1KZGB

Dbscdc42(y889f)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR DBS
publication title A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 63
structure length 188
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kzgB00
2NIPA 2JJ1A 1ZU4A 2XOKD 4OHZA 5LDDC 1S1MA 3EXAA 4EPWA 3HR8A 1AZTA 4CEHB 3ASYA 2AFHE 4RFSB 1VYVA 1KI6A 3CZPA 3AKEA 5FR1A 2QPOA 2ZRKA 4LHWA 4IFEA 4ZDWA 4TQ9A 3AF3A 3LA6A 1G5TA 4TYQA 3SFVA 4D82A 4M1MA 4BRUA 2CNWD 3WBKA 5LD2B 3ZZTA 2RGBA 2ZU0C 3P4YA 3OFNA 4R7ZA 1AK2A 2RHMA 3THWA 4EFLA 3U7GA 4JLKA 2NGRA 3CF0A 3L2OB 3CF6R 3T35A 4TSFA 3VU9B 1S9HA 2MMCA 4RY2A 5EP2A 5JLJA 5B2ZA 1E2HA 2GCOB 2OBNA 4A8JC 3LV8A 1MOZA 2WOOA 2GAOA 1Q1BA 1JR6A 5F9FA 5G3YA 5JI3E 4JSYA 3ZLJA 3ICEA 2IW3A 4URWR 4DXAA 4QJ4A 3X2SA 3CUEF 3A1WA 4Q1EA 1U0JA 5CIQA 2ZRFA 2VP5A 1G8PA 4JKIA 4ZKDA 3AP1A 5FBVB 1YZQA 5H70A 2GXUA 3IQXA 2V55B 3M6AA 4H9GA 2F1RA 4LGMA 4Q4AA 3U44B 1AKEA 1CR4A 4B32A 4CT5A 4LJ6A 3B8HA 4Q48A 4A2WA 1CF4A 3B5JA 4V0OA 3UMSA 2RAPA 1NBMA 3EZ7A 4IXNA 4OI2A 3VHLB 4C0HA 1JPNA 3WHLA 3W3AA 4OL0A 4IXMA 3P4XA 4C0AC 2RGCA 1KI9A 4WVFA 2ZEJA 1E1RA 5LPNA 3DL0A 1MT0A 5FTNA 4DDTA 1SXJE 5M04A 2GA8A 4UXIA 5G40A 2QORA 3P1JA 1S4QA 3SNHA 5BN5A 3U61B 3CLVA 3GQBA 5FI1B 4J0QA 3EIQA 2IX3A 2WHXA 3KKOA 1BOFA 2V7QA 5BYKA 2BKUA 3RVBA 3NEYA 1CEEA 3CX7A 1K6MA 3VX3A 4BLSA 3NBFA 4URZR 2JCSA 1WRBA 1W0JA 2ERYA 5GADl 4V0LA 4JKYA 4K8OA 4YMVA 4AKIA 1Z6YA 3IIMA 3L0OA 1DO2A 1VKJA 4RVCA 4UNPA 4PO9A 5DI3B 1KSGA 2FF7A 3FFAA 4KFUA 2KI5A 3K9HA 2QNRA 1K8RA 2CHGA 1HURA 4TLDA 4M9SA 2ZSFA 1KO7A 1XP8A 3BGWA 2XNSA 3AGQA 3C41J 3Q7QA 4F92B 2I3BA 4Q9IA 4YDHB 3B78A 1YRBA 1Z63A 3U4QA 1BYUA 1AQUA 4PC2A 2WTUA 4RSGA 2Z4RA 4MDEA 4B71A 2YC2C 1RYHA 1XF9A 3MLEA 4K81B 2J45A 1Z6GA 3BH0A 4NTZA 2MMGA 2GK6A 3BORA 1GVNB 1OXUA 1JXMA 3FKSA 1OXSC 2WZQA 4LHVA 5JEEA 1XCMA 3K53A 2GBLC 2PH1A 4A6PA 3SU8A 1I2DA 4JBXA 3EZ6A 1ZCBA 2A5FA 3H4MA 5L3VA 2RGEA 3VKGA 4UNQA 1ZYUA 1N5LA 2ZS9A 4B35A 2BWJA 3TKLA 2YNMA 1OF1A 1ZM4A 4MRRA 2QI9C 4IHQA 2RGGA 4B33A 1XXHA 3EZFA 4I1OA 4YDSA 4HDOB 2RKOA 3CH5A 4DLSA 5KDDA 3WMEA 1FPMA 3PFIA 2H5EA 4CW7A 1SVOA 4Q7LA 4Q1CA 2ZRHA 1R5NA 5BXQC 2YZ2A 4C7OB 4ZKEA 4AKHA 2BJWA 5TARA 1G291 2DB3A 4JVMA 1U0LA 3QENA 3SEAA 3QI2A 3N70A 1TU3A 2HCBA 2NO7A 4B3XA 2J41A 2IUSA 3PUXA 3CONA 3SJAA 2J0UB 4UQOA 4IEEA 3W6NA 3I32A 4DDVA 2WV9A 1FZQA 2N42A 1KJYA 1Z2AA 2QQ0A 2D4HA 2AN9A 2D2FA 3FKSD 2WWYA 3QEOA 3FYHA 5CYOA 4JZKA 2DFLA 1NP6A 2QM7A 4IEIA 3GLHA 1IJFA 1RPZA 2F7SA 4HLCA 1NJFA 4G5RA 4FWTA 1VG1A 3BC1A 3FMOB 2ERXA 3UMRA 4HAVA 2PEZA 6Q21A 2ZRGA 3AVOA 5SZKB 3CF2A 1TF5A 1N0UA 1C4OA 2CDNA 3VHXA 4OK5A 4DCNA 3C15C 2W6JD 2XTNA 3O8BA 4KFRA 2O0JA 4S35A 1E0AA 4Q47A 1FP6A 4U00A 4MGYR 2ZE8A 4Q1BA 1G4AE 5EQTA 1QVAA 1YR9A 3HR7A 2C96A 4OQXA 1ZM2A 4RD2A 2ZR7A 4IJMA 2J5XA 5K8UA 2OLKA 3P27A 2ZYVX 4KI0A 3SR0A 4B3DA 4LPKA 1GRRA 1T91A 1CTQA 5EE9A 1IN5A 3TVDA 1X8KA 3R9XA 5FOUA 2WSSA 1JALA 4MGZR 1DTSA 2KBEA 1CU1A 4GZMA 2CK3D 5JZVA 5FPKA 4MUAA 3QQ5A 5P21A 2JJ2A 2DYKA 1GSIA 2GXQA 2G0NA 4KFTA 2W2TA 4LYHA 3TW4A 1LFDB 4A9AA 3OE7D 4E09A 2IYWA 1E0SA 5JSZA 3GMTA 1GITA 1KKMA 3SOPA 3B9PA 1NVXQ 1BMFD 1T5IA 1OFIA 4L9SA 5AUNB 2IYTA 2ZYWX 4KJZA 3T61A 1SVIA 1GZSA 2J59A 2ZRJA 1FQKA 1U94A 2HCJB 4CEJB 1G19A 1PUIA 2KJQA 2Q9BA 4L16A 3GLGA 5KNCA 1GG2A 2PLFA 1ZRHA 2F43A 3A6PC 4A0FA 4DZZA 3RDPA 4LJ4A 1ZVQA 3KFXA 1KKLA 2VYFA 3VKWA 5JJIA 2J7PA 4TT3D 3PQCA 5JS8A 3KB2A 3RRZA 3ASZA 4Q4HB 3WHKA 4PAOA 5TXGA 2JGNA 5JHHB 2DY1A 1HT1E 1TX4B 1P9NA 5JHGB 2WSSD 5EE0A 4GI7A 4YLGA 4DJTA 2VO1A 1W0KA 2C03A 4MRSA 5DHAA 2P67A 2ECKA 2ONKA 2PJRA 3VNUA 1W47A 2EFEB 1ZNYA 1JBKA 3A4NA 3B13B 2G3YA 1XCPA 1S3SA 3KZ1E 4FCWA 5HE8A 4HUTA 2WPDA 5K8TA 4OJQA 2PCJA 1FMLA 4FMDF 4M9ZA 4M21A 4D26A 1BIFA 3PIRA 1SQ5A 4TZ6A 3ZH9B 3W8RA 1M7GA 5J5CA 1N0VC 2ODWA 2ZE7A 3C16C 5FI0B 3KTAA 4D0LB 3KKNA 1E9SA 3BAFA 3UG7A 4Q7KA 1R8QA 4OI0A 1G41A 1CJTC 2G6BA 1VCNA 1IXRC 3C8UA 2WKQA 1IN7A 1IN8A 1UF9A 2HF9A 1DAIA 1NSFA 2WJHA 4KLZA 5DLQC 3X1XA 1CLUA 1KAGA 2J7PD 2WWHA 3QKSA 2XJ4A 2IS2A 3KXLA 3PUVA 1DPFA 3MWLA 4IDOA 2PZFA 3U2QA 3SHFA 4CT4B 2PX3A 2O8CA 4GMDA 3RNLA 4JJZA 4JLAA 3ZZUA 3RS4A 1F60A 1DAGA 3ADKA 2FA9A 1LNZA 4ARZB 2K5UA 4EQ6A 1N6NA 2Z0MA 3IPYA 4LPSA 3S1AB 2JLQA 3QXJA 4DCTA 5KYKA 2NZ8A 4EJSB 4NCKA 2VSOA 4HZUA 1G3QA 3NH9A 4OQMA 2D06A 3IO3A 1OYWA 3K0CC 2DPXA 1CS4C 4YMUA 5LBIA 2FG5A 2OE2A 3UMFA 4DWJA 2IS6A 5C46F 3O8CA 2WPDD 3RWOA 4DUGA 3CKLA 3AVUA 4LC0A 3DOFA 3GFTA 3VQTA 4HDCA 3AM1A 2JEOA 3GLIB 4WZ6A 2VL7A 1OHHA 4M1YA 2Z83A 2CVHA 3FMIA 4L5BA 2O0KA 2V6IA 3CRW1 4QXAA 3X1WA 4MYHA 4TMWA 2IF0A 1NMXA 1G6OA 3QG5A 4LI0A 1E3MA 1UEIA 1AN0A 4TL7A 2GDJA 1XTRA 2IYVA 4LZZA 4IDNA 4B3CA 1II0A 1MV5A 1KO5A 3LBHA 2C77A 1OB2A 3BB1A 3LD9A 2QP3A 2QENA 3KXIA 3LAWA 5J40A 5A4JA 1WMSA 3KKPA 3CW2A 4UXJA 3FB4A 4YMSA 4TQAA 1IONA 1JEEA 4BZXA 4IKEA 3EARA 1VIYA 1E79D 4OI4A 3SYLA 4A82A 3AKYA 3QF7A 1TUIA 5IHPA 1H8EA 4TMVA 1ELOA 2QROA 1JR3A 4HB0A 4Q9KA 5EXSA 1KY3A 1WA5A 2P6NA 3Q72A 2GEDA 1HE1C 1J70A 3AF4A 1G64A 3DEFA 1E2LA 1OW3B 5K8LA 4NDZA 2BMEA 1Z08A 1DO0A 2OFWA 1R10A 2WMOB 1YZTA 3WXMA 4AY2A 3EPJA 4HUQB 2OO7A 3O8RA 1PUJA 5B58C 1OHHD 2CLDX 2VH5R 2O8EA 2PBRA 3QF4B 2CHVA 1T0JB 1JAHA 1QVRA 1XEXA 4XJXA 3BRWD 5EJEA 2C99A 1ZC3A 4Q66C 2OLJA 5CM8B 1Z83A 1W36D 1D6JA 4IOLA 2PEYA 1EX6A 3TMKA 2ZUDA 4HAWA 2V1UA 3EWSA 2HLDA 3IQWA 4I99A 4QM6A 1RRCA 2RGAA 2DWQA 2FFHA 2XZLA 4GL2A 2OV2A 4L9WA 5E7MA 1LF0A 1YR7A 2QAGC 1E0KA 2ZYUX 1H8ED 2ZXUA 2ZI9A 3RS2A 1E2QA 5J4VA 4B3GA 4HSEA 1OKKA 1WXQA 2CLCX 3M4YA 3WY9A 1LW7A 2JLYA 1KDOA 4JYBA 1GTVA 2IS4A 2PJZA 3VR1A 4BGDA 4NYMQ 5L3QB 3MUFA 1G8HA 2CEAA 4QNRA 4ACBA 4Z1MA 4F91B 3CB4A 3GPLA 1Q3HA 4G3XA 4QL3A 2C04A 2OEPA 1FX0A 2OHFA 3I8XA 3ECCA 1L8QA 3AVPA 1S9DA 1CP2A 3GD7A 1YHNA 5CJPA 2R6AA 4A2PA 3CNNA 1W36B 2CE7A 1U9IC 4KV9A 2C95A 2QAJA 3FE2A 4KLNA 4MKHA 4ESVA 1XFAA 4N0DA 4MITA 5FR2A 2GZHA 2QTHA 1RRFA 3IIJA 4HZIA 4PHGA 1ETUA 2HLDD 3FHCB 3CRMA 4P4SA 3J81k 2QBYB 2QTFA 4PAQA 3W90A 1G7RA 2ZJZA 3LNCA 4HLUC 2GF9A 3THYA 1F2UA 3T06B 1AGRA 4QJ3A 3NEJA 5KSYA 3LW8A 1U0HC 4II7A 1UBGA 2AD1A 2W58A 2WJJA 2ZRAA 1MR3F 1VTKA 2D74A 1OLOA 1P5ZB 4HDQB 1YZLA 3T1TA 2G0TA 1KY2A 2B7CA 4OYHA 3ADCA 3OEHA 4CEIB 1N25A 4RD6A 2CJWB 3AVWA 4E5UA 2JLSA 1M7BA 1Z3IX 3NBXX 2PMKA 1W4CA 1QG4A 1OXXK 3E70C 2ZITA 3LLUA 3ICQB 1VHTA 4DCSA 1G7SA 3R7WA 1Z29A 1NN1A 3DO6A 1NI3A 2FDCA 1FL9A 3OEEA 1HY3A 4GSYA 1M1YE 2H18A 3SJCA 2E87A 5FOTA 4XD7A 4BRWA 2WWIA 3A8TA 1LVGA 5JI2E 2AR7A 2ANBA 3PUZA 4DIEA 1VCOA 2W2XA 3GJ4A 5FTKA 5JWOA 5D3MA 4Q4JB 4Z51A 4IOMA 2W6IA 3H0KA 3GFOA 3LWNA 4LBZA 4B74A 5DNYB 1SULA 2BMDA 4DSTA 1NY5A 1OIWA 3TGPA 2WAXA 2HUPA 4M4SA 5FH9A 2OFOA 4WXRA 3I62A 3CR8A 1QZXA 1GKIA 1U99A 2IEZA 4NL4H 2D62A 5DH9A 4P33A 5FL7D 3ND9A 2P5SA 5LD2C 2WICA 4BFSA 4GOJA 2IWRA 3HP1A 1R5OA 2EU8A 4UNRA 3QVVA 4BFVA 4F4CA 4F4IA 8OHMA 1RE0A 1WF3A 4TWZA 4MYTA 2RMKA 4LCBA 4WZBE 2VRWA 3JZAA 1U2RA 2JA1A 1KK0A 2XXAA 4M53A 1PV4A 2O8FB 5IRCD 3OEED 2QL6A 1KYIA 2V6JA 4KFSA 5L3SB 1GIAA 4BEBA 4RD0A 4XD7D 2RGNA 3ZS9A 4CIDA 4ZIRB 2V3CC 2R2AA 1S96A 5FBWB 1SVLA 1IJEA 4V0MA 3R8FA 4MRNA 5DN6D 4LC1A 1FTSA 1GAJA 1T5LA 1KK1A 4DIDA 3NTUA 3T1VA 3W34A 4KVGA 2NOAA 1TNDA 5E4FA 3IIKA 2ORVA 2IWHA 2EWWA 5IF9A 1M2OB 3U7EB 5JCZA 5F98A 4PC1A 3U3KA 3QJYA 2OAQ1 5JS7A 1YR8A 3F5FA 4RCYA 4QGGA 3QPWA 4OQLA 1XRJA 2ZROA 2LCFA 3KJGA 2ZAMA 3LDAA 5KSPA 3GJ3A 1G3MA 1QHIA 2A30A 2LKCA 3M1IA 4GP6A 4W5JA 3VR6A 1P73A 1P9WA 3REFA 3V4RA 2QEQA 4W5WA 1W44A 2QGNA 2OILA 4B3FX 3GLFB 1CR2A 2RGDA 2CXXA 2C78A 1E1QA 1E2FA 1G4UR 1NIPA 4QC2A 1T8TA 4LUCA 5GJWC 1ZD8A 2QE7A 4P3YA 2FFAA 1VCIA 3TR5A 1Q57A 2ZAOA 5HZHA 2WJGA 2GILA 3BXZA 3GJ5A 3SZRA 1NRJB 5E3HA 3UWOA 4MKGA 2ZPTX 3U3OA 1DEKA 2HJVA 2LKDA 2ANCA 5SZHB 3MD0A 2A7QA 1JB1A 2NO1A 1XB2A 3SDZA 4GOKA 5EP1A 3SI7A 1NVUQ 2N1BA 1NJGA 2ZUBA 4PSAA 4U5XA 3AF1A 1P2SA 1D8TA 1E32A 5HKKA 4PO1A 3GFPA 1SVSA 3G5UA 2XEXA 1RC8A 3QXCA 2QN6A 5DO9A 3CX8A 4GDFA 1KSFX 2P5TB 4L8GA 3SE0A 5DSZA 1ZNXA 4QHYA 3VAAA 4TYWA 3LRPA 3CWQA 2VA8A 2HEIA 2W2VA 2DWPA 3PV0A 3BD9A 5GVSA 2GWHA 2Q3MA 4FWIB 1W2HA 2A2ZA 3AP3A 4ZDKA 1UDXA 2OXCA 1EFRA 2J3EA 1CR0A 4JLBA 3MAAC 2GZDA 2ZI4A 3CPHA 2H1LA 4XWKA 1E1QD 4JT4A 2CCJA 3QUSA 2QE7D 4OJKA 2B8TA 5CLQA 3LO5A 4DLUA 4P4TA 2VSXA 4WIAA 3IBGA 1RKBA 1FNMA 3LY5A 2FN4A 3TSWA 5FTMA 4XVUA 1S1CA 1P60A 3CRQA 3N2EA 3A1TA 2DHRA 3FWYA 4XSGA 4KSBA 1OH5A 2O8BA 1EFCA 2IXFA 2F1HA 3MJRA 4OK6A 3GLIE 1TF7A 2VBCA 4P32A 3ZIAA 1F2TB 4URYR 4H1VA 4JLJA 2UZ3A 4WAUA 3MGCA 4AG5A 3ND8A 2JJ1D 1YRAA 2UZIR 1A1VA 2ZREA 4JT2A 5B57C 4LX0A 1F6BA 1KI4A 1XTKA 1N6HA 2ODBA 2F9MA 3N5CA 4Q19A 3Q5DA 1I4LD 3QBTA 2HXSA 4ZCLA 1CJMA 1RW4A 4QGHA 1GKYA 2PT7A 1FP7A 4I1VA 2OUKA 2HT6A 3O47A 5L8VA 1KNXA 3Q85A 3ZVNA 4MRVA 1EFRD 2YINC 2JIZA 1KIMA 3R9WA 5FOWA 4DBLC 3NC0C 5FTLA 3ONWA 4IFBA 4N0EA 2QSYA 1E2EA 4TLEA 2WWGA 3OFND 4A8JA 3DVLA 4LDJA 4TSFD 2ZI3A 4C4PA 2IT1A 2QP9X 3U60B 1XD2B 3ZQJA 3BERA 2WWFA 1D9XA 1QHXA 4EPXA 2EYUA 5DYIA 1W5SA 4P4SB 4JVLA 1E0JA 3FDIA 3C5HA 2V9PA 3M0EA 3FHTA 1YJ5A 2WIBA 3NDPA 4EUNA 2GRJA 1KI6B 3VKHA 1SHKA 4ACAA 5A5GA 3QKTA 3BIFA 4A92A 3CNLA 1WB9A 2ZETA 2ORWA 4QNMA 4PPFA 1GL6A 2AXPA 3AVXA 2OAP1 1NBMD 5G41A 2R9VA 4QBFA 5HR5A 3RS0A 3G0HA 4DB2A 4PANA 2OSBA 3L8ZA 3BK7A 4K46A 1KK3A 3HU3A 3K0EA 4D4MA 3MMPA 5DIFA 4D25A 3THWB 2N46A 3UIEA 4NH0A 3KQHA 1AQYA 3L0SA 5DYGA 4QBIA 1E1RD 4IVPA 1XTQA 2BBSA 2ZRCA 4DVGA 3I5YA 2FEMA 4TYYA 4LY6A 4OQFA 1ZBDA 2DR3A 4C30A 4V02A 2EFGA 4QBHA 3BB4A 721PA 1MKYA 3QG1A 1JEDA 1BYIA 4LK2A 1XNJA 2NZJA 3TLXA 5E7JA 4UKDA 1FUUA 3F3YA 4DDWA 1P2VA 5LB4A 2QG6A 2V7QD 2FU5C 3IILA 1SVWA 4Q7JB 1NMYA 1XZQA 1EFUA 2ZR0A 1HT2E 1NG9A 3EWAA 1QF9A 1W0JD 2I1VB 4Q4AB 4Q03A 1CR1A 3EC1A 3RRYA 2OCYC 4NCIA 4BEJA 1VYTA 4GBMA 2H17A 4UNNA 4B75A 4A6XA 4B47A 1E9DA 4C9BA 3P26A 4TMTA 2ZSDA 4GOXA 4Q1AA 2JJ8A 2IHYA 1Y63A 2L0XA 4HAXA 3K70C 3EASA 3D7MA 4LJYA 3FHOA 2XAUA 2DFNA 4AK9A 3CH4B 1Z07A 2F1JA 2C9CA 3TBKA 2XSZA 5C1BA 3SQXA 1S3GA 4LJ7A 2BBWA 4KYIB 2YWFA 3PVSA 1LB1B 2GBLA 1E99A 2ODEA 3TAUA 5B64A 1EFHA 3G82C 5FUWA 2ZIAA 3OF5A 3SYNA 5HPYB 1I2MA 2ZRNA 3BFXA 4B48A 2UVQA 3CNOA 2ZSAA 1UAAA 4M9QA 2YJTD 4PQRA 4JBYA 2YVUA 1AIPA 1P6XA 2GJSA 2MSCB 2Z43A 1XU4A 4NYJQ 3HJNA 4TMKA 4B76A 1CIPA 1XD9A 2ZJAA 3BBPA 3C5CA 4NPHA 1ZW6A 2Z5FA 2E1RA 5AJWA 5CB6A 3TIFA 3DHWC 5JECA 3FVQA 3EAQA 4XWOA 3B85A 4A0RA 1N5JA 2CBZA 3SS8A 3U4QB 2D3WA 3CBQA 1P7CA 2QM8A 3E5HA 4BLPA 4DLYA 4ASUA 3LLMA 3T1OA 4MYUA 1I4TD 3VX4A 1QG2A 1OV4A 2XSZD 4B3BA 4TL9A 3CR7A 4FW9A 5JRZA 4EJSC 1KDPA 3A1UA 4C2UA 3QKRA 3NXSA 4KBFA 3B1VA 1VPLA 3IPXA 2GKSA 1M34E 2V4ZA 2R6CA 121PA 1KMHA 1Z28A 3WMGA 4BWYA 1N5IA 4NCHA 2IL1A 3PUYA 2GCNA 3V9PA 2FMXA 3L43A 2ZM5A 3KKMA 4BUJA 1PZNA 1Z06A 4GT1A 2NMVA 3VNVA 1XXHB 4BLOA 3KJHA 1F3OA 3ZVRA 1U8ZA 2I1QA 4M0LA 4LYFA 2C2HA 3CX6A 3JVUA 4W5HA 1EESA 1GUAA 1VHLA 2AKAB 4AWXA 1XMSA 5E95A 3PEWA 1OXVA 1EWQA 2R6DA 3D3QA 4FMCB 1N6RA 2AX4A 1N6PA 3GCGA 2ZUCA 3FKQA 4PHHA 4V0KA 1ZAKA 2CVFA 1O87A 3WYFA 4W7SA 1S0UA 2ZRMA 1AJEA 5KU1A 1G6HA 3CRVA 1OH7A 1CRPA 3K9LA 4EFNA 1SKYB 1SXJC 3KJEA 1MH1A 4FMCF 5C2JB 1ESMA 3UG6A 4ZDIA 1G7TA 3SJBA 1DAMA 4DRZA 2ZE6A 3UANA 2QT0A 3GLHB 4FMDB 1P2UA 2J9RA 4AI6A 2FE4A 3WNBA 3LH5A 1LS6A 2YWGA 1IY0A 2JJ2D 3GLFE 2FV8A 1F5NA 1XEWX 5EP4A 4PXAA 4EDHA 3A37A 2DFKB 3TK1A 1MO3A 4PR0A 5IK2A 2QU8A 1IOZA 1A4RA 2TMKA 2BM1A 4IDHA 1OIXA 3ZZ0A 4BFWA 3SBEA 1P4SA 2KBFA 2RB4A 2HYDA 4R71A 4GRAA 2ZS8A 2GHIA 821PA 1OJLA 3EG5A 1Q12A 1G3UA 4BECA 1KMQA 1VIAA 4ZCMA 2FSIA 4PO8A 1YKSA 3KQUA 5SZIA 1SXJA 4G0NA 3U3RA 4ILEA 3PJRA 5H68A 2WJIA 1H65A 3THXA 2OG2A 2IC5A 1EX7A 3KXKA 4BPBA 1V43A 3T34A 1HV8A 5KPDA 2CL7X 2AK2A 5TMPA 5FOVA 2D7DA 2VLIA 3F8TA 2QUZA 2ATVA 1W0KD 3TQCA 4JVNA 3PUWA 2XZOA 1T3SA 5JSZB 1OYYA 1IHUA 2HYIC 2QPAA 2ZI6A 3AUYA 621PA 5H1YA 1JI0A 1G8YA 1E9EA 2QMEA 5KPJA 3MSXA 1VG0B 1D2MA 2VPPA 1XD8A 3IKJA 4KVAA 4Y0AA 5IK2D 4JIMA 5DGXA 4S2EA 5AUQA 1W36C 2H92A 4EIWA 5CLLA 1HYQA 4B6FA 1G8FA 1CBUA 4WOPA 3GLGB 1SVKA 5TVKA 1LV7A 2F43B 2GJ9A 3AVTA 2BBTA 1Z8FA 4JLOA 5AUPB 4D4KA 1Z6XA 4U7DA 3B6EA 3LXXA 1GRNA 1XJ0A 3H86A 4YMWA 3WNCA 3WMFA 2AXNA 2ZJ2A 4NYIQ 3I72A 1BO6A 5FPSA 4A0GA 3BH6A 2B6HA 2QA5A 1E6CA 4OHWA 5JBQA 2F1IA 3CRRA 3R20A 1W46A 5FPHA 1WBDA 3B1ZA 3IHWA 3NHAA 3K0CA 1DS6A 3CIOA 3WNDA 1NVVQ 2ZSBA 1SVMA 1Q3TA 5FUXA 3RC3A 1X8LA 2FGJA 2REOA 4A36A 4YONB 4HYYA 1HUQA 3MWKA 1R0WA 5J4KA 4B73A 2OZEA 1KZGB 1G20E 2PLRA 2GCPA 3K0AA 4A4DA 1QHNA 4BZQA 4ZV4A 5ELXA 3NDBB 2O8DA 1FMJA 3SFZA 4C0JA 5AJXA 3W6OA 4DUGD 1DG3A 1KDTA 3U6BA 3KTAB 3ZS8A 3HYRA 2ODNA 5CDFA 1MO6A 2VP4A 3RYTC 1U8AA 4YXWA 3LVQE 2QBYA 1YU9A 1E2KA 2Z4SA 4DLTA 1KI3A 1DAEA 1WE2A 2CMKA 4HATA 2X1VA 1XPOA 4X8OA 3W8NA 4BFUA 3QKSB 1W7AA 1Z0AA 3TUJC 4N1AA 1KHTA 5CK5A 2EYQA 4RKFA 4F7WA 2O8CB 4F93B 5HCNA 3RAPR 3TUIC 1KI7A 1JQLB 1YR6A 1UKYA 1Z0KA 3RS5A 3UK6A 4CEIA 5EZ5A 4NYMR 4EQ6B 1UFQA 4Z8YA 5DHFA 2IBMA 1K5DA 1EK0A 3TSZA 4B2LA 1W2GA 4HZUB 4DSNA 4NZYA 3KQKA 4C0SA 1GFIA 1OE0A 3BJIC 1NSTA 4QG7A 4TQUS 3H84A 1JR3D 3REGA 2Q9AA 3THOA 3L82B 4TYNA 2FWRA 1N5KA 2BBOA 4HAUA 4JMPA 1WP9A 2ZS7A 4Q1FA 5KNBA 4RZXA 2BJVA 1KSHA 2VIIA 3T1QA 2NG1A 1OSNA 4XIGS 4Y0VA 4RZUA 3VMFA 3T12A 1NVWQ 4BFXA 5GVRA 2FFQA 5CITA 2Q9CA 4G5SA 4JLVA 5EUQB 4D81A 1GP2A 1DOAA 1RJ9A 2P0EA 3B60A 4Q9JA 3WRYC 3U7FB 1FTNA 5SZJA 1VMAA 3K09C 3ZD6A 1SZPA 3W3ZB 3BFVA 4DT1A 4KITB 1KO1A 3K9NA 2PT5A 2BVNA 3I8SA 2AKYA 1TF2A 2QAGA 4R2IA 5KTYA 1E4YA 1X86B 1NLYA 2FNAA 4M8NE 1GKUB 3OHMA 1P2TA 2IEYA 1YVDA 2ZRDA 2J0VA 3I92A 5EZ6B 3EPKA 1P61B 1NBME 4KODA 3IDQA 1PJRA 3DKVA 3ZQ6A 2HDNB 2BMFA 4XTRA 2WVJA 5KUTA 2ZRIA 4KO8A 1CJVC 3A36A 1XJCA 1E9AA 3JVVA 1UBEA 5J4LA 1YZNA 1VG9B 3HYTA 1OKKD 2P6RA 5B30A 4PPGA 4OKSA 1Z22A 1X1RA 1RIFA 5AUOB 1SHZA 4Z1MD 4KCGA 1YQTA 3KUCA 4KU4A 5EE3A 1M74A 1A2BA 4RJLA 1U9IA 4X8LA 2REBA 2O8EB 2VP0A 1EG7A 4FINA 3CM0A 1II8A 1XBTA 3EIHA 4NE2A 1XEXB 2G77B 4HI0E 5EE1A 1Z0DA 1T4GA 2PMDA 1LY1A 4LWZA 5FBRB 2AHOA 1Z2CA 2FEOA 3PEYA 2W83A 1DARA 3VTKA 3Q7PA 4PAMA 3GJ7A 1HA3A 1ZP6A 4HLUA 4ZPXA 1T3LA 3AUXA 4L4UA 2QT1A 3QVUA 3UATA 1J2JA 4P4UA 2F3RA 4JL8A 2ZJOA 4PZYA 2C9OA 1KSJA 1E2IA 2BMJA 2FH5B 4G5GA 1MABA 3TUZC 4OHVA 1TMKA 2CL6X 3D8BA 1QHHA 3NG1A 4FCVA 2H57A 2RH5A 2JDIA 1JJVA 2R62A 1XZPA 3QIAA 3QPUA 3OEHD 1FX0B 2QPTA 3CWZA 1PVOA 3LBNA 3V00A 1JECA 3LW7A 4URVR 2WM9B 4POAA 1US8A 1BH2A 5F2EA 2JASA 1AS0A 3EW9A 4JJKA 5GJBA 1G17A 3K0FA 3B82A 3ZDQA 1LS1A 2G88A 4TMXA 4AKGA 1Q1QA 3I4LA 4A1FA 3GEIA 4UJ5A 2IUUA 3TR0A 2OCAA 3QY0A 4EKDA 5C18A 1KO8A 2BEJA 4CEHA 1GNRA 3RC8A 4RFSA 4CRWB 3KDSE 1N6KA 2QZ4A 2YOGA 1XXHE 5BW8A 2VHJA 3KL4A 1Y3AA 4KSCA 1F2UB 4PHFA 2FSGA 2QMHA 4PX9A 5FL3A 3THYB 2W6ID 1UPTA 2ZJBA 4R98A 3H1TA 3EC2A 3IBYA 1PLLA 4KXFB 2OBMA 4G5OA 3C7KA 4ZO4A 3FMPB 1JPJA 1S8FA 1Q1EA 1CKEA 1K5GA 5KOYA 2MSDB 2H7VA 2JDID 5C4GB 1DVRA 2GNOA 2A5DA 1ANKA 1XPUA 3EX7C 4NCJA 521PA 2FSHA 3VU9A 3B2EA 2ZJYA 2G1JA 1P9RA 1GL7A 1KK2A 4TN1A 4LYAA 4EPRA 5FTJA 1KTVA 2GCOA 3VR3A 1SKYE 2WAYA 2ZVPX 3L0PA 3R7WB 3B1WA 2FZ4A 5DI9A 2XOKA 2HV8A 2FX3A 3GLHE 2VSFA 4TTRA 2IXGA 3TQFA 3MCAA 2WIAA 1L4YA 2WWXA 1E2PA 4PC7A 421PA 4IVQA 5HTKA 1Q20A 2A3RA 1E94E 2QY9A 3U44A 3P20A 4A15A 4B2PA 5L3RA 1B0UA 5D3MB 3CZQA 4EPTA 3LQQA 3DZDA 1N0WA 5LB2A 4CDGA 2EFDB 2WKRA 1A2KC 4QOSA 1FNNA 1XTSA 5FPYA 4ON9A 4EAQA 4LV8B 4HLDA 3SJZA 4E07A 1R6BX 3F0TA 4NONA 4W9MC 2IYZA 2HT1A 4RD3A 2WSMA 4PQFA 3EPLA 2V8OA 4G01B 3LXRA 3PEVA 1I4DD 1M8PA 3QNUA 2GJKA 4C0LA 3A1SA 2AK3A 3EZ2A 2DCUA 4LJ5A 3SYKA 1VDZA 4JL5A 5CYPA 1CULC 2ZANA 4LJ9A 3W5JA 4O25A 1AS2A 1NLZA 4IOKA 3ADBA 1NN3A 4LV6A 3PEUA 1SKQA 3MFYA 4ITRC 2XB2A 2PL3A 4MDFA 2XXAB 4FMBB 3BH7A 2OFXA 3O8DA 3TNFA 2DWOA 1A7JA 2JLRA 4M1TA 4JL6A 2GTPA 2DFTA 3NH6A 4DEXA 3AGPA 2C5LA 2H8KA 2Z6VA 3BE4A 1Q21A 1E9RA 1X1SA 2FJUA 2GJAA 1ODFA 5DI3A 2J1LA 3PCRB 1IQPA 5FUVA 1R0XA 2KB0A 3I73A 3NWJA 3RSLA 5J47A 3NBYC 3ZVLA 1VCMA 3HWSA 4TL6A 2BCJQ 2W00A 1RRGA 2VHTA 3GLGE 2B7BA 5HKKD 5JJKA 1KAOA 1EWRA 3GJ8A 3QKUA 1UBCA 1U8YA 3A4LA 2ZJ5A 4V03A 4Q7MB 5H8WA 4ZCIA 1DAFA 3GEEA 2C98A 1YE8A 3KB1A 1NN5A 1DELA 5JFGA 2MSEB 1N3BA 2O5VA 2BIFA 2VQSA 4US2R 2WBLC 1UADA 4FD2A 1D2EA 2I4IA 3T15A 2YKGA 5TB5A 4BZPA 3KX2A 2EWVA 3QXHA 4B34A 4C0KA 1IY1A 3X1DA 1T9HA 3A1VA 4KAXA 4ZI3A 4JVSB 4M2LA 2FPLA 5JEDA 2X2EA 2OCPA 4RKEA 1TL7C 2EW1A 4LRWA 4M1SA 1Z47A 5G3ZA 1XTIA 2IYLD 1G3RA 1R7RA 3E2IA 4MGKR 2XZPA 1UJ2A 1J90A 1P3JA 1XDBA 3HDTA 3QOFA 1TQDA 4CGZA 2J87A 1G21E 1VECA 1HEIA 4IVRA 4H1UA 5FBLB 3ZIAD 4D0GA 4C7OA 4AKEA 3U6KA 2WJYA 1OH8A 3VR5A 4JLMA 1GWNA 3ZGXA 4DLWA 2BEKA 1OFUX 4RD1A 3AVYA 2J0UA 4V0NA 2ZI7A 3B1YA 2JLZA 5D3QA 1YZUA 4Q01A 2ZQ5A 4D2IA 2BC9A 4FXPA 1ZNZA 1IBRA 4TLAA 1GL9B 3HPRA 4CVNA 2XB4A 2P2LA 4I4LA 3ZYCA 2JIZD 2GAAA 5J4HA 1G8GA 4WW0A 2QP4A 3OZXA 2V1XA 3HPQA 3X1YA 4Q4LA 4NCNA 5KSOA 4B44A 4UNSA 1MO5A 1NN0A 1KNQA 3Q3JB 4QRHA 1Q44A 3UWKA 1WDTA 3RHFA 4FIDA 5JMTA 2BKEA 2O8BB 3FOZA 5F9HA 1AS3A 3BWDD 4QHSA 3RS3A 4QKQA 4RD4A 4LBVA 1OIVA 2VF7A 4IW3B 4RFVA 1KI2A 4Q21A 2IUTA 2ZR9A 2PZGA 3RLFA 1E2MA 1WCV1 2IYSA 3DKPA 1E69A 1H8HA 4PFSA 1GM5A 1C9KA 3GJ0A 1VG8A 3CPEA 3IEVA 5CJ2A 4OHXA 2W0SA 4NMMA 3AEZA 1ZUIA 2GESA 4Q1DA 4IOJA 4HEJA 2F3TA 1JNYA 2G83A 4B43A 4WA7A 4M1KA 2BHRA 3NIBA 1V5WA 4JSTA 2JATA 3LX5A 1DE0A 5EXTA 3W5IA 4A8JB 1ZD9A 4LJ8A 2ZRBA 1JR3E 5EUMA 4LJAA 4XWAA 1Q22A 3AVVA 1FFHA 5KHOC 3E1SA 4OQNA 3WP0A 4HAZA 1CXZA 5AJYA 5FFMA 2W6JA 2AD5A 2ONJA 4NYJR 2REXB 1TQ2A 2FSFA 5CDFE 1PLKA 4NKRA 4XSHA 4TL8A 3SBDA 2JAQA 2GXAA 2R6FA 3EIEA 4AC9A 2JLVA 4CEJA 2JLUA 2BM0A 1MRNA 1TQ4A 1QHSA 2OESA 1R0ZA 3BFKA 4JLPA 3QEJA 1M6NA 3TVTA 1H8HD 3L0IB 2VP6A 4DC9A 4E22A 3NHBA 2EVWX 2IK8A 1FUKA 1SGWA 1G7CA 5AR1A 3WRXC 4DLZA 4Q4HA 2Q6TA 1R2QA 4BASA 3KKQA 3UPUA 2ZVQX 5AK0A 4LV5B 2NO0A 3FTQA 4PSVA 1IN4A 4JLDA 2CK3A 2G9NA 4QBGB 3WYGA 3QXSA 4MQBA 4BFZA 3TH5A 1IY2A 1W5TA 2O52A 1NIJA 221PA 1GDDA 3R8CA 3OE7A 2J0SA 3OIWA 2NQ2C 4I1UA 2YHSA 3RRNA 5TDHA 1F48A 2IYXA 4TTQA 3ZD7A 1BMFA 1ZD1A 1J8YF 2XTMA 1QBKC 4GP7A 4AURA 5CB8A 4C2TA 3K8YA 1OFHA 2Q0HA 1NF3A 2OBLA 4N3NA 1OT3A 1TEVA 1RFLA 1MO4A 2VHCA 5JJLA 4G1UC 3B7GA 4NU0A 1ZU5A 3IUYA 3Q9LA 2WJVA 1ZCAA 4M1OA 4BE7B 1LF5A 4YMTA 4WBSA 1AKYA 5TV2A 4D6PA 1DG1G 4DCUA 1TTTA 3DM5A 4TT3A 1E9CA 3Q8XB 2J46A 1HH4A 1VYUA 3IGFA 2EQBA 3EPHA 4PTLA 3AKDA 3C14C 3HU2A 1D2NA 3U3MA 3U3JA 5KDOA 3K70D 1ZC4A 4LSGA 1EFTA 3DM9B 3ZVMA 1UDWA 5JCPA 4ARZA 1DAHA 1E9FA 1YZGA 4FCTA 1UKVY 4US0R 4QGAA 3S1AA 1OB5A 1LTQA 3SN6A 4DSOA 4EJSA 3GJXC 1W49A 4GZLA 5JRJA 1KI1A 3NBZC 5KSZA 1N2CE 4ASUD 1OH6A 2GVZC 4NP6A 4M22A 1XPRA 4PQYA 4JLNA 3TE6A 2C9YA 4UJ3A 1BKDR 2QSZA 4TTPA 3X1ZA 4PZLA 3RABA 3MG9A 1Z6TA 3GLIA 1RVDA 2RGXA 1E4VA 2B92A 2ZI5A 4GPTA 5DISB 3U7HB 3HU1A 3RSOA 3VR4A 2KWIA 1AA9A 4BLQA 1Z0JA 3QE0A 3BS4A 1G18A 2AWNA 1X3SA 5FOSA 3OIUA 3QBVA 2CL0X 4XTCS 2X19A 2PZEA 1A5TA 4YC7A 2XX3A 3W6PA 2C8VA 2R65A 3K70B 2OXRA 2GEUA 4LHYA 5BN4A 4O2RA 1D5CA 4LOAA 1EXMA 1EGAA 4O3MA 2ZYTX 1XMIA 3UKDA 3AP2A 3GP8A 2IYYA 5J4YA 3OIVA 1R8SA 1Z0FA 4MYCA 4US1R 2GF0A 4PC3A 5KNDA 3GJ6A 2P3SA 1S2MA 2KE5A 4LHXA 1XTJA 3AH8A 3QKRB 1C1YA 4AD8A 2A5YB 4NHOA 3BOSA 1XMJA 4D4LA 2YWHA 5HE9A 1KMHB 1KI8A 1PLJA 4HUQA 3NC1C 4CZ2A 2F9LA 1AZSC 4UXHA 4TZ0A 5BYJA 2GXSA 2WOJA 1NG1A 2WMNB 3QF4A 3PG5A 1ZM9A 1G3IA 4C0QC 1II9A 2NO6A 3AF2A 1N6OA 4DKXA 2GK7A 2VP2A 4AYXA 4O0MA 4PHTA 3KJIA 2ORIA 2IHBA 2ZTSA 2NO9A 2HF8A 4V0ME 3KQLA 1J7KA 1E79A 4NYIR 4XVRA 1IXZA 4ESHA 2VTKA 3EZ9A 1DAKA 1TPZA 3AKCA 2WWWA 2X77A 3MWYW 4U02A 2X8AA 2J0QA 4D4JA 1HTWA 5TY0A 4HLQB 4IRUB 1NVVR 1KGDA 5AWFC 1SXJD 4URUR 3QXXA 2XITA 3K0SA 2B21A 2Q21A 3AB3A 3K1JA 3K9GA 4XH9B 5EXXA 5FUYA 5L3QA 1E96A 1UKEA 2V54A 4D0NA 5BQ5A 2O0HA 4TMZA 3LFUA 2QRZA 4A2QA 5ANRB 2GZAA 1XEFA 2SHKA 4R9UC 3A4MA 2AL7A 1IM2A 2A78A 3DDCA 1G9XA 4BQSA 5IT5A 1NNEA 2BDTA 4AYWA 2QTVB 3I3SR 4JBWA 2FFBA 4Q02A 4BLRA 4C0BA 1Z5ZA 4GNKA 3P32A 3PENA 5EP3A 1B23P 1AM4D 1O3YA 4QFMA 3T5GA 2JLXA 1YZKA 4ERNA 2ZE5A 1J8MF 4PC6A 4D80A 5EXPA 3BB3A 2QRNA 4OBEA 4TYPA 2IXEA 1COWA 3I5XA 3AQ4A 1FQJA 2GJ8A 3OESA 2UKDA 1AGPA 2IYUA 5KDLA 1OFTA 3DZ8A 1WBBA 4HB4A 2PCLA 1U98A 1NY6A 4MKFA 3V4FA 4DB4A 2XJ9A 5AJZA 1HQYE 5JWHA 4DHEA 1NKSA 1SXJB 3TJZA 2GETA 4MA4A 3AVQA 1ONBA 2Y8EA 1KJWA 2ZRPA 1UEJA 3THXB 1KO4A 1XEWY 4Q18A 2VHQA 2YC4C 2D7CA 2Q3FA 4OK3A 5FOXA 1D9ZA 3SC3A 1N6LA 1KOFA 1ZIOA 4PPNA 4X8HA 4LBWA 3B1XA 5GJVC 2FZLA 2CJWA 2R6GA 1XX6A 5CIWA 1KJZA 2VHUA 5AJVB 1QRAA 4YQFA 4E03A 3FMFA 1TEXA 2PX0A 4LHZA 1WQ1R 2D2EA 4BFYA 1HQCA 3RANA 1IXSB 3EA0A 1W4BA 2GEVA 1ZUHA 2HXYA 4XOIA 1TADA 3TW8B 2ZSEA 2IS1A 5DE3A 4C3ZA 1P72A 3ADDA 1COWD 2ASEA 1E2GA 2FPKA 1J99A 4P0TA 4MKIA 4DDUA 4M1WA 1L2TA 1QHGA 4YXWD 2BV3A 2EFHB 4Q4JA 3NVAA 1A82A 5CM9C 2XNDA 4MGIR 3H2YA 4QHTA 1ZM3A 4DLVA 2IYQA 5F3WB 3FFBA 3RRMA 1RRPA 1M7HA 4ZDJA 4KHZA 4CYMA 3DMNA 3WYAA 1L7VC 2A5JA 1ZM7A 2QGZA 5C4MA 3RWMB 2CE2X 5G53C 3AV0B 2IA5A 3MRSA 1OXTA 1TQ6A 5E7IA 1W4AA 4EPYA 1TAGA 2WKPA 4X8MA 1G5RA 1FW6A 3OAAA 3NKVA 1FOEB 1GOTA 2E9SA 1E9BA 2CCGA 3K0AB 2BOVA 1U90A 5HZKA 3QPVA 2O8FA 2O8DB 3KQNA 3OIYA 3KFVA 4EFMA 4F38A 5L3SA 3W9YA 5UKDA 4ZIRA 4OHYA 5FBQB 2KSQA 4DLRA 3TAHA 1CJUC 2OM2A 2CHQA 1CRQA 4F4JA 1G5PA 1GNPA 3MWJA 1ZNWA 3K09A 4MRPA 2W0MA 2YYZA 1QHYA 2ZJ8A 2XNDD 2A5GA 2VF8A 4PPQA 4I1SA 3WBJA 2F55A 2RCNA 4XVQA 3D31A 4EPVA 1IN6A 2DBYA 3CO5A 2ATXA 3LVRE 4PSKA 2X2FA 4TLCA 5FL7A 5BN3A 1E2DA 1TU4A 4Q00A 1RYFA 3I1FA 2OCBA 4NBSA 5FPTA 5KO2A 2H16A 4DLXA 4KYUA 3DOEA 4O2LA 2FOLA 5IDVA 1Z0IA 4MH0R 4Z54A 4Q5IA 3I61A 4R2HA 5K8IA 1BS1A 2VEDA 3GLFA 2R44A 3OAAD 2XTZA 2FPMA 1KDRA 2AWOA 4URXR 4IDPA 1Q0UA 1U81A 3PITA 3L8YA 4Z8XA 3CPJB 1Z6AA 5DN6A 5A0FA 4M9XA 1GNQA 2QMUA 2GVDC 1NLFA 2CLSA 4Q9LA 4AIIA 2IYRA 1RZ3A 3LBIA 3IHLA 2P6UA 2RGNC 2RHDA 3LX8A 3Q5EA 1RJ9B 4HB3A 1T8UA 1ZIPA 3RS7A 4RCZA 1UBFA 1ZMXA 3TRFA 4P31A 4B6EA 3LQRA 1MRSA 1ESNA 4PZZA 3B9QA 3T5DA 2YOFA 1JJ7A 1XCGB 1XMVA 4FI3C 4DT1B 2XGJA 1HE8B 2QAGB 1ZJ6A 2ZRLA 3AF0A 2IF2A 1L4UA 3EA5A 3SHWA 1UM8A 1ZUNB 4GMXA 3PR1A 3N2IA 3VFDA 2A9KA 1Q1ZA 3GEHA 4BLTA 2G1KA 2YV5A 4FN5A 3C4JA 4Q9HA 3WP1B 4IDQA 4HB2A 4LBYA 1E98A 4BFTA 1P75A 1W4RA 4I81A 1DADA 3SQWA 1E2NA 4A0HA 1XJQA 2F6RA 4DSUA 2QQEA 4WZAE 2QMOA 1T3HA 1X8JA 1X6VA 3PXGA 2FGKA 1R0YA 3QSYA 2HJGA 3UXMA 1T6NA 4DCVA 5BWMA 4KBGA 2NTYC 4JS0A 1GRQA 1G16A 1II8B 4WXPA 1CJKC 2YWEA 1IAQA 4CF7A 5JWRA 3KUDA 4HAYA 3DMDA 2P65A 5CK4A 2CCKA 1XWIA 3FPAA 2ZU6A 3MJHA 1F2TA 2R8RA 4AYTA 5HCIA 3DPUA 3A58B 1DBSA 4AG6A 2YOHA 4RZ2A 3IEUA 2Q3HA 5GJCA 1NKTA 1ZINA 1NL3A 3JZMA 3VR2A 2B8WA 1T0HB 2J7KA 3FGNA 4JYCA 1MABB 1QDEA 1E2JA 4ABYA 1KZ7B 1QHHB 1P62B 5EE5B 2JLWA 1GILA 2CNWA 4LYJA 4QJ5A 3U5ZB 1W48A 1TUEA 3ETLA 2NPFA 3ZJYA 2BCGY 1OPXA 1R5BA 4OI1A 1JXOA 1JQJC 4QM7A 4ZI2A 1W1WA 2VP9A 4QGFA 4GFDA 3IO5A 4TLBA 3R9IA 1R4AA 4L15A 2LWIA 4MUBA 2AFIE 4RZ3A 3TSOA 2NPIA 1UKZA 1US8B 4G5QA 3D6TB 1XD2A 4DEYA 1G1MA 4B2IA 1NMZA 3K0FB 2OT3B 2EFCB 1JAIA 1N6IA
chains in the Genus database with same CATH superfamily
5AI8A 1XALA 3AMVA 3WQQA 4NG5A 5JZMA 1VHJA 2W98A 1BE0A 3JQBC 2CMHA 1DRWA 1JTEA 3DMFA 3AL2A 1JEAA 1TFRA 4EPWA 4NJEA 4CEHB 3EQ8A 4M9RA 2W11A 1C3VA 4EA8A 4G56A 4J0JA 1P45A 4PIVA 2BFBA 3AKEA 2H9YA 2WQZA 2R25B 3F7NA 2YN0A 2LZ0A 3FZYA 3LUCA 4CMIB 3V80A 5M5BA 3CUVA 4D9NA 5AM1A 4HWPA 1R74A 5HILA 2CUTA 2ZSKA 5KTTA 4HMPA 1G5TA 2J9YB 2ZUTA 1UFRA 1WXWA 3GHYA 3EGDB 2WYWA 4M1MA 1FS6A 3TCNA 3A7EA 1NWCA 2G8NA 3D8TA 1L5GB 5LD2B 2WTNA 3KD3A 4QUKA 3TQIA 1U02A 3H5RA 2F59A 2RHMA 4OJYA 4XFJA 3THWA 2Y1WA 3NATA 4Y6SA 4FZRA 4D96A 4BVKA 1NV9A 1SQSA 3BMCB 3M5CA 1OVGA 2IXAA 4CCSA 3RQIA 3DBRA 3O73A 2GFQA 3C7DB 1DDGA 5F64A 2GCOB 5CLJA 4P54A 3BDIA 5A05A 2G6TA 3H8WA 4KQEA 2VSYA 2GAOA 3T95A 1F51E 1Q1BA 4CODB 3GQVA 4JSYA 1ZH2A 3ZLJA 4URWR 2BT4A 1V95A 1OY1A 1P2GA 2WZBA 1O97D 3H65A 1KBZA 4YROA 2NU8B 3TLKA 1SUAA 5COAA 2GD2A 1U0JA 1Y48E 4JKIA 4OGFA 2GN2A 3LG2A 4WNCA 3IQXA 4IH4A 2WR8A 3M6AA 3E22A 4LGMA 4XX1A 5D3KA 1CUSA 1DRUA 1LRLA 3VDMA 3IDAA 4BHTA 3DSRA 2W2OA 1QE5A 1CR4A 4EW6A 4CT5A 3G02A 4LJ6A 4QREA 3NHLA 4Q48A 3HKCB 3ES9A 1SQ6A 1KS9A 3AEXA 3B38A 3DE5X 4J8PA 3UFBA 3HBLA 1NBMA 2V7XA 3EZ7A 5A03A 1JSCA 1LK0A 4QEDA 1OX6A 5TF4A 4YMLA 3FWHA 2EL9A 3WHLA 5FXMA 3G49A 4GPEA 3UM9A 3DMYA 5IUKC 2FP4A 1B6GA 4WVFA 3DPIA 1E1RA 5LPNA 3QELA 3DL0A 2FWNA 3QH4A 5FV4A 4DDTA 4Z4QA 1SXJE 1KR5A 1PYGA 4IJUA 1IM5A 1S4QA 2X0IA 1XSEA 3DXYA 4NF2A 5BN5A 4DV1B 3IAM6 3NM4A 1Z4PX 1D3AA 2IFTA 3OE4A 3PLNA 2QN3A 5FI1B 2Q5CA 1Z4MA 2IGTA 1Y5RA 4EITA 3DC2A 2O7QA 3VZQA 3RVBA 3DXFA 2IP1A 3NEYA 3UJ6A 3VOSA 5BYKA 1PQPA 4BLSA 4N76A 1AUPA 3KE9A 1QHFA 1WRBA 4GQBA 4MVYA 1U3DA 2ERYA 2OA0A 1N2JA 4BDTA 4F4DA 3EIFA 3M9LA 4MB6A 1KU6A 1NYLA 3JQRA 1Z4JA 1UBRS 4RVCA 3E18A 4UNPA 3RTCA 3NHWA 4PRYA 1AC5A 3FFAA 1MGOA 1PEYA 3TX2A 4ETNA 1JH9A 5GGYA 4CMEC 1RE1A 3LIPA 1IEXA 2Q6LA 2Q4BA 2QNRA 4KFUA 4DA9A 2CHGA 3IP8A 1UMCA 1TDJA 4DAEA 1KO7A 3MT7A 4H7EA 2GK4A 2DSTA 4J6FA 2I3BA 4Q9IA 4ND8A 2QD2A 5ISMA 1K06A 4R41A 5JYEA 1RJDA 4BL5A 1ZS9A 1X19A 2MYPA 3RKRA 2PDAA 2YC2C 1RYHA 1GGEA 4UE2A 4IS2A 1CT9A 4FGKA 1HNNA 1IIBA 4L9AA 1U3UA 2HJWA 4G1VA 3RO7A 1ORRA 3VRHA 2R68A 1QTIA 2CDAA 3G2NA 5JEEA 1DJQA 1MQ9A 4MPDA 3VDXA 1XCMA 2LBPA 1RXCA 4E94A 4JBXA 3EZ6A 3T9CA 2HBQA 3M2PA 4TVSA 3VKGA 3WKBA 1NW6A 4U5QA 1G5HA 2CJPA 1QRSA 3OHPA 2PUEA 1LSJA 1JU3A 2IHJA 1XF1A 4W5NA 1GQRA 2R1TA 2GEFA 3FCUB 1R8JA 1ZM4A 2HWYA 2VNAA 1JEYA 2RGGA 1C0IA 1FVXA 3EZFA 4YDSA 1C1DB 4DLSA 1KVUA 5B3KA 3WMEA 5LU9A 3INGA 1MX5A 4RTOA 2YICA 1Q6YA 4PLGA 4X84A 1C4WA 5CPFA 4CKCB 1D07A 1X9HA 3ORSA 2Q5OA 2WJPA 2YZ2A 3MVEA 1IZ0A 2BJWA 5CPBA 5BXQC 5TARA 1G291 2ZCJA 2X8LA 4M76B 4U0KA 2O54A 2J9XB 3RBZA 3T3GA 1G6KA 3SEAA 4YUAA 2X9LA 1U9JA 2Q29A 2V7BA 3HUTA 3N70A 1RWWA 1TU3A 5AJHA 2NO7A 2AQIA 2IV7A 1PWZA 4H7FA 4BU1A 5AK6A 3TLAA 4UQOA 4NOKA 3W6NA 4AJHA 1EIZA 3BIJA 4DCJA 2Q6OA 3EXG2 1WCYA 3KAKA 5IAJA 4WRRA 1VLZA 2EKLA 1QAQA 3LUHA 4M1QA 3F71A 1QPZA 1FU4A 3WB1A 3FKSD 4DMRA 3WE7A 3I9JA 1CUYA 1QR2A 1T5TA 1MIOA 3QEOA 4JZKA 1NP6A 4IEIA 1UQTA 2DUNA 1SOVA 1SIBE 1PZEA 3QKWA 2HMUA 4H35A 1M1YB 3TIIA 3WJAA 5A4KA 2XCRB 1FPQA 4K7JA 2HAEA 2PA0A 4E14A 5E1MA 3AX6A 1R6VA 4W8HA 3AY6A 2HWXA 2O1XA 3UMRA 5CUQA 2HBYA 2JBWA 5I7HA 3FCSB 1Q7GA 1JDBC 3CF2A 1TF5A 1N0UA 2HI0A 3C1OA 1L8XA 4PO3X 2D1SA 5AW7A 4BMNA 4OK5A 5I5GA 2XTNA 4WDQA 3S2EA 1NPYA 3S55A 5BWNA 2AOUB 2JBAB 1YT5A 2O0JA 5LUAA 4DR7B 4L57A 4LDAA 2OK8A 4Q47A 2YBEA 3UJ3X 2COUA 1FP6A 3AR8A 1ABFA 1R16A 2AN3A 2Y0DA 2ZE8A 3IEIA 3QUQA 3D8NA 1WWKA 2EKQA 1KZHA 4DLPA 1M54A 4QDOA 4U7TB 4YAFA 2GBPA 4LE1A 1EIWA 3T7TA 4Q4DA 1X1EA 4YJFB 3CMCO 3FOFC 3PA6A 2ZR7A 3FVVA 3SEZA 4FM9A 2NSLA 1LH0A 2FOXA 2ZYVX 4ND5A 3VI3B 1X92A 2EKPA 2JI4A 4B3DA 3GT3A 3ZZMA 5DP1A 5T4EA 3P2JA 5FBHA 4DXDA 1HE5A 5FORA 1BNCA 1NR1A 3MPOA 3OD1A 5IG2A 4BVBA 4OYLA 2V4UA 5CXXA 1AO0A 3PNLA 5FPKA 4XRRA 2VJBA 5EIBD 3ABZA 3PLRA 4TTJA 2W2TA 4Q3BA 1LFDB 4KXLA 5IX8A 2IYWA 1RKXA 3SOPA 1Z88A 3WGOA 5FBKA 1HEUA 1O03A 1YQDA 2E55A 1C8VB 1SC9A 1Y81A 3D6AA 2QN9A 4K26A 4KNVA 1NFQA 4K8RB 2ZAYA 4N8SA 1Y6ZA 2P3LA 1QFSA 1GZSA 5TS3A 1JKJB 3OFVA 4MB0A 2WB4A 5IU6A 1IQUA 3ZV3A 1U94A 2BMVA 3EXIB 4B6OA 4L16A 2Q9BA 1I0LA 5BQXA 1U2PA 2F43A 3ZBUA 3WGLA 5ADHA 2OY0A 1C0EA 2SICE 3NDIA 3BMOB 2HADA 4YP9A 1WZNA 1UM9B 4EECA 4ZYZA 3VKWA 5JJIA 3UW1A 1C29B 3BWBA 4KWTA 3VPSA 5JS8A 1VZ3A 3FRJA 4Q4HB 1PR2A 3Q8WA 4OMDA 2C8LA 4JEIA 5JANA 2JGNA 2I87A 4F8EA 3ZGVA 4OXKA 2PO5A 5IAKA 1BFKA 1S8OA 1VMEA 1XA0A 2JVIA 1UC8A 1TX4B 1BA2A 1W35A 3BGDA 3ER9A 1P9NA 2OD9A 1VPEA 1W88B 2WSSD 4TV9A 4WNYA 4QDKA 4KWCA 2NTNA 1LBEA 2R1ZA 3BMNB 4DJTA 2X5KO 2FRDC 2C03A 1P17A 1ZX1A 2VDVE 2P67A 1J07A 1UBJS 2BAGA 3BD7A 4XQGA 4GM0A 1PL6A 3OLXA 4YAWA 3DZKA 1BCRA 1Y3CE 2EFEB 3ORYA 4P0QB 3QUCA 1ADGA 1XCPA 2WIGA 4L28A 1MZPA 2WPDA 5JSYA 4KFCA 2PCJA 1Y8AA 4FMDF 4QECA 3U37A 3LSTA 1MN6A 1BIFA 2P5UA 3ZH9B 1FEZA 1PR4A 5J5CA 4FEEA 3MCVA 4ZAFA 2EWMA 1AUOA 5HYVA 4RJTA 3OJFA 3G2LA 4PRZA 4RZSA 5GONA 4Q7KA 3SLKA 4E31A 1MO2A 2GT1A 2OVBA 4YP7A 2J30A 3C8UA 1YRHA 2WKQA 2OYRA 1NSFA 1SBQA 5ESWA 5DJ5A 3IL2A 3A25A 3VR5H 2IS2A 4OIMA 1HT0A 2FZ5A 5EYPA 1DPFA 4IDOA 3HRIA 1ECCA 3RC2A 1CQPA 1XI2A 4GMDA 3WLQA 4DMLA 1DLIA 1F60A 1DAGA 1E64A 3ADKA 3S2FA 2K5UA 3DLAA 3MF4A 5ESXA 2B83A 4B7AA 5CVUA 1TVEA 4YRNA 1TYCA 3QXJA 1YVPA 1DC6A 4YRPA 3MT8A 4V1CA 1TJPB 3URMA 2JB9A 2HFJA 1UOPA 5BSTA 1V11B 2XWQA 4NCKA 3JAMA 1Q1GA 1LD3A 1G3QA 1GN9A 3NH9A 2O3RA 2D06A 2EJUA 1YBVA 4IL5A 5H16A 3VBCA 4BNJA 3D8HA 1ISPA 3I4CA 3K0CC 5BSGA 2QZPA 2HW8A 2YJ3A 4HYQA 4R84A 3IVRA 3GGPA 1GD1O 2FG5A 4TXMA 3UMFA 5ESDA 4TZKA 2YJ6A 5LSAA 3ZWXA 1DQYA 3RWOA 1GUYA 5A6SA 1QIEA 1L5NA 4IO1A 3WGHA 1BXKA 1D2RA 3DOFA 1KFBB 1PFQA 2FK7A 4HDCA 3UAYA 3VQTA 1DFGA 1KMMA 3W9UA 4YYZA 2JEOA 1XMPA 4JVOA 3K6RA 2VHWA 4OBWA 1JDSA 3NEAA 5C52B 4M1YA 1SBCA 1W581 5FWXB 2VQ6A 5A0VA 4DCMA 2V6IA 3MD9A 3DJYA 3FWZA 3NBKA 4XQEA 2H51A 2IF0A 1NMXA 1G6OA 3BRWA 1E3MA 3X2EA 2PR2A 4TL7A 3C3XA 4IKOA 1YDEA 3WV4A 1EFVA 1YB2A 2ZIVB 1MV5A 4UC0A 4RPIA 1H2XA 3JQPA 4EY4A 1XU7A 1QDLB 4X00A 1OB2A 5I3CA 1PD0A 5K3AA 3OF2A 3VVBA 1JFSA 1DXQA 3R1IA 5IMSA 4TQAA 2BZ1A 4BV8A 3AOEA 1QTQA 3G9QA 4IKEA 3EARA 1VIYA 2WTAA 3M6VA 5I4KA 3SYLA 4TVBA 4LF9B 1MPXA 1TUIA 1WXHA 5JFTA 1H8EA 4Y30A 3WWZA 1F4LA 1ZOIA 1X14A 1I6KA 2VPZA 4MVJH 3QK7A 5AKKA 3ZCSA 1PSZA 1ZVMA 2QROA 5FJIA 3VZPA 5HZGA 2I3GA 3RLIA 5LMNB 5ALMA 4D5GA 3U13A 2AG8A 3MGAA 4N39A 2GEDA 4TV9F 3DDUA 4EMTA 1WULS 3HYSA 3V8QA 1YFLA 2J32A 3FW1A 3D4BA 4NDZA 2BMEA 1AOXA 4MXDA 4FYHA 1A4XA 2C5HA 4NICA 4PFQA 1R10A 5BT8A 2WMOB 2P27A 5K3CA 4BGEA 1ESCA 3ER6A 1QHEA 4HUQB 2ODTX 4TSRA 4QTXA 4TRMA 2XA1A 1W76A 2MHCA 2IXTA 3RRXA 7REQB 3H2IA 3INYA 4MQ5A 1PGJA 4QQKA 2JCBA 4X71A 2CLDX 3V46A 4CKXA 2CHVA 4XYBA 1JEOA 1P0QA 1UKAA 1IHOA 1XG5A 3A9SA 4J9VA 4KEAA 2VPTA 5DZSA 1K7YA 3B6ZA 1TJ5A 2C99A 2CNBA 3VH3A 4DMUB 4WADA 5B1DA 4Q66C 4UDNA 1BGWA 1I01A 1EX6A 2PEYA 4R05A 5GONF 3TMKA 2BFMA 5LXTA 3MGKA 2HLDA 1KZYC 2G04A 4GXTA 4G4SP 2J09A 1EK2A 4D97A 1B3BA 2O2DA 2C29D 4NDNE 4RAOA 1U5BA 4NIMA 1LLFA 4ARSA 1P77A 4L9WA 3JQ7B 5E7MA 2WJ6A 3GG2A 5JAIA 3VHRA 2IW1A 2BRUC 2ZYUX 3JTEA 3LM8A 2NT4A 4XQCA 1LDGA 2ZI9A 4JBIA 1Z25A 3E58A 1SA0A 1OKKA 1P18A 2CLCX 4HSEA 4Z9FA 2XB9A 4ZVVA 3WGZA 3WY9A 4N41A 3RJZA 5E6UB 3NOVA 3SZUA 2CD9A 3MUFA 1G8HA 5CYFA 5DT9A 4QNRA 3BFJA 5BMVA 4Z1MA 5INTA 1T9GR 1ILWA 3TM5A 4G3XA 4E2YA 5HM6A 4QL3A 4AO8A 3K71B 3GPLA 3FNEA 5AVTA 3BN3A 4B6PA 1EQUA 3UAVA 4J0CA 3ECCA 1L8QA 3M82A 3AVPA 4Z4HA 1BWSA 2PUWA 3WISA 3UMMA 1YHNA 5CJPA 4MWEA 1GFZA 4HX9A 3GBVA 3OFKA 3PFKA 5F52A 3ZN2A 1P1FA 1S2DA 2GSDA 3AG5A 4FHZA 2C95A 1ZJWA 3MS2A 1ZMRA 3AR6A 4RAQA 3ZWOA 3MILA 3LCVB 4R2LA 1XFAA 4Y6LA 5H3LA 4NBRA 3PFBA 1BXGB 5JPDA 1R12A 4JHXA 3TNYA 4XASA 4BV3A 4AICA 1AQNA 5LA6A 3RUAA 1HYHA 1ZSVA 4P4SA 4EVSA 1D5WA 4L85A 3W90A 1PFWA 1ZK0A 4J4HA 2K87A 3LNCA 1OAOC 4NBKA 1LC0A 4C4RA 5KYUB 4KQHA 3CHYA 3MTAA 1AGRA 3OO0A 2G9RA 4H15A 4E15A 1UXHA 4BNGA 1KEVA 2W58A 4KDEA 2ROQA 1TZ2A 4GE0A 1NUPA 1OLOA 2P9EA 2W4QA 3KEQA 1RTTA 1BVUA 1KY2A 4BP3A 4OYHA 5AESA 1PZMA 3RSGA 4MW1A 3AJ8A 1ZXBA 5DCWA 3K31A 5KKNB 1M7BA 5TVGA 2GM9A 3EEYA 5H82A 1ZR4A 2H1FA 3GUHA 4OCZA 5JQGB 1RP7A 3NBXX 4GI3A 3E70C 4BN5A 5EQFA 5KWSA 4BGUA 4CKZA 4FNAA 1IPHA 1FLVA 4R5HA 5J5AA 4XGRA 3VR4H 1Z29A 1NN1A 1OYVA 1WB4A 3QMVA 1WB6A 1Y33E 4H27A 1FL9A 2O7SA 1F7UA 1HY3A 1VJ0A 3QIVA 4M49A 3CVJA 3KG2A 4RVSA 4QQ8A 4YA6A 3SLRA 3NANA 5CA1A 3KCQA 2CV2A 2WAOA 5F9FA 1IOVA 2AR7A 5K3BA 4JP8A 4K6OA 4LZPA 1VCOA 3OZDA 4KL8S 2DHCA 5JE8A 4LBZA 4RDXA 4HDSB 5HDQA 1K4KA 5G0VA 2F3SA 4DSTA 1NY5A 5LXTF 1KRXA 1QS0A 3VJRA 3I2JA 4H3VA 1EP9A 1ZH8A 2IOFA 2RONA 3OJWA 4NI5A 3R0XA 1NM5A 1NU8A 5DW0A 4Z3DA 2J67A 2OFOA 4WXRA 3JWHA 3TNDA 3H9EO 3I62A 2B94A 1A77A 2JAUA 1QZXA 2IEZA 3DW1X 3LBYA 2WP0A 1V41E 2H7CA 2D62A 2GO1A 2PRSA 4M8IA 4BJ5A 4P33A 4H6WA 3NU1A 1P4GA 3QV1A 2A9VA 3MK31 4G1CA 2WSYB 1GU1A 4OJTA 5TMBA 1R5OA 4NEQA 4EUHA 2L2QA 1AQ6A 2BFPA 1NATA 1O1YA 1P5FA 4E30A 4NFYA 3R0IA 4X64B 1SIWA 4TWZA 1D7OA 1LJLA 3HNRA 3DOHA 2A86A 3D6HA 2WF8A 3JZAA 3M5WA 5B1IA 1MENA 4UZSA 2B34A 3C5VA 2HNAA 3L07A 4M53A 1PZXA 2VCEA 5JMPA 1BS2A 3DWIA 5DHTA 5IRCD 5LL6P 2QL6A 3E9NA 3LKZA 1KYIA 2V6JA 4BE4A 2OAEA 5L3SB 2V3CC 4RD0A 4XD7D 1OA0A 1Q0PA 4H4CA 3LE8A 2PKXA 3CQ9A 3O4IA 4UE3S 4V0MA 5BSFA 1G4HA 1E8MA 1KK1A 2ZW9A 3M6UA 3AUKA 3NTUA 1GUBA 1M0TA 1J42A 3NIFB 3K4HA 1UODA 3DAYA 1CQWA 4W9NA 2CNOA 1OI7A 4KVGA 5AM4A 1SCIA 3W34A 4DR4B 3IAS6 2ZUSA 1FMCA 4GWKA 3ESDA 4RJIA 3ZH2A 4FYYA 1KDVA 4C4ZA 4HDKB 3EBPA 1M2OB 2WZDA 4M7OA 4W63A 1LBIA 2P8JA 4M60A 3AFOA 1ESEA 3L92A 5LA6F 4KQ9A 1NXQA 4ZO8A 2OCXA 1YR8A 4MR8A 2I1WA 3O8QB 4INZA 4P4LA 3F5FA 4H0NA 3SMQA 4GE3A 4HFMA 4ZXFA 1XRJA 3P2YA 3PPYA 4QTZA 1FMFA 1PR6A 1V1RA 5HF9A 1EINA 5EA2A 3KJGA 2J9GA 4MROA 3LDAA 5KJ1A 3GJ3A 4R1NA 5F33A 3ETCA 4UUAA 5B5SA 3M1IA 4W5JA 1SQGA 3OLCX 2E49A 3REFA 5I51A 5F4BA 3WL5A 2GFHA 1NQAO 3MS4A 3JYNA 4WNAA 2RGDA 1ABBA 2GLTA 4KLRA 2QJTA 3QEBZ 1O6BA 5ELLA 4I9GA 4G8DA 1JDUA 2B8NA 2XMBA 4QE3A 2O1EA 3GJ5A 1RNLA 1GAQA 1NRJB 3PICA 4LY3A 1IQRA 2XMPA 3PVZA 2HJVA 2LKDA 5TQ0A 4PRKA 2ANCA 2AJTA 1Q1NA 4R1PA 4D9GA 2NO1A 1XB2A 4GOKA 2VDNB 2N1BA 5CA1F 3PL1A 1ZL2A 2W4IA 2ZSIA 2XDAA 4GO1A 1DIRA 3PNBA 4I4CA 3MWGA 4JI2B 1BVHA 1JXQA 1D8TA 3HCAA 4CQLA 3CJRA 4G5FA 1RC8A 3ABRB 3CX8A 4ZEXA 1E3WA 4RGYA 4G0VA 2P5TB 5G1PA 5DSZA 2RHCA 1CRWG 3HA2A 5IAAA 2WABA 4Y3UA 3G0DA 1WSDA 2LDXA 2WUDA 2DWPA 4AMYA 4PXSA 2XNKA 3BD9A 3VR2D 1QTRA 1Z3CA 2GWHA 4FWIB 1W2HA 5FWYA 1GPDG 1KPHA 3KPVA 4TSKA 4XWYA 1J2TA 4FGLA 4MB2A 1UDXA 4DNPA 1D0IA 1E3DA 2J3EA 4DNFA 1CR0A 3SM9A 3WL7A 1SRQA 2R5NA 4ZTZB 3NVKI 2IIBA 3COSA 3CPHA 1IZ9A 1HMYA 1BU5A 2HRQA 2PAFA 3K96A 1VI6A 1YOVB 2EBWA 1CUDA 3BSFA 3MERA 2CCJA 3QUSA 2QE7D 4OJKA 2B8TA 5CLQA 5FP0A 4WOKA 3RH0A 3ZXUB 1JA1A 3QLVA 1A50B 2B69A 2MJLA 2VSXA 4FQ7A 3THRA 1GSAA 2D7JA 2D0IA 4JKOA 4EHBA 1RKBA 4WJKB 4DF3A 1GQSA 1BDHA 2FN4A 1RWMA 3KQTA 4JFRA 4S0XA 3TLYA 5IVHA 5FTMA 4XVUA 3ZIDA 4DL9A 2WDPA 2W2KA 3RYHA 1P60A 3CRQA 1RACA 1CJSA 4OH1A 1OH5A 2O8BA 4F2DA 2HU7A 1EFCA 2F1HA 4QYXA 4J0KA 3NHPA 4K0KB 2GK3A 4R1MA 1SG0A 5AO9A 4H1VA 2Y1KA 4PYJA 5CLFA 5CIYA 1L1FA 5SY4A 3ND8A 4I6JA 4RVHA 1YRAA 4JR0A 3OZBA 1JLLB 4JT2A 4ND1A 1F6BA 4FI3F 1XTKA 1NUUA 4FYVA 2ODBA 4URHA 9ABPA 2EZ8A 3QBTA 2DKOA 4JLWA 4QTUB 1A7AA 1RW4A 2O9JA 4ZCLA 4Z54A 5C5DA 1GKYA 1XVVA 1FP7A 1XKXA 1K75A 4N5DA 3TZCA 4BMDA 3AUUA 2HT6A 4QPZA 4UBIA 2VKQA 1WHSB 2AR9A 5LZ8A 3UA3A 2WQ7A 1AKQA 3W78A 1O7JA 1UQUA 2OUIA 3BRSA 3BYZA 2IV3A 4O4HB 4BFCA 4ENQA 1Y9EA 1N5MA 4JOQA 4L50A 3QU2A 4DBLC 2W8BA 5FTLA 2ZB2A 4IFBA 1HSOA 3R2JA 3OFND 4A8JA 5EJGA 3PD7A 3DVLA 4C07A 4LDJA 1SUWA 3PGXA 3ZTYA 4K6FA 3RT7A 2Y1FA 4C4PA 2IT1A 3K2EA 1A88A 2QP9X 4MA5A 3ZI4A 1I6WA 4HO1X 1XVLA 2YXDA 1XD2B 3BULA 3ZU4A 1TTPB 3BERA 4I8DA 3ZQJA 2WWFA 4MPPA 5BUCA 1D9XA 1QHXA 4IV8A 1A9SA 5JD6A 4EPXA 2QLTA 4FZJA 1GZVA 3LF2A 5HGXA 2WIDA 3P0IA 3IODA 3G68A 3M0EA 3L0ZA 3FHTA 1K2WA 4X44A 1YJ5A 4MS4B 2WIBA 3RYHB 3NDPA 1C7RA 2OGUA 3VJKA 5BNTA 4DIBA 3WSVA 3NBMA 4H59A 4Q3KA 4ACAA 3BIFA 3UCFA 4LZOA 1C3LA 3HVUA 1Y7LA 1K3UB 4PPFA 4GS5A 3M1LA 2Q5JA 4U7FA 3U49A 2UXBB 3AVXA 3CH7A 4FNMA 1B76A 2I6QA 4QBFA 2J3HA 1PFYA 2B8JA 2P9GA 3AR3A 4DB2A 1VLQA 2OCLA 3N8GA 4K46A 3K72B 5AIAA 4KKVA 4OQEA 4NH0A 3KQHA 4ZTUB 1E7MA 4IEFB 3OP4A 3LC2O 2C1ZA 1YE3A 3EGWA 1P1IA 4IVPA 1XTQA 2C4WA 2C61A 1FE8A 2FR0A 2VJLA 2FEMA 3E3MA 4G67A 4LQDA 4LY6A 4OKIA 1HYGA 1ZBDA 1SXHA 4MAMA 4ZEMA 3OJEA 5IKPA 2EFGA 1UZLA 2J5QA 4QBHA 2CXQA 2J08A 3QG1A 5JALA 2NZJA 3CLSC 1M8KA 1KBQA 5E7JA 2P6OA 1B1CA 3BKXA 5A4IS 4FR2A 3F3YA 4IGFA 4JT9A 1CZUA 1ECGA 1P2VA 1N1GA 2QG6A 2XTJA 2V7QD 3STYA 1YXMA 3IILA 1SVWA 4FOPA 4JR2A 1CFZA 1ZGZA 4CR7A 4L08A 2YHUA 2O2CA 1YC5A 3SF8B 2C5GA 2P4SA 1HLPA 1AXGA 3EC1A 1T0BA 1FP1D 2RBGA 4KAJA 1WV1A 3PGMA 1KWKA 1FFDA 3KC2A 4NCIA 5AOCA 4LNHA 4AVYA 1I7PA 5JAQA 2NQTA 4B47A 1E9DA 3ROFA 1M2HA 3FWNA 5EHGA 3P26A 1R4MA 1JHXA 2JC3A 2ZSDA 2FSPA 4Q1AA 5ELMA 1QH8B 1BJKA 2D0PB 4LXYA 1T3TA 5CX1A 3UAXA 2P1DA 5AI6A 2XQVA 1FF9A 4M7PA 4ZV7A 1KETA 1JSLA 1GHTA 1CDOA 2UVPB 2SCUA 3RU2A 1L9KA 1F0KA 3LKBA 4HH4A 3FHOA 3G79A 2XAUA 2BKAA 3NWOA 3FGPA 3T7SA 4D3XA 4AY3A 2DFNA 4AK9A 2DECA 3UW3A 1Z07A 4WZAA 3GCXA 2XT6A 3TBKA 3FDFA 3ON5A 4AQYB 4MHTA 4HH3C 4HXFB 3SQXA 1KRWA 2QTBA 1A9PA 2FWJA 3OKFA 3PIDA 4X20A 4L27A 3EGXB 4J3FA 4KO4S 3ZJTA 5HUQA 2ZSHA 4QOGA 4DCCA 4X90A 2QTMA 2IZZA 4MUGA 1MA0A 2KM1A 1DJPA 3CJTA 3NJ8A 3RFFA 3TCKA 3EQ7A 3U4CA 3N6VA 3CU5A 3UK2A 1CETA 3BFXA 4QBKA 3WK6A 4B48A 3FYTA 2Z9BA 1QPBA 1E3TA 2IXDA 1CDDA 4QTTB 4RVFA 1UAAA 2YJTD 1H6AA 3EPRA 4HJXA 4PQRA 1DBWA 1AIPA 1D4ZA 1WAMA 3I0ZA 3SXJA 2Z43A 1XU4A 4TMKA 3ZWKA 3IAUA 4BLVA 2IZ6A 4Q1VA 4DQXA 5IKXA 2ZJAA 1ZW6A 2Z5FA 5C3UA 5AJWA 2ENUA 1TGYA 1GLGA 1ID1A 1YZVA 4NK4A 1U4NA 1BH6A 3V6LA 2A9OA 4A0RA 1MZVA 1O0BA 4WEOA 1N5JA 3F2IA 2CBZA 3R74A 4C6TB 1G8SA 2G80A 2P3OA 1YHYA 4KIWA 4YJ2A 5CCXA 1TMOA 1MX3A 2XSZD 3EUFA 1M6VB 4OGLA 1C3XA 4FW9A 5KAMA 2O06A 1M2WA 4NZOA 4B79A 2XECA 3D3NA 3M5PA 1Z75A 3WLEA 3IT3A 1QGAA 2JFPA 4ALIA 2V4ZA 1M34E 3EIOA 4MOWA 5ALUA 2D2VA 3IULA 4BWYA 1FIUA 1O6ZA 1N5IA 3KU1A 4PX3A 4DMMA 4NCHA 5IC5A 2IL1A 5K6AC 2CZQA 1OFUA 2FMXA 4UU8A 3L43A 2ZM5A 3KKMA 5THQA 4RESA 4FYPA 1PZNA 2AFHA 4G5YA 5DNEA 3UUFA 2QPLA 4ZVQA 5EPOA 1FS5A 2CV0A 5IDXA 4DQ0A 4IWNA 4NC9A 4UUQA 1RWPA 1F3OA 4K9OA 1IMOA 1U8ZA 3UJNA 4IH9A 4M0LA 3W2HA 2FLVA 4K6MA 3GRFA 1OGIA 2LCQA 3LSYA 4YDQA 4EHDA 2AKAB 1I4OA 1U0FA 4BP9A 3UGQA 3PEWA 1T2UA 1J22A 4MVCA 3PXAA 2R6DA 1K6EA 4KP7A 1BE1A 4WKOA 2J5RA 2VOJA 4PZPA 3AINA 1N6PA 2ZUCA 5KQLA 1DQRA 5I7SA 1FJXA 1O87A 1JQ3A 2QN7A 2APJA 4WMLA 5JC8A 2ZRMA 1WJGA 3CEPB 5M29A 1AJEA 1JP7A 3KQVA 5EERA 1CRPA 4OO3A 1SXJC 5TRTA 2UYQA 4FMCF 1M75A 4PY2A 5B4VA 5I47A 1XNGA 1UFVA 1G7TA 1U2TA 1UFOA 1Y9JA 4MV5A 2OAGA 4GMKA 5ESRA 4CFSA 4QYMA 4EHIA 3K73O 1EB8A 1TJ4A 1KFEB 3IMGA 4ZARA 4HNTA 4AI6A 3LH5A 1HMPA 2W6MA 3HXOA 1I9CA 3VNBA 4KPUB 1IY0A 1UJMA 2DBZA 2IOHA 3GLFE 1XQWA 2C7BA 1JV2B 3ZZNA 1XEWX 2QTVA 1A1SA 4DDMA 3ANNA 1XDSA 1SB8A 4L5IA 2DFKB 3JALA 4KB5A 1R18A 4YRQA 4YT4A 1NVKA 3KB6A 1IOZA 2BM1A 1TRHA 4W6QA 2HWKA 2OGZA 2YWDA 5DSXA 4CKWB 1QP8A 1S3IA 2OV4A 2KBFA 4RK5A 1YH3A 2HYDA 2QTNA 5L40A 5CGZA 2ZS8A 2GHIA 3IERA 3WG9A 4BZWA 2WF5A 3COPA 2HPHA 5EGNA 1EGHA 5JG7A 1G3UA 4BECA 1KMQA 2V7VA 3U7QB 3W3AH 2WIKA 5KNCD 1OLXB 2FSIA 3I01A 2OPHA 1YKSA 3I42A 3KVVA 5AVYA 5I48A 2C2MA 4FFNA 3KQUA 2JGFA 2RJNA 1VL1A 3TD2A 3U3RA 5A3QA 4ZD6A 3AW9A 4NVRA 3PJRA 1MXFA 5H68A 4JJFA 4BNVA 1PVVA 1P91A 5HSGA 3KXKA 1X0XA 4BPBA 1OBFO 1TCUA 3T34A 3AI2A 1OTHA 3RHTA 3RD5A 4A03A 5HQ3A 5DRTA 3LY9A 1SBHA 5B1HA 3DQQA 3V7UA 2VLIA 3F8TA 4CLHA 5DKFA 4YUYA 2H4ZA 1GG5A 1TJ3A 2AYZA 3T4PA 3V5NA 4C03A 5B3JC 4RS3A 1W0KD 4KGDA 1JDPA 4AF7A 2NZUG 3PUWA 2XZOA 1FJGB 3IRUA 1HT3A 4P3NA 3HKEB 2MSKA 1R0CA 1E3SA 5H02A 2HYIC 3AUYA 3TI7A 1E9EA 2QMEA 2YJ5A 3MSXA 1VG0B 1D2MA 4DV3B 1O6GA 3N2NA 2HNBA 1OAAA 1W94A 5IK2D 3SJ7A 1CFJA 1U2ZA 3FTPA 4LN1A 1HYQA 1EVYA 3UYLA 4ZO7A 5KNLA 4LFCB 1PKEA 3W4JA 2GJ9A 5AD1A 5BNIA 6YASA 4GW3A 3PQDA 1U31A 1TQHA 1WUKS 5H4HA 1BKSB 4PYNA 5GZ1A 4NAUA 1G2QA 3FLBA 3FY4A 3NGMA 1GRNA 1PR0A 5JSUA 1IE3A 3H86A 4FVTA 4YMWA 3WNCA 1QGED 4A6DA 3L1KA 5FADA 4NYIQ 1E4EA 4QPCA 2PFGA 5CT6A 2PWBA 1W73A 4PFKA 3HJRA 4L74A 3T7JA 4A0GA 2QA5A 5LP6C 5JBQA 1SG9A 1RLJA 4C6SA 4G41A 4Y6OA 3DC7A 3P5BA 1JMYA 1R0RE 4QULA 1Z6ZA 2WYHA 5CGQB 1CNMA 1SHTX 1OI4A 5D5PA 3NUZA 2QR3A 5F1KA 5IYZA 3LLVA 1SVMA 1Q3TA 4GM4A 2DUWA 2NZVG 1N4DA 3CXRA 1YE5A 2FGJA 2REOA 3WZ2A 4HYYA 1HUQA 3QW2A 1ORTA 2HREA 1R0WA 4RPCA 5J4KA 2PMBA 4N82A 1H3FA 2OBBA 2OZEA 2HFKA 1KZGB 1X7YB 3IXMA 4C7XA 2NSDA 4OXYA 1G20E 2PLRA 2GCPA 4UEJA 4X1KB 3B20A 1FMJA 2Q1XA 5AJXA 1DQNA 1M72A 3EY9A 4O5AA 4OSOA 1DG3A 2HO4A 2GAFA 5CFOA 3KTAB 5JH7B 3U6BA 2YUTA 1DT3A 2ODNA 4UUPA 1MO6A 2EQAA 4XFKA 2E1PA 3ZD8A 3ZS8A 2O07A 3WADA 2G9ZA 2QUBA 4KXWA 4C08A 3CGWA 4YRLA 1TFUA 2M2IA 5CD1A 2WKSA 1T35A 3HA3A 3NHUA 4HATA 3PDCA 4CM4A 2XODA 4TWAA 4X8OA 2PPLA 1K5PA 1XPOA 3IP7A 1SVUA 3TFQA 2K7FA 4WXHA 1SK8A 5I3ZA 3OCYA 1QP7A 1WOYA 1HFWA 1E1LA 5CK5A 1XMXA 3ZD9A 3P2KA 4F7WA 5BRNA 2I4RA 1WMFA 2AN1A 3N74A 4ZRMA 4DA6A 2Y1LA 4F93B 3OZ7A 2YIJA 4PYRA 1JQLB 1YR6A 2GGSA 2C31A 1JHDA 3LPCA 5EZ5A 1CUVA 1R0KA 5G4KB 2Z56A 4LMPA 1UFQA 4NOMA 4AZ0A 3ZJ4A 5KQRA 4D3FA 3R0QA 2QWXA 1QQAA 1J2YA 2JFGA 1BVRA 1CX9B 2Z8YM 1P3Y1 2F17A 3S27A 3KQKA 2ZBFA 3ZHRA 2JI9A 5A06A 2DE0X 3BJIC 1FFWA 1GYRA 2Z2YA 3LGXA 3H84A 1JR3D 2DHEA 4TQUS 4EBFA 4Y7DA 4XW2A 2FWRA 4JMPA 4Q1FA 4ER5A 5BVGA 5KNBA 2AQ8A 1K89A 4BRZA 4RZXA 3HVJA 1KSHA 2NG1A 3R77A 2PRYA 5COBA 3KWFA 2XUPA 4Y0VA 3NZEA 4EVIA 1BE6A 4GQAA 1L7RA 1PK7A 3EE6A 4FONA 1E5TA 5GVRA 3KR9A 5AVXA 2R5WA 3BBLA 4J2HA 1N1EA 1J09A 3GYBA 1L1QA 5G0WA 4D8TA 2FEWB 4JLVA 1M2GA 3WR5A 4RSMA 2P0EA 1KARA 5TEVA 3B60A 4G23A 3NT5A 5DYWA 1UPXA 1SZPA 1WUHS 3AJEA 3QFCA 4A8TA 3BE6A 2A9PA 4DT1A 3PX2A 4J0IA 2QR2A 3SCZA 4KITB 3K9NA 4I4NA 3EFEA 4YY3B 1UBSB 3I8SA 2AKYA 2QAGA 3TRHA 1X94A 2FNAA 1U2DC 1X86B 3DE2X 3LI2A 3TZBA 1C8BA 5KJEA 1G8JA 1TUGA 1WIWA 1ZUNA 3W5DA 1YVDA 3EPKA