1KZGB

Dbscdc42(y889f)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
total genus 63
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kzgB00
2VTKA 3BB3A 2WIAA 3RRZA 3NHBA 2BJWA 2ZM5A 1NBMA 1QHHA 3FB4A 3W6PA 2ZVPX 3EC2A 1HURA 4DLYA 4ESVA 5EP3A 4EJSA 4LSGA 1E9SA 1UEIA 2OLJA 3WRXC 1T91A 4LWZA 5HZKA 5KSZA 3L0IB 4NCJA 2X2EA 2V55B 1LV7A 2WJGA 2AXPA 4AG5A 2H16A 1KKMA 1FTSA 2X19A 4MKGA 4B3FX 3A1SA 1GVNB 4PAQA 3Q5DA 2Q3MA 2BKUA 5EP1A 3N2IA 4DUGD 3KXLA 4NYMR 3R7WB 4G3XA 1R0ZA 5JMTA 4IDPA 1O3YA 2B7BA 3ADKA 3ONWA 1Q12A 2IBMA 4OHWA 2C9CA 2XITA 4PANA 2BEKA 3CNNA 3WYFA 1OT3A 2ZI3A 3IEUA 1E98A 4MRNA 5FBVB 1R5OA 1W5TA 2F1HA 1G7RA 2R2AA 2ZRMA 4LBYA 4YQFA 1KSFX 4R7ZA 4NYIR 4PZLA 4DZZA 4TL8A 1PUJA 1Z6AA 1NL3A 3FE2A 1S3GA 2NO1A 3EIEA 2QZ4A 2XZPA 2ZRCA 4YMSA 2ZYWX 3IIMA 1P75A 3LD9A 4D80A 3AVTA 4KBGA 1VHLA 4AKIA 2UVQA 1N5LA 3OFNA 4BFSA 2BM0A 1N0WA 4PQRA 3V00A 2FSGA 5GADl 2ODEA 3FMFA 3QG1A 4E07A 4FWTA 4CEJA 2MSCB 4PSAA 1G3RA 2HV8A 1AKYA 2BBOA 1JAHA 1CJTC 2F1JA 1NN1A 2L0XA 1KDTA 3D8BA 4UNQA 1RKBA 2DFTA 5DLQC 3JZMA 4V0OA 1KAOA 1EFRD 2QN6A 4XVUA 2FF7A 3RHFA 3K70B 4I99A 2DFLA 1GRNA 4RFSB 3X1DA 1Z0IA 3QVUA 3TK1A 4TMWA 3UANA 2Q21A 5DN6D 3ASYA 3A4LA 5JI3E 2IS6A 4BLSA 2EQBA 4TLEA 2A5FA 3LRPA 5P21A 3B1XA 1XRJA 2PLFA 4DC9A 2ZS9A 3X1ZA 1L4UA 3T1VA 4LPKA 3SS8A 1DOAA 2MSDB 2GJ9A 2D06A 2DR3A 4RFVA 2AK3A 5DNYB 2ZI4A 1JECA 1UPTA 5TDHA 3E5HA 1LF5A 2FPKA 3FHCB 2R6AA 3ZLJA 2AN9A 2ERYA 1SKYE 2G3YA 1VMAA 1CJUC 1GL7A 1NBMD 4TTRA 1P61B 1MT0A 5JS7A 3C41J 5DYIA 3ICEA 3QVVA 1DARA 3C8UA 2QMOA 2BMDA 3BWDD 4MKFA 2HF8A 4M9ZA 2YJTD 4D0NA 3SYKA 2KBFA 2JJ1D 2OE2A 4PC3A 3SC3A 3V4RA 2SHKA 4ESHA 5CLQA 3T1TA 2CVHA 4KVGA 1E2FA 3HU2A 4BLQA 3GLIA 4XWOA 1IN7A 3E1SA 2EFHB 2EU8A 2WMOB 3N5CA 3QIAA 4F38A 2JATA 1XMIA 1D2MA 2W6JD 2VP0A 3FKQA 1S9HA 3IKJA 1Z0KA 3GFOA 3FGNA 4BFWA 2YZ2A 1AS0A 1W2GA 4TYQA 3THYB 1M7BA 2Z5FA 1BOFA 2NTYC 3F8TA 1VECA 2KSQA 1OXUA 2F9LA 4CRWB 1A2KC 1ZAKA 1FX0A 2OO7A 3JVVA 1KOFA 3NVAA 1I4DD 1WF3A 2OBMA 3OF5A 4DCVA 1DADA 1CIPA 2Q0HA 4F4IA 3K9NA 1GNPA 1U8AA 2WKRA 5C2JB 4LC0A 3VNVA 5JJKA 3TR5A 1NY5A 3QXXA 4D0GA 1ZU5A 5KDOA 2ZI6A 3AH8A 1KO5A 4PC7A 3BOSA 4QL3A 1A5TA 1W44A 2XEXA 5AUPB 1J8MF 4M0LA 4XVRA 4IXMA 5A4JA 4DEYA 1P72A 1RYHA 4XWAA 5FBLB 4M1SA 3EPLA 1J90A 1EFTA 4FMCB 2WJHA 1OV4A 1QG2A 4L15A 4Q9IA 2W2TA 1CJKC 1SGWA 2W2VA 4XVQA 1GFIA 2H1LA 4FMDF 1LVGA 4HUQB 2GETA 2KI5A 5DO9A 3PUXA 4XTCS 2YOFA 4KBFA 2QENA 1US8A 2IWRA 4YLGA 1NJGA 1F2UA 5FI1B 2OFWA 1NKSA 2ZE8A 4MGIR 4TZ0A 4A2PA 1OB5A 2GZDA 2OAQ1 3T15A 3TIFA 4ARZB 3ZVNA 4QOSA 4C7OB 2FZ4A 1JR3E 1E1QD 3Q5EA 4J0QA 4KHZA 5FOWA 4D81A 5JECA 3B1ZA 2IYSA 1X1RA 1CR1A 3IBGA 1KI3A 3K09A 2JGNA 4L16A 5LPNA 5FBQB 1Z8FA 4TZ6A 1XXHA 1UBGA 4GFDA 1QG4A 2CMKA 4Q1CA 2WOOA 3MRSA 5JSZB 1E2GA 4C2TA 5CB6A 5KSOA 3PIRA 4LX0A 2D3WA 1OH6A 2QAJA 5FUYA 1IY2A 4US1R 2XOKD 3CR8A 3IO3A 1U9IC 4WAUA 1QHNA 1Z2CA 3JZAA 1JPJA 2RH5A 5E7JA 4B71A 3X1WA 5J40A 4Q9JA 1U99A 1Z6TA 4D4MA 4DDVA 3L0OA 2NO7A 4Q00A 5BN4A 4DEXA 5H8WA 5JCZA 3NIBA 3A58B 3TQCA 3IUYA 3OEEA 5AR1A 2VP9A 3PEUA 4FXPA 3AVVA 4BPBA 4MRVA 1KSJA 4ON9A 1OFHA 1UKEA 4CT4B 3QXCA 2B8WA 2Z4RA 3IEVA 5FTMA 2ZI7A 3S1AB 3GLGB 1GNRA 3K9GA 4MYTA 1S0UA 1Z0DA 3AP3A 2IYVA 2FFAA 3GLHB 3KB1A 4KFSA 5JBQA 2JLXA 5ANRB 2ZE5A 4TQ9A 2DB3A 1IN6A 1O87A 1TU4A 1HT2E 1GIAA 1OE0A 4P32A 4IFBA 1CRPA 1VYUA 3KFXA 4DCUA 1CJMA 4CVNA 3ZD6A 2YHSA 1N6RA 2ZSEA 3EA5A 2H57A 4Q02A 2OLKA 1W5SA 1KDRA 1IXSB 1NLFA 1Q44A 1UFQA 2Q9BA 4TQAA 2EVWX 3SHFA 4CGZA 1XD2A 3GJ5A 5FPYA 2QMHA 3I61A 1W36C 3GD7A 5FPTA 2O0KA 1YRBA 3UATA 5L3VA 2WMNB 1AQUA 3TAHA 1R4AA 1ZD8A 3GFTA 1GKIA 4FMDB 4XSHA 5B57C 5AWFC 4D25A 1SQ5A 1HT1E 1CULC 2FSFA 5J4VA 3WHKA 3R20A 1BS1A 3IO5A 1WB9A 2FH5B 1RRCA 2VRWA 5EJEA 3B6EA 2WJIA 3LA6A 2ZJ5A 1L4YA 2W0MA 1S9DA 4QC2A 1OIVA 2IC5A 1ZIPA 3KKNA 4BE7B 4TMVA 3IHLA 2RB4A 3AUXA 1IN4A 3BK7A 4LYAA 1P9RA 3AGPA 1COWD 1JAIA 2YVUA 2A5GA 3FVQA 4OK6A 4JLBA 1UADA 5EUMA 1R7RA 4Q03A 3OHMA 3GLFA 2ZU6A 1AZSC 2WTUA 2JLUA 4AYTA 2XNSA 4A82A 1OXXK 1PLKA 5K8TA 3CO5A 4NYIQ 4D26A 2WWWA 2PEZA 3C4JA 4JLOA 1E0SA 1ZNWA 2ZEJA 4DRZA 5BN5A 5JS8A 4CEIB 2B6HA 2WSMA 4PAOA 3KTAA 5FR1A 5JWHA 3W9YA 1E1RA 4JVSB 4MGYR 3ZIAA 5EE3A 3A6PC 2IEYA 1QZXA 3VMFA 1VHTA 5HTKA 2Q3FA 4M1WA 1IN8A 2XNDD 1T6NA 4M9XA 4NU0A 1NVWQ 2VF7A 2ZSDA 4DLUA 3W3AA 1CTQA 4M53A 4V02A 3ZYCA 3W90A 2QRNA 3AF1A 2PX3A 3BB1A 1NLYA 3QENA 3TH5A 3Q72A 2ODWA 4RD3A 5FTKA 3GLIB 1S8FA 3T1OA 1Z6YA 1S1MA 1XEFA 4EPRA 3HU3A 3L0SA 3PFIA 1QDEA 4I1UA 3JVUA 3O8CA 2QTHA 3MUFA 3QKRA 1S2MA 2YOHA 4RD2A 4A2WA 3ZZTA 4BZQA 4AI6A 4C2UA 1BYUA 1Q3HA 2OG2A 4TMTA 4HATA 2AHOA 4WZBE 4W5WA 4P4SA 3K9HA 3FYHA 3KB2A 1OSNA 3PUZA 5DI3A 4B3CA 4F4CA 1UKVY 2GWHA 1GP2A 2XNDA 4ZIRA 4KSBA 3Q3JB 4FMCF 3K9LA 3ZDQA 2BMEA 4PAMA 2JA1A 2FFBA 1DO2A 4IDNA 2A2ZA 3LQQA 4ITRC 1RE0A 4P3YA 5DISB 1NVXQ 1SKYB 4OHZA 4AKGA 2JLRA 3OIVA 3CRMA 4HB0A 4LJYA 3U44A 3LY5A 1G6HA 4BLOA 4OQXA 1KI2A 1WRBA 1X6VA 4EPYA 1ANKA 2NG1A 4PZYA 4GP6A 1ZMXA 2WM9B 2GNOA 2QSZA 4GRAA 2WSSA 1ZNYA 3GFPA 1ZINA 1LB1B 3WRYC 1COWA 1RJ9B 4GOJA 1W48A 1A2BA 4FCTA 5KUTA 2ZRBA 1XTRA 2QPOA 3CX6A 3NEYA 4XD7A 1XCMA 3BFKA 1XBTA 4JMPA 4JSYA 4BUJA 3RC3A 1NJFA 3CRQA 4HLQB 3QI2A 2CK3A 3DVLA 1T8UA 2DCUA 5D3QA 2ZI9A 2PL3A 3ZIAD 4CEHA 2ZU0C 2GILA 4URVR 1WP9A 1FNNA 3AVUA 4DB2A 1XWIA 2QA5A 2ZJYA 2QRZA 3GCGA 3W8NA 1X1SA 2O5VA 1XXHB 4Q66C 1ZVQA 1XMJA 4BLPA 4PXAA 2ZJAA 3R9XA 4G0NA 1TQ4A 5FL7A 1OIXA 3OZXA 2ZANA 2J0VA 1S4QA 2NZJA 2RGBA 3SHWA 4JYBA 2WAYA 3IQWA 4QRHA 4TMXA 2ZSBA 4YXWD 1TEXA 5KPJA 1R6BX 1C1YA 5FPSA 2GCNA 3GEIA 3AVWA 1NN3A 1VTKA 2JEOA 3AKDA 4L4UA 2ZUDA 4Q4JA 4Z1MD 4ASUD 4LJ8A 5FPHA 2GEDA 2WZQA 3A1VA 4RKFA 4TYWA 3THWA 4LJ9A 3TR0A 2QI9C 3AUYA 1UBCA 4Q4HB 2VIIA 1AGPA 2A5YB 4JLDA 1N6KA 3IBYA 1GWNA 1H8HA 2GVDC 1SZPA 4AY2A 1KKLA 1Q0UA 4EPXA 3BE4A 1T0HB 5CM9C 1VIYA 2WWIA 5M04A 3GJ0A 4Q1EA 5JJIA 5EZ6B 4DCNA 2EW1A 3TW4A 4G1UC 5TV2A 5GVSA 1TUEA 3RRYA 1VIAA 4HDOB 2ANCA 2FDCA 5CIQA 4BFTA 1N6LA 4LBZA 4Q4JB 4E22A 1M7GA 4DSOA 3EZFA 5KSYA 2QORA 1R0WA 1CKEA 4JLAA 4HAXA 1KO7A 3M1IA 3R8CA 1XJCA 1TF7A 2GXSA 1NIJA 2BCJQ 2KBEA 3LBHA 2R62A 3UIEA 4Q9LA 4B3BA 3KQLA 3QEOA 4I1VA 4TLBA 2CXXA 2F1IA 1OB2A 3RWMB 3NH9A 521PA 4PC6A 2GK7A 1ZC4A 2VHTA 4NBSA 3WYAA 2QEQA 1TPZA 5CK4A 2QMEA 3QSYA 3P32A 1XFAA 1IM2A 2DFKB 2OBNA 1QHIA 3CWQA 5IK2D 4QHSA 1R10A 1VYVA 2O8BA 4CYMA 3C7KA 2V8OA 3P26A 1E9BA 1LFDB 2VEDA 1QRAA 2C04A 4OBEA 4K81B 1OW3B 1K5DA 4P31A 1W36D 4V0NA 4KLNA 1IJFA 1FUKA 2JCSA 2GESA 4GT1A 4N0EA 2C9OA 1NSTA 1W0KD 1FFHA 1D2EA 2FU5C 2PCLA 1OPXA 2ZRJA 3FKSA 2YWGA 1OHHD 3BORA 4B34A 2XSZA 3VKGA 2RGDA 4JLMA 1F2TA 2CL0X 3EA0A 5FTJA 5DH9A 2P6UA 2JLQA 3KQUA 1CU1A 2J5XA 1SXJA 2CL7X 2IS4A 5J4YA 2QBYA 4C30A 5DI3B 5EXSA 3IQXA 3WP1B 1N6PA 4DDUA 3SJBA 2N42A 1E94E 2AR7A 2C77A 1YVDA 1E2QA 3EPJA 4EFMA 2XJ9A 2R44A 1XJ0A 1KK0A 1G21E 2J46A 4DXAA 1YZGA 1HEIA 3RS4A 2BOVA 3F0TA 4CT5A 2R6DA 3BAFA 5HR5A 4C0LA 1G291 3TLXA 1TQ6A 5F3WB 3MMPA 2FSIA 3UXMA 4B35A 1UBFA 2DYKA 3SR0A 4WXRA 3ND9A 4Q1BA 5GJBA 3AGQA 3NG1A 5AK0A 5KTYA 3PEVA 1U0JA 4WBSA 5BWMA 3FDIA 2ECKA 3WXMA 2ONKA 4A9AA 1D9XA 2VF8A 1WDTA 2VQSA 4JS0A 3BH0A 4PPNA 3QF4A 3NHAA 2REOA 1W47A 3MGCA 1X3SA 2AL7A 1ESMA 1KI4A 4PX9A 4IJMA 3PEYA 1H8EA 1Z83A 2HXSA 3IIJA 3U44B 2ASEA 1NI3A 4Q7MB 2QTFA 3T5GA 3CNLA 4JVMA 1KO1A 221PA 1IAQA 2XJ4A 3OAAD 2E87A 2V7QD 3CX7A 1T3HA 2NPIA 4B2IA 3THXA 2CE2X 2O0JA 2IUUA 3OE7A 1JEDA 4Z1MA 1Z07A 2FWRA 2PZEA 4D4LA 2VP6A 2W2XA 5K8IA 2QL6A 1Z0AA 4WA7A 1KJWA 5AJXA 4GP7A 4B3GA 1YR6A 2BHRA 3H4MA 4C0BA 3GJXC 1CLUA 1ZYUA 4AYWA 2BKEA 3CRVA 3SQWA 1RZ3A 4LBWA 3SE0A 4YMWA 4LUCA 1E6CA 4L5BA 3CF6R 1S1CA 2P5TB 4DWJA 1XJQA 4OJQA 3K0EA 1Z5ZA 5CITA 3GLHA 4EFNA 1KDOA 2AFHE 3I73A 3M4YA 2O8FB 3NKVA 2FJUA 3B85A 2CHQA 3KKQA 2H17A 3NBFA 2AXNA 4OQFA 4Q5IA 2WPDA 2JLVA 4AC9A 1W46A 1DAMA 2CLDX 3U3MA 4QFMA 5E4FA 2GHIA 1LNZA 4A92A 3KZ1E 1G64A 2FA9A 2IUTA 4D4JA 1MR3F 5FTLA 5CYOA 1NN5A 2LKCA 2IXEA 2OCBA 2TMKA 5KNCA 3A36A 4KVAA 4NP6A 2JIZD 3AVPA 2EFGA 1ZUNB 2VP5A 4K8OA 1JXOA 2WVJA 1YZNA 3AVQA 4LYFA 4Z8YA 1G3IA 5EXPA 3FMPB 1UKZA 5SZIA 1OYYA 2DHRA 2A7QA 5JWRA 2C96A 2F9MA 4IRUB 4DDTA 3KDSE 4JKYA 1Q21A 5G3ZA 4QJ5A 3SNHA 1G7TA 3RSLA 3LXRA 1DBSA 5GJVC 1M6NA 2IF0A 2QT0A 1ZM4A 4U02A 5BQ5A 2HYIC 5BXQC 2FZLA 4M1KA 5TMPA 1SVOA 3GLHE 3T61A 1R2QA 2W6ID 2QGZA 1II9A 1G8FA 3LVQE 2F3RA 1TADA 3M6AA 4Q4AA 1Z06A 4KO8A 1PVOA 5KU1A 3BJIC 1J8YF 3KUCA 3K0FA 3U3OA 1KK3A 2F3TA 3NBXX 3EZ6A 1JEEA 2AFIE 3IGFA 2OAP1 2RHDA 1D8TA 3PITA 2YKGA 3TVTA 1IY0A 2OZEA 2CEAA 2ZYUX 1UF9A 2CNWD 4D4KA 4KLZA 2BC9A 4PPFA 5GJWC 5H1YA 4B3DA 2JLSA 2I4IA 2WJVA 4GMDA 2AWNA 3EXAA 1SHKA 3KX2A 4BFYA 3HWSA 2ZE7A 4B6FA 4Y0AA 2N1BA 1SVMA 2IS2A 2O8BB 2W6IA 2ZR9A 1KY3A 1MO4A 4FWIB 4S2EA 1PZNA 1SXJB 1UEJA 4U5XA 1E0KA 1SHZA 4PR0A 3BERA 1KNQA 2Q9CA 4V0MA 3PR1A 4ILEA 4GZMA 3C5CA 3V4FA 1SVIA 3QKSB 2WWYA 4RY2A 3CB4A 3QJYA 1ZUIA 1WBDA 3LV8A 1E4VA 5EQTA 1HYQA 4EUNA 5L3SB 4XWKA 2WICA 1NY6A 3H86A 3VR3A 2GTPA 2A9KA 2RKOA 5C4GB 3RDPA 4LY6A 4EQ6B 2IYLD 4HZIA 3G0HA 1EESA 1OH7A 3NWJA 4WZ6A 2ZS7A 1XF9A 1L2TA 2JLWA 4KCGA 3WHLA 4UKDA 1QHGA 1YE8A 1Z3IX 1MO3A 3QXSA 4A4DA 5TY0A 4N1AA 1XTKA 3RNLA 3GMTA 4NCHA 2ZRHA 4HEJA 4GZLA 5LD2C 1US8B 1LF0A 4BEBA 4MRRA 5HKKA 1AN0A 3EZ2A 1DE0A 3F5FA 4D2IA 4QJ4A 3RAPR 1FQJA 4JL6A 4HLUA 2VYFA 1OHHA 2D2EA 4DT1A 3CZQA 4JLVA 1JBKA 1E2NA 2VA8A 4MUAA 4NKRA 1IXRC 4ZI3A 2IYZA 1TEVA 3FTQA 4OI1A 3FHOA 3MFYA 4NPHA 1IJEA 2O52A 3B13B 1MV5A 4OI2A 4M8NE 5HCIA 5CYPA 4C4PA 1RPZA 4HB4A 1OKKA 4TL9A 1U81A 3UMFA 3GQBA 5KDDA 5JJLA 3CPEA 3OEHD 3N2EA 1T5IA 1IXZA 2JJ1A 3U7FB 3THXB 4NYMQ 1TQDA 4HUQA 1ZD1A 2D62A 1NNEA 1CRQA 1OFTA 1ZM3A 4G01B 3FMOB 4MYHA 2C78A 4HI0E 2ATVA 1LS1A 3HR8A 5AJVB 5FFMA 1N2CE 3EW9A 1XEWY 1G8GA 4QXAA 1E3MA 2KB0A 3Q9LA 4GSYA 3TAUA 3PUVA 1XCGB 5EXTA 4CF7A 1HV8A 3BFXA 1UAAA 1MABB 3L0PA 5FR2A 2ZYTX 3PUYA 3QKTA 4CZ2A 1XP8A 1NMZA 1AK2A 1GKYA 1QHXA 3I72A 4TL6A 2OXRA 1XD2B 2IX3A 4RVCA 4WZAE 2HEIA 1WXQA 4A15A 4ZKDA 2ZR7A 4FCVA 1DVRA 4KYUA 5L3RA 3RRMA 2GZHA 4I4LA 4MDFA 2JDID 2G83A 3ZGXA 5HKKD 5TARA 5CDFA 2VHUA 3A1WA 3L82B 4HAWA 2A5DA 2ZRIA 3DOFA 2W00A 3O8DA 3A4NA 3EX7C 1N5KA 2R8RA 1G17A 4A0GA 1DAGA 2P5SA 5CJPA 1ZM7A 2QPTA 3UG6A 5B58C 1Z0FA 1G16A 4C9BA 3G5UA 1BYIA 4G5SA 2IS1A 3RRNA 4DLSA 1EWQA 5AJZA 4IVQA 3L8YA 4N0DA 1PJRA 2ZRGA 3D7MA 5EE0A 2UKDA 2QAGB 1E9CA 4OQMA 5CLLA 4XOIA 3M0EA 4HAYA 2GJ8A 3GJ7A 5FBRB 1NG9A 2ZTSA 2ONJA 4QGGA 1UDXA 1ESNA 3U4QA 3QY0A 4C0QC 2REXB 4LV6A 2XXAB 2NMVA 1NMYA 4B32A 3KXKA 1E9RA 5K8UA 4TYNA 2DBYA 3Q7QA 4H1VA 3DHWC 1TF5A 3SJAA 3ZJYA 2C95A 1K6MA 2OSBA 2GF9A 1XPRA 3KKPA 2PEYA 3LLMA 2BVNA 2BBTA 4DHEA 4B73A 4O2LA 3B5JA 3DZ8A 2WV9A 3AP2A 3CW2A 1QVAA 3PV0A 4MRSA 4TT3A 2J0SA 4Z54A 1NVVR 4V0ME 5AUQA 3SI7A 2W83A 5JI2E 2NZ8A 4OQNA 1KIMA 3MWKA 5KPDA 1XTIA 2WPDD 4OHVA 1XZPA 4M21A 4Q7LA 4EPWA 3K0FB 1ZM2A 3QUSA 2CVFA 1E99A 1R0YA 4ABYA 2GK6A 4DLWA 3F3YA 1J99A 3K0CC 4CEIA 5DHFA 3H84A 5J4HA 1U98A 4LJ4A 2ZROA 1KI9A 1Q22A 3KJHA 4JLJA 1G3UA 4NL4H 3RS7A 3TSZA 2PMKA 2VH5R 4NE2A 4QHTA 1E2PA 1MKYA 4S35A 4G5GA 4IXNA 2GEVA 4Q21A 4Q47A 1TUIA 5K8LA 4BASA 2R6GA 4JJZA 4GNKA 3VKWA 2O8DA 1H65A 2IYRA 3C15C 2J0UB 3K0SA 2OCPA 3OESA 2BMJA 2P67A 3W8RA 2JDIA 1MO6A 5CB8A 2REBA 3L2OB 3CPJB 5AJYA 2NO9A 2XSZD 4M1MA 2BBSA 5F98A 2W6JA 1M7HA 2NIPA 2CCGA 3U5ZB 4Q1FA 4MRPA 4EAQA 2QE7D 5EE5B 1P3JA 4ASUA 2VPPA 1UJ2A 5IT5A 1T0JB 4P4SB 4NMMA 3B9PA 3CWZA 4YC7A 3FFAA 4FW9A 1Z08A 2NPFA 3AVYA 2PH1A 4P0TA 3L43A 1XU4A 1G8YA 4UJ3A 2XTZA 3PCRB 4AURA 1VKJA 3LLUA 3QBTA 3RC8A 4OQLA 3PVSA 5E7MA 4W5HA 4DSTA 2BWJA 5C18A 1NLZA 1TL7C 2GDJA 1MABA 1ZUHA 1Q20A 4ZKEA 1M8PA 3BS4A 3CH4B 3LFUA 1VCIA 1OYWA 1GITA 4EQ6A 3CR7A 1E9FA 1M34E 2EWVA 2KJQA 5KHOC 2HT1A 5HPYB 1U8ZA 1X8LA 1XPUA 1DG3A 2X8AA 1YZLA 1E96A 3CM0A 3CX8A 3BH6A 4MYUA 5HE8A 3LBNA 2VP2A 4M1OA 1Z47A 3HU1A 3QF4B 1U0HC 4OJKA 2F6RA 3KQNA 3PJRA 2GJAA 1VG9B 5J47A 4R71A 2ODBA 2NO6A 3IILA 1LTQA 4LJAA 1KK2A 1KZ7B 2C99A 1XZQA 3EASA 3AKCA 2QUZA 3IDQA 1KSGA 2O8EA 2MSEB 2HUPA 4Q7JB 1HQYE 1EFHA 3FFBA 1AKEA 5J5CA 3VX3A 2AKAB 4A0FA 5E7IA 4O25A 2V54A 2MMCA 1FPMA 4JBWA 2GJKA 1A7JA 4D0LB 3AM1A 4B33A 1XDBA 1EX7A 1RYFA 4LJ5A 4GOXA 5KSPA 4MITA 1NRJB 2FFQA 1RJ9A 4GMXA 4RJLA 4A8JB 1G9XA 1R8QA 1C4OA 4KAXA 1HE1C 3VU9B 1XX6A 1XPOA 5CM8B 2K5UA 2YWFA 3DM9B 2WHXA 1RRFA 4AG6A 1DAIA 2GJSA 5J4KA 3KJEA 1U8YA 4OKSA 2A78A 1HY3A 3DPUA 3NXSA 2J9RA 1R5BA 1MRSA 3LAWA 1A82A 4XTRA 2XAUA 1FTNA 3GLFE 1AZTA 2QT1A 3QG5A 2FX3A 1DELA 4HYYA 2ORIA 4UXHA 4PPGA 3EAQA 2FPMA 1N6OA 3K0AB 1QF9A 3RS2A 4ZI2A 4MH0R 2C8VA 3MSXA 4RZXA 4H9GA 4EKDA 3B2EA 1I4TD 1E9EA 3BXZA 4JKIA 4MKHA 1ZU4A 2GVZC 1GSIA 1CF4A 4FD2A 4Q01A 1GOTA 3QOFA 4PSKA 3TBKA 1FZQA 2VBCA 3OIUA 4TLCA 3IIKA 3L8ZA 5UKDA 1JI0A 2JIZA 4F7WA 1YR9A 4NCKA 4JT2A 1HE8B 4IOJA 1RW4A 2IEZA 2RCNA 3GEHA 1KDPA 4JIMA 3I92A 1G19A 1J7KA 1KJYA 1SVKA 1E79A 4GPTA 1I2DA 4KV9A 4CIDA 4U00A 3LXXA 3QPUA 3D3QA 1XNJA 2OILA 3I3SR 4RSGA 1E2EA 1JALA 1N25A 2NGRA 1KO8A 2B21A 4FINA 3U3RA 1KI6A 2ZJOA 1NVUQ 4M1TA 4TMZA 5F9FA 4IKEA 4HZUA 3AQ4A 1XMSA 4D82A 2G0TA 2MMGA 2ZR0A 5JLJA 4LRWA 5LB2A 1ZCBA 4JSTA 4LC1A 5BN3A 3CKLA 3B1YA 4MQBA 2RGNC 4JLPA 2ODNA 2C2HA 4P4UA 1T5LA 4QM6A 1XMVA 2I3BA 4PFSA 3D31A 1XTQA 2DY1A 2Z6VA 4LDJA 2GXUA 4V03A 2BV3A 2G6BA 2OHFA 4XH9B 1E2IA 2CDNA 2B92A 1F60A 2EFCB 1E4YA 1OXVA 2H7VA 2YINC 3BFVA 3KUDA 4KFRA 4UQOA 1G4UR 3C16C 5JWOA 4ZCMA 4C7OA 1Q1ZA 5KNBA 1KI1A 3DDCA 4LHWA 8OHMA 2ZREA 1GAJA 3VHXA 3SJZA 4JZKA 2WKPA 2J7PA 2ZETA 4TTQA 2ZJBA 1T3LA 2XTMA 3BGWA 1SVWA 4BEJA 4C3ZA 3BIFA 3GLGE 4RD4A 4EPVA 2IHBA 1JR6A 3EPKA 1FX0B 2Z83A 5D3MB 1ZBDA 1KO4A 2ZIAA 2IYWA 4F91B 4M2LA 2XOKA 3AKYA 3KJIA 4FCWA 5G53C 1VG8A 3VFDA 3PENA 3HP1A 5BYJA 4EJSB 4KU4A 4BFXA 3UKDA 4NHOA 1E1RD 3U3KA 1KNXA 1BH2A 1JQLB 2PT7A 2V7QA 4FI3C 3FPAA 1E0JA 1NN0A 4BLTA 1ZC3A 4UJ5A 3K53A 2IHYA 3B78A 1FOEB 3LQRA 4BFVA 4UNRA 3R7WA 5FH9A 1UDWA 1KK1A 2GXQA 3A4MA 2DWQA 2YWEA 2FNAA 4EFLA 4QG7A 1EFCA 1FW6A 5AJWA 1X86B 4XD7D 1SKQA 3AVXA 4JL8A 4WW0A 2WOJA 3VAAA 1P2SA 4IVRA 2PLRA 1N0UA 4BZXA 5TXGA 4D6PA 2IYUA 1YHNA 3K1JA 2VP4A 1NF3A 1KI7A 2C9YA 2QNRA 2VLIA 3P27A 3WY9A 4LGMA 5KYKA 2F43A 3LO5A 1JR3A 1WMSA 1YZTA 4NTZA 5E95A 3ZVMA 2IYYA 1G5RA 3THWB 4RFSA 2QP4A 4XIGS 3ADBA 1GL6A 4UNPA 4YDHB 3CPHA 4YONB 4BRWA 1W2HA 5CJ2A 1G5TA 1SULA 4Q18A 3EZ9A 2YOGA 2W58A 4LCBA 1E1QA 1F6BA 1Q1QA 3B8HA 1GKUB 5CIWA 2IXFA 2GAAA 2GF0A 3NDBB 1GTVA 3TGPA 3ND8A 2NOAA 1E2HA 3I5YA 1F48A 1KHTA 3NBZC 1DAHA 2QP3A 3AP1A 3NC1C 3A1TA 3B1WA 4G5QA 3W5JA 4Q48A 5JHHB 4OI4A 2P2LA 4HDCA 1TMKA 1G3QA 3DEFA 1AA9A 2LKDA 1KSHA 2CLCX 1P60A 2DPXA 2H92A 3MLEA 1HTWA 2QAGA 2QSYA 3EWAA 3TKLA 2JJ2A 2IL1A 2X2FA 1Y3AA 3WBJA 1Q3TA 4JLNA 1W0KA 5BYKA 2IYXA 2QY9A 3P4YA 2FEMA 1II0A 2BIFA 3WYGA 1K5GA 1U2RA 2QROA 1ELOA 4AKHA 4HZUB 3GPLA 5C4MA 4DKXA 3SFZA 1EWRA 4CW7A 2EFDB 1Z6GA 2WJYA 3EIHA 1SXJD 2V4ZA 3O8RA 1E9DA 1CBUA 2PT5A 5HE9A 3I4LA 4I1OA 4M1YA 4M9SA 4YMUA 1UBEA 2IXGA 2VHQA 5BW8A 1CEEA 3AEZA 3MWLA 3KXIA 4NH0A 1Z0JA 2P3SA 4A6XA 2VSOA 5EXXA 1G8PA 3ZQJA 2O8FA 2A5JA 2BM1A 3QNUA 5IDVA 4W5JA 4LZZA 5EE9A 3ZS9A 2OESA 3CRRA 1KTVA 2HYDA 3LNCA 1Z63A 1RFLA 1VCNA 3DZDA 4QJ3A 2VO1A 2G9NA 2XTNA 4URZR 1AS2A 1N5JA 3C14C 3VR6A 5EUQB 3GP8A 4G5RA 3AB3A 4BECA 3ETLA 3IHWA 2HF9A 2DWPA 3W6OA 3KL4A 3ZH9B 1LW7A 2ATXA 3ZS8A 4ZDIA 3BBPA 3U7GA 1QHHB 3A8TA 4QBIA 5EZ5A 1G7CA 1U9IA 4AIIA 4IOLA 4E5UA 3I62A 4QNMA 3AF4A 3CBQA 3RWOA 1EG7A 1OH8A 1T4GA 2O8CA 2ZUBA 2FOLA 5JEDA 3SYNA 2J1LA 4O2RA 3E70C 4DVGA 1YKSA 2YYZA 2J7KA 3ZVRA 3VNUA 1P2TA 3LBIA 1E2LA 1KMHB 2VSXA 4PC2A 4RD1A 1S96A 2Y8EA 4QGFA 1P2VA 4HLDA 1LS6A 4AWXA 2GA8A 4PHFA 4BZPA 1PV4A 1GRRA 2ORWA 1YZUA 2O8DB 2AK2A 2WIBA 4LHZA 3TSWA 1YJ5A 2FN4A 2OXCA 5KDLA 3WMGA 3U2QA 3WP0A 1G3MA 1KGDA 1X8KA 1GG2A 5JFGA 1E32A 2O8EB 3SDZA 4W9MC 2PBRA 1II8A 4B6EA 1XEWX 3BD9A 1GL9B 1V5WA 3CNOA 4AD8A 1NP6A 2ZSAA 4GDFA 2ZYVX 2YWHA 1ODFA 4ZCIA 4LV8B 1QHYA 3DOEA 1KY2A 3MWJA 1CR4A 1FMJA 5L3QB 1XEXA 1A4RA 5H68A 4FMBB 1G7SA 4KFUA 2H8KA 2GEUA 4NYJR 4LYHA 4DLVA 1YZQA 4R9UC 4RD6A 1ZCAA 5DN6A 4CEJB 4A36A 3IPYA 2BEJA 2JASA 1GM5A 5DSZA 2BMFA 3LW8A 5L8VA 1JPNA 4X8OA 4DLRA 2LWIA 3ZVLA 2HLDA 1KZGB 1TNDA 1U94A 4HAUA 1F2UB 1FP7A 2QTVB 3U6BA 2XX3A 3TW8B 5KNDA 1QBKC 2NQ2C 3EWSA 4A0HA 2RGXA 1W4RA 3ASZA 5FOVA 3NDPA 2QPAA 3T12A 3RVBA 2W0SA 3SU8A 1YU9A 721PA 4DT1B 4JBXA 3LVRE 2G77B 2XZOA 1BMFD 2D4HA 4ACAA 5L3SA 3AF3A 4YMVA 1E0AA 1MH1A 2Q6TA 2EWWA 3K0AA 4OHXA 3EIQA 1Q1BA 1YZKA 1VCMA 4HLUC 3H0KA 1TX4B 4E09A 3I8SA 1E2JA 3VX4A 3U7EB 4V0LA 4M22A 5DHAA 4WOPA 5DI9A 1OLOA 2YNMA 1P9WA 4QBFA 2HJVA 2R6CA 1Q1EA 3CIOA 3Q7PA 4ZCLA 2A3RA 2D7CA 1E9AA 4YDSA 1HH4A 3OIYA 3ADCA 1W0JD 1QHSA 4A8JC 3VR1A 5JCPA 4DIDA 2OT3B 1ZJ6A 2H18A 3VR2A 5IHPA 1MOZA 2G1JA 2Z43A 3DO6A 1AQYA 1TAGA 5SZHB 4NCIA 1E69A 3P1JA 3FWYA 2UZ3A 4LHXA 1GILA 1G41A 1WE2A 5H70A 3OFND 4TQUS 3MCAA 1NSFA 1P5ZB 2JJ2D 4PTLA 2ZRFA 1N6HA 3QXHA 4Q9KA 1VCOA 1GDDA 5B2ZA 3RABA 3WMEA 5IF9A 3HPQA 4F93B 2EYQA 2ZAOA 3P20A 6Q21A 3FOZA 1KMQA 5SZJA 4EPTA 4TT3D 1W0JA 1TF2A 3ZQ6A 3HYTA 1NMXA 3FMIA 3QKUA 2CL6X 4IOMA 3AV0B 1I2MA 1WA5A 1Z22A 4B75A 3OE7D 4UXJA 2J7PD 4Q4AB 2CJWB 1PUIA 2VHCA 4IVPA 5IRCD 1H8HD 2CE7A 5SZKB 2IK8A 4TWZA 2RGNA 2P6NA 1KI6B 3LDAA 1CXZA 2GBLC 3E2IA 3UMSA 2F7SA 1ZRHA 1P73A 2Q9AA 3HDTA 4W7SA 3X2SA 1N6IA 2FMXA 4DCSA 3KQHA 4EIWA 4DIEA 2J3EA 4ZDWA 4US2R 3AF2A 2QM8A 4DLZA 3BB4A 1EX6A 1AJEA 2B8TA 1E79D 1T8TA 2I1VB 3U6KA 2CK3D 2I1QA 1KYIA 3EC1A 5KOYA 4B2LA 1GRQA 2WWXA 4KXFB 2WBLC 1YQTA 2X77A 1YR7A 4B43A 5JRJA 3B60A 4MDEA 5FUVA 2VSFA 3KKMA 3CF0A 3HR7A 1FP6A 3QQ5A 3RS0A 3KQKA 1II8B 4C0KA 5FL7D 5E3HA 1D5CA 4BFZA 2QE7A 4IDQA 1IQPA 2V6JA 2XXAA 1FMLA 1HUQA 4LV5B 1P7CA 4UNNA 1FUUA 3I32A 4I81A 3SFVA 2AWOA 2AD5A 1B23P 2VHJA 2BCGY 1R0XA 3IPXA 1DG1G 1NKTA 3K0CA 3RSOA 4RZ3A 3EARA 4HUTA 1ZM9A 3LWNA 2D2FA 3VTKA 3I8XA 3G82C 3HJNA 3VHLB 2ZVQX 2JJ8A 3K09C 4DCTA 3MWYW 4MGKR 2OM2A 1DS6A 5CK5A 2GBLA 4DB4A 2GRJA 4OI0A 2RGAA 3I1FA 3SBDA 3B7GA 4RD0A 2F43B 4EDHA 3X1XA 1JJVA 5FBWB 4B2PA 4HDQB 4IEIA 4CEHB 4C0SA 2C03A 4BGDA 5DIFA 2H5EA 1R5NA 5FUXA 1DPFA 1KMHA 5FOTA 2GCOB 4O0MA 1IN5A 5TVKA 3WNBA 2R6FA 2GXAA 3DL0A 421PA 3RYTC 4U7DA 1OFIA 2GAOA 2DFNA 4IDOA 5FOUA 3SQXA 2PJRA 1E2DA 5B30A 1KAGA 4QNRA 1EGAA 4P4TA 2QMUA 1KJZA 2QM7A 2QQ0A 2HLDD 1G18A 1IY1A 4R98A 2FPLA 4MA4A 4NCNA 1DAEA 3ECCA 3OEHA 4P33A 4XSGA 5DGXA 3WMFA 1W4CA 4YMTA 3BH7A 4BLRA 4TL7A 1BKDR 2HCJB 5FUWA 5FPKA 2UZIR 1T3SA 1OXTA 1XEXB 2P0EA 2QGNA 3MD0A 3EZ7A 4LOAA 1VYTA 2AKYA 1RRGA 4C0HA 3KFVA 1XB2A 2LCFA 4H1UA 4ZDKA 1RRPA 4MUBA 4OK5A 3SBEA 5EP4A 2PMDA 1B0UA 3EG5A 2IT1A 2ZRLA 4I1SA 2J87A 4TYYA 2HT6A 4HB3A 4II7A 4KITB 2FEOA 2J0QA 3ZZ0A 5C46F 4IDHA 2CCKA 3A37A 3W34A 2OEPA 1C9KA 1D9ZA 4B48A 4V0KA 2QP9X 3QPVA 4PO1A 4POAA 3O47A 4JJKA 4LPSA 3QE0A 1LY1A 1NIPA 2ZJ8A 1AS3A 3CF2A 4Z8XA 2OFOA 4X8LA 3TUJC 5AUOB 3U61B 3AVOA 3HPRA 1J70A 2ZI5A 3FKSD 3RS3A 1J2JA 1I4LD 1E2KA 1OKKD 1G20E 4JL5A 4PO9A 3DKPA 4LI0A 4IFEA 2RHMA 2C98A 2GZAA 4KI0A 1S3SA 5CDFE 4OHYA 1VPLA 3GJ6A 4IOKA 1OFUX 1Y63A 5JRZA 4WXPA 4L9WA 3LX8A 2F1RA 2OV2A 5A0FA 4LJ6A 3UMRA 2FE4A 4ACBA 3NTUA 821PA 4QM7A 1BO6A 3FHTA 2IW3A 1ZNXA 3H1TA 1XD9A 3T1QA 4IEEA 4Z51A 3RS5A 2DWOA 1OJLA 5HCNA 1FNMA 3GJ8A 4NONA 3GLFB 1NBME 1XTSA 1DTSA 1SXJE 1PLLA 4F92B 2ZRKA 3BRWD 3CLVA 3GJ3A 2ZJZA 3I5XA 2OUKA 4QBHA 4LHVA 4B44A 2WAXA 4PHHA 1BMFA 4L8GA 3W6NA 3V9PA 4RCZA 121PA 3KJGA 4WVFA 4Q9HA 4NZYA 4XJXA 1Z6XA 1RIFA 1M2OB 2J45A 1JQJC 4BFUA 2WWHA 3CH5A 1L7VC 3PUWA 1GZSA 1N6NA 4C0AC 4KFTA 1ZW6A 4GOKA 3MAAC 4KODA 4IHQA 5C1BA 3PEWA 4BRUA 1VDZA 2G0NA 3CONA 2CJWA 3LW7A 5J4LA 4O3MA 2QG6A 1NVVQ 1NG1A 1Z29A 2CCJA 4MKIA 2D74A 4ERNA 1KI8A 5A5GA 4C0JA 3Q85A 2PJZA 1OH5A 2B7CA 2FFHA 4URYR 3ZZUA 4URUR 1GNQA 3KTAB 2P65A 1N3BA 3HYRA 621PA 2ZSFA 3UG7A 4ZV4A 3B82A 4CDGA 5L3QA 5FTNA 3TUIC 3DKVA 4HB2A 1W49A 3REFA 1CR0A 1H8ED 4DJTA 2YC4C 3UWOA 4R2IA 4OYHA 1SXJC 1UM8A 4URWR 1W7AA 2P6RA 3ADDA 2NO0A 4KYIB 4QBGB 4AKEA 3QF7A 1E2MA 1SVSA 2A30A 5G41A 1FQKA 3W3ZB 4BQSA 2IYQA 2J59A 1JJ7A 2WWFA 4JVNA 2ZITA 1IHUA 1ETUA 4ZIRB 4WIAA 1TTTA 4TTPA 4Q1AA 3SJCA 3SN6A 3MG9A 3MJRA 1M1YE 3REGA 3WNDA 2IA5A 2IUSA 4B76A 2V3CC 2ZRNA 3QKRB 1Z28A 4N3NA 1OXSC 4X8HA 3NH6A 5HZHA 2QQEA 5FI0B 1JR3D 3DM5A 5JEEA 2QU8A 2BJVA 2G1KA 1G1MA 1N0VC 2FV8A 4LK2A 4K46A 1F3OA 1D6JA 2GCOA 2C5LA 4A1FA 2E9SA 2HJGA 1WCV1 2FGKA 3CUEF 1JXMA 3TMKA 5JHGB 1RVDA 4LYJA 1XD8A 4RZUA 3U60B 4DSUA 2RAPA 2HXYA 4MYCA 1W1WA 2ANBA 4GL2A 2RGGA 5G3YA 4PO8A 1WQ1R 2WWGA 1D2NA 2ZAMA 4OL0A 3T35A 3WNCA 3MJHA 3TRFA 1RC8A 1CP2A 3OIWA 4QKQA 3QKSA 3H2YA 3K70C 3OAAA 1FL9A 4AK9A 4TMKA 1CJVC 2XB4A 4Q4LA 4ZO4A 5JZVA 3AF0A 4DUGA 4DSNA 2ZS8A 4FN5A 2Z0MA 4NDZA 2V1UA 3UK6A 2AX4A 2BBWA 1G4AE 3Q8XB 2FG5A 5JSZA 3TUZC 2EYUA 4A8JA 2XB2A 2IF2A 2PZGA 3VU9A 2JLZA 4F4JA 1K8RA 5D3MA 2ZRAA 1N5IA 4TYPA 2O0HA 3UWKA 5EP2A 2ZQ5A 5TB5A 2XGJA 4LHYA 1DAKA 2V9PA 1CS4C 4X8MA 4FIDA 1EXMA 3VKHA 4KSCA 4TLDA 1A1VA 3NEJA 2OFXA 1YRAA 2HCBA 4RCYA 4A2QA 1GUAA 1U90A 2OBLA 3RLFA 2ORVA 4BWYA 1XCPA 4GI7A 2WSSD 1X8JA 2XZLA 1G8HA 2IYTA 2WKQA 1T9HA 1U0LA 4E03A 2BDTA 1V43A 2VL7A 3S1AA 3GLGA 2GKSA 3NBYC 4M9QA 3U4QB 2ZRPA 3KKOA 1DEKA 2RMKA 4PQFA 3A1UA 4JVLA 4Y0VA 2Q3HA 1W36B 4NYJQ 1G5PA 3B1VA 3DMDA 1MRNA 3QXJA 2GCPA 3LH5A 3PXGA 1AIPA 3R9IA 1EFRA 4PZZA 3VQTA 4PPQA 3SZRA 2AD1A 4EJSC 1XXHE 5ELXA 2KE5A 4JYCA 4JLKA 3TSOA 1P9NA 2CHGA 4OK3A 2Z4SA 3TJZA 4B3XA 3ICQB 1BIFA 2J41A 3GLIE 2PCJA 3D6TB 3ZD7A 3UPUA 1P6XA 1EFUA 4QHYA 3QPWA 4Q4HA 1P4SA 3O8BA 2CHVA 4B74A 2V1XA 3QBVA 3U3JA 4PQYA 4RKEA 1HA3A 4DLTA 2R65A 4ZPXA 2G88A 3AKEA 4TN1A 3TQFA 3PQCA 3R9WA 2PZFA 1TU3A 4QGAA 1JNYA 4A6PA 3OEED 4AYXA 4Q19A 1CR2A 3C5HA 5FOXA 3U7HB 2CLSA 1TQ2A 2QAGC 4B47A 2ZUCA 1ONBA 1XTJA 1ZIOA 1Q57A 5LDDC 2OCYC 4JBYA 2V6IA 3N70A 3THYA 5AUNB 4HAZA 3GEEA 1UKYA 2EFEB 5GJCA 4TSFD 3SOPA 5LB4A 4PC1A 3R8FA 2D7DA 2ZE6A 2QBYB 5FOSA 3DMNA 4HLCA 5FL3A 4US0R 2OCAA 4PHTA 4JT4A 3VR5A 2YV5A 4A0RA 4Q7KA 4DLXA 4ZDJA 1DO0A 1QVRA 2J0UA 4GBMA 5GVRA 3TNFA 4URXR 2ZXUA 2IWHA 2JLYA 1DAFA 4HAVA 1VG1A 1ZNZA 3CRW1 1WBBA 1HQCA 1M74A 3WBKA 3W5IA 1R8SA 3X1YA 2PX0A 4DDWA 2CNWA 3K8YA 4TLAA 1P62B 1YR8A 1ZD9A 3P4XA 1L8QA 2HDNB 2O8CB 3THOA 1VG0B 5G40A 3LX5A 1IOZA 4DBLC 4LBVA 4UXIA 5LBIA 1W4AA 2X1VA 2YC2C 3BC1A 3VR4A 1Z2AA 1AGRA 2F55A 1F2TB 2FGJA 2N46A 1PLJA 1JB1A 4TSFA 1MO5A 3GJ4A 3T06B 4PSVA 3B9QA 4QGHA 5F2EA 2FSHA 5B64A 5F9HA 1F5NA 4HSEA 5DE3A 2CBZA 2WJJA 1OF1A 4Q1DA 4YXWA 3T5DA 5KO2A 2ZJ2A 5LD2B 4MGZR 3QEJA 2RGEA 1W4BA 4LJ7A 4PHGA 3TE6A 5DYGA 4R2HA 2ZRDA 1EK0A 4KJZA 2ZPTX 1OIWA 3PG5A 4ARZA 4M4SA 3EPHA 4UNSA 4L9SA 1ZP6A 2R9VA 5EE1A 4IW3B 3SEAA 3T34A 2ERXA 2JAQA 3J81k 4G5OA 1G6OA 4RZ2A 3RANA 1P2UA 2RGCA 3TVDA 1AM4D 1IBRA 3NC0C 1SVLA 1IONA 3SYLA 2KWIA 5IK2A 3CZPA 3K70D 2E1RA
chains in the Genus database with same CATH superfamily
2ZYDA 4RHTA 3BB3A 2G7ZA 2WIAA 3RRZA 1J5PA 2BKVA 3PQ3A 5AOBA 3FB4A 2G36A 2WFLB 3W6PA 4EHBA 3ZCTA 4O1IA 5KNDH 2ZUWA 5LOVA 1ZCFA 4CN9A 3TIIA 1VKHA 3NFYA 3PDIA 1L5QA 4RESA 2AF3C 2XDQB 3K2EA 3L93A 4HH0A 2F17A 5E3IA 1SJ9A 1BXZA 2BUCA 2LCIA 1E9SA 1UEIA 5J43A 3RKRA 1P19A 1UBMS 5HMLA 1RYMA 2BL4A 2Y1WA 5HZKA 1PX0A 2H2DA 1YQUA 1LV7A 1TA0A 1UZAA 4PEVA 2H16A 4MR8A 1XHFA 2QK4A 2XXJA 4WVLA 1FUEA 5IJZA 1PL0A 4ZZ2A 4DNOA 1A88A 1SB9A 5CA1F 3NAMA 1JFTA 4FOLA 2C2YA 1V3QE 2O8NA 3H1FA 3N2IA 2BUBA 3KXLA 1JYFA 3N76A 4HXEB 4PVCA 4GVPA 1YOVB 4IDPA 4UDNA 4ZARA 4EA7A 2B7BA 4G4IA 5K7SA 3ONWA 3QJGA 2P62A 2NP7A 1NFRA 4OHWA 5D85A 2C9CA 4PYIA 3UV6A 2XITA 4PINA 4RZSA 1Q19A 2CSUA 2R47A 1RQPA 5TC4A 1AA6A 1SG6A 2BEKA 3CNNA 5JUWA 3R4CA 5ITSA 1GPNA 1WZUA 2ZI3A 3JSXA 5LZ5A 3WQHA 1BVUA 4GR4A 4MRNA 5FBVB 1R5OA 1W5TA 1VJTA 2F1HA 4LBYA 1KOJA 4Z7OB 3E9EA 4WZZA 4R7ZA 2G07A 4PZLA 4OQYA 1ECBA 2BP7B 4Q39A 1YZHA 4RY9A 1U1EA 1KQ3A 4DSAA 1HE2A 1WY5A 2TMYA 1WZ2A 5FNZA 1NL3A 2HU7A 3BWCA 1MVOA 4HDMB 1J8FA 1N7IA 1MFZA 3IIMA 5AJTA 3AFIA 4MR8B 1IUPA 4PLZA 2UVQA 1N5LA 3OFNA 1IM5A 3HA3A 4BFSA 1RPJA 3EAGA 3O93A 1R00A 3R5SA 5DTQA 2ODEA 5GADl 4F8JA 1OLSA 3QG1A 4X66B 4FWTA 2NLOA 3PSHA 1X1BA 1NTRA 2XEDA 3I37X 2MSCB 4PFJA 3Q2OA 1V4NA 3SSAA 1AKYA 4XR4A 2MINB 1Z7EA 1JAHA 5BMVB 2X5KO 3KQOA 3OBIA 1KDTA 1U0NA 4BB6A 1ES9A 1TUGA 3DEHA 2R3SA 5KVSA 2QBYB 1ULBA 2PRIA 4FDMA 3WLAA 5C8YF 1DKRA 5TX7A 1T5TA 3GCWA 3S3TA 2WJ6A 3LUHA 4GD3Q 1K68A 2FF7A 2GAFA 2LTAA 3RHFA 3ANYB 4M36A 2COKA 1XN4A 1Z0IA 3UANA 1JU4A 1JFFB 2JA2A 4NESA 4FHDA 2DHCA 1Y8AA 5E1BA 3UENA 2I6SA 3LQKA 4QT4A 4BLSA 5EKSA 3WO1A 4TLEA 4H17A 3R40A 1SXPA 5P21A 2V9CA 2XKAA 1XRJA 1KJQA 3E7FA 3ESDA 4LA4A 4DC9A 1EUQA 5AM1A 3HXPA 2WIDA 4LPKA 4P3OA 4Y2RA 4OFBA 2MSDB 4HS4A 2D06A 1G5QA 3DOCA 4HK4A 4YH1A 5DNYB 1ZBQA 3HBLA 5G4KB 3CA8A 2QMYA 3E5HA 4DARA 5JSUA 2FPKA 1ZG3A 4QUAA 5FO1A 2AN9A 2ERYA 2DUJA 1SKYE 1EH5A 3K5IA 4C3UA 1P61B 1H5UA 3RT1A 2OOSA 1P5HA 1HFWA 1Z2NX 3BWDD 4N5IX 3EGCA 4JOBA 2I80A 2YJTD 4XGIA 4D0NA 3K8ZA 4ZAGA 2JJ1D 9LDBA 5BVHB 4GKVA 4B8ZA 3HP7A 4L72A 3QFHA 4ALIA 1VOTA 2YFKA 4LNAA 2H31A 1V11A 1Q7BA 2CVHA 4FXOA 5CLQA 5BR1A 3WLRA 3HU2A 3UMCA 3IQIX 4XWOA 1JAZA 3EWIA 4WXMA 2EFHB 2P2DA 3FSGD 3O0DA 3QBEA 4RE5A 2JATA 1C1HA 3F7TA 2PT9A 4LEIA 1AS0A 1O8CA 3F8TA 3RUPA 1QMPA 1WZEA 2C7BA 4CRWB 1A2KC 1U28A 3OI7A 3L0CA 4Y6LA 1ISGA 1JHRA 1GQOA 1I4DD 3INGA 4D0SA 1CIPA 2PUCA 2VNIA 3K9NA 3VOSA 2WKRA 2I6FA 1LPMA 3TR5A 3OUUA 1ZU5A 3PFBA 2SNIE 1HZZA 4URHA 4X7PA 4YWJA 4D4HA 1P1JA 1V1MA 2QQFA 1P18A 1KO5A 4DR3B 2WPNA 3LSYA 2DUUA 4KH1A 1HOTA 3T7IA 3VUFA 2E89A 1H9AA 1RJWA 2V6FA 3D8UA 3F67A 4IXMA 4NJMB 4XVRA 4ZOEA 2GN1A 1RU3A 2REQA 4XWAA 5IHXA 3EPLA 4L74A 4U39A 4L15A 4YJ3B 2R6ZA 2Q1YA 2GK3A 4FFBA 4CF6A 5JS6A 3ILYA 4BMYA 4ID3A 4I36A 4NK5A 1E4OA 3C0KA 4PZ9A 2H1VA 3GARA 4ZXPA 5BURA 5AW9A 4FMDF 3F3SA 3GT3A 3KDPA 4ZZ3A 4G8BA 2VJBA 3A6EA 3IRVA 3PUXA 1EAMA 2Z2KA 2YOFA 3H6KA 1IRXA 4L8LA 1OX5A 1XCLA 3AXSA 3HUEA 3W5VA 1OX4B 3GGCA 1YIAA 1GUDA 5TT0A 1PZEA 2G04A 2IYOA 2OFWA 2VJLA 2ZE8A 3QJ5A 4MGIR 2ZJ7A 2W90A 3ZWOA 3E2PA 5CB4A 4QOSA 1M2WA 5AIBA 3D7RA 1DKQA 1JR3E 2HAEA 4D81A 1GZHB 2YFQA 2YH2A 4KHZA 4PFKA 4RTLA 5K0CA 3ECAA 3BIWA 4O4IF 4LXQA 2CVQA 3EIWA 4L16A 3B52X 3F8WA 3QFFA 1NWHA 2RH8A 1Z8FA 1C8KA 1UBGA 1XL0A 3FCYA 3CMCO 4Y8VA 1FYVA 3GVPA 3RR2A 3UF0A 2JI9A 3UWDA 4PSUA 2WOOA 1MG5A 3HNOA 3KYIB 3UKOA 4C2TA 1C3OB 3B20A 3BE5A 4DTIA 3GWGA 3U1VA 3CT4A 4MVCA 2H48A 3H3JA 5SICE 3RW9A 4B31A 4TKUB 4DV5B 2BFCB 2Z57A 4US1R 3CR8A 2YRWA 2FZ5A 1F38A 1GGFA 1NX9A 2R84A 1NXPA 1QHNA 1TFRA 1MHPA 1JPJA 3LFTA 4E11A 1J1UA 2ATEA 3EMBA 1CZNA 3MWEA 1QUEA 2F67A 3LFHA 2J4CA 3UOWA 2I55A 1UOEA 4TV8F 3ZDFA 1U6KA 4D4MA 1TI7A 2AYYA 2EJVA 1DAPA 2QLTA 2NUPB 4G9BA 2I8AA 1QPBA 1GZ3A 1SFRA 3KYCB 3DTTA 4IWNA 1P17A 3A58B 3GGGA 3IAAA 3K35A 1X87A 4IWXA 3TQCA 5LXTB 3OEEA 5AR1A 1WCXA 2VP9A 3AVVA 1FSFA 3JALA 4BPBA 1UKEA 4R8LA 4X64B 1IUOA 2HSWA 3IEVA 1YJAA 1M1XB 1Z25A 1L8LA 3VC3A 5FLEX 2F00A 2G76A 1PHPA 4EG7A 1S0UA 1Z0DA 2HD4A 3GLHB 4DA9A 5JBQA 5ICFA 2QTWB 5DGCA 1UANA 2VT3A 3DO5A 1AHPA 4O4HA 1HT2E 1UAYA 3TEMA 4P32A 3S8EA 1EFVA 2AN1A 3UT0A 4DCUA 3NBKA 3O6VA 1DUSA 1ND6A 3UMJA 1CRZA 1Y4AE 1ZOLA 2V7XA 1N6RA 2JH8A 4OQZA 1I5RA 3ZD6A 3X44A 4LZNA 3QWIA 4Q02A 4FX2A 1W5SA 3IUMA 4RFLA 5E38A 1NLFA 1JQBA 1U8UA 1UZMA 2FRVA 5FNVB 3B7PA 4ESVA 3CEJA 3GDWA 1DJQA 2YV2A 5FPYA 4DQVA 1W36C 1QV6A 4PICA 2JFHA 5L3VA 2DHDA 4PCVA 4JD5A 1AQUA 3I9FA 1R4AA 4XSHA 1GKIA 4R5MA 4C89A 4YXFA 1SQ5A 1SD2A 1I2AA 1HT1E 1CULC 1WWKA 4F3RA 4A23A 3T5MA 4BMVA 1BJKA 1OI4A 4XDGA 3UAXA 5J4VA 1NBEA 1QPGA 3KKZA 1BS1A 2FW1A 1EEHA 1P0PA 3IO5A 4RDHA 2CLKB 5A04A 3DS8A 1RRCA 4BJHB 5EJEA 1LZLA 1B6SA 1CPYA 1AE1A 2ZJ5A 3PT5A 4O33A 3ZJUA 1XIVA 4HT3B 4F6RA 4KDRA 1S9DA 2ZP1A 4YEDA 4IDBA 5IP5A 5L7YA 1QQBA 1LA2A 3HBFA 2F1OA 5KYXA 3UAWA 2I71A 2ZJ3A 3FJOA 3AUXA 4MMYB 3ZLTA 5C7YA 4R5HA 1L5MA 1R27A 4J0GA 3FYUC 4KMRA 1ESEA 5CNKA 4B80A 4GR5A 1OZFA 4BO1A 4UTVA 1TJ3A 3FN4A 3LP6A 3W7VA 1FXWF 1UADA 3PFHA 3CLHA 4FOOA 3R7NA 1GO2A 2VUUA 2G80A 2XNSA 2C54A 2D1YA 4GU5A 3GUHA 6CHYA 1X74A 4D26A 3N2KB 1W88A 2IZOA 1WDWB 2X7HA 1ZNWA 3S44A 1XRQA 4MGHA 1E3IA 5JS8A 2QN7A 5J3JA 5C0OE 1RYBA 5DYTA 4J4HA 1Y5NA 1Y80A 2BGWA 2X5NA 4Q3KA 4XIJA 2IEYA 1AQJA 1SIOA 4CV0A 2ZATA 2FRDA 1XZIA 1ZQ9A 3BX1A 1DDGA 4HVCA 1JQAA 2C2GA 2VF7A 5KOJA 4N6NA 4V02A 3T4PA 5F1KA 1F8UA 1RC0A 2PKEA 3JR7A 3RQIA 3BT7A 4DYVA 2Y05A 4KMOA 4C6TB 5CEEA 2I62A 1NLYA 2EEPA 3TH5A 2Q7OE 3B5EA 4RPIA 2G8NA 2X6TA 3C8DA 4ID9A 3PXUA 4RD3A 2OUIA 3FZEA 3AFHA 3CV3A 3T1OA 3LPDA 3VSDA 1PG5A 4EELA 3C2QA 1E59A 1H0KA 1J2TA 3MUFA 1A5BB 4NABA 4TPKA 1VJRA 4C20A 2RJ3A 4RVSA 4D6XA 5FX2A 2OGUA 4RHYA 3ZZTA 2P6MA 5CTJA 1BYUA 1JBQA 3JZDA 1DDOA 1XZEA 1QE3A 1QYXA 2EL9A 3N6RA 3AYXB 4HATA 4WZBE 3BM5A 5EQJB 3M81A 4ZI7A 3K9HA 3GLKA 3WAKA 4MNTA 1OSNA 1SVUA 4ZT7A 2I7CA 2GWHA 1GP2A 2XNDA 4ZIRA 5BNIA 1K97A 5KC9A 2ZTHA 4R3NA 2QTVA 4QLAA 4CU2A 4S1VA 1C3VA 4Y18A 1N36B 2FFBA 1PR4A 2Y93A 3PWSA 1V8PA 2A2ZA 3SQOA 4KPYA 4G24A 3KXDA 5B1EA 4ITRC 5FA6A 2CWWA 4M7RA 1B3RA 4M0PA 3NHYA 1JWBB 2JLRA 5CLHA 1A72A 4ANFA 2IHTA 4TV8B 1JVSA 2Q5CA 2VP3A 1CZUA 3DZIA 2ZKIA 1T5SA 4QOFA 3ND5A 2WM9B 1WPQA 4N39A 4ESEA 4LVOA 4OG2A 4G0YA 3QUBA 4ZEVA 4GRAA 2WSSA 3WRYC 1RJ9B 3JAKB 4ND8B 1A2BA 1JJIA 2P9HA 5CX1B 3DT6A 3BICA 1DAOA 1JN0A 5ALRA 4L3VA 1EZZA 3RJTA 1ZK0A 1CQPA 1NUPA 3NEYA 4LHEA 3V4PB 2GPBA 2QLBA 4KQ9A 1QUFA 2P90A 4RV9A 1WCWA 3PLNA 5BW4A 2CV2A 1F14A 3FTFA 3RC3A 4ZYTA 1N2XA 2PD4A 2JCXA 4F8YA 3B2NA 3MTJA 5MN6A 4OA8A 3GRPA 2BP7A 3D7LA 4MRAA 3LIPA 3Q10A 1TC2A 3QMVA 4R1LA 1E20A 2IFTA 3ZIAD 4CDMA 1IVSA 2GILA 1WP9A 2XMRA 1P29A 1TO1E 3TPCA 4D8YA 4UU8A 4Y2PA 4ZZIA 2D1SA 1JFFA 3FZNA 5HQ3B 2WQ6A 3F47A 3GCGA 1FFDA 1PCXA 4GGPA 2QVXX 3V4VB 5K03A 4DAOA 2IEGA 4PXAA 4BQNA 3M5PA 4G0NA 1E5VA 1TQ4A 2RHWA 5HQTA 3F74A 3DV9A 1NJ6A 1PFUA 1QDUA 2XXBA 1U63A 2J0VA 4J1QA 1K9VF 1QVWA 2X3FA 3D6FA 4ZAVA 3VHRA 3UEOA 2BFWA 1NRXA 1QZTA 2HK8A 5BMVA 1QK4A 1ZPDA 1FFCA 3LI2A 4OB8A 5JTTA 1VL5A 1CQJA 4PLHA 4A8TA 1C1YA 2IZ5A 4N5HX 5FPSA 2ZULA 3DZKA 3GL9A 3COZA 3GEIA 3W5UA 1NN3A 1VTKA 4L4UA 2ZRQA 4HDNB 2PFKA 4HGQA 3WGQA 4C0WA 1T6XA 1XEAA 4JC0A 5HA5A 4LJ8A 2FY8A 4LWQA 4B3MB 3C24A 1J2EA 4TYWA 3A9WA 3EVCA 1AUVA 1REQB 1FLDA 1I9GA 1SELA 1URPA 3H2KA 4FR0A 5CBPA 2JH9A 1VSUA 2AFVA 2WU0A 4PRZA 4LRSB 3LQ1A 2A5YB 4JLDA 3IBYA 5IUJC 1GWNA 1NR5A 4TUYF 4YJ2B 4EMSA 1HKUA 4NOKA 4AY2A 4PU0A 4J0EA 4OXXA 4AUNA 1YBMA 1R6UA 1KKLA 1PZMA 4U7WA 2HNAA 3OCXA 2EC5A 2QRLA 2FLWA 1VIYA 2WF6A 2WWIA 5LDHA 1GPLA 4DHWA 2R25B 3PS9A 3RV3A 3H2HA 4EKGA 2V6BA 4HDKB 5AJUA 4F06A 1WULS 4KACA 4KXQA 3KE9A 2AT1A 4NAUA 1AQNA 4LE0A 2YHUA 3T9DA 5CDHA 2GPTA 3KHUA 3FRJA 3HRIA 4LY9A 1DP4A 1F6WA 4UMVA 2PWPA 1Q2XA 1Y8QA 5CIQA 1N6LA 4NJOA 4LBZA 1BKSB 1E6WA 1M7GA 2PL1A 3L07A 2J6HA 5KSYA 2QORA 3CLKA 2VRBA 1R0WA 1CKEA 1UFKA 2ZWMA 4WXEA 3ODPA 1ZGGA 1QH9A 4QIHA 3SY8A 1L7DA 2JGFA 2TRSB 1MNAA 2NZ2A 2O2DA 4LHSA 2WJZB 1M6VB 4LSWA 1TF7A 3FPCA 3MEQA 2XUOA 2P75A 1JEQA 4GZ5A 4OEHA 1Q50A 1U2PA 3LBHA 2A1TR 2ZBUA 3BKWA 4OGWA 4B3BA 3A6FA 1DC5A 2J09A 2YCBA 4I1VA 1DZIA 4IS3A 2HEGA 4J0HA 4M86A 3RWMB 4ZOBA 4CKBA 5I51A 4HYQA 1EBFA 2VK8A 3C6MA 3I2GA 1OXMA 5BW6B 1ZC4A 2JG3A 3AEKA 3WYAA 3T12A 3DEJA 1X8XA 1ZW1A 1EWTA 3FDZB 3KSZO 5CK4A 3P32A 5CH8A 2QUKA 1XYVA 1IM2A 1QHIA 1GAWA 3CWQA 4AP9A 2C8LA 1LQTA 1WXDA 1VYVA 2WG0A 5EKTA 2O8BA 4QPDA 3P26A 4HOYA 3SXJA 4BBZA 3SC2A 2C04A 3HMQA 3DLTA 4OBEA 5DLDA 3GWZA 1P2DA 4NC9A 1CEXA 1V7QA 1K5DA 2A14A 4GSLA 3WK7A 4G1BA 4TKVB 1W36D 2JRLA 1FUKA 4D3YA 2C9OA 2PKQP 5L95A 2XVYA 3DL7A 1D2EA 3RJ9A 4O4LA 2P68A 2ZSUA 3FKSA 4BMDA 4W8HA 4YRZA 1NPYA 4B34A 2WHQA 4BQRA 3UWPA 1RWKA 2RGDA 4YRBA 1TUBB 3VKGA 3NGMA 1B14A 1GQRA 3TL2A 1CDZA 1HDEA 1RHRA 3PGJA 1YRLA 1PR0A 3P2JA 5TEWA 4A03A 3TFWA 1SXJA 1E7QA 3MMZA 2NUAB 4YMHA 3IDSA 3UTDA 2Z8YM 2PX8A 5JIBA 1DGQA 3RIEA 3RAFC 4ZAXA 5HZGA 2YUTA 3FCEA 3LY8A 4M83A 4NJEA 3Q11A 3STWA 2Q99A 2R1TA 1YVDA 5GOZA 4EFMA 2J3QA 4ER5A 2XJ9A 2ECPA 1FFXB 4WQMA 1EUDA 2V03A 4HADA 4CMIB 4YUZA 4XIYA 1KPGA 4GLOA 3RJMA 1HEIA 2ZQZA 1I2CA 1J09A 1P5RA 5D5PA 2X13A 5C5IA 5KS2A 1Y5IA 2FX2A 2FSIA 4NXNB 3KSAC 3EG9B 4B35A 1FXUA 2W70A 2DYKA 1YI1A 5AKXA 4OUDA 3SR0A 1WABA 3CINA 2NN3C 4KDEA 3W2IA 1MNQA 2QTTA 5HG0A 3NG1A 3V8RA 5KTYA 1U2EA 4PAWA 3E35A 3U56A 3C5WP 3E0QA 3WXMA 1GTMA 1AKMA 1HBJA 1IB0A 4JS0A 4PPNA 4L9AA 1XLWA 3LK6A 3PHJA 4RTQA 3MTAA 3L1IA 3A04A 4WY5A 3PEYA 1B2LA 4F2GA 2PXCA 3OOYA 1OVGA 4KQGA 3GAAA 4U63A 4W1RA 4V1CI 5AM4A 1YCFA 1HDOA 2QTFA 4ME6A 4RTJA 5HK9A 2DJIA 3PU6A 3G0IA 4JVMA 5LYJB 2KW5A 1AZLA 1DB3A 221PA 1IAQA 2CFSA 2MYNA 3D0RA 3HN7A 4FOTA 4J0IA 2VQ3A 3A4YA 3DLPX 3DP7A 5CH5A 4F46A 5IXSA 1FNSA 3THXA 1WV1A 5JYBA 1KAEA 5EG5A 4DBVO 5MGNA 3I05A 4PV7A 4MHTA 5JCOA 1RR6A 2DFVA 1JTVA 1KFJB 4YAOA 2PZEA 2GT1A 2VP6A 4H6VA 1NULA 1KXZA 2W2XA 5F76A 5EMJA 5K8IA 1Q74A 2Q3BA 2CDAA 1XAGA 5FEUA 1BZYA 4WLUA 3DAOA 2BHRA 4C0BA 3AOEA 1CUWA 1CLUA 2XKJE 3AXTA 3GJXC 3KALA 3HH8A 4FFSA 4AYWA 1GN9A 1Q0RA 2FSVC 3CRVA 1O6FA 3SR4A 4LISA 2Q46A 2RHOA 3SQWA 3TXAA 3VU8A 2GEKA 2SKDA 5IBPA 3RC2A 3CCFA 3L7LA 2HWWA 3KOUA 3T9BA 3IOYA 4LUCA 1RRMA 4QEDA 2VS1A 2IHUA 2WTAA 4L5BA 3CF6R 4L8VA 1IBLB 2P5TB 1FJXA 1LBIA 3ZPXA 1XAHA 1KFKB 2CUTA 4LXUA 2XRYA 5DGDA 1Z5ZA 1N5DA 1UXHA 4EFNA 3OMXA 3OQVA 4AF8A 1I5OA 2CHQA 5C1PA 4R9RA 4EI9A 1PSZA 1V5FA 1R4NA 4A6EA 4D41A 4Q5IA 5B36A 1OU0A 4K05A 5JDCA 3WA7A 5JQGF 1EDBA 1QO0A 3B6ZA 3LM8A 1DAMA 3LQ4A 4P8RA 4QFMA 3M2TA 3O4GA 1G64A 2PKYX 2ENUA 2RD2A 1MR3F 3Q87B 1RI5A 2EV9A 3USCS 2PUEA 4K6HA 4LDAA 2J5KA 1O4WA 5K4HA 1UIMA 1OBFO 1VMKA 3BXOA 4D4IA 1VJCA 3AVPA 1YI0A 1RD4A 3KJXA 1QO7A 1SM4A 4HV4A 2HMTA 1HNWB 4TWJA 1ZUNB 3ESCA 2PUVA 2VP5A 3DMTA 4MB0A 3AVQA 4LYFA 3ZCQA 2P1DA 5JQGB 2O6LA 3PUJA 4OMFG 2BTOA 1N2HA 1OYYA 4PONA 4DC1A 3WMWA 1NNUA 2OYSA 1MFPA 5A3QA 4IRUB 1N1EA 3FSJX 4C5BA 4KUHA 1PYGA 2YXBA 2I54A 2FPIA 1Q21A 5DMXA 1EUZA 1AHIA 1X9HA 1XCJA 2HRZA 3IB6A 2VPTA 4BPRA 3K1AA 5A9SB 4BVEA 3RSLA 5JLAA 1UPXA 2G28A 2CDCA 3EWNA 1TCVA 3K92A 4KAAA 5ESDA 4UOQA 1ZGBA 4I4IA 3ETDA 2CGEA 4J3JA 3T61A 1A9OA 4ZREA 2CXQA 5DEIA 5HUQA 1O97D 3SS7X 1R2QA 2G06A 1VLJA 2QGZA 4IZOA 1J1ZA 5AQ1A 2ADFA 3KSDO 4HPJB 4CLEA 1AV7A 5CCDA 1TADA 2VH1A 4WK4B 4CV3A 2QJRA 3GJQA 1QS0B 4KO8A 4JASB 3HBAA 5TQ0A 1NM5C 1ODKA 1V3TA 1YE3A 3EGWA 4S0ZA 1BRTA 3VZRA 2R751 2HADA 3EZ6A 1JEEA 1U9ZA 3S2GA 1PN3A 3PNKA 2GYVA 3PNQA 4PYKA 1M54A 1SQ6A 4BGEA 2XVXA 4H31A 5CX4A 3LQ2A 1WMAA 2W7TA 3KXPA 1F1JA 2CNWD 1GLGA 2JFGA 1KEUA 2V5VA 2BC9A 4LOHA 1YK1A 2BDEA 4YA6A 4TYMA 5KINB 1K6JA 4EUEA 2JLSA 1R8JA 1ZSVA 3RRJA 2WJVA 1G5FA 4GMDA 1EE2A 1G6Q1 2AWNA 1HQDA 1Q15A 2HNKA 4TXHA 2J3IA 4IX1A 1Z68A 5G4KA 1T9ZA 4FFBB 4BFYA 2W11A 3D54D 4UD6A 4Y0AA 5E0KB 5K4AA 1SVMA 2IS2A 1SIBE 1VJGA 1ZJ4A 2ZR9A 2DPHA 4DYHA 3TVYA 1M2EA 2JBAA 3NJ8A 1PZNA 5AH0A 3NXKA 1UEJA 2XZTA 1E0KA 4HGNA 1H3FA 5G4LA 4WTOA 1G98A 4Q15A 5CTAA 1PL6A 4GZMA 1OASA 1FS6A 1MVNA 1LKZA 4KX3A 4RY2A 4KDFA 5DXAA 2IOFK 4NNPA 1KJIA 3DVSX 5EQTA 1HTBA 3P4UA 4EUNA 2IH2A 1VLQA 5L3SB 4E3ZA 1C4XA 1NY6A 2W2LA 2WICA 3H86A 4YAGA 1TC1A 2AR9A 2XF2A 1LNQA 3AR3A 2K87A 4PLWA 4MQLA 2DQKA 2RI6A 4EQ6B 4HZIA 5ITZA 2CEKA 1T15A 1I01A 1XF9A 4NBUA 4Q4CA 1P74A 2CMFA 1V7ZA 1I4WA 5MN4A 1XTBA 5HRAA 3E3MA 2B25A 1UR5A 4AMBA 4N1AA 5F1PA 3K5PA 4YAIA 2ZRHA 4I2NA 5ENZA 3HUTA 3Q88A 2CKMA 4BEBA 4FHGA 3FKJA 5FWNA 2GZ2A 3JVEA 4LY0A 4X0EA 3THSA 4YRSA 1QDLB 2WABA 4UZFA 5COQA 2QRKA 4HLUA 4AQDA 1MGPA 4DT1A 4NKRA 4DCMA 1LTKA 4PTZA 4DV0B 3ZCRA 2J9YB 1DKMA 3S6JA 1IXRC 2IYZA 2HR1A 3FHOA 1H4QA 3MFYA 3M9WA 5DYNA 3B13B 4C4PA 4OI2A 4CMEC 2HSGA 4GWGA 5CT9A 3UMVA 3WGNA 4Z49A 1U81A 4OQ4A 1WOMA 2X1LA 5JJ5A 3EEBA 1NXOA 3ABIA 1T5IA 4KQEA 4BVLA 4FQ5A 2PFSA 4OM7A 2D62A 1ADCA 1O0SA 1RACA 1TYZA 3FMOB 3SEQA 5B6JA 1C30B 1CVRA 3N8KA 1A8PA 1A1SA 3EQ9A 3F46A 3HR8A 3L6RA 3MELA 5JV5A 3ZJTA 1K08A 3CKYA 4AROA 4HTAA 4KNWA 1YA4A 3O4IA 3VYTB 2XVMA 3TAUA 5EXTA 2QX4A 1HV8A 1T10A 4NS1A 2HQOA 5LP1A 4F21A 2R1VB 3L0PA 5JSKA 3EVFA 1PF7E 2PX2A 1VZ3A 3V4OA 4UUAA 4CZ2A 1XP8A 3G6KA 3RD5A 4L95C 5BNTA 1QU3A 1GG8A 3GA7A 5IANA 3ZZNA 1T5BA 3NNSA 4AJJA 3FCUB 3I72A 2J32A 3JW8A 3PR3A 4RVNA 3HI4A 3WV5A 4BIIA 4RVCA 3RVLA 5LQSA 3WL7A 5BSGA 2HEIA 3WIBA 3OOWA 2DX7A 4IGFA 3CR3C 1HL7A 4FCVA 1XKQA 4GYYA 4MP6A 3KHKA 3S70A 3HM9A 4I4LA 4C7BA 1VKZA 2B61A 4MDYA 3E5NA 3BD7A 4MV7A 5CDFA 2ZIUB 2C7GA 1XHEA 1Y3BE 3L82B 3N7UA 4WN3A 5DBOA 5CCXA 2W00A 4W9NC 1GN8A 2MHCA 4HN2A 1BJTA 2R8RA 4RTPA 1G17A 3FMVA 1ZM7A 4LG1A 4OBBA 2C58A 5J5AA 1PNRA 3WQBA 3EFHA 4ZI7F 1G16A 3DULA 3LUAA 4GDMA 4JAVC 1VRVA 5U4XA 3D0QA 3GNQA 3RRNA 1DJMA 1EWQA 4EY4A 2R7AA 3DLHA 2ZRGA 3HCFA 3NDJA 3D7MA 2RB5A 2UKDA 3BD6A 3NTOA 4P7KA 3NWBA 5CLLA 5C7IO 5LJLA 2P40A 3GJ7A 3L7YA 3GRYA 2ONJA 4EHIA 5CFRA 5JPIA 1UDXA 2QN3A 4DJEC 3A2KA 2E4WA 3JWEA 4C0QC 1HX7A 2I4OA 3OKPA 1NMYA 2SKCA 4B32A 4EWLA 1ZESA 5K8UA 1ZVVA 2NMVA 4TYNA 5LIRA 2GGSA 1ODCA 3DHWC 1TF5A 3GMIA 2JI6A 3SJAA 4J2HA 2QNBA 2OSBA 2Q7DA 4CU5A 2GYYA 5KCMA 1TAQA 5MGBA 3ZE9A 3L6OO 1J8QA 1T34A 3WHIA 4F6RB 5K0GA 3V8VA 4LDRA 5I8ZA 5JS1A 5FV4A 4Y9RA 3H9EO 1QVAA 3PV0A 1Q1AA 1ZGJA 2H2HA 8ADHA 3TM4A 4M6WB 3VYRB 1AHHA 1NVVR 4V0ME 2QL9A 3SI7A 3COPA 3WGKA 1BVHA 4ZO9A 3RSCA 1KYXA 5JPDA 2YWXA 4CCWA 2PANA 4LRUA 3VJRA 3LHKA 1FRFS 3LL4A 3RVMA 3TZQA 3W5SA 4BV9A 5K8JB 4X93A 2FR8C 2EP5A 4OHVA 4Q7LA 3RRBA 3V1LA 5JAMA 3H8WA 4F97A 2UAGA 1EHIA 3LBFA 1UBJS 2QYTA 5AIAA 2AJ8A 5DHPA 1EBBA 1R0YA 3K6RA 4YI5A 3Q1KA 5DTJA 4ABYA 4C1BA 4DLWA 4YO8A 1PX2A 1V5GA 2H2AA 3K0CC 4DCGA 2IUEA 5ILOA 2Y2UA 2WG1A 2BF4A 3CNEA 1U98A 2IH5A 4AU1A 1QGOA 1Z12A 2ZROA 1BXRA 1JSCA 1KI9A 2A5LA 1EVIA 3LCVB 5IM5A 2YZGA 5F9MA 2IELA 2OXTA 3PFGA 2Z95A 3VO8A 3E6AA 3KYJB 4MW6A 4NE2A 5F7JA 3RVKA 4B83A 4EBBA 3N05A 4QYWA 5KOJB 4IXNA 1A5AB 1MB2A 4H16A 1UQRA 4BQQA 4CKYA 3QEMA 4PIPA 4CDRA 4GNKA 1H65A 3ZI4A 2P67A 1V2GA 3OM8A 3QUAA 5EZYA 3W8RA 3BZUA 4XGNA 3O1IC 1MO6A 5CB8A 2B9EA 1KOGA 4M1MA 1W87A 3Q3EA 3ZQKA 1M7HA 2NIPA 2CCGA 2NVOA 3HDGA 2P2NA 1VL2A 1W88B 2VYQA 3GRKA 5IZCA 4EAQA 3FLBA 5DM4A 4TTTS 2XUFA 4TXLA 1UJ2A 5IT5A 3PC4A 4A26A 4EGQA 1D1PA 1X2BA 2VJDA 3OCYA 4YACA 4ZI7B 5AHOA 2NADA 1EUCA 3DDUA 4H0FA 1NOIA 1CG6A 2E5FA 4YC7A 2I6XA 2DQSA 1DX9A 3G23A 4REQA 3TGWA 2V4UA 2JKVA 2H9AA 4FIZA 5T7BA 3S99A 1DT3A 3QA3E 1GPWB 4MS1A 3LLSA 2BFEB 4OXKA 3DUWA 3AVYA 4MO9A 4O8ZA 2IDMA 4OFXA 1G8YA 3DTVD 4G0VA 1E6KA 4MW4A 3TCXB 1E6LA 2XTZA 1OLUB 3PCRB 3MRVA 3TX6A 2ZCVA 1CUHA 1FRZA 4UU0A 1E3DA 4FYXA 3V48A 2XNKA 4WKNA 5E6UB 5JJCA 5IDQA 4E5NA 3CH4B 4MINA 5FYDA 1ZR2A 1WZNA 4DEVA 1OYWA 4XUDA 4AQ7A 3CR7A 2EWVA 5KHOC 3OCWA 4OCZA 5BWNA 1U8ZA 3HDVA 2X8AA 1LSUA 1QP8A 5CT4A 2FSUA 5CX1A 3LBNA 2VP2A 1ZL2A 4M1OA 3FF1A 4LJKA 5DASA 5ALEA 5C8XA 1U0HC 4OJKA 1KZYC 1YZ3A 2F6RA 2IY9A 3AETB 4TVBA 2NTJA 4YK7A 5KOHB 3PJRA 5K1ZA 4S1PA 2YHBA 3G0DA 2PKWA 1O94D 3M83A 4IG4A 1L9XA 1KK2A 4LJAA 4N5MA 1P33A 3IDQA 2QUZA 5K3EA 2NZWA 2D2IA 1JZTA 2HF7A 2MSEB 3C70A 1KBQA 1SUWA 2IXTA 1RBZA 2OO5C 2PJDA 2Q2WA 3D4NA 3D64A 4Q7JB 5E4TA 1JIVA 3SF0A 1EFHA 3R6GA 4MZXA 3VX3A 4YCCA 3A9RA 1DKPA 3A9SA 4JOCA 4OHUA 5E7IA 4O25A 2J85A 3KKKA 2XMSA 4LZLA 4MUJA 1T8SA 2MMCA 5D1NA 5E2AA 5GINE 2QTLA 3KCQA 3BMCB 1LD3A 1LUAA 4QYSA 3VC1A 1UJ5A 3VISA 1QQ7A 1VKRA 2GJKA 3ZHVA 4BP9A 4D0LB 2EP8A 2PFGA 3PNPA 4JI4B 3AM1A 1BCRA 1EX7A 4KMMA 3OZEA 2Q07A 4GOXA 5HP4A 2XUAA 4TTAA 1RJ9A 4ND8A 4RJLA 4IYJA 4A8JB 1J49A 1N7HA 3MJTA 4L76A 4M7OA 1NFFA 4PYRA 3VU9B 4FBGA 4CCSA 3DM9B 3E48A 2JANA 3HNPA 1RRFA 1EE1A 2R60A 4AG6A 4X61A 2PH7A 1U8YA 3KV1A 1WDLA 2A78A 1HY3A 1BG6A 2BFDB 1QONA 5KTMA 2J9RA 1F0PA 1SQ0A 3HYSA 3LAWA 2GX6A 1A82A 2I6UA 2CYBA 3OCUA 2WIGA 4M37A 4E51A 1V16B 4PF1A 3FLMA 3AONB 3TJRA 2H0AA 3LUGA 2O7NA 1DELA 4I9UA 4RY0A 1Q7GA 4YS6A 3UFBA 3WLOA 1N33B 1GADO 4UXHA 2EOAA 4KJXA 5TRTA 3RF7A 4YIKA 3EXFA 1QF9A 1UPUA 3RS2A 5A5VA 1HGXA 1Z26A 2HO5A 3AHEA 4KE7A 3BMOB 3C3AA 1Z3CA 3HUUA 2AOXA 5JISA 2ZJ1A 4RGQA 3LCRA 1CF2O 1E9EA 2IZ1A 4JKIA 1GSIA 3NS7A 3I5AA 1CS0B 3BF8A 3IVMA 3LYAA 4REOA 3S2EA 3QOFA 1Z37A 3OIUA 3U0BA 1JI3A 1MX3A 1RI4A 3F78A 3H2BA 3IIKA 4GAEA 4WZBB 5FQNA 4JR2A 5UKDA 1JI0A 2XD4A 3JQBC 3S27A 2ASVA 4F7WA 3I2HA 2YW2A 4XLZA 1RXEA 3DTNA 3EEIA 3OHPA 3CLTC 2IEZA 2RCNA 3GEHA 2ZYIA 4QVGA 3DYBA 4RLHA 3CF4A 4CKCB 1MMFB 3RFCA 1GCUA 1SVKA 4GPTA 4KV9A 4B85A 2YDYA 2W6PA 3DH0A 3LXXA 4U00A 4PCAA 3QPUA 1HRDA 3E22B 2B34A 3CHYA 4OHKA 5DULA 1JALA 2G9ZA 3Q3VA 4IEFB 3DAHA 5JSHA 1PTJA 3N9IA 3FNIA 4L0CA 4EB8A 4Z9XA 3U3RA 1ZS9A 1PFYA 2WAAA 3R5XA 4HNQA 4NWIA 2CNKA 3S0JA 5JXGA 5ICGA 4HZUA 1XMSA 1HC7A 4G56A 3ZWWA 4NVRA 1R66A 1HOXA 2Q6IA 1BNCA 3V80A 3ZIDA 4JLSA 2VQ6A 4U7TB 1ZCBA 3I5MA 5IKMA 2F3UA 4XYGA 3B1YA 1Z4MA 3R3UA 4MQBA 2RGNC 5DW3A 1RZRA 5T67A 4EFDA 1BGVA 4HNVA 4FEGA 1GQFA 3D02A 3LNTA 2IIQA 2L2QA 1Z9BA 4UEQA 3RTBA 1ZONA 2QYOA 1D0SA 4ZVNA 3C1OA 4IDDA 3MF4A 3GUUA 4QDJA 4ZOAA 2D8AA 1NOJA 2VJOA 2AOTB 3PPXA 4D5EA 4PG8A 2XTJA 1OFUA 4V03A 1EWVA 3IRUA 3ZWCA 2YN0A 2AIRA 2Y0BA 4WFIA 3IKVA 1N8KA 3CZRA 1MAVA 3DE3X 1U1DA 1OXVA 2YINC 1HDX