1KZGB

Dbscdc42(y889f)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 63
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kzgB00
5EP3A 1E2KA 3CRMA 4LSGA 4Q5IA 1E2DA 4BLTA 4M0LA 4EQ6A 2QP4A 2BMEA 1Q20A 2WVJA 3GLIB 1Z0DA 1H8ED 1R8QA 4MYCA 3GLIE 1U0HC 2GJ8A 3C5CA 2VP9A 1GSIA 4QNRA 1E0SA 1KZGB 2ZJOA 3WMFA 2FA9A 2GEDA 1XMIA 4M1OA 4LPSA 1U81A 3NBFA 4RD4A 4LRWA 2AR7A 1QHIA 2MMGA 4OK3A 4TLDA 1NNEA 4L8GA 3DM9B 2WMOB 3X1ZA 4KCGA 3DM5A 4TZ6A 1MH1A 3K0EA 4JSYA 4B2PA 1H65A 1P62B 2FG5A 1W0KA 4EDHA 2BMJA 3BXZA 2ZAOA 2OT3B 4U5XA 1IAQA 2HLDD 3CB4A 5DN6A 1R5BA 5CM8B 4NH0A 4OYHA 3BOSA 1VDZA 3H0KA 3G5UA 1E79D 4AK9A 4KBGA 3W5IA 5A0FA 2AXPA 3C5HA 3IPYA 2R9VA 1N6KA 2FPKA 5D3MB 1NBMA 2CCKA 3B6EA 1FX0B 2ZYWX 3G0HA 2QMUA 1JEDA 3BAFA 5EQTA 2JLQA 3CR7A 1V5WA 1NN1A 2H92A 3B1WA 4QNMA 4ARZB 2F1RA 2CNWD 2AKYA 3RRMA 2C8VA 3VR4A 1KI3A 1XB2A 4CEIA 5KTYA 1KKLA 3HJNA 3VFDA 1XCGB 2NG1A 5L3SA 3HYTA 4ZCIA 1N6NA 2BVNA 1BOFA 3P20A 4GOXA 4IVRA 4LOAA 5JRJA 2QRZA 3KQKA 2GF0A 1BKDR 1Z2AA 4LYHA 4NYIR 1GTVA 3ZDQA 3TW4A 1PV4A 3D7MA 1VHLA 1OB2A 2VA8A 2K5UA 2O8FB 3MWJA 1YE8A 3U44B 5JJKA 4MITA 1QHHB 2LKCA 4ON9A 1UFQA 1E1RD 3CH4B 3HPQA 4QBHA 1GFIA 2D74A 1XZPA 5EXSA 3IHWA 2ZSFA 1XCPA 4TYNA 4BFVA 4A8JA 3ZQJA 1U9IC 2JJ1A 1PLJA 1JJ7A 3VR5A 5M04A 3A1TA 3KQNA 2QQ0A 4LX0A 5JS7A 3K0CA 4L4UA 4DDTA 2WSMA 2V6JA 1E4VA 1TQ2A 4BZPA 3FHCB 5CB6A 1GVNB 1TQ6A 3LW7A 4K81B 4LDJA 1CR4A 5BQ5A 5L3VA 4TSFA 3U5ZB 4MGKR 4WA7A 621PA 1Q44A 3C4JA 2VSOA 3T1TA 4TLBA 1XEXA 2V3CC 1KMHA 4P4SA 4QL3A 1G3IA 5EJEA 4RVCA 1P6XA 3H4MA 4EJSA 4FIDA 2FGKA 2CLCX 3SJAA 4Q7KA 2C03A 5JJLA 1R0YA 2GJKA 4GZLA 2CEAA 2NQ2C 3SDZA 1RPZA 1KO1A 2BJWA 3CW2A 2VO1A 3UMRA 2IXEA 1ZW6A 2J0UA 2ZRIA 5UKDA 2XZLA 4KYIB 1NRJB 3RC8A 2RGBA 2ZU0C 1WRBA 5FR1A 5KPDA 1KI9A 3DHWC 3IPXA 2R6CA 3DEFA 4LK2A 3RDPA 5G40A 2Q3MA 3U7EB 1M2OB 3Q7PA 1T3SA 4TMVA 3OE7D 1KI2A 1VCIA 4B43A 1KY2A 2H57A 3O8RA 3KQUA 1GG2A 1AM4D 4JLPA 4XJXA 3NTUA 1FP7A 4W7SA 1C4OA 1KI1A 1G16A 1NN0A 2ANCA 2ORIA 3A4LA 4M53A 1DG3A 2WWFA 4XTCS 1UEJA 3VR1A 3CRRA 1E69A 3QKUA 4HEJA 1J2JA 3RS2A 4LPKA 4DJTA 2CLDX 5LD2C 4NCJA 1F2UA 5FPYA 4PQRA 1MO4A 3ZZTA 1HT1E 2RB4A 2FOLA 2VSXA 3U3MA 4JZKA 5FTLA 3UMFA 4ZDJA 5EE1A 3R8CA 1NMYA 1II8A 1GP2A 4GMDA 2VHJA 5TB5A 5BN3A 3IKJA 5FH9A 1DPFA 5HKKD 4V0MA 3B60A 1X8LA 4CT4B 3KUDA 2XXAA 5EUQB 3FHTA 3CLVA 5F98A 1PLKA 1TL7C 1S96A 4PPNA 1XMSA 2GCOB 1Z47A 2QT1A 4TZ0A 2PZGA 2HF8A 4O0MA 5FPSA 1X8JA 1E0AA 5EXXA 4AKIA 4NDZA 2ZI5A 3B5JA 4WZAE 3UK6A 3NBXX 3P26A 3CWQA 3GJ4A 3QXXA 1FQJA 3ASYA 2QE7A 1D2MA 4CGZA 5KUTA 2BV3A 1A2BA 2G1KA 3DKVA 4HDOB 3GLIA 4DZZA 1XFAA 1KI6A 1L4UA 5FUYA 3U3JA 4MRRA 3WNBA 1JQLB 3KJHA 5CIWA 4RZUA 3AVPA 1JPNA 1XTJA 3QY0A 5GJBA 4UXIA 3BFKA 4CW7A 1FQKA 1GUAA 5E4FA 3UMSA 1H8HD 3LV8A 2QSZA 1F3OA 4G01B 2XGJA 1GDDA 2ZS7A 4NP6A 3OFND 3RANA 3FHOA 3ICQB 1W2HA 4JLMA 4QJ3A 3ZVNA 4A2QA 5H68A 2VEDA 1QHNA 1OHHD 2WJYA 1YHNA 2Z83A 3AKEA 3TQCA 2PJZA 1ZNZA 4A0FA 2ODWA 4UNQA 2ZRAA 1KSFX 3W9YA 4IRUB 4D4MA 1VG8A 2A78A 4HZIA 1DAHA 1ZU4A 3RS4A 4EPYA 3EARA 4Q19A 1N5KA 5D3MA 5IF9A 3NDPA 3HU2A 1Z0AA 4TT3D 1FX0A 1R4AA 4I99A 1KY3A 4PQYA 1N2CE 4TLEA 1ZP6A 5J5CA 1SULA 4ARZA 4JLOA 4ZI2A 2Q21A 3M0EA 4BASA 1SHZA 3W6NA 4W5JA 2ERXA 4DCNA 4QGFA 2DCUA 2VIIA 4PHTA 5JWOA 4RZ3A 4LJ9A 3K70C 1EWQA 2QROA 1OXUA 3T35A 1KI8A 3GCGA 3MUFA 2FPLA 1CKEA 5EP4A 4KO8A 5DHAA 4AC9A 1HYQA 1U2RA 1TADA 2O8FA 5FI0B 3U44A 2OCAA 4UQOA 2C77A 4DUGA 2IX3A 1XF9A 2WBLC 1IN5A 1Q3TA 5HR5A 3QF4B 5G3ZA 1ZM3A 3GJXC 1IXZA 1U9IA 1G8HA 3U6KA 1S4QA 4DLUA 3GLGA 1YR9A 2AD1A 3IQXA 4MKGA 3W90A 2FFHA 1LTQA 3T15A 4TL8A 3REFA 2YOFA 5B57C 1E98A 5EP1A 1X6VA 4C0SA 2X8AA 4B48A 5J4YA 2QM7A 2Q0HA 3MGCA 2NO1A 3OEHA 3VHLB 4G5SA 2QEQA 2NPIA 4QJ5A 2ZR7A 1XRJA 2ZI6A 4F38A 3GLFA 4WVFA 4POAA 1W36C 2GCPA 3AF2A 1A1VA 1TEVA 3E70C 1AGRA 1W36B 2ZUDA 3LBHA 3QPWA 1W4RA 1OPXA 3T61A 2ZJ2A 4P4TA 2D06A 3RSOA 4OQLA 4CIDA 3QXHA 3RC3A 1SGWA 1V43A 1BMFD 2QGNA 4UJ3A 1W0KD 4LV5B 4A2WA 1JR3D 1RZ3A 2QGZA 1AZTA 2R2AA 2ZJBA 4XH9B 4AKEA 1OH6A 1OB5A 4NZYA 4OJKA 5AJXA 5DN6D 5LB2A 5IHPA 4MGYR 2PZFA 4KJZA 1U90A 2AN9A 1W4BA 2BCJQ 4JLAA 2ZE7A 1G291 1F48A 1M7GA 4HUQB 3ND9A 2BKUA 2BBWA 5TVKA 1FUKA 1NSFA 1LY1A 3K09C 4HLQB 1SVMA 4DB2A 1Q1EA 4MUBA 4TMTA 3ZD7A 3IIKA 2BKEA 2V7QA 1NY5A 5D3QA 3IUYA 1CBUA 1QDEA 4EPWA 3CM0A 2MSCB 1FPMA 2AXNA 1E9SA 4FWIB 1NLZA 1R6BX 2OCPA 2WJVA 4LC1A 3BE4A 1W1WA 5FPHA 3SHWA 3CUEF 4OQMA 2PCLA 2P5SA 3BFVA 4UNPA 3U60B 1IQPA 4DWJA 4F4CA 3VHXA 1S9HA 4Q4LA 2QORA 1UBGA 2GCOA 3B85A 1M34E 2FDCA 3TSOA 4HAVA 1NSTA 1UEIA 4TL7A 1GRQA 5EUMA 4QHTA 1UJ2A 2XTMA 4FN5A 3L2OB 5JWRA 1FUUA 3FMFA 2GZAA 4LY6A 4Q00A 4F92B 1CIPA 5L3RA 4X8OA 2O8CB 2EWVA 2RHMA 5DI9A 1J7KA 2PL3A 4WXRA 4BQSA 2Q9AA 2WICA 2CXXA 3B9QA 1VMAA 4G5RA 4TSFD 4ZCMA 2D7CA 1KO8A 1YRBA 3QJYA 1AK2A 5TXGA 1W4CA 4M9QA 4WIAA 2WPDD 3CX7A 3TW8B 3KKQA 1E2QA 4C7OA 2GJAA 3N70A 4R2IA 3AKDA 1W5SA 2JASA 5CLLA 2QPTA 3LY5A 1GNRA 3L8YA 3TIFA 3A1SA 4IOMA 1W5TA 1MV5A 3RWOA 3LX5A 3KXIA 1XEWX 4KFSA 2ERYA 5LBIA 1IY1A 1DAFA 1CJVC 1J99A 3PJRA 5AJYA 4II7A 2ZR9A 4BUJA 3SS8A 3THOA 2O52A 2Y8EA 2IHYA 4ZDKA 2AFIE 3H84A 1U0JA 2PEYA 2GXSA 3RS0A 4FCTA 1RC8A 3ZGXA 3KDSE 4BLSA 4TL9A 1DEKA 3KZ1E 1KOFA 1O3YA 1II9A 2GVZC 3OAAD 2G6BA 2GAAA 1ZC4A 4KFUA 1E2FA 3K9NA 3QG5A 3IO3A 4IXMA 1G5PA 3ADKA 2AWNA 1MABA 1U8AA 3B78A 4GOJA 1G3UA 2UZIR 4M4SA 4HI0E 4Q48A 4YMUA 3QBVA 1L2TA 3QQ5A 1KDPA 5FBLB 1N5LA 3WRXC 4A0RA 4PPQA 1N5JA 4LUCA 3THWA 5HTKA 4BLOA 1G9XA 2GDJA 2H7VA 2QBYB 4B3FX 4ESVA 2DYKA 5JJIA 2P6UA 4HB4A 1US8B 5FL7A 3R9IA 1Z83A 2EFHB 1KSGA 4DT1A 4HZUB 1W4AA 5IT5A 4RD1A 5DYGA 1G7TA 3QF4A 1F6BA 1KIMA 1Q21A 2G1JA 1KK0A 4GDFA 1HA3A 2ZRFA 5HZHA 3N5CA 2WAXA 2WJHA 4D80A 4KHZA 4C3ZA 3RSLA 1KJYA 4M1MA 1L7VC 1TU4A 4LZZA 3RRYA 2Z4RA 3VR3A 2B8WA 2XB4A 1NBME 5B64A 5B30A 3WP0A 5J4HA 1W0JA 2ZROA 4NPHA 4J0QA 1OH7A 2VH5R 3BIFA 3LRPA 2KSQA 1TPZA 1EFRD 3T5DA 3K9HA 1A82A 1N6PA 4RKFA 1YU9A 2YZ2A 1RYHA 1ZU5A 1FNMA 4JL5A 1ZBDA 4KSBA 2D62A 4RCZA 2VQSA 4YMSA 3AB3A 4YDHB 2RGNC 4RZ2A 2BCGY 2I1QA 4PTLA 2W0MA 2IYTA 2ZYUX 4RKEA 5B2ZA 5DH9A 1ZD9A 1E0JA 2ANBA 4K8OA 2OHFA 5AUPB 3AVQA 3EZ6A 4NL4H 4JKYA 4XVQA 4KLZA 3KQHA 3AVUA 3U3OA 3SFZA 4B33A 2UZ3A 2YC2C 4IDHA 2WTUA 4I4LA 1NMXA 4YDSA 2PT7A 1UADA 4V0NA 2O0KA 3AF4A 2MSDB 2DPXA 3K09A 4DIDA 4CF7A 2J59A 4C0JA 5EXTA 3A6PC 2CL6X 3OHMA 4N0EA 4Q66C 3VR6A 1KMHB 4P4SB 3B13B 1Z6TA 5LB4A 2QL6A 4ZKEA 1S1MA 1SVKA 2C9OA 2CBZA 4CYMA 4EJSB 2QU8A 3PQCA 1R5NA 2XJ4A 1BYIA 3KX2A 4IOJA 1I4DD 1JAHA 3FB4A 3IQWA 1D8TA 1CRQA 2DWQA 2QENA 3GJ7A 5HE8A 5GADl 1R8SA 3JZAA 3ZVRA 4V03A 1HY3A 3CX8A 2QI9C 1EXMA 2C95A 3SYLA 4DUGD 1KKMA 1VECA 4ZDIA 3BORA 1GOTA 3M6AA 2JJ2A 4MYTA 3SYKA 4TTRA 2IL1A 2R6AA 4XSGA 3NDBB 1XPOA 1E9AA 4BRUA 1AZSC 1E96A 5EP2A 5DYIA 1E9CA 1CJTC 5BW8A 4GP7A 2DFKB 2FGJA 2JLXA 2QMEA 1OXXK 1G41A 3PUZA 2CJWA 3Q7QA 1GNPA 5BWMA 2O8CA 1KSJA 4LBWA 3MWLA 2NOAA 1EFCA 4OI0A 2MSEB 3B2EA 2OAP1 2VYFA 3OEHD 3HR7A 4PANA 1QHXA 3DMDA 4P3YA 2D2FA 4DHEA 1P72A 1Y3AA 4Z51A 4LHWA 2ZI4A 5H70A 1G3QA 1KZ7B 1LS1A 3FKSA 3FYHA 1Y63A 4K46A 4JKIA 4LCBA 1AIPA 1NMZA 1II8B 3S1AB 4W5HA 2LCFA 1KDTA 4YMWA 4JJKA 4QJ4A 1KJWA 1VHTA 5FUWA 4E5UA 1E2LA 3SI7A 1JNYA 1G8PA 2VHUA 1XX6A 4KI0A 4DCVA 4EFMA 1KI7A 2GZDA 3CR8A 5JI2E 1N25A 4XOIA 2BBSA 4MGZR 4UNRA 2QPAA 1JI0A 3V00A 3CBQA 1XDBA 2IYUA 2JGNA 1ZUIA 3OEED 3LLUA 3AH8A 5FTNA 3RS3A 1KSHA 2X19A 3W3AA 3KKPA 4OL0A 4RD3A 2GA8A 1KI6B 2OESA 1IOZA 2FJUA 2KI5A 1Z6AA 2PX0A 5AR1A 5SZIA 4B34A 3P1JA 4WBSA 1WE2A 4Z54A 4FW9A 1E2PA 2CCJA 2IF2A 2ORWA 1Z08A 4QOSA 1U99A 4NCNA 4AURA 2NO0A 2IYLD 1CR0A 1QVRA 4FINA 5DNYB 721PA 2FEOA 2X77A 3TQFA 4B3BA 1DAEA 2Z43A 3LA6A 2QBYA 2WJGA 4PSKA 3UG7A 3EWAA 4H1UA 3X1YA 1US8A 4YLGA 3ECCA 3K53A 4HZUA 3OIWA 3GFPA 4EIWA 2JA1A 1UAAA 5C1BA 2F43B 1X3SA 4OHZA 4N1AA 4PZYA 2L0XA 3LVQE 4NCKA 5HCIA 2HXSA 1G8YA 3AGPA 2OBNA 1ZAKA 4JMPA 2E1RA 3EA5A 1OKKA 1KDRA 1G20E 5JS8A 3PEUA 3FPAA 1KHTA 5HE9A 2W6IA 3SJZA 3X1DA 3Q85A 4JS0A 4IOKA 4LWZA 2QP3A 2EYUA 2CE2X 4KFRA 4PAMA 1VKJA 1R0WA 3EC1A 5DO9A 3EASA 4A0GA 2ZRPA 5LDDC 5JZVA 4IOLA 1WF3A 1LS6A 2Q9BA 1P9WA 2ZJYA 2P6NA 4DLWA 2B6HA 2IBMA 2IXGA 2ZANA 3DL0A 1ONBA 2ODBA 5CIQA 4UXJA 3V4FA 2ZRJA 2FPMA 1N6RA 3IIMA 3N2IA 1XD2B 5C46F 2RGNA 4GZMA 2A7QA 3VQTA 2O8EB 1JEEA 3EPKA 1E1QD 3EIQA 4QBIA 4A15A 3J81k 1HE1C 3KFVA 3GLGB 4MDFA 4DCUA 2PH1A 1G17A 2YOGA 3GLGE 4CEJB 4AYWA 2VPPA 2HV8A 1MKYA 1ZCAA 2Q3FA 5JSZB 3E5HA 3QKTA 4DSNA 2FWRA 1DO0A 2DHRA 3Q5EA 4DDVA 1T91A 2J7PA 5F3WB 1WQ1R 1E2MA 2AK2A 3KJIA 8OHMA 3T1VA 5JRZA 4A36A 1JALA 3RVBA 1U0LA 3NHBA 5CM9C 2AFHE 3AEZA 4C9BA 3GLFB 1E6CA 3GLFE 1IN6A 4PC6A 2OZEA 4BFUA 3O8BA 3GLHB 2EVWX 2OBMA 5G53C 4YMVA 3GLHE 1E9EA 4LI0A 4PSAA 5AJZA 2IEZA 2JJ8A 1Q1BA 2OAQ1 4Z1MD 2XZPA 3B9PA 1CR1A 2GKSA 2N46A 2GESA 2JDIA 1G64A 3QG1A 4MYHA 4Q9KA 4A4DA 1GKIA 2WWGA 2G9NA 1E4YA 3MSXA 3QVUA 1ODFA 2WHXA 1QZXA 4XWOA 5TDHA 1RJ9B 2F3TA 4PO8A 3CNOA 2J0VA 3JZMA 5J47A 3I73A 1QVAA 1NIJA 2C04A 1VG1A 2PLFA 1NJGA 2WZQA 1QF9A 5DHFA 2A5DA 4Z8YA 4JLJA 2IS6A 2N1BA 1G5TA 3WBKA 1UKZA 4B2IA 3DKPA 1P5ZB 1GIAA 2A9KA 3IIJA 4MQBA 4TL6A 4WZBE 2D7DA 4OK6A 1LF5A 1U98A 3EC2A 4Q1FA 2IUTA 1S0UA 4QHSA 1QHYA 4MYUA 3TK1A 4YMTA 1D6JA 2ZETA 5EE0A 2B21A 4JL6A 4DEYA 1G21E 4LYJA 2GJSA 3MAAC 4RFSA 3NXSA 4C30A 2RHDA 3X1XA 1XTQA 4DEXA 3BH7A 5LD2B 1KYIA 2FSFA 3BD9A 3D3QA 3AF0A 3FWYA 4GSYA 3LNCA 2J46A 4D82A 4DCTA 1EWRA 1KNXA 1SVLA 2ZIAA 3S1AA 4ASUA 1G5RA 1DARA 1Z29A 5L8VA 2HYDA 3CKLA 2VHCA 3GEHA 4IKEA 2ZR0A 1J8MF 1WP9A 2NO6A 1IXRC 4H1VA 1E9FA 1S8FA 2QMOA 4CEHB 3CIOA 4AKGA 5FPKA 2ZUBA 2B92A 4NTZA 3RS5A 3AP2A 1YZNA 3FVQA 2GXQA 4RY2A 1IXSB 3R7WA 1JR6A 1KO5A 3L82B 2PMDA 3KTAA 1OT3A 5JI3E 3QNUA 2BEJA 3AVYA 4LJ5A 1T0JB 4JIMA 1ZNYA 3L0OA 1XCMA 4BFZA 1N6HA 4DVGA 4CVNA 2GETA 2QRNA 2XOKD 1XPUA 4NYIQ 3AVVA 1A7JA 3CF6R 4I1OA 1MRNA 3RLFA 5JLJA 2NIPA 1OIXA 4KVAA 4XD7A 2R6GA 2QG6A 2W6JA 3WHKA 1VPLA 4FMCF 2J45A 3ZIAA 3SEAA 4L16A 4ZO4A 4C7OB 1S3SA 2JLRA 4L9SA 4Q7MB 5KNBA 2O0HA 2J0SA 4QBGB 3K8YA 4URZR 2FF7A 5FTKA 2YWFA 1N0WA 5J4KA 1G4AE 2H1LA 2OFOA 2W00A 3K9GA 4M2LA 5EXPA 2NPFA 4ESHA 4CT5A 3FMOB 1DTSA 4RD6A 1NJFA 221PA 1VCOA 2VRWA 4GFDA 2F6RA 4URYR 2J87A 4D0GA 4QM7A 4H9GA 2CL7X 2F43A 2IC5A 2LWIA 4BFSA 3KB1A 3PCRB 2B8TA 3RYTC 2ZRNA 1T6NA 1T5IA 1AQYA 2VTKA 3AP3A 4HB0A 2HT1A 3DMNA 1OIVA 2FU5C 1E2JA 2R44A 1KK2A 3MD0A 2DBYA 1L4YA 4UNNA 3JVUA 4QM6A 3SOPA 3TAHA 5KDLA 1E2NA 2OBLA 2OLJA 1RIFA 1MABB 2VL7A 2XNSA 3ND8A 2ZSEA 3NIBA 3LX8A 5IK2D 4MDEA 1OLOA 1SQ5A 2XTNA 2BOVA 3LO5A 3H2YA 1Z22A 421PA 4BE7B 1NG9A 2X2EA 2ATXA 3K70B 1I2MA 2XX3A 2BHRA 3THWB 4B32A 1G4UR 1D2EA 2YOHA 4U7DA 1Q0UA 3FMIA 1XD8A 4TMWA 1IBRA 2WKQA 2RGGA 4W9MC 2GTPA 1XD2A 2H8KA 4TQUS 4B44A 3I4LA 1P4SA 1F5NA 3BB1A 4DT1B 2XB2A 3ZS9A 4EFNA 2O8EA 1UKVY 2WKRA 3T34A 2JLZA 1ETUA 1TQDA 1XMVA 4NYMQ 1MRSA 1PJRA 1MO5A 3TR0A 5KSZA 3Q9LA 4CEJA 3KFXA 2F1IA 3QXSA 1P9RA 3A4NA 4JLNA 5FUXA 1E2IA 2IA5A 1Z2CA 4BRWA 5JSZA 1ZUNB 3CZPA 1XNJA 4O25A 3VX3A 1W7AA 4TTPA 1GL9B 2JCSA 4U00A 1G18A 4OQXA 4Q1CA 2DFTA 2FV8A 2C96A 3H86A 3NHAA 1TNDA 2ZI7A 4OI4A 4A1FA 1BO6A 2YYZA 2CCGA 4F7WA 3GLHA 3ZZUA 3GJ8A 1IJFA 3T12A 4IW3B 3THXB 2P67A 3C15C 5CK4A 1LFDB 3RHFA 4JT4A 3B1YA 1Z07A 1GKUB 1T0HB 3BBPA 4IFEA 2VP5A 3CPHA 2A5FA 1E32A 4S35A 3R9WA 3EXAA 3U7FB 3D6TB 4QGGA 2EWWA 4PAOA 3KXKA 1RJ9A 1G3RA 2CHVA 2RGEA 2FE4A 3MJRA 1VTKA 2AD5A 2QA5A 5JBQA 2XTZA 2UVQA 3QKSB 4C2TA 2R6DA 1E94E 2QUZA 1AA9A 1KI4A 2XJ9A 3T1QA 3RABA 2LKDA 1JBKA 3WRYC 3AGQA 1U8ZA 1P2SA 5BN4A 5EZ5A 1P2TA 1YVDA 1NBMD 1GRNA 3KUCA 4DLVA 3SQXA 2CHQA 3KJEA 3TNFA 4TLAA 5GJCA 3SU8A 3DOEA 3OESA 4FMDF 4N3NA 3QVVA 4EAQA 4X8MA 2ZQ5A 3I5YA 4RSGA 1EK0A 2TMKA 2A5YB 1PVOA 2QTFA 5K8UA 1C1YA 1W44A 3SJCA 2NO7A 3GFTA 4DSUA 1SKYB 2JLVA 1JJVA 1Q12A 4OBEA 1SKYE 5C2JB 1O87A 1GRRA 1WA5A 2ZRLA 2C2HA 4JSTA 2KBEA 2KB0A 4PSVA 2ZI9A 2IW3A 4B73A 2IYVA 3WYGA 4AG6A 2PLRA 3QIAA 4MH0R 4C2UA 3G82C 4OHXA 4Q9LA 1IONA 5FBWB 1NL3A 4P31A 3K0FA 4Q7LA 1H8EA 4CEHA 1FNNA 4OQNA 3C8UA 3F5FA 4GBMA 3QUSA 3W6OA 1E9BA 3W6PA 3ZYCA 3VAAA 4EPVA 1OH5A 2W2XA 3QBTA 5P21A 1XD9A 1IY0A 2YVUA 1ZD8A 2Z5FA 4URXR 1HURA 3CRW1 4ZV4A 3D31A 2IYZA 1BYUA 3X1WA 2P0EA 4AYTA 2NZJA 2ZAMA 4AIIA 2JJ1D 4M9XA 5E95A 5AK0A 3IEVA 1OFIA 3VKHA 3WMGA 4EPTA 5ANRB 2CJWB 4D4JA 4FMCB 1MR3F 4Q21A 1ZD1A 3RS7A 1TU3A 5JCPA 1GWNA 2P65A 3ADCA 5CYPA 2HLDA 1RFLA 1EX7A 1FZQA 1P2VA 4B3CA 1G8GA 2VSFA 3EWSA 3L0PA 2VHTA 2JIZA 2ZJZA 2G0TA 4LGMA 3DVLA 4DLXA 3GJ5A 1QHGA 3WMEA 4V0LA 3I3SR 3OIYA 3KXLA 1C9KA 1S1CA 5BYJA 4QFMA 1D2NA 5SZKB 1LVGA 2REXB 2GWHA 4LC0A 3EPLA 2CNWA 5DSZA 1NKTA 1Z6GA 2YWEA 4TLCA 1ZYUA 2WV9A 3LH5A 2SHKA 1OXSC 1T3HA 1TUEA 3C16C 3LW8A 4KAXA 5FOTA 4AG5A 2ZJAA 3V4RA 1D9XA 2F1HA 2KBFA 1UM8A 3QF7A 4M9ZA 4NHOA 4HAUA 5BXQC 2WJIA 3QENA 4G5OA 1TUIA 3DZ8A 3SN6A 3QEOA 3EZFA 2CVFA 2IEYA 2OILA 2F7SA 2OFWA 2V1XA 4A6PA 5FOSA 4ZCLA 2IS2A 2UKDA 2OXRA 2WWHA 3GFOA 1M7HA 1W46A 1E2HA 3O8DA 4LV6A 4QGAA 2IUUA 3RRNA 4A0HA 3UANA 3NVAA 2HDNB 1E1RA 1NKSA 4ITRC 4BWYA 1FTNA 5AUOB 2QQEA 1ELOA 2ZRCA 1R0ZA 2OM2A 3ZQ6A 2OG2A 1W2GA 1L8QA 3SC3A 3A36A 3SYNA 1T5LA 3K1JA 1ESMA 1FOEB 3B82A 5TMPA 5A4JA 2Z6VA 4Q1BA 4ASUD 3U3KA 3TGPA 2ZRDA 4MGIR 1K8RA 3LQRA 5C4GB 1DS6A 1HV8A 3W34A 2V1UA 1GM5A 1YR7A 2D3WA 1Z0JA 1VG9B 1KO7A 1TF2A 2AWOA 2G88A 3NBYC 3Q3JB 1VIAA 5DIFA 3K9LA 2XZOA 3PEYA 2GBLC 3CPEA 3PIRA 1UKYA 3VKGA 2XEXA 3IBYA 4JBYA 3B8HA 1YZQA 4MRNA 4Q02A 1R7RA 4IEEA 2ZEJA 4JVNA 3DO6A 3K0SA 4CRWB 2PJRA 5DE3A 5IRCD 2EQBA 1KK3A 3LWNA 1XEFA 4KU4A 1QHSA 1WCV1 4AI6A 2QE7D 2ZVPX 1YR8A 1WDTA 1T8TA 1DAKA 2KWIA 4URVR 1JPJA 1ZUHA 4B3XA 3PUWA 2AKAB 1JR3E 2IK8A 5FL3A 2BM0A 4XD7D 4PPGA 3W5JA 2AHOA 2V55B 2IYXA 1OW3B 3EZ2A 1KMQA 2ZRGA 3VU9B 1NLYA 5AJWA 3RRZA 2OFXA 2ZJ5A 4A9AA 4LHVA 3THXA 1NI3A 4BFYA 2HT6A 1EGAA 1Z5ZA 2PBRA 3EIHA 4IVPA 3GJ3A 4CDGA 4NYJQ 5K8IA 4PFSA 3A4MA 5G41A 5CITA 1HQYE 2PZEA 4IEIA 1NVUQ 3B1ZA 4LJAA 3WBJA 4C0QC 5B58C 4HDCA 4JLVA 5KSYA 3GEIA 4TMKA 5TY0A 1NVVQ 3QKSA 2V8OA 1E3MA 2RGXA 4M22A 1XJCA 1RRGA 4DB4A 2I1VB 4UJ5A 4FCWA 2C78A 4FMDB 3B1XA 2QPOA 2Z4SA 3CONA 1M1YE 4DLTA 5HKKA 4IDPA 1UDXA 1WBBA 2I3BA 4JL8A 1BS1A 2C5LA 3GPLA 4DLRA 3EX7C 4OKSA 4HLUC 1CJUC 3IHLA 4URUR 1J8YF 2QTVB 3QPUA 1Z06A 3MMPA 1NN3A 3O47A 2A2ZA 2IWRA 3IGFA 2VHQA 4BLQA 4JBXA 4L5BA 4DXAA 1OXVA 2ZSAA 2ZSBA 4M1SA 4MKHA 2PT5A 1TX4B 2BIFA 4ZDWA 1YZTA 4Q4HA 5CYOA 1COWA 1MOZA 2QMHA 3ADBA 3A1UA 5DLQC 2P5TB 4HUTA 4GI7A 4P4UA 1G6OA 1YZUA 3VKWA 3WXMA 1XTIA 3BGWA 2KJQA 4MA4A 5JCZA 1P60A 1FMLA 2YINC 3L0IB 4KVGA 1CXZA 2CLSA 2IHBA 3HR8A 3TVDA 1FP6A 4B71A 3NH6A 1W48A 1VIYA 4Q4JB 4D26A 1YRAA 3CWZA 5F9FA 4D25A 4EPXA 4LJ6A 3IILA 1WXQA 2QAGC 3A37A 3I61A 3AM1A 2QAGB 4QG7A 4GT1A 3BH6A 1GZSA 1D5CA 3MRSA 3AVWA 2O8BB 1OHHA 4HAWA 3HPRA 3EIEA 4RFSB 4B75A 4IVQA 1CF4A 3K0AB 2GILA 4Q4AA 1OXTA 2IS1A 4MKIA 2D2EA 4C4PA 1DVRA 1XP8A 2WOOA 2XITA 1XXHB 3HYRA 3NWJA 4D4LA 1XXHE 1OJLA 1DE0A 2IYRA 3REGA 2C9CA 2QZ4A 4KXFB 4C0BA 3EPJA 1P2UA 1ZIPA 2B7CA 3X2SA 2HUPA 3AUYA 3F8TA 3ZLJA 1RVDA 2WSSA 1GL7A 3KKMA 1E9RA 2EU8A 3P4YA 1AS2A 4M1WA 1PLLA 4QBFA 3R20A 2O8DB 2C9YA 3PFIA 4RJLA 4R2HA 3PVSA 1YQTA 2DB3A 3NC0C 3R7WB 2YWHA 4X8HA 3KTAB 3UG6A 4EFLA 2W2VA 1ZM7A 2FFBA 2NZ8A 3V9PA 2QN6A 3UPUA 4MRVA 4PAQA 4ILEA 5FPTA 2QTHA 2R8RA 1CS4C 3R9XA 3DOFA 4PZLA 2GNOA 1OE0A 3Q72A 2BWJA 1XTRA 2ZPTX 1JAIA 2FSIA 2H5EA 4M9SA 4Y0VA 3TSWA 3TUJC 3BK7A 2ONJA 2ZE8A 2BM1A 1GL6A 2C98A 2V7QD 4FD2A 3TKLA 2DFLA 2ZITA 2EFCB 3SJBA 1DELA 3TR5A 4JT2A 4JLKA 5C4MA 1RYFA 1EG7A 1YR6A 2A5JA 3AQ4A 2WAYA 3OF5A 4LHXA 3TLXA 2BMFA 4DDUA 4WZ6A 3QOFA 2J41A 3BB4A 3DZDA 5FR2A 1CP2A 1T4GA 3VX4A 1VCNA 4OJQA 3A1VA 3CF2A 3U6BA 3U3RA 4ERNA 1AJEA 1OYWA 3GJ0A 1Z8FA 2BC9A 3MFYA 1EX6A 1XJ0A 1S3GA 2DWPA 2GBLA 3QI2A 4PC2A 5FBRB 4OI1A 3RWMB 4DCSA 2VP2A 2ZE5A 3KJGA 1ZM4A 2WJJA 3QE0A 1R10A 2FX3A 3U4QA 1XTKA 5J40A 3A1WA 2J5XA 1P9NA 1AS0A 4JVLA 2ODNA 4C0HA 1BMFA 1B0UA 1PZNA 4XVUA 2A3RA 1SVIA 2EFGA 3AF3A 1JR3A 5EZ6B 3SR0A 5L3QA 3QEJA 3TH5A 1YKSA 2OXCA 2O5VA 4PXAA 2QP9X 5JHGB 5FOWA 2GCNA 3C7KA 4HYYA 4TYWA 3VU9A 4KYUA 1JQJC 5J4VA 2F9MA 2JIZD 4QRHA 4ACBA 4EUNA 1UBEA 4L9WA 4A92A 4FI3C 2NO9A 2ORVA 1TF5A 4XWKA 3W3ZB 1TEXA 1A4RA 4LJ7A 4LV8B 2ZE6A 4D4KA 2GEVA 4HB3A 3HU1A 2VF8A 5GJVC 3HU3A 1XBTA 1QG2A 3PG5A 1LNZA 5AJVB 3T1OA 2HF9A 4NE2A 5JWHA 1OFUX 4BFXA 1EFHA 1SXJC 1S9DA 1SXJB 1SXJE 5FOVA 1X8KA 3NKVA 5FOUA 2R65A 3TBKA 2W0SA 2YV5A 3M4YA 4DSTA 3QXJA 4O2RA 4DLSA 1P7CA 3W8NA 1IN7A 521PA 2REOA 2JLYA 1BIFA 1E2EA 1FL9A 3CNLA 3PXGA 2RCNA 4HLUA 2VP6A 5C18A 2JLWA 3ADDA 4P0TA 4B3GA 1I2DA 3PEVA 1CU1A 4D81A 1MO3A 4US1R 1ZINA 1IN4A 5CK5A 5KPJA 4DIEA 1CJKC 2OSBA 3K70D 2EW1A 4HAYA 1G7RA 2H17A 3T06B 5KDDA 1XWIA 4HSEA 4OHVA 1XU4A 1ZRHA 5E7IA 3U7HB 1RE0A 4JVSB 5FL7D 3F0TA 4L15A 4ZKDA 1ESNA 1UBFA 4M21A 3KQLA 5BYKA 2WPDA 4PPFA 4F4JA 1OH8A 3E1SA 1T9HA 4W5WA 3SBDA 4B35A 3UWOA 3SE0A 2MMCA 2ZS8A 4ACAA 2FZ4A 2CK3A 4NBSA 1Z6YA 3U61B 4E03A 4Q4JA 2WWYA 1OYYA 4B74A 1NLFA 2PCJA 3ETLA 121PA 4PC1A 1UF9A 2X2FA 2QAGA 4NCIA 2GXUA 4XWAA 1W0JD 1SVWA 2ZM5A 2O8BA 1DAMA 2ASEA 3OIUA 2BMDA 3A58B 3K0AA 4X8LA 1UKEA 1RRPA 2ZVQX 1W36D 1CR2A 1P3JA 1Q3HA 1XXHA 4C0AC 3CF0A 1XZQA 2RMKA 3OAAA 4JYCA 3AVOA 4MRPA 5J4LA 2YKGA 3LDAA 4AWXA 3KL4A 3B1VA 2G3YA 1II0A 3GJ6A 3IO5A 5F2EA 3I72A 3K0FB 2HJGA 1HE8B 2OEPA 3TMKA 1E9DA 1NP6A 2OV2A 3ZS8A 2FZLA 2IYQA 4NYMR 2O8DA 4TYYA 3OIVA 4DKXA 1YZLA 4BPBA 4YXWA 1T8UA 2HYIC 3BRWD 2P3SA 1P75A 3AF1A 3Q5DA 4Q47A 2E9SA 2OO7A 1NN5A 3EA0A 5KHOC 2VF7A 3AP1A 2YNMA 3WYAA 4LHZA 4HAXA 2WIBA 4G3XA 1F60A 2WM9B 3IDQA 1P73A 1OFHA 1RKBA 4QC2A 1OF1A 4UNSA 4NU0A 1DADA 5CDFA 4I1SA 3ZD6A 4ZI3A 4MKFA 1TMKA 5TV2A 1G1MA 4LJ8A 1A2KC 2GVDC 1LW7A 2GRJA 3MG9A 1SVSA 3NEYA 3VTKA 4JJZA 1SZPA 4JYBA 4KODA 3THYB 1LV7A 3UWKA 2FSHA 1N3BA 3CRVA 1LF0A 1COWD 1OIWA 4LBYA 3MJHA 3UATA 5E3HA 4US0R 1AN0A 4B3DA 4E22A 3CNNA 1X1SA 4IHQA 2IF0A 2XNDA 1EFRA 3CPJB 2JJ2D 3BC1A 3I92A 1DOAA 1WBDA 1G19A 1HTWA 1XEWY 4GOKA 2OCYC 3KKOA 3O8CA 4JVMA 1R2QA 2O0JA 1Z28A 3I5XA 1D9ZA 4A2PA 3H1TA 5FBQB 3SBEA 4BLPA 1UPTA 5KDOA 3WHLA 2GJ9A 2QY9A 3TJZA 2GXAA 2JEOA 2FEMA 1R5OA 3BFXA 3L0SA 1KGDA 3E2IA 3I1FA 1N0VC 4AD8A 3HP1A 4Q1AA 2W2TA 4RZXA 2NMVA 3WY9A 2HEIA 3DPUA 3I8SA 3UKDA 4WOPA 2PMKA 3FKSD 2NGRA 4OQFA 5F9HA 5KYKA 4P32A 3U2QA 1UBCA 4PHHA 2J9RA 4MUAA 2GEUA 1NVWQ 1DAGA 3VNVA 1ZC3A 2PX3A 1FW6A 3PUXA 3PR1A 2WSSD 1AKYA 3PUYA 1ZM9A 4HATA 1ANKA 1SVOA 3GD7A 3MCAA 3UXMA 3ICEA 4B6EA 3AKCA 4D0NA 1FMJA 1RRFA 1SXJA 4FMBB 3NH9A 5FUVA 2QT0A 5AUNB 3FKQA 4BLRA 3TUZC 1JXOA 2V9PA 4KLNA 3QKRB 3M1IA 4KBFA 4GNKA 2IS4A 4YQFA 3MLEA 1AQUA 1GKYA 1G6HA 2FSGA 2VLIA 1FFHA 3ZH9B 2IWHA 4TTQA 1QHHA 1N5IA 1ZJ6A 2FMXA 1Z63A 3BWDD 1G7SA 1M7BA 1G7CA 4LJ4A 4BEBA 1ZNWA 2GF9A 2RGAA 3LBNA 1IHUA 4QGHA 1Q57A 5BN5A 2V4ZA 1QBKC 1XMJA 1CLUA 4Y0AA 1U94A 2WOJA 1U8YA 1NIPA 4HLDA 1S2MA 5JEDA 1N6LA 3SZRA 4TN1A 4Z8XA 2HXYA 1TF7A 4M1YA 4Q9HA 2OUKA 2EYQA 4PC7A 4NONA 5HCNA 4P33A 4OHWA 2CL0X 3AVTA 1VYVA 4TYQA 3EW9A 2DFNA 3P32A 4XSHA 4HDQB 3B7GA 1XTSA 2XSZA 5GJWC 2WWIA 1VYTA 4M1TA 2W58A 3NBZC 2VP0A 3AV0B 3OZXA 5G3YA 3MWYW 1KTVA 2G77B 4XIGS 4B2LA 5KSOA 1OKKD 3AKYA 4F4IA 3SQWA 1HH4A 4IDQA 2YC4C 3TSZA 5EE9A 4S2EA 3LVRE 3QSYA 1ZNXA 4PHFA 1E0KA 1K6MA 4I1VA 4PC3A 4HB2A 2W6ID 3BS4A 3WNDA 2EFEB 4Q03A 3HDTA 4PHGA 4BFTA 4PO1A 1EFUA 4BECA 2DR3A 2IYYA 2Q6TA 1F2TB 2RKOA 3VR2A 4OI2A 3U7GA 2J1LA 6Q21A 1OSNA 4V0OA 3ZJYA 2AK3A 3FFAA 2FN4A 4GRAA 1VG0B 2F9LA 4JLBA 5DI3B 5KNDA 5SZJA 4WW0A 4ZPXA 3OEEA 1HUQA 2JLSA 4NKRA 2R6FA 2ZS9A 4Q4HB 4ZIRB 4JBWA 1IJEA 4JLDA 1Z0IA 1KDOA 2WWWA 3FTQA 4CZ2A 2G0NA 5ELXA 4N0DA 2Q9CA 2V6IA 4A6XA 2GK6A 3FMPB 1UDWA 1IM2A 2JLUA 4QHYA 3BH0A 4MRSA 1DAIA 5HPYB 2J7KA 2REBA 1TAGA 2ZUCA 3FGNA 4EPRA 4WXPA 4LJYA 4Q01A 4TQAA 1K5GA 1QRAA 1MT0A 3LQQA 5FBVB 2ZTSA 1AS3A 1R0XA 3GEEA 2FFQA 1EESA 2BBOA 2G83A 2J7PD 3PUVA 4FCVA 5EE5B 1CULC 3EG5A 4G1UC 3I8XA 3PENA 2W83A 2ZI3A 4Q4AB 1DO2A 1E79A 1FTSA 3EAQA 2F3RA 2RAPA 3JVVA 4Q1DA 3WYFA 4URWR 1N6IA 4NYJR 1B23P 2A5GA 3TRFA 2PEZA 1LB1B 3THYA 3EPHA 3LLMA 2BEKA 2OLKA 1Z0FA 2C99A 2HJVA 1CTQA 2JDID 2QM8A 4UXHA 3EZ9A 3VMFA 2BDTA 4DLZA 2F55A 2A30A 1A5TA 1NG1A 1AKEA 3EZ7A 3LBIA 1NVVR 4YONB 3PV0A 3LXRA 4HLCA 2E87A 3C41J 4LBVA 2ECKA 4U02A 1NF3A 4R7ZA 1SKQA 5H8WA 5KO2A 2HCBA 3GP8A 3R8FA 4KFTA 2V54A 2IYSA 5GVSA 1J70A 3ZVLA 2CK3D 5FTJA 3MWKA 4V0KA 4I81A 4DBLC 1YZGA 3NG1A 2OE2A 3A8TA 5KSPA 1RRCA 4R71A 2YWGA 5CJ2A 3WNCA 1N6OA 2HCJB 2ZRBA 4O2LA 4E07A 4D6PA 1VCMA 2FFAA 2ZSDA 1E1QA 4D0LB 1HEIA 4TYPA 2BJVA 3IBGA 1NVXQ 2J3EA 1W49A 2FH5B 2YHSA 4KITB 2J0QA 2KE5A 4Q9JA 5A5GA 5TARA 2ZYVX 3I32A 1SHKA 4XVRA 2QNRA 4EQ6B 2OCBA 1P61B 4KV9A 2ODEA 2RH5A 3LXXA 4LBZA 3PITA 2CMKA 2JATA 4DLYA 5FTMA 4DSOA 1Z0KA 2AL7A 3AUXA 3BERA 2CE7A 1NY6A 3NC1C 4F91B 1XJQA 3CO5A 1HQCA 1DG1G 1IN8A 2H16A 2XAUA 4IJMA 5IDVA 3U4QB 4F93B 2ZU6A 5K8TA 4YXWD 2BBTA 3FE2A 5H1YA 3QKRA 4DC9A 5LPNA 3ASZA 4B6FA 4EKDA 821PA 1GNQA 3BB3A 4NMMA 4Z1MA 3UIEA 5JFGA 4AY2A 3LAWA 3Q8XB 2VBCA 2GHIA 5KOYA 4Q18A 2H18A 2WIAA 2DY1A 4R98A 5L3QB 2X1VA 1E2GA 4C0KA 4FXPA 1WMSA 1EFTA 2P2LA 4M8NE 2W6JD 3TAUA 4PX9A 3CZQA 1KJZA 3TUIC 3ZIAD 2FNAA 4AYXA 3OE7A 4OK5A 1E99A 3I62A 2GK7A 2WMNB 2GAOA 4V02A 2VP4A 3RNLA 2IUSA 1WB9A 5E7MA 3SHFA 4LYAA 1M8PA 4ABYA 1JB1A 5K8LA 1RW4A 4TMZA 3T5GA 5DISB 1X1RA 1I4LD 4YC7A 4G5GA 1CRPA 1AGPA 3N2EA 4DRZA 4BZXA 2XNDD 3FFBA 1GILA 2EFDB 1TQ4A 2GZHA 4O3MA 2ZRHA 4CEIB 1N0UA 2N42A 4GPTA 5L3SB 1HT2E 1TTTA 1JECA 1K5DA 3FOZA 4Q7JB 2JAQA 4QKQA 1CEEA 1G8FA 4BEJA 3CRQA 5CB8A 1YZKA 2ZRKA 3D8BA 4A82A 1ZCBA 4E09A 1OFTA 5JHHB 2Z0MA 3HWSA 4OHYA 4M1KA 3KKNA 4B76A 1ZVQA 1IY2A 4IDNA 4NCHA 4A8JC 1F2TA 2DWOA 4IFBA 5GVRA 4A8JB 2P6RA 4GL2A 2QAJA 2ONKA 2B7BA 5DI3A 4XTRA 4FWTA 4HUQA 3K0CC 2ZREA 4BGDA 3PEWA 1M74A 2XOKA 3ZZ0A 4LYFA 4Q1EA 4ZIRA 3CX6A 1T3LA 3P4XA 4WAUA 5AWFC 4G5QA 4TQ9A 1W47A 2ZYTX 1XEXB 1I4TD 1Q1ZA 2ZRMA 3TE6A 4PQFA 3SNHA 4DDWA 4EJSC 5KU1A 1QG4A 3ONWA 1SXJD 4QXAA 4PZZA 5SZHB 1H8HA 1OV4A 4GMXA 5EE3A 2CDNA 4US2R 3RAPR 4HAZA 1G3MA 3ZVMA 3GQBA 1PUIA 2ZJ8A 2QSYA 2CHGA 4IXNA 1VYUA 2J0UB 3OFNA 4GP6A 4D2IA 4I1UA 2ZXUA 1KAGA 3VNUA 2RGCA 3F3YA 3L43A 1GAJA 2AX4A 2R62A 2Q3HA 3GMTA 3LFUA 4RD0A 1M6NA 3KB2A 1YJ5A 2WWXA 3P27A 4TT3A 2ATVA 2D4HA 1GITA 1KK1A 3QXCA 1BH2A 3CH5A 2IXFA 3LD9A 3AVXA 1KO4A 4R9UC 5AUQA 5KNCA 2RGDA 1XPRA 1Q1QA 3QPVA 3NEJA 4UKDA 4TMXA 5IK2A 3W8RA 2IYWA 1J90A 2IT1A 4G0NA 1Z6XA 4BZQA 4Q9IA 3L8ZA 4LHYA 1F2UB 3C14C 4RD2A 5CJPA 5DGXA 1KAOA 4RCYA 2XSZD 4PO9A 5JEEA 1ZM2A 3WP1B 4PR0A 3FDIA 1JXMA 4B47A 4IDOA 5JMTA 1DBSA 2CVHA 2I4IA 1ZMXA 4TWZA 5HZKA 5JECA 1PUJA 4V0ME 1CJMA 2YJTD 2XXAB 4AKHA 3IEUA 1Z3IX 4RFVA 3DDCA 1Q22A 3TVTA 1X86B 2NTYC 5CDFE 3BJIC 4KSCA 4C0LA 5FI1B 5FFMA 1KNQA 2F1JA 4BFWA 1MO6A 5CLQA 5E7JA 5FOXA 2WKPA 1ZIOA 3SFVA
chains in the Genus database with same CATH superfamily
4OLBA 3SAJA 5EP3A 3BG5A 3CRMA 1QV9A 3INGA 1NJ8A 4LDRA 1E2DA 4EQ6A 2BGRA 2OO5C 2QP4A 3TLKA 1Q20A 2CC2A 3T3GA 5GZ1A 2PVCA 3OMXA 1U0HC 2JIDA 5DLYA 3B3JA 4MEBA 1I4EB 3MQ2A 1USUA 1E61A 3FPFA 2C29D 2AC7A 3ZOKA 4DLLA 2QG4A 2NXWA 2ZJOA 3F4KA 4IDGA 5ALYA 4RY9A 5KVSA 2NUPA 2PGOA 2GEDA 3ZXSA 2XBUA 1E58A 3FI0A 1M0TA 3MCTA 4IV8A 4L8WB 2RHTA 4LRWA 1GSHA 5HZGA 2MMGA 2VXBA 4D79A 1DCKA 4KCGA 5JQGA 1P1RA 1RFGE 3S2UA 4B2PA 1H65A 1P62B 2IQIA 1W0KA 4MVJH 4QUHA 4EYOA 2P9HA 3I28A 2X3UA 1KJ9A 1IQRA 1SPBS 3LCCA 3R41A 4EGAA 1C30A 1FS6A 1DFHA 3UXEA 4NH0A 1KARA 1H1TA 3AO0B 1VLHA 1W1IA 3H0KA 3MJSA 4OXRA 1EINA 1NUPA 3B6IA 4R1LA 3S0JA 5A0FA 3W5IA 3ODPA 4KXVA 4ZT5A 1C0PA 4QVKA 4RGQA 1FX0B 3ZQUA 3JSXA 2WTBA 2QMUA 1RRVA 4W1PA 1PSDA 3RYHB 2YCLA 3KPYA 4IZ6A 3OQ6A 4DCPA 2Q5OA 3O3NB 4L4RA 1P4JA 3CSSA 4QNMA 2BZ1A 2ZCVA 4J16A 1QIKA 3SXUA 1O0BA 3RRMA 4OHPA 3NAQA 4Y2SA 2AHRA 2VJKA 5LP6A 1KI3A 2LIVA 1CUHA 3JQRA 5K4GA 4RULA 1KKLA 2H0RA 5DYYA 3SYMA 3ZGYA 3HKCB 1GSOA 1WDWB 1WDLA 5L3SA 2YASA 5BR7A 4GOXA 4LOAA 3GFFA 5C8YB 1Y3HA 1Z2AA 1XU7A 1L4NA 1X77A 3ISVA 4LYHA 3L9XA 1RHQA 2W4QA 3H2SA 1VHLA 5JZOA 2VA8A 2EP7A 3MWJA 5JJKA 2MINA 1SVUA 3PS9A 1MP0A 4ON9A 1UFQA 1V7CA 1O89A 1N3YA 2W2LD 3HPQA 4QBHA 1GFIA 3AOGA 2FWMX 3E05A 3N8HA 4N8SA 2JVJA 3IHWA 4XYGA 5F7ZA 2BD0A 2ZSFA 1LLDA 2O0MA 3DEYX 1NZFA 1ULTA 2A8YA 1U9IC 4H3SA 1BVRA 4RA6A 1Y5MA 3M6UA 3STHA 1SKUA 3U7IA 3VR5A 1NJ6A 3LUCA 4AG3A 3KQNA 2GPAA 1EU1A 1Y9DA 4G2TA 4EX7A 1SK8A 5JS7A 5LMCA 2B37A 3ZE6A 1M2FA 2H65A 2V6JA 3L4BA 2QTWB 3DHVA 3FHCB 4BZPA 1TJ4A 4K81B 4LDJA 3QFHA 3DHEA 3VNQA 5L3VA 1W2WB 2DJIA 1I0LA 3HCEA 3OJOA 3C4JA 4XWGA 5JSKA 1NBEA 1LI4A 4UUAA 1T2CA 4S2UA 3HZOA 4L27A 3UHOA 4F0JA 1BHSA 5E0OA 5EJ5A 2R1VA 5AHRA 3PPIA 4EJSA 2FGKA 4KO4S 2X6RA 5ES3A 5G0TA 1R0YA 2GJKA 1A96A 1FVOA 4GZLA 3SDZA 4ENPA 5JJLA 1KO1A 4ROTA 3CW2A 5FPPA 5E9QA 2VUHB 4HDSA 4Q7EA 2OGWA 4L4YA 2BTOA 5UKDA 1DG9A 1JHXA 3GDHA 4E21A 2JIBA 2RGBA 5KWJA 5KPDA 2YWCA 4PLFA 4P2GA 2UZAA 3JU3A 1BD3A 5I7WA 3I62A 1LEHA 5JUWA 1DMSA 1SQ6A 5G40A 1Y6GA 1X2EA 4LGVA 2PYIA 4HMPA 1M2OB 4U0JA 1T3SA 1K7YA 3OE7D 4QLAA 2H4FA 1GCUA 1VCIA 2WAOA 3OEWA 4BQPA 1G2OA 3VZBA 4KH1A 1LBIA 2P1DA 2VDQB 5LOVA 3ZH2A 4ZEMA 3EIOA 3NTUA 1FP7A 2C42A 1C4OA 2Q4RA 5IX8A 1G16A 1NN0A 1T36B 1T9GR 2JANA 3VR1A 2ZRQA 5A3JA 5IAOA 4W8OA 3HR4A 1E69A 3M70A 4LPKA 5LD2C 4NSNA 1SAYA 1FP4B 4NCJA 5IASA 3CFYA 4PQRA 1XAIA 3ZZTA 4YRFA 4YRPA 2OZLB 5B5SA 1W5EA 2FOLA 2ODPA 5B7PA 1WS6A 13PKA 2V9ZA 1ULSA 4HVAA 2J9FB 1YQWA 1D2RA 1GP2A 1L1FA 1V4VA 2VK8A 5LL6P 1UC9A 3I6YA 2C2YA 1I14A 3PEFA 5IJZA 2D1SA 3TKAA 5L3ZA 3KQYA 4Q39A 5HKKD 4C05A 1FU8A 4V0MA 3IA7A 2I65A 5EUQB 5KI6A 1H2HA 3IAS6 2PMEA 2BEUA 3GEPA 4YJ2F 1EZZA 4IAOA 4PPNA 3WKAA 2QT1A 2I4TA 3MBOA 3B7WA 3LHIA 1T1EA 5E7QA 5C5EA 1PI3A 2BR5A 3ADOA 2HF8A 4O0MA 1ZN7A 2ABWA 2Y4NA 3KYDA 4AKIA 4NDZA 4WLOA 2ZZKA 4NESA 5F2OA 5EN4A 3ENZA 4CM4A 3F6BX 5HK8A 1WAMA 3CE9A 3GJ4A 3ICCA 2OZPA 3HJFA 3ASYA 3P9YA 2P8JA 2NXJA 1RBZA 1D2MA 2PG3A 5KUTA 3K8OE 1N78A 3KU1A 2CLHB 2WTXA 3LC0A 2OO5A 1VSQA 1JEJA 3CU5A 4B7UA 1KI6A 1L4UA 3CRNA 4ZZ2A 4H3HB 3T1NA 1Y8AA 1JQLB 3DQPA 1KDYA 4WKPA 4BJHB 2FN8A 3WLRA 4KNYA 1JPNA 2YQ5A 1BDIA 3B3GA 1UJMA 4CW7A 3G0BA 4DA9A 3HRKA 3LKZA 2FWIA 4UCQA 3L7AA 1H8HD 5FWYA 2VN8A 3L5KA 2BF4A 3JPWA 3HV0A 5G1PA 3Q2KA 1GDDA 1H93A 3WHIA 3INYA 2VK1A 4NP6A 2P75A 4DR4B 2R86A 3RAFC 3ICQB 4HEHA 4LFCB 1XUOA 4EI7A 1L7DA 4PZAA 3M9XA 3BFJA 3ML1A 2C9ZA 2NT3A 2YY7A 3OOEA 1FLNA 4A0FA 2ODWA 2ZP1A 2ZRAA 4IGAA 1OZAA 3V5NA 1DEXA 1DO8A 1VG8A 1DAHA 1G1AA 2Z8XA 3PGLA 2QRJA 3ZBUA 4GRDA 3WV4A 1NUTA 1UBLS 3BJRA 4BNIA 3TDMA 1R4AA 2D7JA 2LDXA 4R05A 1N2CE 2CHEA 4M86A 4MI6A 4ETNA 4Q9DA 4GUDA 3RU2A 2ILTA 2G8LA 3OE4A 3PJEA 4QT0A 4ZOAA 2PRZA 3NGXA 5JG7A 4ARZA 4ZI2A 2Q21A 3H17A 3IDOA 3U13A 4R8VA 1QGDA 1Z82A 2JFUA 3VPFA 2X1LA 3FMGA 4XD2A 3W6NA 1SY7A 5AOBA 1J33A 1DNPA 4M9UA 4QUIA 5CDGA 2DCUA 2VIIA 4PHTA 2I91A 3O4GA 3PZBA 1RM0A 4NBVA 3BMCB 3PHIA 4RZ3A 1JU4A 4MJXA 2FP3A 2B1GA 4LAFA 2QROA 3KZVA 2XYGA 3WA6A 3T35A 3FYTA 2FPLA 4MRMB 4FEEA 5EP4A 5LKAA 3C5WP 4KO8A 1A98A 4N5LA 3QMMA 5AHOA 1HYQA 1JUDA 5E3IA 2UDPA 4AC9A 3U44A 1FCJA 5HQ3B 4KGDA 4DUGA 1D2GA 2G5CA 4XKJA 1DT3A 4EO4A 3ZC3A 3QGMA 1IN5A 4ZQFA 3C3KA 3HRIA 4C5BA 2AC4A 1ZM3A 4GICA 4GG1A 4RGYA 1D4OA 5JLAA 4L2IA 1U9IA 1G8HA 1I7QB 4KK4A 2P5UA 4DLUA 1VE5A 2G07A 2OPBA 3HXQA 1LTQA 1AF4A 2X4GA 3JS5A 4EFDA 5BV1A 5DWVA 1AUOA 1O4VA 3T15A 5B57C 2PL1A 2DQKA 1U5BB 5EP1A 1GA1A 5I4CA 3ZBPA 5IEJA 3S2IA 3U1BA 2QM7A 3PFWO 4K9QA 4MS4A 1LX7A 1E1CB 1SVNA 3GYBA 5IUNC 2QEQA 4M7OA 4ARCA 5REQB 4MVYA 5LZ8A 1YZYA 3IEKA 5JC1A 3DDHA 2ZI6A 4M6WB 2YX1A 3GLFA 3OKFA 2PMCA 2Y77A 3L7CA 4GS5A 2H9IA 4FX2A 4POAA 3AF2A 4CKXA 4N8DA 2X0JA 3SX4A 5CXQA 1W36B 1M66A 3ER8A 4IJKA 2PGIA 2RGWA 3LBHA 3EF1A 3QPWA 3A26A 4MPRA 2YZKA 1VXOA 2D06A 3OECA 4GVPA 3UV3A 4CIDA 1B6GA 3QXHA 5I4KA 2JFWA 3E15A 1U8CB 2QGNA 1DEOA 4UJ3A 1PUXA 5DSXA 3K4QA 2BGMA 2ES4A 1RZ3A 1AZTA 3KTFA 3NB0A 1JDVA 4XH9B 4EBFA 3NU1A 2C07A 5LQMA 5CCXA 1OH6A 5EIOA 1Q6ZA 4NZYA 5F77A 1OB5A 3H4TA 5LB2A 4MGYR 2PZFA 3ZHCA 1XXLA 1TYZA 4NQRA 1GR0A 1KAQA 2AXEA 2BCJQ 4JLAA 2X8WA 1G291 4R1NA 1KAMA 2I7CA 1SG9A 3FNRA 4E3WA 1LC0A 3FCUB 3A0UA 1OREA 5GQSA 5ICFA 5TQ2B 5ESXA 4C1NA 1PBTA 3A4IA 4QWMA 1I1OA 3OTIA 1Q0HA 2IUEA 3WWOA 4EJ6A 5A6VA 4FDVA 4DB2A 3E3MA 3KJXA 1QOPB 2BKEA 4C22A 3JQ7A 1YE3A 3L0CA 3UPTA 1NY5A 1O2DA 4XGNA 4BB5A 4EPWA 3CM0A 1KC3A 2FTKE 4ESEA 3HVUA 4FWIB 4IGFA 3IJEB 2FKAA 4ZVLA 3HYNA 1WW2A 1AURA 4C4OA 1Z73A 1DC7A 1P1BA 2OCPA 3CW9A 3BE4A 3F4BA 4P5EA 5BURA 3ABIA 3PDJA 4YNBA 4LNUA 3W78A 4EO9A 4ZYZA 1QGED 1R74A 1XTBA 4N0PA 1HLGA 4OQMA 3VZPA 2P5SA 3BKWA 1YHYA 3U60B 1FZTA 3TCXB 2LCIA 2HN9A 4NBRA 1M6VA 2QB5A 5BR8B 2G67A 3G17A 3L04A 4TS1A 4Y2YA 2GCOA 3B85A 3DO5A 3QU4A 4H6PA 3TSOA 2VNKA 2W22A 1NSTA 4D8VA 2YS6A 2XVXA 4QHTA 2LZ0A 2ODQA 2XTMA 4FSDA 4C5AA 1EVQA 5BSGA 4C3ZA 1OLUB 3N1UA 2CMFA 4MS3A 3GJSA 2GZAA 1Z6ZA 2K6GA 3C43A 3O82A 1Z74A 4KE8A 4BGVA 3BEOA 4MA0A 2AOXA 4BV8A 1M3SA 4DBVO 5BYAA 2O5RA 4BNFA 3L6UA 3R5XA 2X22A 4G5RA 4E94A 1VMAA 2FRVA 3BSFA 1KO8A 4NMHA 4R5HA 1AK2A 2VSNA 5MN5A 1LX6A 3NDJA 1KRWA 1D07A 1XRQA 1YS2X 5CNIA 5EZYA 4QTTB 3PR3A 1E2QA 3TW8B 4YUVA 3L40A 4B45A 4U6NA 4MLZA 2XUKA 1OU4A 1W5SA 3LCVB 4YXFA 1PFWA 1J2EA 1C3EA 3D8TA 3MINB 4HGQA 5SY4A 2JFVA 3HJGA 4KRYA 1BN7A 1I36A 3LY5A 1GNRA 1K8YB 5BO5A 2X0EA 1SCBA 4E51A 2E5FA 4TVSA 2FHPA 3LX5A 4O1IA 1NJ5A 3KXIA 3UWMA 4J07A 4KFSA 3WJ7A 4DBLE 4RTLA 2HRRA 1HNXB 4MUGA 1C9MA 1J99A 1NDHA 2AYZA 1OPRA 4NU6A 4Q9AA 1FDRA 5HF9A 3SS8A 4HNTA 3THOA 1KPHA 2O52A 4LCEA 5K1ZA 3PEEA 1IZ9A 2AFIE 2ZIZA 4CMBA 2F64A 3WLMA 1DXOA 3RS0A 4URHA 1NNUA 4NPAA 3R40A 3FYUC 3DE7X 1ACMA 4I4NA 2V0GA 4G0YA 1O8CA 4O08A 2WRZA 2Z56A 4ZK2A 4N03A 1II9A 2GVZC 5B2FA 3NR2A 1FEZA 1KVUA 5GP1A 4AT1A 1OX6A 4D56A 1LKZA 5GV8A 1U2EA 3S4YA 5TE9A 1G5PA 1J0XO 3H2BA 1ZMTA 1G8AA 5DV9A 3FETA 3ETEA 2UZIR 4QYIB 2O6LA 2WV7A 4R54A 4GPEA 3R74A 4HI0E 4F06A 4Q48A 2Q5LA 2IEGA 4NJEB 4F2GA 1SIWA 4DR7B 2JEZA 1U8UA 2HBRA 3HZZA 4S3MA 1VI2A 3HJUA 2C8KA 3DUWA 5A03A 3Q3HA 4I1PA 3R3SA 4RDHA 1QOQB 2MR5A 4A0RA 1N5JA 1A04A 4MNTA 3ZLBA 1PVDA 2GDJA 4PRYA 1GPBA 5IAGA 3VI3B 5IBCA 1LQ2A 4EG6A 1NDQA 1HGXA 2Z2YA 4NV3A 3KVNA 4P92A 5IJWA 1Z5WA 2HX1A 4LW8A 3W04A 3HNOA 3I4FA 1US8B 3M5CA 4J2HA 4U3JB 1HLDA 1Z83A 4BQOA 3MXOA 1W87A 4RJIA 1K86A 1QAOA 2EFYA 2V5AA 2J4CA 1W4AA 4OQEA 5F78A 4AZSA 4LSZA 2A1TS 1GARA 1OWNA 3EMKA 2ZIFA 3GAAA 3P0RA 4IIHA 3U1TA 1O58A 1LBHA 4D80A 1E3SA 3QI7A 3RTDA 4U7WA 3T7RA 2ZB4A 2QVCA 2QTBA 3A6GA 1Z5VA 1USKA 1IQ0A 1TU4A 2VF5X 3BMOA 3RRYA 2I67A 2XIQA 3VR3A 3RASA 1DDOA 3NFRA 4OQZA 3HVIA 4YV2A 2ZROA 1H05A 3PKZA 5KTTA 4RHXA 4K9OA 4MX8A 3VDXA 1OUMA 4MUXA 4NPCA 2C8JA 1FSGA 1HZZC 5CB4A 5JSHA 3PPWA 1PJ3A 1VA4A 3ECSA 3OD5A 2Q6LA 3X1JA 4BVAA 1KP9A 4R01A 1N6PA 1JP7A 2BP7A 4RKFA 1DTWB 4C87A 5LDGA 1Z39A 1KS2A 1SWVA 2A1UB 3D6HA 3IAM6 3JYOA 1AD2A 4MS1A 5ITZA 3BL6A 3QBJA 1AE1A 4L5YA 2PIAA 2MYTA 3KVVA 4KSBA 3WMRA 3MTQA 2PTHA 4H0FA 4L76A 3TTXA 1TJ5A 3OCUA 4GKAA 2A92A 4QQRA 1ZOLA 1K27A 3IELA 4WNAB 1CB0A 1ZD9A 1E0JA 2C3UA 4C4AA 2IY9A 1J06A 5GONF 2JGFA 3AVQA 4XVQA 3KQHA 1E3QA 2VRNA 2ZYHA 4PYNA 5AXDA 3TRHA 5LUBA 3OZDA 4B33A 1XYYA 2YC2C 1I6KA 2FYTA 1DWPA 3K6SA 2WMYA 3S2SA 4OP2A 5C34B 1E0DA 5L6LB 1T1IA 4M3NA 3DP9A 1DIBA 5I7HA 4B3TB 4V0NA 1IEXA 1RKVA 1U3WA 3ZHUA 1UBSB 2RAFA 3Q7SA 3TRJA 3VTFA 4BB6A 2NUAA 4AJKA 2W2KA 5CA1F 2R6R1 1L4KA 3AEQB 4N0EA 4Q66C 4RS4A 3CLUC 4NAHA 5G0VA 4O29A 3CZMA 5LB4A 4OATA 2QQGA 2B82A 1S1MA 2CBZA 3FBTA 3I5AA 1V95A 3W4JA 1BYIA 3F6SA 3P96A 1I4DD 2HRZA 3FB4A 3AG6A 5CFQA 5DP2A 1D8TA 4YJ2A 1CRQA 1DRJA 4YJFA 4EF4A 2VJPA 1VJ1A 1R8SA 1Y1QA 4V03A 4EHNA 2IIQA 2ZQZA 4FQ8A 2C95A 1QFJA 1C4WA 3WOVA 2N3ZA 1VECA 4CKCB 5DW0A 3M6AA 1UKAA 3SYKA 2JJ2A 3QWFA 1JMVA 1ECBA 2QOEA 2R6AA 1JTVA 3LVFO 1AKWA 1YDFA 2VNJA 1K7EB 3Q4GA 5IZ4A 2BGKA 3TI9A 4BRUA 1EWYA 4IWXA 3DNPA 4MR8A 3WGYA 1PGPA 3BSWA 4YCLA 4FHZA 3EQ2A 4E12A 4EL5A 2DFKB 4G0VA 3C8DA 4BKPA 1QF7A 4F4DA 3PUZA 3FUWA 1HG1A 2V5UA 4PXSA 2Q3DA 2O8CA 1QGUA 4LBWA 1KKUA 1PT9A 2FUKA 2DFVA 4C6SA 1RLJA 5DU2A 3RIXA 4C6TB 2BFOA 5I9IA 3B2EA 1NXTA 2OAP1 4BHTA 2UVDA 3OEHD 5BW6B 2E6UX 4L5CA 1G2PA 4HNUA 5I8WA 1Z16A 3DMDA 4CMHA 2H1OA 2PD6A 4BN4A 3GUZA 4NQZA 1P72A 4LHWA 1QJ4A 1STOA 1LS1A 2E37A 3L7IA 1Y63A 4RGBA 2YICA 2IEBA 4MJ3A 2JF0A 5CLHA 4RJ2A 1XZLA 3ZZ1A 1PV1A 3KBBA 2F67A 1ISHA 3QFFA 1UZLA 1Y37A 4GAEA 1Y4DE 2VJNA 4V0RA 2X5NA 3M9LA 2EG9A 4GXNA 4A2CA 3SI7A 5LFAA 5PGMA 4EI9A 1K66A 4F60A 3CKYA 3U48A 3CR8A 4TWIA 4PZ9A 4MGEA 3ZNOA 1DXHA 3V7FA 2GQ0A 1O1YA 2J09A 3DZHA 1W76A 3FX2A 3FYUA 5H3CA 1O6GA 3Q9NA 4FFRA 3V00A 5HKLA 2L17A 2YRFA 3WDLA 4WBNA 2O59A 1UJ4A 3AU8A 4IEFB 4L7QA 1WV1A 1ZUIA 3H0EA 5KNDD 3GRUA 1NKVA 1WJGA 2PKWA 3B3AA 3R3VA 2R5FA 3AH8A 1R4MB 2G08A 3JWGA 3OHSX 4PLCA 1PCXA 5FTNA 1KSHA 4FFMA 5EJ4A 4OL0A 2GA8A 2XCOA 2PX0A 4N39A 4QARA 5DCLA 4FW9A 3WIVA 2QTTA 2O2XA 1SWWA 2CCJA 4L02A 2IP4A 4IICA 3GELA 1W581 3RG8A 4AX8A 2IYLD 1PNRA 3OZRA 2PYZA 5EYPA 2OPHA 4AN1A 3IUJA 2FEOA 1DAEA 1AUXA 3X1YA 4HJRA 1YK1A 4KNVA 4H08A 5TJ9A 3LHSA 4YLGA 3RUPA 2CFIA 3MK31 3KJQA 2A35A 3LSTA 4HZUA 2LNDA 1CZRA 3PPVA 5C1BA 5JNUA 3L7KA 1YBAA 2QTMA 1BWRA 4DLPA 3U4IA 3KWLA 4W7IA 3OOHA 2D0IA 2L0XA 2P2SA 2PD3A 3WLJA 2JW5A 4NCKA 1H1LA 3T9DA 2CNNA 1NDUA 2PUWA 3BYZA 3WAGA 4UCFA 3A4YA 3EK2A 1G0NA 3C3JA 1CY0A 1OKKA 1Q0ZA 1B00A 1G20B 1KDRA 2CZCA 3I64A 3DUFB 4BATA 3WGUA 4LOIA 1KZ4A 2YVQA 2FPWA 1JEOA 3UOGA 2E0IA 3O1LA 4JJAA 3ILYA 1P1FA 3R76A 3ONFA 1WHTB 2VKTA 2Q7OE 1HZZA 1GN8A 1LCIA 2R8EA 4D57A 3BK2A 2EYUA 2CE2X 2ONYA 1NVKA 3EC1A 1Y3CE 4G8CA 4KFRA 1FF9A 3EASA 4YS6A 5BNIA 2IH2A 3PLAE 5CG1A 2VH1A 1C1XA 1Q3KA 4AUEA 4LTMA 2O50A 3QLUC 3S2ZA 4D99A 2XCLA 4IOLA 1WF3A 4Q3NA 4R83A 4WFQA 1LS6A 1NVEA 4C2BA 3B70A 4QUAA 1RPTA 2BUAA 2CUKA 4CKBA 1XF1A 3FVWA 1GG5A 5CIQA 1ONBA 2ODBA 4A3SA 5CLJA 3I1YA 3CNEA 2GB4A 1Y4UA 1OMOA 4KG7A 4NNPA 1PR5A 3FLMA 1A7KA 1FXSA 3FSJX 5A2GA 4B4UA 3NUZA 2EZUA 3DXYA 3I34X 5HJEA 4L9AA 4GYJA 4OXIA 2BJHA 1R9JA 1JEEA 4E2XA 1QYXA 1E1QD 4X9XA 3TS1A 1CERA 1UFKA 3UFBA 3EIQA 4QBIA 3J81k 1LUAA 3LT2A 4J9VA 4YHHB 3GLGB 3DYIA 3HHEA 4DCUA 5IKXA 1VFNA 4L5JA 4KP7A 4WOBA 2HV8A 4RORA 1FDSA 1MOPA 2RK6A 3WA7A 3TQRA 2Q3FA 4H15A 2N75A 4NZNA 5D3KA 1A7UA 3EPPA 3LY9A 3JPYA 3R7AA 4DDVA 3O9ZA 1T91A 2J7PA 3P9QA 2KPOA 1L4HA 4Z2AA 1BWPA 1TUBB 3KJIA 4JCCA 3R5SA 4R2WA 5JRZA 1OWPA 1ISJA 1JALA 3E0QA 3RVBA 2AFHE 4ITUA 4C9BA 1IY8A 2OCGA 3P5SA 3GLFE 1OWLA 3E6AA 4I46A 4I08A 1NE7A 3IV7A 3O8BA 4ZCTA 3GLHB 2EVWX 2OBMA 4YMVA 1E9EA 4H77A 1QGAA 3OCWA 2OAQ1 3HADA 3HI6A 4MKXA 3MGGA 3L8MA 3OSZA 1SA0A 4C07A 2FN7A 3UAVA 3BIWA 3EN0A 3I2KA 3KIPA 1GA6A 3PGMA 3QG1A 3UOWA 3WIDA 4A4DA 2WWGA 2G9NA 1E4YA 3QVUA 5E9WA 3HWWA 1QZXA 1J00A 2O57A 3N8IA 1NUQA 3CNOA 4N49A 3JZMA 1A9RA 3I73A 3ZI0A 4B7AA 5ENVA 1A8IA 3LFHA 4CT0A 2WZQA 2YXNA 2DGDA 5CVCA 4K9NA 3NGMA 4E88A 5CPFA 1XDGA 4W1RA 1Q7BA 4Q3LA 4PCAA 2VA9A 4U8HA 4BU1A 2Z6QA 4Y9RA 4RVNA 2DTDA 5PNTA 3WBKA 5JIBA 1DU4A 4TL6A 1W0CA 2A9KA 3IIJA 5I9NA 1TD9A 4QFDA 1LF5A 3II6X 4Q1FA 1AG9A 4RLSA 1EIWA 1GAEO 2VC2B 3DZJA 4OU4A 3TK1A 1AMNA 4G4JA 4MIYA 5K51A 1G21B 2B21A 2IPAB 2Q46A 3JQBC 3WIEA 1YZHA 2GJSA 3L0ZA 4LYJA 5JO0A 5B36A 1K4MA 3NXSA 1PYOA 3OOYA 1EHYA 1S2OA 1EEHA 1XTQA 2GHQA 2J0EA 2W2OA 3IBSA 4P22A 4RK6A 2FSFA 2ZYAA 5JASA 1N75A 2P5YA 3E0XA 2I2FA 4CL3A 1CQWA 2R87A 5TPZA 3Q0TA 1EWRA 2H1HA 3G0IA 4LMAA 2GGSA 1RQPA 2O1SA 4ASUA 1G6KA 4JXKA 1V5EA 2QLLA 2HYDA 1XQXA 4HS9A 3LFTA 5BQPA 5U4XA 2ZXFA 1O94C 1SC3A 3BFPA 3T7SA 3QHQA 3W5UA 1GAXA 1HX7A 3V97A 4CMAA 2G4LA 1J8MF 2NO6A 1HQDA 1Q0RA 2B1JA 4TMFA 1YGPA 2ZUBA 5D00A 3JQAD 3ZHYA 4B6JA 2B92A 2WY2D 2O2CA 3AP2A 2SNIE 3PC8C 4IXWA 2AV6A 2GXQA 2Q1UA 5HF6A 3DE1X 1JAZA 2JAUA 3CURA 4MCAA 2PGXA 3GPBA 2PMDA 3MBKA 2OMKA 4OA5A 3VOSA 3AVYA 5BXYA 2JFHA 3HK2A 3LQ4A 1FRZA 3PL1A 2JIPA 4CVNA 3AY6A 4ENUA 6YASA 3AL2A 3IBCA 3RU3A 3VSEA 3NRCA 1L9KA 1UT5A 3CF6R 1MRNA 2YBDA 4S12A 1C9NA 4YK7A 3ZWXA 3QIVA 4KVAA 1H94A 1N2GA 1OIXA 1QIJA 3MLBA 2HY7A 3ZDRA 3ZCSA 3IDAA 2W6JA 3TTUA 4CR6A 3TDKA 4WY2A 1IPFA 2J45A 3E58A 3VR6D 3IPLA 4L16A 5JW6A 1ZOSA 1I7PA 1GPYA 1U5AA 1S3SA 3MJDA 3PD7A 1O6CA 4HQ6A 5LMNB 1BNCA 3O8OA 4GM4A 3RJ9A 5KNBA 1FS5A 4DV7B 2J0SA 4OCZA 1J0DA 1GNVA 4QBGB 4QUEA 2AE1A 4DLAA 2AFRA 4TQGA 1VPEA 4URZR 1U63A 3FUTA 1SIOA 5FYQA 5F1YA 1YB1A 2FW8A 2H4ZA 4HCJA 1Z5OA 1KEUA 2OFOA 3HXLA 5EXPA 5K3SA 5BSEA 1Q6YA 1RWOA 3SC6A 3GLKA 3FMOB 3B6MA 4CV0A 3VHQA 3I23A 4RD6A 5CDUA 2R00C 2WG0A 2CL7X 2LWIA 3WLFA 4N0MA 3LECA 5FLXA 4RAQA 4CCWA 1FMFA 1OX4B 4BFSA 1KEPA 3VU0A 4M7RA 1C7FA 3UJDA 3VXKA 2QRGA 5LZ7A 4ICIA 1T5IA 1AQYA 3NJ8A 4MAMA 1XV5A 1OIVA 4PLTA 2Y6VA 5MN6A 3T7DA 1E2JA 3MD0A 1WCIB 2AN4A 1X7ZA 2PZBA 1LPMA 3D4BA 4OTZA 1UWCA 1VSBA 4JI6B 3SOPA 3TAHA 2OLJA 2N9UA 1MABB 2X8BA 2YYAA 1FPQA 2IQ5A 3OY7A 4BBAA 4IDBA 4KIFA 3LX8A 2OYSA 3B6JA 4TKVA 3DL7A 3OLQA 1OLOA 5IK2D 1XMOB 4MDEA 2BOVA 3TNDA 4A91A 5DX1A 3U9TA 1NQWA 2ZXEA 5K01A 1Z22A 2P9YA 3C3XA 4FQ7A 5D5HA 1E8NA 4GC9A 1K3UB 3QLUA 2XX3A 4UBOA 4B32A 4F6RB 1MQ8B 2YOHA 3DLAA 4MQEB 4R51A 4U7DA 4YP0A 2VCYA 1B6RA 3VJKA 2EXXA 2WKQA 4IIBA 2M6KA 5GONA 3G7SA 4ZD6A 4AX4A 4Y2TA 4TQUS 1SD5A 1Z4LA 5HGJA 3U4HA 2YXDA 1BMQA 1CG6A 3BB1A 5EIBC 2XB2A 2RSLA 3AZOA 5JY6A 4MYSA 3ZS9A 4EFNA 2O8EA 2P4QA 2JFPA 2QRMA 1QLJA 5DHSA 1ETUA 1YGYA 5E6RB 2EBUA 4HWPA 4YV0A 1MDFA 4X95A 4IF4A 5JDIC 2ZM6B 4F4HA 1F20A 2OL4A 4CEJA 2JGDB 3UJHA 3WRVA 1XZIA 4JEHA 5HS4A 1J9ZA 5CA1A 4N3AA 1Z7GA 1E2IA 2IA5A 4BRWA 2C88A 3VNRA 5JSZA 3HXOA 3SBXA 5I9MA 2EKQA 2DU8A 1XNJA 4UW9A 3VX3A 3TE7A 5HIKA 5LYJF 1GL9B 1PL8A 1RS0A 4HFNA 3V55A 1YWGO 3W3AD 3JQ6A 3LPDA 1GDHA 5GPBA 2H54A 2PU5A 1P0IA 2DFTA 2FV8A 3DVAA 4IDCA 4OJYA 2ZI7A 1FXWF 3OA2A 1ACLA 5CX4A 2YYZA 3D0OA 4I6GA 4C20A 3EQ6A 4UU1A 2N0SA 5KTMA 1IJFA 4U2EA 4IW3B 2IEDA 4BMCA 3C15C 1LFDB 2MYNA 3SQNA 2WYHA 3E5NA 1Z07A 4EJ0A 3EWIA 4MCJA 4CR7A 1TMGE 4RNDB 2R1ZA 1KYYA 2FMUA 1R6VA 3TZQA 4S35A 2WFLB 4KREA 3U7FB 2EQAA 2QN3A 5BR1A 3G9UA 4JGGA 4PAOA 2XDWA 1T0BA 3FZGA 5AI9A 1KJQA 2OZKA 3FMVA 3WLSA 2XTZA 1E5DA 2UVQA 4DOMA 1XVIA 2R7NA 3LXUX 2FMHA 2LCQA 1AA9A 4MB2A 4Z9AA 1FJGB 2VUTA 1Z2OX 3UT5B 5GMOA 1CQPA 3IQDB 4K87A 4HQFA 5BN4A 2J6BA 3WGMA 1P2TA 2IV7A 1YVDA 3D2CA 1DFIA 1MOSA 3KUCA 3ORFA 4I5FA 2AOVA 3KQMA 1JQEA 4WHMA 2FZWA 4Y6OA 1M76A 1XKXA 3FNGA 3RTEA 4TLAA 2XUIA 2I29A 5GJCA 3SR4A 5MDHA 4F84A 3SXJA 3HXMA 4N3NA 2PUVA 3IP7A 4YMLA 3I5YA 1I6LA 1ULBA 2DVMA 1EK0A 2GZMA 3HXTA 3OX4A 3ULKA 4BNGA 1PVOA 4D9IA 2WF6A 4DCMA 2R6JA 2JLVA 1Q12A 2GUWA 2P2YA 4OBEA 3I9JA 4CFYA 3KYBA 5C2JB 5KTSA 5KYXB 1I3OA 5CH3A 4U7PB 1N5OX 4D4HA 4JSTA 4QIHA 2KBEA 4PSVA 3A9TA 3WYDA 3WYGA 3D5TA 3TNYA 3NIWA 4MH0R 1TC2A 1IEWA 1O94A 2MSNA 3D43A 2FQYA 2XQJA 1X80A 1O03A 3KK0A 4OHXA 5FBWB 1GTMA 4EHHA 3GP5A 4LE2A 3LF1A 3ZGLA 1RT9A 1W88B 5ED4A 4MW2A 3F5FA 1MG0A 1RKQA 4GBMA 3ASVA 2QLNA 2BH2A 1U4OA 4ALLA 1XD9A 1IY0A 1TE2A 2CXPA 2REQB 2QN2A 1HURA 2Y71A 3GDWA 4MVWA 3PC8A 4Z9FA 4AZVA 1R0RE 4JP1A 3KKZA 1UOQA 3AONB 4QOHA 4ZO6A 1RM4A 2JGKA 3HM2A 3JSAA 3L0BA 4BFLA 1H4VB 2NZXA 1D1SA 4U7GA 3VKHA 3TFQA 3L4JA 2XKKA 3TEJA 4OO3A 4DV1B 2M1ZA 3ZKAA 4MWOA 4S1TA 3ADCA 4QQNA 2NU9B 3KWMA 1ETHA 3H42B 3AFNA 4JVOA 1OILA 2BZ0A 3L0PA 2VHTA 1KETA 1UC5B 3OC0A 3SYRA 2G0TA 1SR8A 4S04A 4U2GA 3DVLA 4DLXA 3UICA 1QHGA 4BO7A 4P7JA 3TQQA 3NOQA 4ZU3A 1L0BA 3SZLA 1XTVA 3OIYA 5EHIA 3UJCA 4AJOA 1J8VA 1C9KA 1XZJA 1CE8B 1ULHA 2CKMA 5BYJA 2Q3BA 2WSLA 1SHUX 3C7AA 5EGSA 4XEUA 5HIIA 3Q1LA 1YIAA 5SZKB 5JXHA 3C7CB 4GRIA 2GWHA 5D5PA 1AOXA 3JWJA 2I6FA 4ME6A 3HKBB 1MZPA 3O8QB 1YL6A 5DSZA 3ADPA 1NKTA 1Z6GA 2R6ZA 2YWEA 3RSZA 3TRIA 4BYGA 1YK0A 1GPMA 3QV1A 1H6DA 2R00A 1NASA 3LT4A 1T3HA 1TUEA 3OTHA 5FOTA 3TZKA 3ZDYB 4C29A 1NI4A 4DMLA 1Z56C 1T2AA 3JYLA 3L49A 3FNIA 4LS3A 2W6CX 4Q9NA 5BXQC 3FB1A 1SN7A 4G5OA 3DZ8A 3AR2A 2IEYA 3C87A 2OILA 3NKLA 4QX6A 4A6PA 4E46A 1A95A 2IIVA 3H2ZA 2IS2A 1L5HB 1T1JA 1XN1A 2OXRA 5ALPA 4EB3A 1SKAA 1M7HA 3Q3IA 1E2HA 2WD8A 2IUUA 1QC5A 3EGCA 1RLOA 4BRSA 4MW4A 1EUQA 2HDNB 1E1RA 2PWBA 1CEEA 3FCYA 4ITRC 3U4GA 3E9QA 2QQEA 3KQQA 2IS6A 1ELOA 3HFGA 1LTHR 4O8ZA 2EBWA 4XM2A 2OG2A 5EFZA 3I2YX 3SC3A 3DO8A 2V65A 3HFRA 3JATB 3DE4X 1WY5A 3DEJA 4UBIA 2AQKA 5AKLA 1FOEB 2XUGA 3SYNA 5TMPA 2Z6VA 2AMVA 4JU8A 3PXBA 5KJCA 3L0YA 2VJLA 5ILQA 2BHTA 3RT1A 3LQRA 1IBMB 1A9TA 2XI4A 1HV8A 2V1UA 5DX8A 4QXMA 4E5MA 3GVHA 4KSYA 1YR7A 2D3WA 2L2QA 3R4CA 4RV9A 1Z0JA 4HDKA 4ZAFA 1TF2A 3NBYC 5ALNA 2G88A 3VUFA 1XHFA 5DTEA 5BP7A 3K9LA 2XZOA 1DKNA 1UK8A 4LIPD 4E4TA 1RI1A 2R5NA 1UKYA 4KKXB 3RJZA 3VKGA 3IBYA 2JIMA 3LG2A 5FBZA 5KNDH 3LCJA 2DBVO 2HH9A 5CPBA 4ZEOA 2WQZA 4KQIA 5JDIA 5B3KA 4QPNA 3K0SA 2EQBA 3A0RB 4YCDA 1KK3A 2H2AA 2YV1A 1ML4A 1N7GA 3TPCA 5BSWA 2R7AA 1JSZA 2XB6A 1V25A 1Y3IA 2WKWA 4XX1A 1XELA 4I50F 1NF9A 2IHNA 4EUKA 3K9FC 2MSWA 3L79A 5HUHA 1WDTA 1T8TA 2Z1MA 1E6WA 4AZTA 4DS3A 4F5EA 2GO7A 4ZTUB 4B3XA 5AOVA 1VBFA 1CCWA 2B0CA 2AUTA 5H02A 3MFQA 2VNIA 4F72A 2OTCA 1EK5A 2TMYA 3ID6C 4PPGA 3W5JA 2BZSA 2HSDA 4JMLA 1OW3B 3EZ2A 3H16A