KFTA 4U5XA 1E79D 5TB5A 1QG4A 2AL7A 1QRAA 1TUEA 5J4VA 1Z8FA 1S8FA 1Z0DA 1CR2A 3GJ6A 1NKTA 2VA8A 5JWRA 1M74A 2GNOA 1TPZA 3ONWA 4NYIR 4LGMA 1JEDA 4EPWA 2ZR0A 4ZDKA 3W90A 3GLFE 3CPEA 1CU1A 4XIGS 2HCJB 1Z28A 3LX8A 3JZAA 1OW3B 4IVQA 2WIBA 4RFVA 2AXNA 3THXA 4DLVA 3MSXA 5FFMA 3BK7A 2UZIR 3M1IA 2ZYWX 4EJSB 4PSVA 4ZDIA 3VHLB 4ZO4A 3MG9A 4AYXA 1XMVA 2O52A 4KSBA 3T1QA 4LBVA 5B57C 3AV0B 2V7QD 5G3ZA 1UDXA 3U3OA 2HEIA 5E7JA 4A2PA 2ZRLA 1NVWQ 1P72A 3GJ3A 2Q3FA 3IEVA 5E7IA 1OE0A 2HJGA 2CXXA 1Z6XA 2FG5A 4E07A 2AHOA 5F9FA 4FCTA 4CEIB 1LY1A 1X8LA 3RC3A 1EFRD 2XNDA 4B74A 4DIDA 1P2VA 4HUQB 2W0MA 3P4YA 4PSAA 1XD2B 4GZMA 1K5GA 1N0WA 3ADCA 5TXGA 3A6PC 2ORVA 5EUQB 5L3SA 1II9A 4TMTA 2PT5A 1UF9A 1T8TA 2Z4SA 1G17A 1W4AA 3I32A 2ECKA 4BRUA 4M2LA 2GEVA 4KFUA 3SFVA 5FTMA 3C4JA 2JLUA 4BFSA 4JLAA 2ZE5A 4YONB 1KTVA 1SULA 2HYDA 2BEJA 3AH8A 3W34A 1Z0JA 1Z47A 4LJ5A 2ZRDA 4JYBA 1JAHA 4HAZA 2GKSA 3IQXA 3S1AA 4EIWA 2ZRAA 4Q9HA 4QBHA 4AYTA 1W5TA 1BYUA 1N5LA 3UATA 3QG5A 5JZVA 1NLFA 4JL5A 4URVR 5JSZB 3TJZA 2G83A 3CB4A 4KFRA 3RVBA 1E2KA 3TR0A 2VIIA 2R6CA 2QY9A 4DVGA 2CLDX 4KI0A 5FUXA 2D3WA 2RHMA 1PUIA 1TU4A 4B2PA 2GHIA 4TMXA 3ZVLA 2OLJA 2FSHA 1O87A 1QHNA 1JJ7A 1S9HA 4NH0A 1ZYUA 1GIAA 2ZPTX 5SZHB 3H0KA 2AKYA 4ZCLA 2QBYB 3DMDA 4C0SA 1Z0IA 1M8PA 4HB2A 4XTCS 2F1IA 2QN6A 3MLEA 4GBMA 2ZQ5A 2G1JA 4Q9LA 1RRPA 1G3MA 1ZD9A 3ASZA 3PUZA 1CULC 2XJ9A 1U0HC 1RJ9B 2BDTA 1OXXK 3NHBA 1J8YF 4NCHA 4PC3A 4F91B 121PA 4BLRA 2J7PD 5BN3A 5IF9A 1NIJA 3QF7A 4UXIA 2A9KA 2G6BA 1QZXA 5HZKA 3WP1B 5EP2A 3K0FB 1E2MA 3SJCA 2OBNA 5B64A 1OIVA 2G1KA 4KVGA 1G8PA 2OSBA 5EJEA 4BEBA 4PTLA 2QMEA 3VR2A 1T3HA 4G5QA 5B30A 4FI3C 4BEJA 4GRAA 1TX4B 4OKSA 1ZD1A 2F1RA 3PXGA 1FNMA 3QPWA 1Z07A 1JR3E 2QTVB 1ZUIA 4I4LA 1YZGA 4NYMR 2VP5A 1R8QA 4ESHA 4KJZA 2VHJA 3HR8A 3AP3A 1E9SA 2WHXA 4JLJA 5C1BA 5J4HA 1AN0A 1GRRA 2ZI5A 3FDIA 2XNSA 2WBLC 4TTQA 3W6NA 4AC9A 1NMXA 1WF3A 3QKUA 1E0JA 4B48A 1O3YA 2VL7A 2FFBA 3KFXA 3WHLA 3WMEA 2WWWA 1Q44A 3OFNA 2ZRMA 1KIMA 2ZJ2A 2FOLA 3IGFA 5EZ5A 3LNCA 2IC5A 1W47A 3G82C 3GLHE 4D4KA 4C7OB 2B92A 4JVNA 4JIMA 4DLRA 4N0EA 2GBLA 1KJWA 3CONA 4PSKA 3NBYC 5FL7D 4MRRA 4R98A 1KO1A 1DAGA 1QBKC 2REOA 2X2EA 4TL8A 3RRNA 3TR5A 1AGPA 4TQAA 3QF4A 1G20E 2WWIA 1E2HA 2CLSA 4FD2A 4B3DA 1AQUA 1E96A 4TLEA 2QMUA 2ZJBA 3X1ZA 2QT1A 3L0OA 4B47A 3L8ZA 2EQBA 3X1YA 1W0KD 1FMLA 3P4XA 3RS3A 5FBVB 3IHLA 3CRRA 4LY6A 5FPHA 2CK3A 3LW7A 1BYIA 3X1WA 4CEHA 4EFNA 3AF0A 4HDCA 3UK6A 1N25A 2VP0A 1N0UA 2YWFA 4Q1FA 3VR6A 2XNDD 3IQWA 2ZRPA 3T1VA 1D2EA 2HXYA 2OESA 3GP8A 2X8AA 2O8BA 3AEZA 2FFHA 1US8B 2PX0A 4A0RA 4MRSA 4Q21A 1CP2A 3PEVA 2IHBA 1NSFA 4Q7JB 2J59A 1I2MA 2GJ8A 3QUSA 4YMWA 1YR6A 1VHTA 5FTLA 2ZROA 3U4QA 2C04A 1XDBA 3QNUA 4M53A 5IRCD 1XD8A 4Q9KA 1KI1A 3WBJA 4KSCA 4UNSA 3RSLA 3MGCA 4HSEA 1KAOA 1E1QD 1KNXA 3K9NA 3V00A 2OT3B 2VP2A 3VMFA 1L8QA 2QSZA 1ETUA 1E2QA 4ASUA 3EA0A 2NQ2C 5AUOB 3EXAA 3D7MA 3U3RA 4B35A 5TY0A 1P9WA 1OFTA 3KKPA 3GLGA 2HF9A 2HCBA 5FOUA 3K9GA 1RRCA 1NY6A 1PZNA 3KJGA 3GLFA 3I92A 4HUQA 1UKYA 1XXHE 2WAYA 1EGAA 3K53A 3SDZA 1KK1A 2F1HA 3B1VA 3TSZA 3LAWA 3KQNA 1S96A 3EPHA 3IIKA 2KE5A 2N46A 4M9SA 4RKEA 4TYNA 1X86B 5GADl 5CYOA 3DKPA 2LKDA 3DEFA 3U60B 2CNWD 2RGXA 4DLYA 3B1YA 1AKYA 3OAAD 4IW3B 3ZLJA 1GILA 3K70B 4G5GA 3U4QB 3PFIA 2HJVA 1J2JA 4EJSA 1LVGA 1C4OA 2FN4A 1F2UB 1NKSA 1XTJA 4UQOA 2ZU6A 1TQ4A 3L8YA 2IYTA 3M4YA 4LYAA 1GM5A 3QPVA 3KKNA 2XEXA 4Q9IA 5AJZA 1T0JB 3MWKA 4HLUA 4O2LA 5IDVA 3RRZA 3EPKA 2B6HA 4UNPA 2GAAA 3PENA 4CEHB 3AF3A 5JJLA 1IY2A 4TYQA 4IOKA 2ZANA 2IUSA 4UKDA 3VU9A 4EDHA 3UMRA 4G0NA 1W5SA 4PO1A 2ZSDA 4CIDA 2NO9A 4EPTA 4D0GA 4UJ3A 3QPUA 1YZTA 3EPLA 4WZ6A 1XTSA 3QKSB 4LJAA 4PX9A 3E70C 2ZREA 4OI2A 3ZZTA 5DHFA 1G19A 2R6DA 4B34A 2Q3HA 4HUTA 2HXSA 5FOSA 1Z6TA 1W4CA 2GCPA 4IFEA 1RYFA 3ZD6A 1JBKA 1E2NA 2XB4A 1UBCA 5BWMA 5DI3B 2D2FA 2PCLA 2QGZA 3I3SR 1DOAA 3ZVMA 4RFSB 4BLPA 2F9MA 1E4YA 1COWA 1CR1A 3SU8A 3P26A 2A7QA 1E2IA 3L2OB 1J90A 3ZZ0A 2G9NA 1OKKD 3R20A 1G21E 1T6NA 2BBSA 1CKEA 3FOZA 1T5LA 2F3TA 4IFBA 1Z83A 1NL3A 3JZMA 4JSYA 4KHZA 4NHOA 1VG1A 2KBEA 4OK3A 2F43A 3QVUA 4NCIA 4CEJA 3U6KA 1TU3A 1Z6AA 3NBXX 4A8JC 3NDBB 5CDFA 2WSMA 1GG2A 4XD7A 1N6LA 2P6NA 4WZAE 2GK6A 4TSFD 5DLQC 5KYKA 3MCAA 4UNRA 2ZRIA 5KDDA 3W9YA 4B44A 1DS6A 4Q4JA 4O3MA 4MRPA 3ZYCA 1GVNB 3PQCA 1U9IC 4S2EA 4DT1B 4UJ5A 2YOFA 1T8UA 2GAOA 4M1TA 5TV2A 2XOKD 2RAPA 1OXTA 4E22A 3RWMB 3QBTA 1L7VC 2G88A 3HYTA 4QGAA 2CHQA 4XH9B 4MKFA 1U94A 4Q66C 1OT3A 2GXQA 4RD2A 5TMPA 1T3LA 2KB0A 2QMOA 1V5WA 1PUJA 1NIPA 4TYWA 2W2VA 2IEYA 2V1UA 2UKDA 4QHTA 3NBZC 1EWRA 4QOSA 1OF1A 4I99A 1KDRA 4Z8XA 3I5XA 1W36D 1E3MA 1S4QA 2A5YB 3FHCB 1LS1A 3THWA 4V03A 3C8UA 4E5UA 4DCUA 1CTQA 1LB1B 4YMUA 4DDVA 4I81A 4MGYR 1Z29A 4P33A 3DOEA 1ZM2A 2P5TB 5FPTA 2ZJAA 1SVLA 2FFQA 4MITA 2W6JD 1LTQA 2W83A 3TNFA 1NBME 4KCGA 3OE7D 5KO2A 5HKKD 1GRQA 1CR4A 1D2NA 2JLQA 1I2DA 1QHYA 1RKBA 1KSFX 2ZSBA 2ODBA 1EESA 4US2R 4RY2A 1W46A 3TK1A 2O8EA 4F4IA 4Q1CA 4JT2A 1OIWA 3HDTA 4LRWA 3GLGE 5IK2D 1A7JA 3BS4A 2BMFA 3I4LA 5L3QB 3VKWA 5JECA 3SEAA 1A2KC 1G16A 4ILEA 2CVHA 4QGFA 3EIEA 5UKDA 3O8CA 3I8XA 1NN1A 5DN6A 1N5JA 2Q3MA 4DLSA 2C96A 3B8HA 1B0UA 1S2MA 5A4JA 5DHAA 1EFTA 1WXQA 1P6XA 1AZTA 1WCV1 1AIPA 2FZ4A 1FTSA 1XEXB 2RMKA 2YJTD 1ZP6A 4M1KA 1G9XA 2QBYA 4B71A 4B3BA 3U6BA 3E1SA 4QNMA 1G64A 4HLUC 1SZPA 3PUXA 1E79A 4O25A 2PJZA 4MRNA 3PUYA 4XOIA 1GNQA 1CBUA 2H16A 2Z4RA 5B2ZA 2BEKA 2E9SA 4YDHB 3WNCA 1XWIA 1XZPA 5KOYA 1YZUA 2ZJYA 3WXMA 4D6PA 4WBSA 3CRQA 1PLLA 3FHOA 4TL7A 2RGAA 3VR1A 4ESVA 3PEYA 3H86A 1F3OA 5F98A 2W6ID 1KY3A 2R6AA 3NXSA 2J87A 5FPSA 1Z5ZA 2KSQA 2YVUA 4D2IA 1OFUX 3DHWC 1FQKA 1FTNA 1EFCA 3RRMA 2IF2A 2F6RA 2IWRA 3IKJA 2JCSA 1ZJ6A 4B3XA 1IJFA 1J70A 3BAFA 1G5TA 4RD0A 4C7OA 2J0QA 4QGGA 2WOJA 3QKRB 5FUWA 1IAQA 3PV0A 1NMYA 5LD2B 1D5CA 3GLFB 3EARA 3LY5A 4D26A 3QKTA 5CDFE 1ZBDA 3RC8A 4B3GA 4M1WA 1MRSA 2D4HA 3A1SA 4LOAA 5AUQA 4OQFA 4LBWA 4AWXA 2ZJZA 1LS6A 2JDIA 5AJYA 2IYUA 4TQUS 2BKUA 2FNAA 1N6OA 4MKGA 5EXPA 1N6HA 2BMDA 3SJBA 2FDCA 2O8FB 5L8VA 2P5SA 1TNDA 2IYZA 4L9SA 4NCKA 5FTJA 1QHXA 4F93B 4C0KA 4JBWA 2YHSA 3BORA 3EZ2A 2EYQA 4N1AA 4N3NA 2OFWA 3BBPA 1MABB 4OI1A 3RRYA 3SNHA 4Z8YA 4ACBA 1JXMA 3WYAA 1J99A 3DDCA 5A0FA 4D4LA 5F3WB 3VQTA 1ODFA 3LVQE 4KYIB 1P9NA 2EFDB 5EE9A 1T3SA 1CXZA 2IX3A 4GP7A 521PA 2Q9CA 1RVDA 1NRJB 2R2AA 4CW7A 3THYB 2V3CC 1E9BA 2XX3A 5TARA 1G5RA 3AVOA 1XXHB 1JXOA 4WOPA 3HPRA 2J0UA 1S0UA 1Y3AA 4PPQA 4BGDA 5JEEA 2FPLA 4HB3A 3BB3A 3SE0A 4LPSA 1BH2A 2HF8A 1G8HA 3CRW1 3UWOA 4BFUA 4C2UA 4O2RA 3GFTA 4PAQA 3OE7A 2W2TA 2ZYVX 2CK3D 2WVJA 4F92B 1VYUA 3QY0A 1COWD 4BPBA 3TMKA 3OEED 5H8WA 1UKEA 2YWEA 1KI6B 1NMZA 2NOAA 2ZUCA 1IN6A 2CHGA 2JASA 2CE7A 2ATVA 2GEUA 1F2UA 2QE7A 1T5IA 1Z06A 4LV6A 1SVMA 3TIFA 5HZHA 1CJTC 4FIDA 4MQBA 1IXRC 2O8CB 2ZUDA 1N6RA 1JR3D 3NC0C 5DNYB 1LF0A 4HLDA 1EWQA 2WJGA 1ZW6A 2H8KA 5P21A 4TSFA 4JBXA 4EUNA 4UXHA 2OM2A 1JPJA 2IA5A 3IBGA 4XTRA 4ASUD 2QT0A 3DZDA 1YR8A 3TE6A 4C2TA 1YE8A 2YINC 2QTHA 2QQEA 2YZ2A 3R9XA 4HAYA 3KJIA 1R5BA 1GOTA 5TVKA 4A92A 2O0KA 5L3VA 3T1OA 2QAJA 2JLZA 4WW0A 1DO0A 2YWHA 3EWAA 3SBDA 1E0SA 1ZINA 2NPFA 1SKQA 3AGQA 2XTNA 1R0ZA 3OF5A 2PMDA 4BUJA 4B3FX 1YZKA 1RRGA 4IXMA 2OBLA 1KGDA 3A36A 1UAAA 3BFVA 1P60A 2K5UA 3SC3A 1XMSA 4OHWA 5K8LA 1LF5A 3QKSA 3QXHA 1VECA 4NKRA 2FH5B 3TVDA 4C0LA 3SI7A 4BE7B 4BZPA 3LBHA 1OHHA 2P65A 3ADBA 5AWFC 2ZRCA 4X8OA 2V6IA 3HWSA 1YR9A 5EXXA 1T0HB 4NP6A 4B73A 1TF2A 2WSSD 2IYXA 2C77A 2J1LA 2ORWA 1SHKA 1ZM9A 4DCNA 5KNBA 2GVZC 1GDDA 2IYWA 5JHGB 1E1RD 1I4DD 2PT7A 4IDOA 4L5BA 2EWWA 4QBGB 4RZ2A 4TTPA 5KUTA 1II8B 2JJ1D 1KK3A 4FCVA 3KKQA 1CIPA 5AJXA 2BMJA 4RZXA 2F3RA 1NF3A 2WIAA 1G7TA 1KOFA 4Q1BA 1LW7A 1E2FA 1E32A 2NO7A 3NH6A 4JVLA 5JMTA 1NLYA 2NG1A 2GZDA 4JBYA 1OXUA 3DM9B 1GKYA 5J4LA 1CEEA 2YOGA 1EFUA 2X1VA 5HTKA 4A36A 2ASEA 5IT5A 4V0KA 4NCJA 1ONBA 1U81A 2YNMA 4YC7A 4Q4AA 3TLXA 4BASA 3BC1A 5DN6D 2FF7A 5L3SB 1DTSA 3HU3A 4Q03A 3C5CA 1A1VA 1ZNYA 2C9CA 3MWLA 1E99A 3NWJA 5DO9A 2PZGA 4DDUA 4XSHA 3T06B 5JCZA 1W2GA 4MYUA 2J0SA 1U90A 4D0LB 2ZE6A 4O0MA 2HV8A 4AIIA 3DZ8A 4LC0A 3CUEF 2JJ8A 3PUWA 4EFMA 3D31A 1CJKC 1XPRA 5H1YA 5BW8A 1N5IA 4XVQA 3RDPA 5JRJA 1QHIA 1UKZA 4LSGA 1DVRA 5KSYA 2XITA 1XP8A 3I1FA 3KTAA 3PEWA 3REGA 3AF2A 3ZDQA 3AVQA 4TYYA 1FP6A 2IWHA 3V9PA 2A5GA 3OAAA 3CPHA 4DLTA 3K70D 4AK9A 4X8HA 3C15C 2ZRJA 3SR0A 2WOOA 3H84A 1GFIA 2WWHA 5GVRA 3BE4A 1G41A 1E1QA 3OEHA 3W8RA 3CM0A 4FMCB 3QBVA 2Q0HA 3L82B 3FTQA 1Z2CA 2AD1A 5EP4A 1QHGA 5HCIA 1XX6A 4II7A 1DARA 5E7MA 2RCNA 1NBMD 1Q21A 1S1MA 4PC1A 1OFIA 2D7CA 4HAVA 3TW4A 2ZRFA 5JJIA 5KDOA 2FPKA 3ZJYA 1AKEA 2REXB 2EW1A 4JSTA 1OIXA 4PQRA 1OB5A 1KDTA 5FR2A 4H1UA 4LJ6A 3WBKA 2C78A 3K70C 2ANCA 3CH5A 2DYKA 3F8TA 4M1OA 4NYJR 4NYMQ 3N2EA 2Z0MA 4P4TA 3N5CA 1S3SA 3T1TA 4JS0A 1HH4A 4JZKA 3WHKA 2I1QA 3VX3A 4LJ7A 2VP6A 4DKXA 1YQTA 3Q85A 1GL6A 4TMKA 4V0OA 3G5UA 3A4NA 2GZHA 4EAQA 3NEYA 4FMCF 1XPUA 3GLIE 4V0LA 4IOMA 2FSIA 4A0GA 4LHXA 4LK2A 2BVNA 2WPDD 5HKKA 2WSSA 5J4YA 2IS6A 3IO3A 3K09A 2IXGA 1L2TA 2GXSA 1JJVA 4MDEA 1XJCA 1OKKA 1VKJA 2PX3A 1KKMA 2VHQA 1N3BA 2YYZA 3L0IB 3J81k 3U5ZB 2QA5A 4DHEA 3W6OA 1UEIA 4CF7A 1G7CA 3K0FA 2YV5A 4B6FA 4A82A 4DWJA 3CKLA 2NGRA 3CW2A 3OEEA 4GPTA 1JQJC 3QQ5A 3AB3A 3AUXA 4ZCMA 2OHFA 5CB6A 2IT1A 3CBQA 3CZPA 5D3MA 3BERA 2NZJA 1V43A 3FPAA 4TTRA 4U02A 1X1SA 1IQPA 1D9XA 4DDTA 5GJCA 2WJVA 2ZIAA 4Y0AA 2HT1A 1HQCA 1CJUC 2ONKA 4PZZA 4A1FA 3CWQA 1S9DA 1KDOA 2KI5A 3NG1A 5JHHB 2R8RA 4MDFA 1H8HA 4LV8B 2GCOB 1M1YE 1F2TA 1EK0A 4IRUB 1K8RA 2MSCB 3AM1A 1SKYE 2FEMA 3FYHA 4CRWB 2KJQA 3UIEA 1FFHA 1JAIA 5DISB 4QBFA 1U98A 2FEOA 2ERXA 1FUUA 3KQLA 1JECA 4DLXA 3S1AB 2H5EA 4KLZA 2IEZA 5DI9A 4PC2A 1H8ED 2QP9X 1W2HA 2D2EA 3W3AA 5J5CA 4D4MA 4B6EA 4LJ4A 1P5ZB 1NG1A 1IN8A 1XBTA 4NCNA 2OUKA 2ZR7A 3CX7A 3AUYA 1P62B 2EFGA 5FBRB 2GTPA 2FGKA 3KUCA 4FMDB 4M9QA 4QHSA 2ZSAA 5FTKA 4QM6A 3B7GA 1U2RA 4HB4A 1IM2A 1RRFA 2Q9AA 3VR3A 4OK5A 5E4FA 1XCPA 2XOKA 3D8BA 3U2QA 5DYGA 4GMDA 5SZJA 4XVUA 2WJYA 3T35A 4TZ0A 4EQ6A 1KI9A 1OJLA 5C4GB 3EIQA 4KBGA 2BBWA 3FGNA 1DAEA 4DUGA 3OEHD 3VAAA 2C2HA 3AVTA 1OXVA 3BJIC 3CF2A 1DAFA 3EZ7A 5CJ2A 2QM8A 3AP1A 3OFND 3QXJA 4DB4A 5IK2A 1E9EA 3K1JA 2FE4A 1NBMA 1DEKA 2IYSA 2JJ1A 3HPQA 2GJAA 1P2UA 1KO8A 3GEIA 5CB8A 4HAUA 4EPVA 1MH1A 4TN1A 2PLRA 4M0LA 4ZV4A 2I3BA 4W5WA 2ZS9A 1GKIA 4LC1A 1G7SA 5FBQB 4AYWA 3BOSA 2CE2X 4L15A 3FKSD 4K46A 4C30A 3GEHA 5H68A 6Q21A 1IHUA 3IDQA 1E9FA 1P9RA 4MGZR 2W2XA 4BFZA 4MA4A 1ZIPA 2ZAMA 2V55B 1DAHA 4JLNA 2CCJA 1KMQA 4F4CA 4AKHA 3H4MA 4IJMA 1ELOA 2CL0X 1G8YA 4JLKA 3NVAA 2JAQA 3ETLA 3SBEA 3WP0A 2JLXA 4DBLC 2HYIC 4BRWA 1WDTA 2JLWA 5KSOA 2AWOA 4TMVA 3B85A 4U00A 2NMVA 3LLUA 1W0JD 3X2SA 2QEQA 4Z1MA 4JMPA 4AURA 2G0TA 2IYRA 2ZI7A 2BHRA 4TZ6A 2QZ4A 3EZFA 1GUAA 4A4DA 4KAXA 1Z3IX 3UMFA 4ERNA 5LDDC 3LXRA 1OH5A 3VU9B 1YJ5A 3WRYC 2FSGA 1P4SA 1GP2A 4NDZA 3ZIAD 1IN4A 2AD5A 2PEYA 2XZPA 2W0SA 3HJNA 3V4RA 2LCFA 3PVSA 4LHWA 1I4TD 3GJ7A 5A5GA 3CH4B 4G5OA 2DFKB 4URWR 2X19A 5EE3A 1NN5A 4CT4B 3BH7A 1NG9A 2DB3A 1FPMA 2JLRA 2PH1A 3NTUA 5FI1B 1NJFA 4BZXA 1FNNA 3TAUA 2J46A 4E09A 3B78A 1ZU5A 3LXXA 2DHRA 2XZOA 721PA 2UVQA 3KXKA 4FXPA 4M9XA 4A9AA 4B32A 4MUBA 1SXJD 1RC8A 4BZQA 1K6MA 1KI4A 1WMSA 3MMPA 1WB9A 4IOJA 5GJWC 3A4MA 4NZYA 1ZCAA 5DSZA 2OILA 4M21A 4M22A 2ZS7A 2WV9A 4JLVA 2GZAA 3O8DA 2CEAA 4LJYA 1FQJA 2BJVA 2MSDB 1Q20A 1IXSB 2ODWA 3MJRA 2WJIA 2ODEA 3FMIA 5EP3A 2QP3A 3IEUA 3ZVNA 1ZCBA 2P3SA 5KSZA 5FL7A 5EXSA 2QNRA 4F7WA 2ZJOA 2GXUA 2WWXA 4Q00A 1KO5A 1UBFA 2CLCX 2ZEJA 3QXSA 1WBBA 2QP4A 1XF9A 4JT4A 4HATA 2QPOA 4Q7LA 2J45A 2RGEA 2VHTA 1AS2A 3CX8A 3QEOA 4JKYA 4M1SA 2R6FA 4UNQA 2LKCA 3RWOA 3U3JA 1UEJA 4PHFA 1W0KA 3LW8A 5BQ5A 4Y0VA 4Q1DA 3FKQA 1G3UA 3QENA 2REBA 4WVFA 5EXTA 1HE8B 5EUMA 1JI0A 2C98A 4G01B 2PLFA 2OCBA 3CRMA 1X3SA 3MUFA 2JJ2D 3FHTA 2CMKA 2WPDA 2G3YA 1US8A 3KJEA 2ZRNA 3ND9A 1FW6A 2AR7A 4BFYA 2C99A 2FPMA 1IBRA 4QJ3A 4DRZA 2JIZA 4Q4LA 1FOEB 4DCTA 4DEXA 3KDSE 3CO5A 3QG1A 3W5JA 4KVAA 2J0UB 3KB2A 2BBOA 4ARZB 2B21A 2CCGA 2N42A 2YWGA 621PA 2IL1A 1KI7A 2AWNA 1FL9A 2MMGA 1HT2E 1Y63A 1YHNA 2ZI4A 4BLSA 4BECA 5BN4A 5JRZA 3EC2A 1P7CA 4NYJQ 4RZUA 5AJWA 5LD2C 1Q57A 4DSTA 4P4SA 2ZI9A 2D74A 4CEIA 4P4SB 4URZR 1EX7A 4WIAA 2EVWX 5JLJA 3LV8A 2HLDA 5L3RA 5D3QA 3NEJA 2QL6A 4HZIA 1ESNA 1RZ3A 2Q6TA 2VH5R 3NDPA 1IY0A 2J9RA 4PO9A 2ZU0C 2RH5A 4PQFA 1KJYA 4C0QC 4US1R 4AKEA 4EPYA 3OIUA 2PMKA 4I1OA 1N0VC 4DSOA 1N6NA 1LV7A 1E2DA 3THOA 2JGNA 1VIYA 3ZH9B 1Q1ZA 4YXWD 5FBWB 2CNWA 2FFAA 3CWZA 4KXFB 4E03A 1KMHA 3VFDA 5JWOA 4OQLA 2GA8A 3CLVA 3BWDD 1H8EA 1G8GA 3Q8XB 4ZCIA 3U7FB 1OV4A 4ZI3A 4G5SA 4GSYA 2QTFA 3K0CA 1ESMA 1F6BA 4MYHA 3BH0A 5HE8A 3B13B 2XAUA 2YKGA 1XU4A 4Q5IA 3RANA 1G6HA 3B6EA 2O8DA 1EFHA 2BMEA 4FWIB 1P73A 2ZJ5A 4US0R 1T9HA 1SXJE 4C0AC 1R5OA 1HEIA 4B33A 3LQRA 5FBLB 4IEIA 4ITRC 1DAKA 1DPFA 1P2SA 5K8UA 1KSHA 1M7HA 4Q9JA 1R0WA 4LDJA 1E2PA 1MR3F 3A1TA 2OZEA 3VR4A 1XEWY 1GZSA 1GKUB 1VCOA 1XCMA 2ZRHA 4IXNA 3R9IA 4QRHA 3NC1C 3LFUA 4M1YA 4LBZA 4ZPXA 2DWQA 4FMBB 2V4ZA 1ZM4A 4RD6A 3KQKA 4B2IA 1FX0A 4QNRA 3CF6R 5G53C 1HV8A 1CLUA 2IF0A 2ZETA 3V4FA 3FKSA 1Q3TA 2AK2A 3X1DA 4D0NA 1QHHA 3TUJC 1WP9A 3EW9A 2R65A 4POAA 3SJAA 3NHAA 3UANA 3VX4A 4DCVA 4LWZA 1D2MA 3WNDA 2B7CA 4R9UC 4KBFA 3DM5A 2J0VA 4PQYA 3UPUA 2KBFA 3CZQA 3CRVA 2IXEA 3U3KA 4Q7KA 3WMFA 3ZS9A 2IYLD 3T34A 1E94E 4G3XA 3R7WB 3FFBA 3KJHA 3BIFA 5JI3E 1G8FA 3C7KA 3U7EB 1MO4A 2C03A 2PZEA 3U61B 3ZGXA 5FOTA 2F7SA 3A1WA 3SYKA 4QGHA 2GESA 1M7BA 4AY2A 2C5LA 4JJKA 4BFVA 1JEEA 4EJSC 5C4MA 3IPYA 4RZ3A 5JJKA 1N5KA 2XGJA 3EAQA 4TLCA 1KI6A 4DB2A 1E0AA 1RIFA 4G1UC 3AKDA 4IDHA 1IN7A 1GL9B 1MV5A 2WKPA 3FMFA 4LUCA 2J3EA 4PXAA 3O8BA 2OAP1 1DBSA 2WMOB 3QXXA 4HLCA 3T5DA 3EZ9A 2XB2A 3SHWA 2OAQ1 3B1WA 3KKMA 5C18A 2JLVA 5ANRB 4JVMA 4YQFA 1M6NA 3TQFA 1RFLA 1W49A 1ZVQA 4PPFA 2HLDD 1BMFA 4P4UA 4V0ME 2D7DA 1E4VA 1E0KA 1XJQA 1X8KA 3P1JA 1W7AA 1NN3A 4GOKA 4X8MA 2RB4A 3AVXA 2QAGA 4OHYA 1P3JA 221PA 1II0A 2BWJA 4TQ9A 4OK6A 2P6RA 2VQSA 4PO8A 3O47A 4WA7A 1DAIA 4TL9A 4C3ZA 4YMVA 3UKDA 2EU8A 4LI0A 1U8ZA 1YKSA 3B2EA 1AK2A 2OCAA 1PJRA 4LYFA 2IYQA 2W6JA 3DOFA 3PR1A 5CM8B 2QRNA 3W6PA 2JATA 3LLMA 1HTWA 2GDJA 2WJHA 4OJQA 5CIWA 1ZUNB 3PITA 1ZC4A 4DT1A 1RPZA 2GJKA 3EIHA 3GFPA 4M8NE 4BLOA 5AUNB 3HYRA 1JB1A 4TT3D 1HQYE 1R4AA 4PPNA 1CF4A 1Z63A 1ZU4A 3OHMA 4KITB 3AVYA 1U8AA 5KPDA 1J8MF 3LWNA 2BM0A 1E6CA 1U0JA 1TQDA 1VTKA 3GCGA 5AJVB 3SOPA 1SVIA 3F5FA 2H18A 2EYUA 2F43B 3SS8A 4CEJB 5LPNA 4CZ2A 3U44A 1XTKA 3FFAA 2WJJA 3GQBA 4QJ4A 3K0AA 4TWZA 5CLQA 3ECCA 1PV4A 1KKLA 1E9AA 3H1TA 4OQXA 2BC9A 1X8JA 2GXAA 2N1BA 5EE1A 4PHTA 1VMAA 2OBMA 2OLKA 1KYIA 2ERYA 4PPGA 3QI2A 4BQSA 3K9LA 4RFSA 4BFXA 2RHDA 1JR6A 1Z08A 1G4AE 2WZQA 3KFVA 1FUKA 2QAGC 1VCNA 3KL4A 2DFLA 1E9DA 1KY2A 4B75A 3RSOA 1GAJA 4GOXA 5CYPA 3FB4A 2XTZA 1FX0B 4U7DA 4EPRA 4L8GA 2B7BA 2FJUA 3C16C 2QRZA 4YDSA 1KSGA 2PBRA 3SN6A 5BYKA 2H92A 4H9GA 4W7SA 4B43A 2GCOA 2GJ9A 1HUQA 4GP6A 1JQLB 1KK2A 3QEJA 4MYTA 2ZITA 4S35A 2GRJA 3VR5A 2WMNB 4F4JA 2F55A 2NIPA 3FMOB 2IYVA 4FCWA 5DH9A 4HDOB 3Q5EA 2VHUA 2I4IA 3IPXA 5CIQA 1SQ5A 2IBMA 1NVVQ 4K8OA 2CDNA 2J5XA 3TRFA 2E1RA 1G3QA 2XXAA 2O0JA 2XSZA 4LYJA 1AA9A 2QPAA 1JR3A 2VSXA 4LX0A 2VSOA 2ZYTX 3MWJA 5FUVA 3O8RA 3ICQB 4ZIRA 2O8DB 4MUAA 1E9CA 1VG0B 3Q3JB 4NE2A 1QDEA 4DJTA 2CJWA 4OJKA 5JWHA 1KI3A 3I8SA 1KI2A 1NN0A 1ZM3A 5L3QA 2FGJA 5CJPA 5FTNA 1YVDA 2GF0A 3EG5A 1ZRHA 1GL7A 3EASA 3AVUA 3BRWD 3KX2A 2P6UA 1NI3A 4URXR 1ZC3A 1WA5A 1SGWA 1G7RA 3H2YA 5SZKB 1NJGA 3BFXA 3VNUA 4JLDA 4TLAA 1VCIA 5LBIA 1E9RA 1AGRA 2A30A 1A2BA 2IXFA 3T5GA 4K81B 5HPYB 1Q12A 4YMTA 4GOJA 3T61A 1R8SA 5KNDA 2QORA 1B23P 2BKEA 1DADA 3OZXA 1MRNA 1XEWX 5JFGA 4LV5B 2ZSFA 3AGPA 3RABA 4V0NA 4G5RA 4LYHA 4BFWA 4OYHA 1MO6A 4JL6A 4OHZA 1P61B 4M9ZA 4Q47A 2R9VA 5FPKA 4W5JA 1ZAKA 1N2CE 2BV3A 4PAMA 2B8TA 2FU5C 2WWFA 1NVXQ 4KO8A 1OFHA 1SVOA 4MH0R 3SQWA 2G0NA 4EFLA 3G0HA 3SYNA 1N6PA 2R44A 2OE2A 4CDGA 2CJWB 3TW8B 3K0EA 1OSNA 2AFIE 3RHFA 2WM9B 3AP2A 2DY1A 2RGNA 4WXPA 4ZIRB 1OB2A 4OBEA 4OHVA 2XJ4A 1TF7A 5JEDA 1YU9A 4A8JA 4Q19A 3DL0A 3TUZC 3N2IA 3ZVRA 2ZVPX 1ZMXA 3HP1A 2UZ3A 1AQYA 3R9WA 4P32A 4DSNA 3WYFA 3KXIA 4Z1MD 1NY5A 1A5TA 3F3YA 1GSIA 4DSUA 4LJ8A 3GJ4A 2R62A 3CNNA 2VF8A 5EQTA 1XPOA 2VBCA 1R7RA 2JA1A 3UMSA 2QE7D 3IIMA 3LBIA 4HZUA 1G5PA 2DCUA 2PEZA 2QG6A 3A37A 4WXRA 5FR1A 1U0LA 2ZAOA 4M4SA 2IW3A 2WKQA 5FOVA 1BIFA 3B9QA 3KQUA 5F2EA 2QPTA 4GI7A 3QE0A 1FMJA 5HR5A 1UBEA 3B82A 2O8FA 4I1UA 3KQHA 4P31A 5BXQC 3QF4B 3R8FA 4HLQB 4QBIA 1YZQA 1DO2A 3GLIA 4J0QA 4FN5A 3U3MA 3DKVA 3QOFA 4DCSA 5JI2E 1YZNA 1Q0UA 4L16A 3AVPA 1OXSC 2HDNB 2QGNA 1MO5A 1CJMA 5F9HA 2EFCB 1E98A 1KDPA 2RGNC 3B9PA 5CLLA 5DI3A 5C2JB 1Z0AA 3QVVA 4GMXA 1FP7A 1XFAA 2GWHA 4RKFA 4QFMA 4V02A 2OFXA 3MJHA 1OLOA 2FV8A 3MD0A 1R10A 1RW4A 2O0HA 4ZDJA 1KJZA 4OQNA 1S3GA 3RS2A 3K0CC 4D80A 1XTRA 2V9PA 2FSFA 3BXZA 2VPPA 1IOZA 1OHHD 1VPLA 3ND8A 5LB4A 3WYGA 2W00A 1VYTA 3PIRA 4MGKR 2ONJA 1QHSA 5ELXA 1GTVA 2ZXUA 1AM4D 3NH9A 4ARZA 3JVUA 2L0XA 1SVSA 3QSYA 1TMKA 2CCKA 2X2FA 1SVWA 2H1LA 3A1VA 2ORIA 4GT1A 3MAAC 4IDPA 3BD9A 4XD7D 2AKAB 3D3QA 1TTTA 2G77B 1JNYA 2GJSA 3MRSA 1T4GA 3DO6A 4MGIR 4Q4HB 5IHPA 1E2LA 4MRVA 1HY3A 5KPJA 3CX6A 5FL3A 3W8NA 3I72A 3K8YA 1MT0A 1TADA 3SJZA 2YC4C 1GRNA 2QSYA 2B8WA 5LB2A 4TMZA 1XMJA 4PHHA 1BS1A 1Z2AA 4I1VA 1BOFA 4JL8A 3EX7C 1R6BX 1W44A 5J40A 4PHGA 3MWYW 2P2LA 5H70A 4GDFA 1K5DA 5K8TA 1KZGB 3FWYA 4XJXA 3EPJA 4LPKA 2GK7A 1TL7C 3R8CA 4A8JB 3AKYA 3GJXC 1EX6A 2AK3A 4QG7A 3CNOA 1KHTA 1TAGA 1XB2A 1XTQA 3IUYA 4N0DA 1F48A 2J41A 4PZYA 1OYWA 4FMDF 1LFDB 3AKCA 2GILA 4P0TA 4C0BA 4JLBA 2VHCA 1JALA 1Q1EA 3BGWA 3CR8A 5KDLA 2CVFA 2O8EB 1KO4A 4Q01A 1JPNA 4P3YA 3VHXA 3TGPA 1KMHB 4KFSA 4RCYA 4C4PA 3GLGB 2A5FA 3RLFA 3B60A 4Q4HA 3B5JA 3R7WA 2BCGY 4PC6A 1I4LD 2ZSEA 5JBQA 4XWOA 4BWYA 1U8YA 1W0JA 4OQMA 2IUUA 2JJ2A 5AK0A 4ON9A 2ZS8A 1UKVY 4LHVA 3U7HB 1XD9A 1ZM7A 2ZE8A 2P0EA 4Z54A 2V1XA 5FPYA 1MKYA 1W36C 2ZM5A 3RS4A 4D82A 2ATXA 1KK0A 1G3IA 2D06A 1CJVC 4JLPA 4GZLA 4IEEA 4A2QA 3B1XA 1IONA 3L0PA 2QQ0A 4V0MA 1HE1C 4HB0A 2P67A 1BKDR 3CF0A 2WWGA 5GVSA 4XWAA 2GETA 5JS7A 2XZLA 3LX5A 5DIFA 1Z22A 4Q4AB 2BOVA 2W58A 4LHZA 4KV9A 2A78A 3IIJA 3WNBA 3A8TA 1IN5A 2EWVA 1TF5A 1VDZA 2CBZA 2VLIA 5BYJA 4A6XA 8OHMA 1J7KA 4HI0E 2Q21A 3KXLA 3TKLA 2NZ8A 1W36B 1QVAA 1SXJA 2TMKA 2WKRA 2IK8A 3HR7A 2E87A 4DC9A 1ZD8A 1PVOA 4IDNA 4IKEA 3LA6A 4ACAA 2WAXA 3A1UA 3TVTA 1E2EA 1E2JA 2JEOA 1U99A 1KZ7B 2RGBA 2JLYA 4Q4JB 4IVPA 3ADDA 4DIEA 4L4UA 3ZS8A 1NNEA 4TLBA 4HZUB 1VIAA 5CITA 1NLZA 1KI8A 2ZJ8A 1F2TB 1M34E 4Q02A 3EWSA 2A2ZA 4CYMA 2PCJA 2V8OA 1RE0A 1XRJA 3ADKA 3IHWA 3QIAA 2MSEB 3IILA 1DELA 1VHLA 2VF7A 2J7PA 2Z5FA 4TLDA 1UBGA 1QF9A 1TQ6A 4R71A 3KB1A 2GF9A 5D3MB 1CS4C 3OIYA 4NYIQ 1L4UA 3PCRB 2NO6A 1DG3A 3Q72A 4DUGD 3LBNA 4GL2A 2V54A 4PAOA 2X77A 4PZLA 2VRWA 3EZ6A 3SQXA 2AN9A 4JKIA 3GLHB 1EG7A 4NMMA 3HU2A 4QJ5A 1TEXA 4Q1EA 3FVQA 5EE0A 1EFRA 2BBTA 3F0TA 3M6AA 1E69A 4FWTA 1PLJA 4B3CA 1F5NA 1NP6A 2C9OA 3GLIB 2H17A 5J47A 2WWYA 2JDID 821PA 4NL4H 4B2LA 1R0YA 2Z6VA 3DMNA 1OH8A 4LBYA 3GJ5A 3OESA 2BCJQ 1QHHB 2QENA 3JVVA 4RCZA
chains in the Genus database with same CATH superfamily
4YMSA 4IHQA 3OJEA 4ZYVA 1T91A 2D54A 1ZGCA 1YRBA 5A0TA 2VKTA 1J21A 1FTYA 4LNUB 5FWNA 3GCXA 5K99A 4R9SA 2Q4OA 2ZT7A 2DPYA 2J09A 1C7IA 4P7GA 2Y77A 2V7GA 2ZP1A 5FOXA 5EE5B 3A58B 2IEDA 3IR7A 4YRLA 3TD2A 4RE6A 1YC5A 1G18A 3LD9A 3FZGA 4WZAA 1RPNA 5JSZA 4YRRA 1XEXA 3UW1A 5JT1A 3IQHX 2OC4A 5F52A 2F1JA 2OG2A 2MJLA 2Y8EA 5DZSA 3TBKA 3K9HA 1FP1D 4NJEA 3W79A 4XCXA 1TECE 2NO1A 4W6ZA 2DPGA 3DB2A 3W5SA 2C95A 4HQOA 1WG8A 3LCMA 3SYLA 3SEZA 1SD1A 2JD2A 2XSZD 3BMOA 4JH0A 4PFSA 3HY6A 4AY6A 4MVJE 2W4QA 4TM7A 3VPGA 4R1QA 2XT9A 1NSYA 1PEAA 1E5VA 1OWNA 5E95A 3ZZMA 3F6SA 3O26A 4X1KA 2R68A 3GCWA 3Q11A 1VRCA 2QN1A 1UK7A 4QQKA 5DOVA 5EVJA 2H07A 4BMDA 1ANKA 3KXPA 5GJVC 2M6LA 3MHTA 2Y4NA 3VDQA 4QPNA 4BAZA 4IHJF 2Y2UA 1CUJA 2SECE 3A1DA 4NPHA 3SCZA 1K8YB 2QUHA 1YMVA 3I01M 3P5SA 3PXDA 5K3FB 1Z0KA 1L7QA 1Q11A 4NFLA 4PYLA 5TDHA 3TLZA 3VR2D 3LRXA 1L8AA 4X7PA 3OP1A 3W5IA 3LHIA 3LWBA 3KD2A 3CG0A 1RYHA 2N9UA 2Y71A 3FHJA 4E3WA 4C5BA 3N2LA 4RH3A 3HWX1 2GD2A 1SUBA 2VDJA 1MAAA 1UZUA 1G9SA 1W4RA 2QJTA 2CLHB 1T8RA 2QMQA 4INPA 3LGXA 2EX1A 1YUMA 2DR3A 3F2VA 4H2DA 1Q7BA 2QU7A 5CNKA 5EP1A 3EC1A 3ZHCA 2YOHA 4DM3A 1RCUA 4JDPA 4EYSA 3OOYA 3A4LA 4I55F 3AF4A 3I61A 5D6NA 4GKVA 3LOUA 3TPFA 4MV6A 3WLRA 1VCMA 2AV6A 3TFQA 2BGRA 3IQEA 3PFFA 4JHXA 1WBDA 3OZIA 4BMNA 4Y1GA 1WS6A 4M99A 1CIJA 4DLUA 4X00A 3WYEA 4BU0A 4KBYA 4JENA 4UFNA 4YJ2B 5H02A 4Z2AA 1MBZA 4TXHA 2BI8A 2HPHA 1B6RA 2H5JA 3CZRA 3LHSA 3E82A 4DEYA 4KLNA 4ER7A 2WICA 2OXFA 2PGIA 3WV4A 4EK9A 3ADBA 3ER9A 4F12A 4P3OA 2UXBB 1P80A 3QXCA 1UXOA 3GU3A 4FYYA 5AKJA 3BICA 4CM4A 4DLPA 4QKQA 3KAQA 4FJ0A 3D8SA 2F3SA 4OU4A 2FMUA 3T15A 1O97D 4DZZA 1OH7A 3C5VA 4J6FA 4CKBA 1YR7A 1GNVA 3JQ8B 2PYDA 4TT3A 4BWFB 3F5DA 2D0OB 3E5MA 3CKYA 4O4HA 4F45A 3MPUA 1RAGA 2OV4A 5C46F 2ID4A 4YCAA 3RARA 2OV2A 2I7CA 1UBUS 1IB6A 2R66A 1I24A 4NZPA 1L5QA 4Q4CA 5HF9A 2I1VB 3KUDA 4JUBA 3OP4A 4KPGA 3WMGA 4C2AA 1ZFNA 2RFLA 4NTZA 2CXNA 4GNKA 4CLDA 5BMVB 4KNVA 4WFJA 3L7YA 1FFGA 4WN9A 4Y6LA 5BN5B 3NT4A 5ALUA 4BIIA 4B2YA 1EM8B 1G2QA 2XDWA 5K3AA 5KQMA 5EI5A 1UDWA 4KRXA 4X3PA 1N8NA 4PSCA 5JPDA 4H7PA 5BV7A 2FA9A 2ZDQA 4ZJUA 3S27A 4F3YA 4W9MC 4YJ2F 4OJYA 1SXJB 2I99A 1YZFA 4AJ1A 1J0XO 3BB4A 3E3NA 3Q9LA 3USCS 5EZ6B 3PGLA 2NNLD 3OF3A 5IC4A 1NQVA 4MINA 2NU8A 3Q6NA 5A02A 5C7YA 1RADA 3QQPA 3ZTWA 1KSJA 2AX4A 2EOAA 3K0AB 4LE1A 1LRLA 2ODNA 3LKDA 1V7QA 1Y5RA 1ZOOA 1OR8A 3PKIA 4FFOA 2BM1A 2IGTA 1CRPA 4FPXA 3BH6A 1N6KA 1EFVA 3ED5A 2BI4A 3QY9A 4HAXA 4PS0A 4DLNA 4L4XA 1YJXA 1PTJA 2P90A 1T9ZA 4YGXB 3EUEA 4LRYA 3OIWA 4I14A 1L1RA 2VJMB 1KAGA 2O0LA 1QCCA 3DUFA 4ZAWA 1Y3BE 3C14C 3GJRA 1XMXA 4Q3OA 5AW2A 1HTTA 2G0AA 4HQFA 1UP6A 1NQOA 4HYYA 1KH1A 4I1SA 4XM1A 4E5KA 4H6PA 3NHLA 3KZ1E 3PQDA 4OHXA 1JHOA 4M7RA 4EW1A 3I5YA 1KY5A 1C80A 4Q82A 1Z6YA 4I1RA 3CLSD 4XKJA 1YRAA 2W6IA 4L4YA 4Y9UA 3WR5A 1H9BA 3IAAA 2PMWB 4M0EA 2PA3A 2ZIVB 3VRHA 1ONSA 4KOAA 5KU1A 1WUTA 5H59A 2VP4A 5B7NA 2WD7B 1YDHA 5JCPA 1C3LA 2V7QA 3LECA 4BGEA 1XZQA 1YU6A 5IXJA 3ICPA 1L8OA 4EJ2A 2CB9A 3IFSA 3MHPA 1Y3DE 4GE3A 3EFBA 3ER6A 2IELA 3H1EA 3OCCA 1LLCA 3WMWA 4OGLA 2DZDA 4YO7A 3PLRA 4XJVA 5L51A 4N03A 4R7ZA 1XWFA 2F00A 4KWIA 2IHKA 3CBGA 2HJHA 4OREX 4QQ8A 1IJEA 3DYIA 2FWAA 2Q1UA 5F3DA 2ZIXB 2O8CA 1W8DA 3DS8A 5DNUA 3BFKA 4IJVA 2R2GA 4YQEA 3EQ7A 3IMEA 4ZYLA 3FXAA 1TQ2A 4EMSA 2R0QC 1T2CA 3SZMA 2NPIA 2RIRA 4ABYA 4A15A 3EA5A 3OSZA 3CCBA 3ECSA 3L79A 4NAHA 1WLYA 2PUDA 4OI0A 4IH9A 1MOZA 1D6JA 5LSAA 3IELA 2VLBA 4G0OA 5I9BA 2G9UA 3WGZA 4WQMA 3RIHA 1NNI1 2C7PA 2EKQA 2XPCA 4ZODA 1KOJA 3KOUA 2ZQYA 1BAPA 1G1MA 2YDXA 4WK4B 5DSTA 5FI0B 1RI1A 2WF6A 3A9VA 4J3NA 5KNCA 3UWSA 3ICEA 2O2EA 5HIIA 4KFCA 3QYAA 5EAIA 5I4CA 1YQ9A 2Z95A 5AR1A 3D4IA 4KYUA 3K2EA 3L6DA 3N7TA 3RUFA 4POOA 4CGZA 2E7ZA 1XD2A 3HBMA 3ZG6A 3DLIA 3H18A 4OO3A 1JN0A 5AW6A 4V3BA 4B76A 5JW6A 4JYCA 4QTZA 4X95A 1U7PA 2GVDC 2J32A 3DO8A 4X63A 2B4TO 2RH4A 1U28A 4HDNA 1R27A 1U7WA 2YV1A 4FZ5A 4TL6A 3SFZA 5CA0B 4JVSB 1XTUA 2CHVA 3T7CA 1T8YA 1MG0A 4G0YA 5G0SA 5EJIA 1ZIOA 5ECWA 5ICEA 1L4FA 2XWQA 1WB6A 1F38A 4JYZA 1XYYA 1TQHA 1ZCZA 2D62A 3FAZA 1Z4QA 2EP5A 2ZTHA 4M86A 4ZI2A 1GNPA 1P1IA 2IUTA 4K86A 3I2YX 1L5LA 2FXIA 3ZQ6A 3VNVA 1SMKA 3THWB 5H9VA 3LZDA 2WHPB 3PGJA 2P9JA 1I4WA 3CPJB 3FVWA 3R6GA 3CPSA 5DPMA 4CQNA 1R6VA 3HGQA 1ZKDA 4MJLA 1TUGA 4RELA 5BORA 3I30X 1NM5C 1W1WA 2ZRKA 1GZ5A 4UAUA 3THXB 1EB9A 1YULA 4A6EA 5ICSA 3N75A 4OI4A 3QA3E 5CW2A 1HX7A 5J4KA 1W34A 5K8VA 1NVUQ 5A1JA 5BWOA 4WMLA 3TEMA 3QKRA 4I2VA 4WOKA 1PEDA 1SKYB 3PJRA 1RPJA 2V45A 3JQ9A 2YRXA 4YJHB 1N2CA 3FUTA 3GCDA 5DTEA 4N9WA 4P92A 4YPFA 3TLEA 1UJBA 4R2HA 1ZPDA 4YAJA 1VXRA 1V4VA 2NAFA 1YMQA 3M3PA 3NVDA 4CV2A 1ZZEA 1RWOA 1U0NA 1K6IA 4OEHA 3FSJX 2Q1SA 4I50B 4E08A 2QOEA 3BA6A 3GC6A 2DJIA 3H42B 1C4WA 2ACVA 3TQCA 1GPBA 1IHDA 2IYEA 2JARA 3Q41A 4F6CA 3HSSA 1YMUA 4JKOA 2HGZA 1Z0UA 3GJ8A 1C30B 5F1YA 5B3JA 1H8HD 1IY1A 4ENUA 2A5JA 4NMXB 8ABPA 3HYSA 4U5XA 6NULA 1QG4A 2AL7A 4OHPA 1U0RA 2DBRA 3QWBA 4WLNA 3GJ6A 2E4UA 1BD4A 1X9HA 2VA8A 1PL6A 4O2BB 4F4UA 5HM6A 4Y2RA 1H2RS 3NR2A 2C2KA 4E5SA 1ZSYA 4F97A 1W5FA 5JWRA 4NYIR 4PYNA 1V3UA 4M49A 3W90A 1ECGA 4C87A 1ACLA 1CU1A 3CPEA 3OLXA 2R7LA 3I2IA 4Z9FA 2VEOA 3UCXA 4D9JA 1Z7BA 4E7OA 3L6EA 4ZOEA 1OD6A 3KS9A 2Z6AA 3Q8WA 4I55B 5FFMA 2WEKA 4D1YA 1LDEA 4RANA 4DQVA 1XUOA 2VDWB 4Y2SA 4ZDIA 4PSVA 4RF5A 1TO2E 4ZO4A 1I6KA 3NONA 2AHRA 2O52A 3AB7A 1PI3A 4FKZA 3PCTA 4IUYA 4KSBA 2HBYA 2FHSA 4OQQA 4XDGA 5G3ZA 3T1QA 2BCEA 2EX0A 3AY6A 4ZQCB 4GXTA 2ZRLA 1P72A 3IEVA 1P4HA 2Q3FA 3NHRA 4NCAA 3LT2A 4U6NA 5E7IA 5GAJA 1EXWA 2FVXA 5CDHA 3SZLA 3A6PC 5A05A 1EI9A 2DECA 3UCEA 2GKGA 3HO8A 1QZ3A 1FTQA 2DLNA 1PGNA 1B15A 1X1TA 2CHFA 4HUQB 2VSNA 3BXOA 3C6QA 2ID9A 4BVFA 3RR2A 3AFIA 2CC2A 5B2FA 2RG1A 2ENWA 4PSAA 1O6BA 5DLEA 2BW0A 2EJWA 4MV3A 4NV0A 4D3FA 1RWPA 2ORVA 3A10A 3M6WA 4MPPA 1JHPA 1FP4A 3H9GA 4HEQA 1KE1A 1OLUB 4TMTA 5IU6A 2PJDA 3LBFA 2Z4SA 4FGUA 4D9BA 4L0DA 4WY2A 3FSEA 3T3MB 4D9MA 1SOMA 1FSZA 4X45A 3AWDA 4KUHA 4LYGA 3HYCA 4ZO9A 2B4AA 3G13A 1F1BA 3D0KA 3HVIA 1CQJA 1XFDA 2E5FA 2MWMA 3FBTA 1KTVA 1PS0A 2CUZA 2HYDA 3AH8A 3FYUC 4GOND 2Z09A 5CVEA 3TLKA 5FUBA 2IV7A 1NI4B 3M6IA 1DDGA 3OPQA 4ERXA 9LDTA 4EIWA 4HAZA 5BNTA 3BZBA 5T3YA 1HI9A 5C53B 2GHTA 1QHEA 4C7VA 3K9BA 2GHRA 2JCVA 1BYUA 3FMGA 4NZMA 3DMTC 4CM1A 5JNWA 4U9HS 4JL5A 1JGTA 3MERA 4K6MA 4P36A 1NNSA 1E63A 2RHBA 2Y3IA 4XOUA 3HR4A 3RVBA 2O3TA 4TKZA 1L1QA 1U7HA 2VIIA 2QY9A 3TEFA 1QE3A 1E1CB 4ZOLA 3ROGA 2G5PA 4UHHA 1BCRA 1TU4A 2DQZA 2I9PA 2B0JA 2A0UA 2Q4RA 3O74A 2A84A 4QVGA 4TMXA 3JS5A 5AK5A 5LZ8A 1QHNA 1S9HA 1JJ7A 3AMVA 4WNAA 4XW2A 1BXRA 2ZPTX 4LZJA 5SZHB 1CEXA 5GINE 2VUTA 3DMDA 3ZNOA 2Q4TA 4C0SA 1Z0IA 1XQ9A 4HB2A 5I9SA 1EZ1A 2ETVA 2VAXA 2HQSA 2ZT5A 4XTCS 3O3MB 2F1IA 2ZYRA 4YP0A 2QX7A 4GC9A 2G1JA 1D6MA 3G5LA 1RRPA 1QGAA 2AJCA 2Q5LA 3KV3O 1QYWA 2PBLA 3PUZA 3ETDA 4UCXA 4XLTA 1CK4A 2CVOA 2XJ9A 4NCHA 3ZXXA 1WD5A 1N4DA 3SQNA 4KAJA 4S12A 121PA 3BHMA 4NFYA 4BLRA 3H6KA 1T1JA 1SBNE 4ED9A 3WNQA 4RF3A 3PTAA 2A9KA 2G6BA 3H1BA 2P3OA 3OURA 1T1IA 3PUIA 4GR4A 4NE7A 5EP2A 1IK6A 5HF5A 1E2MA 1JZQA 4R1LA 5EGNA 3KTDA 1OIVA 2PUFA 1QLHA 2JEYA 3M1AA 1RS0A 1NUSA 3CLUD 2PKXA 3PRJA 3T7DA 2QMEA 4BEBA 1E3JA 4BJHB 5B30A 2WHYA 1X7YA 1TX4B 4OKSA 3T0IA 3P45A 4EF6A 3VVCA 4AJEA 1Y1QA 5MN5A 2QTVB 1CR6A 4I4LA 1YZGA 3LT4A 4RJKA 5DHQA 3S2YA 4BO7A 1J9ZA 1EVIA 4NENB 3AIMA 3TZLA 3ZY2A 5TNXA 4KJZA 4JA0A 2VHJA 2HDOA 1K1EA 2C3UA 3IP8A 4W1QA 4H16A 5JCOA 3Q9UA 3ACCA 3W6NA 4AC9A 1WF3A 3NVKI 2Y1OA 1MXHA 2ONCA 5ALLA 1O3YA 1DKRA 3WHLA 2PUCA 1BW9B 1Q44A 1RBMA 2ZRMA 2ZJ2A 4G09A 5AVZA 1N3IA 1KMIY 3PNBA 5IVPA 4P9NA 5HCUA 1AQNA 3FTFA 4F3NA 3GLHE 4RDXA 4E2ZA 1HRKA 5TEWA 4D4KA 1CUGA 4JVNA 2CXUA 4BV9A 4DLRA 4N0EA 3QVJA 3UAVA 3PX3A 4ZOQI 3CONA 4PSKA 3NBYC 5FL7D 4MRRA 2QTAA 1IMOA 3UHPA 3UB4A 4UEKA 4UTNA 4GEGA 1QBKC 2R86A 3RRNA 5LIRA 1NF2A 3INYA 1AGPA 2FPIA 5H3HA 5BN4B 1F8XA 5HS6A 3WZ2A 6LDHA 4DR6B 1X0XA 1QK4A 1XTBA 3MS7A 1E2HA 1JEYB 1E96A 1UZLA 2W2LA 4MVJP 2QMUA 2DETA 2FW6A 2PT9A 3PQ6A 2Y0BA 3PJGA 2QN2A 1D04A 1FMLA 1W0KD 3JARB 3WL3A 3L7OA 4B4OA 1DX6A 1WMDA 3P4XA 4I2NA 5E9JA 4BBAA 3R3YA 4ZZ0A 5HIKA 3DT9A 5K6AA 3FW1A 5FBVB 3FJ1A 4GVPA 5GONF 3CRRA 4CEHA 2HA3A 2EJCA 1NJ5A 3A28A 4RABA 3GD5A 4HDCA 4NMHA 2J9ZB 4YP9A 4UUBA 2AR9A 2XNDD 3IQWA 2ZRPA 3BSWA 1D2EA 1HDCA 3GP8A 2D5LA 2X8AA 3C3PA 5CU7A 4YIKA 2AW3A 4UUOA 1ZOSA 2PX0A 4HO1X 1IJBA 3SVZA 5TE9A 3T6KA 3PEVA 5CLIA 3DV0A 3OLCX 4Z4QA 2BR3A 3MGGA 1MT3A 1LJUA 3L46A 1PT8A 1L5ZA 2C04A 2P0YA 3TECE 3PIIA 3ZVKA 1UT5A 2FWPA 3IP3A 4OF4A 1KI1A 4RS3A 3RTBA 5TF0A 4Q05A 3MGCA 1F8FA 1PG2A 1KAOA 2LDXA 3BPSA 1GEEA 3GJTA 4R6XA 4D97A 5JUWA 4JBLA 3OX1A 3FNQA 4OXXA 2QLBA 3L5OA 4MTLA 4RHCA 1E2UA 4TTAA 2Q07A 1EJ6A 3EA0A 4FEAA 1T0UA 4H4EA 4ESOA 1V1MB 3DSRA 3EXAA 4ID9A 5E6RB 3PFWO 3V1NA 4B35A 1HKUA 1Q16A 1SOVA 2HF9A 1CCWA 1W0CA 2HCBA 4P5DA 2O19A 5FOUA 3WK7A 3RC2A 2XCUA 3SVLA 3JYPA 1X92A 4UUNA 1EGAA 4K88A 1KK1A 2F1HA 4YFVA 3ZV7A 1ZI8A 4AJIA 3EDYA 2TYSB 3D0RA 3KQNA 1SH7A 2DPLA 3LFHA 3T7RA 1Y34E 4M9SA 3VAZA 1WMFA 1SXHA 2FSSA 2I7XA 4RKEA 4XR9A 3RVQA 2C5EA 1G21A 2GLTA 5CYOA 1UMBA 2X6RA 2LKDA 3QYJA 5KCMA 1Z75A 3LBYA 1I8TA 1SHJA 1TM1E 2CNWD 2HA5A 2VTEA 3GZJA 1CJBA 3BDAA 4AUKA 4X7BA 2AZ4A 3VSCA 5JSYA 4Z7NB 2K4MA 1TMOA 3CVUA 3W8EA 1S5PA 3RKUA 3U4QB 2OYSA 1J2JA 4WD3A 2I6XA 1LVGA 1C4OA 3GFGA 5AVSA 5AT1A 3WWYA 1NKSA 1XTJA 4RNCA 4UQOA 1U63A 2IYTA 3UT5A 1DC4A 1VCHA 1O95D 1ZG3A 2YIVX 3NWBA 2RJ3A 4CQJA 4L3VA 2I9KA 4JXKA 5AJZA 1TPYA 2A8YA 2NUAB 1P8AA 3RRZA 2O6LA 3WX0A 3A2MA 1JH9A 3NM5A 3WLMA 1SK9A 2B6HA 2GX6A 5CRIA 5DCUA 3QEKA 1N2OA 2P9TA 2V0NA 1ADFA 1R37A 3AF3A 3PENA 4HXGA 4JBNA 1F0KA 1IY2A 1FF9A 4WECA 3LDHA 4TYQA 3WFIA 3U7RA 2ZANA 4MVJI 5IJ9B 4L50A 4YECA 3HMKA 4G0NA 1EJBA 5A4AA 1I94B 3DE4X 1GG5A 3R3ZA 4NRDA 4EPTA 4D0GA 4M87A 3STXA 4YAKA 3EPLA 3JALB 4I8DA 5HUJA 4PNEA 3K94A 3KWMA 1DZ3A 2C2BA 4OU5A 3T4XA 5JY6A 3H9EO 4WXMA 4BXOA 5AM5A 3DVQX 1YBAA 4I50A 1WL8A 3RUPA 4OI2A 1O2DA 4MUHA 3ZZTA 4BP3A 1NVBA 2P2YA 1L4MA 5CB4F 4B34A 4DIUA 2HXSA 2Z5GA 5FOSA 1Z6TA 5FNVA 1J7JA 2CZQA 1KJNA 1W4CA 2CUTA 1JIXA 1K3TA 4FP9A 4ABTA 4HZGA 1JBKA 2AB0A 1TKCA 1L6RA 2CNDA 5DI3B 2D2FA 4RHEA 3I3SR 2IH5A 3ZVMA 4HWPA 2XUQA 3GGDA 4BLPA 1E4YA 2HI0A 1OBHA 1IIBA 1KHHA 2V6FA 3M6XA 1ZHHA 4MIEA 3GG2A 4LW8A 3HL0A 1J90A 4WCDA 4L27A 4CWAA 3MJEA 1OKKD 3WIDA 4B4UA 2D5IA 3PNLA 1VIVA 3GZNA 5JH7A 4Z2YA 2GBCA 2F3TA 3L05A 2ZAYA 1OWLA 1NL3A 4OKNA 5KC9A 1HLDA 4B83A 5ESRA 4OK3A 2F43A 1T3TA 2OSVA 1LWOA 4E33A 3RIEA 1VBMA 3L3BA 1BOOA 4PWZA 4HH0A 3L8CA 3NBXX 3NDBB 4W5NA 4MV5A 2OV6A 3BVPA 1GG2A 1T6BY 4XD7A 3ZGOA 4CM9A 1JDTA 1IG0A 3V1UA 1CB7A 5KDDA 3W9YA 4B44A 4OMCA 5AI6A 3DV0B 3ZYCA 3PQCA 4HDNB 3AUJB 1C1DA 4J9VA 2XMDA 3H4IA 4EKNB 5CCBA 2MYNA 4DPMA 5JADA 4ZCRA 1AG9A 4DNOA 4M1TA 1T24A 1XN4A 3IJ5A 2RAPA 2XTJA 5IYZF 3KSBC 1H0HA 4X94A 1V0JA 1MNQA 2GLXA 2X40A 5JFOA 3OY7A 4EO7A 4Q66C 2GXQA 1P18A 2PQ6A 4RD2A 4IMJB 5TLSA 1WXEA 1ORRA 3ZLUA 4CNQA 4R8RA 5CB4A 4YR7A 1ZI9A 5EJAA 5A04A 3DEHA 2JZCA 3EFOB 1NIPA 3L7LA 1PBTA 4FBGA 4V0SA 4W63A 4HPXB 5MN6A 1EU1A 4ZJYA 2PVSA 4MVJM 1WZUA 4F56A 1Z8NA 2OBBA 1OX5A 1N2XA 5KS2A 1L4BA 1EWRA 2IUEA 1T25A 1KA9H 1OF1A 1U7ZA 1C1DB 1KDRA 2G4LA 1GTMA 3M5PA 4UU0A 5AKHA 3QVGA 4RZIA 4LXGA 4Z8XA 4JC0A 3CMMA 3T1NA 1W36D 2OUIA 1T1RA 2BM8A 1S4QA 2W4IA 5BQXA 1TU0A 1LS1A 5LR6A 4PX5A 1PIWA 2JFQA 4ZT6A 4LTNA 3C8UA 3LS2A 3ZW7A 4BX2A 5KYNA 1LB1B 2YH2A 4FEEA 2RHOA 4YMUA 3D5TA 4I81A 4DDVA 4UHDA 2Z2YA 3ONDA 1CY0A 2ZJAA 2D59A 3JTMA 4KX5A 4LDRA 3G0GA 3ZDCA 4X64B 1L5FA 1QLWA 2F9FA 3TNFA 1A96A 3GPCA 3HLKA 3MRXA 4MUMA 2C5GA 2IU6A 2ONYA 4YRFA 1NBOA 2RARA 4HXYA 2DUWA 4EHKA 5I7HA 3C43A 3HA5A 4L6AA 5EMHA 1YB1A 3RUCA 1D1PA 3TZHA 1FRQA 1RKBA 2NACA 3P4UA 2NNWB 3HP4A 3OX2A 4US2R 4NF2A 1YHYA 4JA2A 4RY2A 4L74A 4IQGA 3P5BA 1VB3A 5FO1A 2CDCA 2P4EA 4FGWA 4JT2A 2B4RO 3FWPA 4WOJA 3EEBA 3AW8A 4NBRA 3S81A 1V1MA 3UGKA 5AW7A 3FAKA 4X66B 3VO2A 4QSHA 4ILEA 4CF4A 1PZGA 3V7NA 5AW1A 1TFUA 1UXIA 2EKPA 4BNKA 1UKAA 2P2SA 4PZEA 5LQSA 2JFZA 4K3VA 3I8XA 3LOPA 4CMIA 4DBLE 2Q3MA 3DULA 4JUAA 3O8CA 4A10A 1Q91A 1SM4A 3H5AA 1HLPA 3EDRA 1NF8A 3HI4A 5COAA 4ALKA 1IATA 3TGLA 1UMDB 4HX5A 1V5FA 5DHAA 1P6XA 1K2VN 1AZTA 4KACA 4ZRNA 2QRUA 1BNCA 4ISCA 4RFLA 4MP8A 4X92A 4YS6A 2FZ4A 3WYDA 3A0UA 4IVNA 4DJFC 1FTSA 1XEXB 4JYBA 1XF1A 2YN4A 2REQA 2EF1A 2MCFA 2QBYA 4KPUA 1JDPA 4B71A 2BN4A 3B48A 1XLVA 2NXJA 1U6IA 2GFIA 3PUXA 4GF5A 4CM5A 2ODAA 1E79A 4O25A 3WLPA 1Y7LA 4H7JA 4NR0A 2B2XA 1GV1A 3REQB 1Q17A 4MO9A 4WK2B 5B2ZA 4HR7A 3R24A 3OCUA 3E9ZA 4YDHB 1LUAA 5D5QA 1XWIA 3E3LA 1DWQA 1XZPA 3HB7A 4EA6A 1YZUA 2ZJYA 2TS1A 3WXMA 5AM3A 5CVTA 2PS1A 5AKEA 2VF2A 3H04A 3H9CA 3W5UA 4EEXA 1ADCA 4C3UA 2B9EA 2RGAA 3VYUB 3BIJA 3IS3A 3N6RA 4ESVA 3H86A 3PEYA 5DGDA 3R5SA 4HX2A 4QUGA 3OZTA 3O2QB 3PFHA 4BNWA 1XYVA 3TINA 2GYWA 3HA2A 3NMUF 1IEXA 2ZM6B 2VP3A 4IDGA 2X5KO 1OFUX 2HQBA 3DHWC 3DT6A 4EZBA 2F6RA 2H4XA 3UUWA 3AILA 5FFFA 4F5WA 4MB0A 4IR7A 1WPGA 2HLNA 3BXXA 4KIJA 5KWEA 4B3XA 1IXYA 5IAEA 3BAFA 3BTUA 1P1JA 4RD0A 4YH1A 1P5JA 2R1ZA 4QGGA 1M6WA 5JS6A 3F67A 4ZAYA 3CKKA 5LD2B 3IXMA 4IQ0A 1CQZA 2VK8A 2G36A 1TMGE 2XMQA 3NAMA 1EX1A 1YR2A 3BWMA 1WXWA 3CNHA 3E0XA 3OSUA 4JJ8A 3FOAA 3OECA 3WB1A 3WVNA 5A06A 3PRHA 2LW7A 4KN8A 1O5OA 3GN1A 4B3GA 3K4HA 4YMHA 3F78A 3KBOA 4XGQA 5G1NA 4F3CA 4L08A 4NS1A 4FHGA 1EUQA 2HUNA 4K26A 4AWXA 2ZJZA 1V11B 2IYUA 2HIHA 5HQ3A 2BKUA 5FV7A 1N6OA 4FBMA 4U2FA 3PQ4A 4KQMA 3DE6X 1FTWA 1MVLA 2FDCA 1E92A 1SOUA 1KVQA 5G4LA 5L3ZA 1QHXA 2DPHA 5ELMA 2QVCA 5E9QA 5F7XA 1C8LA 2EYQA 2P9EA 3DNMA 4R3UC 4OI1A 3U1TA 2PR2A 3SNHA 4A3SA 3GH3A 4Z8YA 2VR1A 1K75A 2A6PA 2H1SA 3DF9A 2H65A 2UUCB 5CA0A 1NU8A 4K9MA 2DLDA 1Y5LA 2CGEA 1H2XA 1P9NA 5IWAB 2DH6A 1TMYA 2IX3A 4GP7A 1C0LA 2NLOA 2ZATA 4Y6OA 1RVDA 4CW7A 3THYB 1HE2A 2YN2A 3E05A 5TARA 3TB4A 4CKBB 2GZSA 2JK0A 1DIGA 2GD0A 5TQVA 3D6MA 3TRIA 4D9KA 1H4SA 4OGKA 2CLEB 3FWZA 1WD7A 1K6JA 1SY7A 2ECPA 3IBFA 2HCFA 3MQFA 2XYPA 1FUIA 3I2FA 2VK4A 3OE7A 2W2TA 2ZYVX 4D4IA 2CK3D 3E6AA 4EELA 4F9TA 2BY4A 1VYUA 2YCLA 3MGKA 1WUKS 2FCRA 4B8YA 3EDCA 1KQ3A 3AHIA 1BXKA 4R8LA 5DX8A 1UKEA 2I67A 1NMZA 2ZUCA 3I64A 2GEUA 3VC2A 4Y6RA 5KOIA 1F2UA 2QE7A 3DBIA 1UMKA 5I7WA 4B3RB 4NBTA 3JQ9C 2AG1A 2E21A 4LV6A 1SVMA 2Q3EA 4JD5A 4I5EA 2ADFA 3G2JA 4RSHA 3V8VA 4QDKA 3OTGA 3OCWA 2PWYA 5ALVA 1ZSVA 2JLBA 3FNEA 1ZW6A 1DBPA 4BB5A 4FOLA 1HORA 1LPPA 4CMGA 3ZXUB 3GG9A 4KLRA 4YYEA 1JI3A 1SBQA 5EKTA 1W35A 2W6NA 4HWTA 5BW6B 4ASUD 4D4HA 1O97C 3X1JA 4BMPB 1CUXA 2QT0A 2JGDA 2QD1A 3K92A 4CF5A 1JIJA 2I7DA 3RVDA 2CXRA 2OV3A 2I6UA 2CNNA 3FUUA 1UIMA 4FR2A 2YINC 5B1SA 2YZ2A 1WY5A 1Y7HA 4HAYA 4BO2A 3R9XA 5KHAA 2WMDA 3LC2O 5L3VA 3OI7A 4XB6B 3LGSA 3G88A 3WDLA 2YMQA 3I83A 3IKLA 5M3BA 3N7AA 1KXJA 2O06A 1DO0A 4EENA 4I4TF 1SC6A 3JAWB 1H2BA 4EYGA 3SEQA 1ZINA 1SKQA 3AGQA 4XPIB 1XRRA 2VDKB 2GN4A 2DG2A 4YR9A 3HUEA 3WGYA 3RVPA 3ZE2B 1PJ2A 1IPEA 4LRQA 2XVMA 1G60A 1KGDA 4YALA 3GEPA 4N8EA 3RK4A 5HSGA 1JQ5A 2EGUA 1SOWA 2A57A 3I2KA 2XHEA 3LPNA 3QKSA 5K8LA 1QQ7A 1HG1A 4CLRA 5DX1A 2P65A 5AWFC 1L5YA 1S2NA 1KRWA 4X8OA 5I7SA 2V6IA 1Y6RA 3HWSA 2L19A 5AM2A 3FRIA 1YR9A 1QTIA 2WJPA 2NVWA 4MIYA 1JFLA 5CDGA 5KIAA 3F73A 1XNRB 1E1YA 3W1EA 2ORWA 4WZAB 5HM8A 2XMSA 1SHKA 3I12A 4QYTA 3KLBA 5KNBA 2GVZC 2IYWA 4HPJB 4IRMA 1I4DD 4L5BA 3GARA 3ODGA 4TTPA 4CL0A 3HC7A 4PXSA 4UM5A 3H87A 3ND7A 5JS1A 4J7UA 4QZVA 5EA2A 1SUIA 4YRAA 4DE5A 1IULA 2R5FA 3GEBA 3MQ4A 2R1TA 1CIPA 2FPGB 3KO8A 4X65B 3ER8A 4CDNA 4ENSA 2NO7A 3RYFA 4AP9A 3MC1A 4KIGA 5A5FA 1NLYA 4MQEB 1Z17A 2QNIA 3M33A 3OU7A 5DBFA 3UMVA 3WA7A 2XBMA 3GGPA 2RH8A 1OXUA 5FWXA 3AFHA 5C52B 1GKYA 2IIBA 1SXQA 1IRXA 4YHBA 5A5EA 2JGJA 3DL7A 3ZJTA 2ASEA 1ZBQA 4PAGA 2NU6B 3UJ8A 5BPFA 1INLA 1Z7YA 3TF5A 3ZWVA 4V0KA 1RE1A 4NCJA 3HZRA 4TRNA 3TX2A 3TOXA 5C8DA 4YC7A 5MFZA 4BASA 1PSDA 2FF7A 4H6VA 5CYFA 2AOWA 4X90A 5T5QA 1XYGA 1MAWA 3HU3A 3G0IA 4HPWA 4Q03A 3RRBA 4B46A 1A1VA 4HRAA 1BA2A 1ZNYA 1E99A 1XJWA 4J0DA 1L3CA 4ZANA 1TA9A 3T06B 1D4AA 2J0SA 2C4UA 2QT9A 2AN1A 2D1SA 2IYOA 2HA4A 3SF8B 1E61A 1NJ2A 4J91A 4L95C 4O0MA 5K3DA 4C3VA 5KWJA 1EP9A 2D00A 1YASA 3GLRA 1LD3A 3EIFA 5TQ2A 3LKZA 2X9QA 3D31A 4IX9A 2OB1A 1Y4AE 1AQ6A 3AYXB 3FBGA 5H1YA 5KJCA 5C80A 2YRWA 3RDPA 1KFBB 4BRZA 4CG3A 4F8JA 4LSGA 1UKZA 4WNYA 5CH5A 3CVWA 5AH0A 3DVSX 1NYQA 3TZBA 1XP8A 4MI9A 2B5OA 2BP7B 3KTAA 3AF2A 3CC8A 4HWSA 4TYYA 2CN1A 3D6HA 1GU1A 3OLWA 3ZC3A 5LNK1 2XXJA 2RBGA 3L8FA 1GZ3A 1KH2A 2IODA 5I51A 3V9PA 5CAEA 4I8XA 5DASA 2A5GA 2GFQA 1YB7A 2JVJA 2R85A 3PIDA 5KYYB 1H6DA 2Q5FA 4DLTA 1JLHA 1RABA 1N9GA 3OBIA 4XUCA 4X8HA 4DHWA 4HQLA 4KIUA 1WCXA 3H84A 3WS7A 2FEXA 2JFYA 3BXHA 1R50A 3KPJA 3O4FA 2MT9A 4HGRA 5CFQA 5IVHA 5AI5A 2IH2A 1XTVA 3CM0A 4GVLA 2IKQA 1FFWA 3FTQA 1JVBA 2CVZA 4QXQA 5A9TA 3ZWAA 5MF6A 3FYTA 1L7BA 3AI7A 1JDBC 2PXCA 3V2HA 1XX6A 3J80A 3CSDA 4XM2A 2MSNA 5EUBA 3RVSA 4FMPA 3QH4A 1NBMD 3Q7RA 5CTAA 5JASA 1S1MA 4S1NA 2ZUVA 3T0FA 3O4HA 4RTPA 4J0JA 4DV5B 2ZWMA 5C8XA 5IXYA 4WBNF 1QPZA 1U8UA 2EW1A 1XRSB 4PQRA 1OB5A 1KDTA 5BSRA 4BP1A 5CH8A 2V3VA 5FR2A 4ND5A 4XYLA 3CG4A 2R4UA 4KYVA 4G5HA 5NULA 2EF0A 4EB6B 5DYNA 3FDFA 2B94A 2ANCA 3FH0A 3D1JA 3CH5A 3F8TA 3IC5A 4M1OA 3IIIA 2Y1XA 4NYMQ 4C06A 1FYFA 1QO7A 3N2EA 4GX1A 1YH3A 4N0QA 5FUQA 3AU9A 4IIXA 2HA6A 4P4TA 4CMKA 1L6IA 3PC6A 2G4VA 2P68A 3H13A 3ZGLA 3TNLA 4JZKA 3HCOA 2B1RA 3HJTA 3D3WB 1BX1A 2G6TA 3ZHTA 3D1VA 3W9BA 1YVUA 2BM9A 5ALTA 2GASA 1YQTA 5ARBA 3LIIA 1F8YA 2Y27A 4INOA 2X41A 3LQFA 4V0OA 4OH1A 4RENA 3ZIDA 4EAQA 1JG1A 4GS5A 4V0LA 5ENZA 3SZ3A 5ALPA 1KPGA 3UGTA 1R9GA 3H2JA 3KVOA 3U49A 2R11A 4LHXA 4LK2A 2WPDD 5J4YA 4XIJA 3USZA 4DQXA 4P3XA 1IVYA 2HADA 3K09A 2IXGA 4JITA 2GXSA 4TV8F 3VGJA 1JJVA 1NP3A 4WK6A 2G82A 5KWSA 1XJCA 1DFIA 1JFSA 1V8FA 5KTTA 2V7EA 5TJHA 2PX3A 3DVRX 1KKMA 3L7NA 4ZAVA 3K9FC 1N3BA 1NAIA 2YVLA 3DMHA 2QXUA 3FF1A 4PEVA 3ZE7A 3U5ZB 6AT1A 5IM5A 3MXOA 1XNHA 3FI0A 3P9SA 2O1XA 2NXWA 5JDCC 3JQCA 1MPXA 2XYGA 3BXGA 2WF9A 3FGOA 5IPFA 1WXFA 2EP8A 2HL6A 3BSYA 3TD9A 3V8MA 3CKLA 2NGRA 3RAGA 1Y8RB 2DHDA 3EA4A 3MAGA 3H2HA 4OVKA 2FX2A 3BSFA