1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords phosphofructokinase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
4MCJA 1S2IA 1ZXXA 4FYHA 4KXMA 2KHZA 4OHBA 2HIGA 4HX9A 3HNOA 1KZHA 4JEMA 3O8OA 4KXNA 2Q4DA 4JENA 1MTOA 1S2LA 4WL0A 3O8LA 3BQ9A 4I7EA 4LJLA 2IZ5A 4FYIA 1S3FA 1WEHA 2KLHA 4KXLA 3UQZA 6PFKA 3O8OB 4NPAA 3PFKA 1F8YA 1S2DA 2IZ6A 5AJUA 4MEJA 3U39A 1RCUA 1S2GA 4PFKA 4P5DA 2F62A 4LJRA 4I36A 5ITSA 4U1RA 3EHDA 2PFKA 4RH3A 3F5MA 2F48A 3SBXA 4I4IA 4LJKA 3IMKA 1F8XA 4OHRA 3OPYB 3GH1A 2F67A 2PMBA 3O8NA 1T35A 4JELA 1PFKA 2A33A 3QUAA 5AJTA 3K2QA 1WEKA 3OPYA 4A3SA 2F64A 3MAJA 2NX2A 1YDHA 2Q4OA 4FYKA 2F2TA 4P5EA 2A0KA 2IZ7A
chains in the Genus database with same CATH superfamily
1F51E 2OV2A 3NT4A 1PUFA 4JLDA 1CVIA 2GNAA 1K8YB 3E61A 4TL9A 5G4KA 4ALMA 5HRCA 5LHGA 1DKUA 3RROA 3L8FA 3M4XA 2ZIXB 5M04A 1QG0A 4C4TA 2WTNA 3AY3A 2CYAA 2NSJA 5C8XA 1F6WA 3LM8A 1Z2NX 1K6JA 1ZMBA 4PINA 3OFND 3PEYA 1GPUA 1PR5A 2ISSD 3UJ9A 5J3LA 4DQ0A 1XCBA 1FMLA 3QUQA 4JUAA 1EGAA 3FCCA 1JNXX 4C7MA 5HZKA 4ZZLA 2EZTA 1A98A 3EGEA 16PKA 1SQSA 3GN1A 3Q1LA 4XM2A 3PYXA 3WJ1A 2C07A 4DMCA 1W52X 2D7DA 1T2AA 3WKDA 5HJEA 1EIZA 4NBRA 3K2ZA 2M34A 2ELKA 1CE8B 1QH9A 3E9ZA 1YSCA 3T0IA 1O89A 4ZV4A 2X2EA 1SG9A 1ULYA 2QLTA 1S6LA 3DCYA 5HQJA 3T3PB 4BBJA 4DR1B 3GLXA 1ECFA 4HCJA 1NL3A 4AB1A 4DIBA 3P4UA 1FX0A 3VAAA 3VZPA 1CRPA 1IULA 3M89A 1BW6A 4L9AA 3R3JA 2LPMA 1O9BA 4IOJA 1IPHA 4TZTA 3H9GA 1M6VA 1PFUA 2QL7A 4RDUA 2MC4A 3EVTA 4P0QB 2YU3A 2XD4A 5J5CA 3UKOA 2FJ1A 2IX9A 3G2LA 1MR3F 3OA0A 4G5OA 1I7NA 3PDJA 2FRXA 3W9YA 4ERNA 1J5EB 4DC9A 8LDHA 4UPVA 1PFQA 4Q7JB 3SZ3A 1WJCA 2GBYA 1OVMA 1FBSA 1K83J 2OV4A 2C5GA 4EZIA 4W5RA 4XORA 4LJRA 1RBZA 1MJGM 2DPUA 1CJSA 1VL5A 2YYYA 2H9AA 4IDHA 4MIOA 1SKBA 5JY1A 3EEFA 1MHTA 3VRHA 4RLQA 1LBTA 3RYTC 1LJ8A 2A1UB 4KPGA 4MV9A 4REQA 1TK3A 1Y5RA 1T4DA 2DGDA 1PFYA 2FPPA 2VPQA 1MV5A 1Q2UA 2Q28A 2NIPA 3K0CC 4ZAZA 1GAEO 3PUFA 1ETYA 2F48A 4XSZF 1AF4A 2QD1A 3NEYA 1E4EB 3PI6A 3A8TA 4C4YA 3RT1A 2V79A 1BNCA 4JR1A 3H0EA 4I55B 4RZ2A 1FIPA 1WHSB 2DBRA 1NN1A 2EF0A 2LY1A 4MULA 2LW7A 1DB3A 4JVNA 5FKNA 1XXLA 1A9PA 1KPGA 3LA8A 3EISA 4ONEA 1PFKA 2Q2OA 2RHCA 4HH1A 2PR7A 4BFVA 1R8YA 2ASEA 2A86A 4ALLA 4QEKA 3N5KA 1OOEA 3DBIA 5AONA 3HMKA 5HIJA 2DDBA 2C98A 1BOAA 5DNAA 1VI6A 5BQXA 4X7PA 2FP3A 4U6SA 3VHQA 3Q4GA 4AQDA 1C8LA 4WMLA 4IJWA 4OHKA 1SC9A 1W48A 4Z7QB 2OGWA 2P9ZA 1B8OA 2PZMA 2DMUA 4ND8B 5CNMA 2J9YB 4EITA 1XPRA 4HTFB 1NNEA 1UP6A 4YAEA 4NJEA 1T56A 1I33A 3L7IA 1JSZA 3D6VA 4PRYA 1WUHS 4K46A 3RVJA 1Q57A 3PNYA 2PX0A 1IXRC 1FUUA 1ID1A 1JEOA 1T2CA 4HEJA 4QTTB 3ZX4A 4UUMA 5KSZA 3EY9A 1E8DA 4GP9A 4C3HJ 2GCPA 3H9QA 3O92A 3KVRA 4E4HA 1R8JA 3VR2A 5D8KB 1Z21A 3R4KA 3F3YA 3F9KA 5DBGA 3H3UA 3ADBA 2H4FA 4OA8A 4RS3A 4MCJA 5I5GA 5F1JA 1THMA 2HHCA 2ZS7A 3FJ1A 1NW4A 2RVCA 2QN6A 3RV4A 3VZSA 4RVHA 1ZK4A 4B84A 2Q1ZB 4ACBA 4CEIA 2KBEA 2GN0A 1NHGA 1UKZA 2Z9BA 4ILKA 3UUWA 3NNNA 3WTCA 4JZKA 2XAQA 3ADPA 3B5EA 1WPQA 4WKGA 2NQTA 3QBTA 4M8LA 4ZO7A 3LMKA 3LWDA 4MS3A 3RAGA 1GPDG 3R7WB 1N2OA 5FI5A 1DOAA 1JHXA 2IA2A 3HRKA 4R0VA 8ATCA 1LVAA 3BR3A 1QLHA 4E1AA 2GD1O 2IC5A 3RAFC 4PFSA 4BS9A 1IDN1 4OB7A 1OIXA 4Y9RA 2FWMX 5FOXA 5KNDA 2Z0MA 3OT1B 3C5WP 5BW8A 1A9YA 2LRDA 2CF5A 3ECAA 3KYJB 2OO7A 5IC6A 4DLNA 4F2HA 5LXTB 4BLOA 3D1LA 2C59A 1N2HA 2CCKA 3D2CA 5LQUA 3LAWA 4MPTA 1OFUX 3RS0A 4REOA 2Y31A 1QQ5A 3GX4X 1PHPA 2G1AA 3EF3A 5FEMA 3WLQA 4F5YA 3DG9A 3RUPA 2V6EA 3REOA 3O84A 5ALFA 3TRJA 2GUGA 4JGBA 2DBBA 2K85A 2XVYA 4XPIB 1HW2A 1OTXA 4C4SA 3AV3A 2XXJA 3MWGA 1M2KA 3EXFA 1UDBA 2R7SA 2BGMA 3MNFA 3AEQA 1W4ZA 3IBYA 3PZRA 4N4OB 1RPNA 3BIXA 2NUTA 1UEJA 2Q49A 2H4ZA 4BNNA 2PMFA 3GW2A 1ZJZA 2CVZA 1YB7A 2FSVA 2CMDA 5LD2B 5EIFA 4BLRA 4AUEA 3TG2A 1WXIA 4A0ZA 4D0LB 4KR6A 2ZXWH 3IB6A 2BEOA 3NAUA 5LB2A 1PYVA 2H92A 3IP1A 4FJ2A 4LZZA 1R10A 4J0JA 4PZAA 4A1FA 2VYND 3SLKA 5CDHA 1FCJA 4Y9DA 4XGRA 3ROEA 4WUTA 1ZCBA 4X97A 1QRTA 2QRJA 3LDAA 3S6JA 3A9RA 4YJFA 1GLNA 1LKZA 1NRWA 4D80A 1KXJA 5DX1A 1WFXA 4X1EA 2F59A 4A0QA 4UHTA 1EINA 1PT7A 2VRCD 3IP6A 2CDNA 4MW1A 3K15A 5LIPA 5CLFA 1H93A 1PT6A 1X1DA 4E7HA 1NIPA 1OH6A 2H52A 4NZMA 2YC4C 2QTTA 4OP3A 3UK7A 1Y39A 3PICA 1ZUWA 1RI1A 1QHXA 2QZZA 4DDUA 5KNCH 4HGYA 2V9CA 3SYTA 5CJPA 4L8LA 2AA3A 1IEVA 4IH1A 3WIVA 4LMAA 3WRXC 1T1RA 3RDPA 2WHPA 1YIOA 3L8GA 3A01A 4QPCA 2MD5A 2HAEA 3U9GA 3L9FA 3KWLA 4A2PA 4B3CA 2C88A 1RM4A 2EWMA 3K1YA 2R00A 1JQEA 5HODA 4HGQA 2QTCA 2HNKA 2LKDA 4NV1A 5CNIA 5BSRA 2A1TS 3D7SA 4JBLA 5A9TA 3KFWX 4DLSA 2IS1A 1G0NA 3AF1A 4GPEA 4ZZ3A 3UH1A 1ORDA 2OUMA 5LQJA 1H0MA 3C39A 3IJEB 4DJEC 4Z54A 4CA0A 1CE8A 4BQIA 3HBLA 3ESRA 3JWGA 3K70C 4OK3A 4EDFA 2JIZA 4H9GA 4MW7A 4B4WA 3I9JA 1DGWY 2C58A 4PYLA 1PT9A 4FGLA 4I01A 1A8QA 1IZ8A 4EJ0A 3C3MA 3V7NA 3RADC 5BN1A 1IZ1A 1SK9A 1TM1E 2O2YA 3F6PA 2WAEA 3I1JA 4HMOA 1DT5A 4QODA 1I0ZA 1Z6PA 5C8YB 4A3JJ 4FYPA 3GRAA 1MC5A 1K7EB 1Y9EA 4S0ZA 1QPBA 3DAFA 5FDFA 3THRA 1R8XA 3EX7C 3W5BA 1H9TA 1FYMA 3DEYX 4ND8A 5IW8A 5C5EA 2FMYA 1JX6A 4LK3A 4WY5A 4WOPA 1FTTA 4IL6C 2A9VA 5JAQA 4BL5A 4A15A 2HCRA 2VDWA 4KRYA 1X92A 2QVGA 4HDAA 2XGEA 1K9SA 2AFHE 2C57A 4QOGA 4N6GA 4X6XA 3F9IA 5EE1A 1OLUA 3ZZMA 4BXOA 2UVQA 4N6OA 4FYHA 4HNAA 4LHVA 4KXVA 3BCBA 4AYBA 3HXLA 3R3VA 4I6ZA 1DRUA 1YJ9I 3U0VA 3AY0A 3RABA 1JG6A 1K3FA 3WGUA 3JCUC 4P55A 2Y6UA 1PL7A 1KYVA 4TMTA 2DEUA 4N48A 3RTCA 1TYDE 2GFIA 3MINA 2F17A 5DDIP 1MNEA 1KBQA 2Y1LA 4D96A 2O3UA 3QNMA 1X1PA 1J2TA 1ESNA 1MO5A 3COZA 4MWBA 4IIJB 4L18B 5BOSB 3DLPX 3M4OJ 3EQ6A 3KLMX 5EJ2A 1JGGA 1V16A 1PDWA 5A1TA 1JB1A 4JU9A 4RFSB 4NZOA 4E22A 2C5SA 4DT1A 3G17A 3QEKA 3NGLA 2AQHA 3G3ZA 3BGSA 4Z9BA 5IDWA 2QMUA 2MYSA 2D3WA 3MELA 4DIQA 3TKYA 1PP7U 1D0IA 1DWQA 3NJ8A 1WUKS 4KI7A 4DR3B 2PUBA 3VBEA 2W2KB 1L7BA 3FSJX 4QIWN 1HEYA 2B0JA 2NYRA 2Q07A 3FIJA 4ZC1A 3URKA 3WK4A 4EUKA 4F6CA 2B7LA 4HF1A 2PMZA 3B2QA 5H3CA 3DC7A 4ZJYA 2WUVA 1IB0A 4MTEA 2QX7A 3SHOA 1W5BA 2BY3A 5DHQA 5AI6A 3B1WA 3FVVA 3AESB 2XWQA 7ABPA 3WMRA 2E49A 4DGSA 4EQQA 3HJTA 4HX5A 5JLXA 1BEEA 4I1VA 3K0CA 4M88A 4WXMA 5D6NA 3UB4A 1XZMA 4CKEA 2EGHA 2RBKA 3WO1A 5BSWA 3M49A 2Q9BA 3JTEA 3QFTA 3OU6A 5DNYB 3FNQA 3F8SA 5DHFA 5J3JA 4KIGA 2C0PA 2IDKA 2ZBPA 5D3QA 2DH5A 3VNRA 3A05A 2B4TO 3M4NA 5TEVA 1JKXA 5LNK1 2PO7A 1VI5A 1M0EA 1ZMXA 3WYFA 4OAYA 2C04A 4Q3OA 3SVTA 4MV0A 2ZRNA 3QVLA 4P7BA 4G4GA 2PZAA 2IU3A 4LJ7A 3UMYA 4DIEA 3MZYA 1L7OA 3L6RA 3HSFA 3L06A 3C3BA 1PUFB 4IDAA 1D07A 4JJGA 3SM3A 4FQ5A 4FS8A 2G8NA 4MGHA 4X54A 5AK6A 3WNDA 1QHHB 1DCMA 4P2BA 2NU9B 3ZZNA 5JMTA 1KK1A 4LB6B 1W6UA 2H54A 2Q2NA 2A6EF 2EHJA 2XTJA 2ZDHA 3CHYA 4QIHA 3R9IA 4ZN6A 4ZQFA 4LGWA 1CZHA 4BO5A 4MUHA 2GFQA 3NYRA 2I03A 3HZZA 3V7WA 4UUBA 5ALUA 5J9FA 4J03A 3UANA 3ZHXA 421PA 2A9OA 2G80A 3FAZA 5FB3A 4AIDA 1NXXA 1WTCA 2QNRA 3EBPA 1E58A 3UFXB 1CNEA 1JE8A 2K6GA 2XDYA 4B2IA 3PUBA 4B40A 3HKCA 5DNEA 4C5BA 3BJIC 1PGOA 4DJTA 3GJXC 2R5ZA 4EKYA 3P5BA 3M4ZA 5H82A 4F11A 1XZKA 3HEBA 1BN6A 3LK6A 4QOFA 1A2BA 1X8KA 2EZ9A 2QG9A 3FXMA 5HRAA 1ETHA 2FR1A 1ZQ1A 4EH1A 1OYVA 3RUCA 4D5EA 1NOIA 5FPTA 5FOVA 4AZTA 3G0BA 4Y0VA 5J23A 3DPUA 3HP4A 1EFKA 2GN9A 3MJTA 1TCUA 3WNQA 2KRCA 1EWTA 3DHEA 3EQLF 1L2TA 3H1AA 4WN9A 4MGKR 3ELKA 3WE7A 5I9TA 2OBXA 2V59A 1JLLA 1HA8A 3E7LA 4XLNF 2OBMA 3B60A 4I4CA 5FYDA 1X9GA 5B30A 3IOBA 4IQ8A 3AI1A 3BUSA 5IYZB 5CQGA 3BBPA 2C3PA 3K72B 3OFKA 4Y3UA 4I09A 4MVYA 3AF3A 1REPC 2KKOA 4DHEA 2ZT5A 1POWA 1U3TA 1XB2A 4MGYR 4MUBA 4N01A 4Q39A 1ZXXA 4FLFA 3FKQA 5KYUB 1P4SA 1U2GA 3Q3CA 5I9BA 5C7LO 4HDKA 3RSGA 3IUQA 3T7KA 4N8SA 5CQEA 5IYZA 2XGSA 3T5GA 1LY1A 2KHZA 4Z8YA 3I6BA 2HIGA 3CR8A 2JLBA 4J19A 1SFXA 5BUZA 5TPZD 1ZAYA 1DPRA 1GGJA 4LOKA 3GVCA 1R16A 3PSFA 5KKAA 1GGMA 2IPAB 1ORVA 2DFHA 1ODSA 1X7YB 2VSNA 3GYGA 3JAWB 3N6VA 2A67A 4NESA 1MB3A 1B14A 5ILOA 3T5AA 4CM7A 1I3MA 5FKOA 3JQFA 4TMYA 2PMEA 5TGTA 5JDIC 1M2OB 4CLOB 4EZBA 5LKRA 1YOVA 3ZMDA 5KNCD 2WQ6A 1DARA 5ILUA 5KHDA 5TR9A 1W85A 3UKDA 1E5TA 2PLAA 5GV7A 3RCOA 1HDXA 1L4BA 4AG3A 4UNIA 2X40A 2EIKH 4KNWA 4X1IA 2HPHA 2ERXA 2OUIA 5IPAA 3E7WA 1VKRA 3B9BA 4G09A 4JP5A 1K8QA 1VL0A 2V3WA 3AUYA 1NI3A 2WWGA 1XG1A 3IA7A 3BGWA 4GMFA 4U0YA 1Q5PA 3ANSA 4K8OA 1XD7A 1I0IA 2IPLA 3EEIA 3BWMA 3GT0A 3VAYA 4BEVA 3ECSA 5AKGA 3KKNA 1JG1A 5CAEB 2ZTHA 3IIKA 5KS2A 4FFPA 1FP2A 2MA3A 1N33B 4XFKA 2WMYA 2XX3A 5JI6A 4QASA 3GLIB 2IYOA 4HGZA 2ID3A 2L01A 1ISSA 1HE2A 1P0PA 4KN8A 4E09A 5IT4A 1N5JA 1GVHA 2Q6VA 3QBDA 4V1CI 1LW6E 1RIIA 2X9GA 2Y67A 5GM2A 1RWQA 1Y7TA 2ZE8A 3R75A 4TLCA 2P9HA 2RKWA 2C9ZA 2NAZA 2JLAA 3MD2A 2YDXA 1IK4A 3HU1A 1SKAA 2QW0X 2DPGA 4FYVA 4NEGA 2BZGA 4YT4A 1CVRA 3LCRA 4A6DA 2IYZA 3T9DA 3EVFA 2X1HA 1MDMA 4ALIA 3F8TA 1C3OB 2WZBA 2A58A 3QA9A 4E32A 3ZVLA 4G63A 4YMUA 1XP5A 4H59A 1BCSB 1P4AA 1PJCA 3GWGA 4BU1A 2EKBA 1EAMA 3T7AA 4DMHA 4WEOA 1HE4A 5EGOB 4J7UA 1L6RA 4IHJA 3H4VA 3H9BA 1AXEA 4JIMA 4MW4A 2XJ4A 3VU9A 2H18A 4FNAA 1B15A 3KYDA 5E1DA 2EEZA 4UXIA 3W5JA 4YBZA 4EKEA 5KEIA 1GRRA 3TNDA 3TXAA 5B6PA 3D5RC 5C4XJ 4KWCA 2RGGA 4WCDA 2C83A 2A0FA 1S4QA 2VYCA 3GCDA 3PNBA 1FBUA 4RLSA 4ZT2A 4RY0A 5C7IO 3L7JA 4HDKB 1RQLA 3ZQHA 2CW5A 4YI3A 3MEQA 4K81B 4B6FA 2JLZA 2N0SA 3LKZA 4AY2A 3O8QA 1X1RA 3TQCA 2IFTA 3CPJB 1M2JA 2PJDA 3LA2A 1TO2E 1CQWA 2H17A 3IUEA 3LQ2A 2QD3A 3OFNA 1SVWA 3AFHA 3F7OA 3GUYA 4MI9A 1JEYB 2RMKA 4K0RA 3AL0B 4R9NA 1PDNC 3K0KA 1Z0XA 1V55H 1H1DA 2C4TA 2DUUA 3DKXA 5BWMA 1MMSA 1KVTA 5DYMA 1T2DA 1Q7RA 4C2AA 1ADYA 2CLMB 4LLNA 5ALIA 5DWQA 3A02A 3O4IA 5KYKA 2CVPA 1FYWA 1TQ4A 1NJ1A 2FLVA 2VXYA 3GUDA 4LSZA 1VP3A 4HLUC 3LO5A 4YQFA 3AKCA 3NP9A 2A7QA 2OAQ1 2VPXA 4F4UA 2LDBA 5AJHA 1Z6RA 1A9SA 2I4IA 2PUCA 4ZCIA 4CEHB 3RU3A 4JBYA 2AB0A 2XPVA 1D0YA 2CL0X 2WF5A 4KPFC 4UHJA 2CF6A 3RK0A 3FYTA 1W4BA 2V65A 1KOJA 4CG2A 4D79A 1GA6A 1NOJA 2G63A 4FDAA 4MLZA 4O6VA 3MWEA 4WLOA 5EZYA 5IYDJ 2I2FA 4MKXA 1AVTA 2J3DA 4F5EA 4UE6A 4KXFB 3QTLA 5I4KA 2BV6A 3I09A 1QM5A 1WPKA 1V4BA 3ICEA 3HEMA 3LSJA 4KMUX 1CD5A 2FMKA 2I76A 5JVDB 3VJMA 3AXSA 2JNWA 4S35A 2GZ3A 3VO9A 3I61A 1E2DA 3CZ9A 4C3ZA 1YT5A 1IATA 1DADA 4NENB 1RZRA 3O4JA 3WLIA 4KTVE 3FPSA 2CXRA 1A8IA 1IVSA 1RWXA 1VA5A 1WIWA 2D00A 3N6RA 2NU9A 3QXJA 1W2GA 1H2BA 3MWFA 4I7EA 4PPGA 5IMBA 4LK1F 4INOA 2WWTA 3CLSD 4NDLA 1YFZA 2ZPTX 4MWCA 3OCUA 3RD5A 4HRXA 4D8WA 4E51A 3WRYA 2R4TA 5MN6A 1HR0B 4BMYA 5A5GA 2PSDA 1B59A 1QAOA 1IJWC 2PU5A 3RVNA 3DTVD 4YRVA 2FLKA 4PSKA 2NRAC 1SD1A 3KXKA 4OHFA 4EB6A 4EHAA 5AW8A 3O31A 2W2XA 1CUAA 3LI2A 1REQB 4B4VA 1L0BA 1NSFA 4P22A 2QP3A 2WHPB 4V0NA 4BE2A 3Q5FA 1Z06A 5AI4A 2OGUA 1K7SN 2ZUBA 4RD6A 3IWFA 4R9VA 3CTAA 3WYBA 1B6AA 5H70A 5EZHA 4OBEA 4R79A 4MR9A 4BAGA 5LJLA 1ARZA 1M34A 4GX1A 1N3IA 4FASD 1IGNA 2JAWA 5TGDA 2WZQA 3MQ2A 3B78A 5CXUA 2XEXA 1RJEA 3A37A 3C87A 1DL5A 5BWBA 1D8JA 4RD1A 5DZSA 1CS0A 3R5SA 3DZKA 2HJSA 2PH1A 4I5IA 4CTKA 3JY6A 3B89A 1CSEE 2GESA 2N9UA 3EHDA 5FBKA 2NO4A 1L5SA 3OC6A 3RE1A 1FW8A 1G0OA 3S2DJ 1K97A 1UWKA 1ZMRA 4FTWA 1WW2A 3WK6A 4RQTA 1XZDA 2ACWA 2RGXA 4CUZA 3LP8A 2P81A 2MINB 3KJIA 4K3VA 1WW3A 3ZTWA 2J5QA 1UH5A 2EJCA 3AFNA 5DLQC 3HOVJ 1VFCA 2W6ID 1QBGA 2ZYDA 3PNKA 1EH8A 3WMGA 4R1MA 2UZ1B 4Q4HA 2WAOA 3STYA 3AEQB 1JKOC 3IE0A 5IJ0A 5JDCA 2YHAA 2EFWA 3DYIA 4KQHA 3PGLA 1XDUA 5D5QA 3A1WA 3T1YB 4MV4A 1H85A 4RKEA 4QWWA 4S2UA 1HFKA 3ELUA 3DW3X 3W6PA 4RAYA 3LFHA 5BYBA 3LQ4A 3QF4B 4A3BJ 1DSSG 2WVJA 4N49A 4HPWA 3UHPA 3IS3A 1GUBA 2FW7A 2HNBA 4HB0A 4L73A 1VJ1A 1YRWA 3D4IA 1L5ZA 2WFZA 1WSDA 1HF3A 1GV2A 2PEZA 4NK5A 4YPOA 4OJQA 2RHWA 1Y6RA 3I73A 1QX3A 2NX2A 3AZQA 4JR0A 4G9BA 4OLAA 2PM8A 2R84A 1LVGA 5REQA 3DWGA 1L4EA 3N0RA 2XOXA 4Y3OA 3AR4A 4W1QA 4A82A 3D1VA 2RHOA 4F0JA 4NQWB 2DA6A 3JYHA 3FOBA 2JFVA 4PHTA 3A9WA 1Q2XA 3JSOA 4NZNA 4NECA 4DBLC 2DOKA 5FR1A 3K4NA 1EFVB 1D4FA 2W4QA 2O07A 5K4GA 1EXNA 2YOGA 1GPH1 3RGGA 1VJCA 3SKXA 5KOJA 1IRFA 3ESWB 1GRVA 2PKRA 3CZCA 1NSTA 3GZ4A 3ZEAA 4IOKA 1S96A 2AI2A 3CS3A 1IUFA 3A03A 3WGJA 2GFHA 5F5LA 4EG0A 3JZFA 2DMRA 2LFBA 3KAKA 1XZPA 4G26A 5BYJA 4C0XA 1W9HA 2VI5A 1JZTA 3KZ1E 4FR2A 4GF5A 1Y82A 2W82A 1AC5A 1N5MA 1HCRA 4I0AA 4OM8A 4TLLB 4TWRA 4WDRA 2Q9UA 2W22A 3UAVA 5C80A 1RI5A 1T2EA 5CVVA 1ACIA 4W1RA 3M3YJ 4QAJA 3OO0A 1C7FA 1L8AA 3H13A 3VSKA 2ECOA 1VI2A 5TE9A 3NC1C 3ADDA 3A1UA 5AUNB 3LBHA 1NR7A 5K5OA 3THSA 2QLFA 3E70C 4PUSA 1KIAA 4MB0A 1LC0A 1VDZA 3IVGA 4DSAA 1ZH0A 1U5TA 3V2UA 2EFJA 2KM1A 1JBKA 4ARUA 3EF0A 4IEJA 2P6UA 4I19A 3A6JA 1IWOA 2GXSA 2XNDA 3SE7A 4BNCA 1YQDA 4MUAA 4A7PA 4GLBA 1UBKS 2P3QA 1P9WA 3H3FA 1FNMA 1UJMA 1X1BA 3ENNA 5FUQA 3K0SA 2WLTA 3TZHA 2H57A 5DASA 2GCIA 2ETXA 1JQAA 3A28A 5FXMA 2BXYA 3IHLA 2A5FA 3MMXA 2V7XA 2OBFA 3OF5A 4JT4A 4S0HB 4LDRA 4FCYA 5I4IA 3G1LA 1R6BX 3CWZA 4YK7A 1C3JA 4HLYA 2VPLA 4Y15A 3UATA 5M2QA 1BCRA 1Q83A 1KP2A 2IXAA 4B9EA 3PQ3A 1T9ZA 2O0JA 1OV6A 5IX8A 4AVYA 3P5JA 4E03A 5LP6F 1TIBA 3AKZA 1AA9A 4G6TB 1L5HB 2D1FA 2JK0A 3GEBA 1LA2A 3IAM1 2OV1A 3ITEA 5JFTA 4LOJA 1RPAA 1UBHS 5A7HA 5KNCA 3WWEA 5F33A 3TSOA 2P3SA 4EGYA 3U6BA 1J0XO 4Z0PA 3VYWA 4YELA 3T3DA 4QREA 4RDHA 3AFGA 5JDIA 4BBRJ 5JLWA 5EXPA 1N9GA 1B7GO 4XSXF 4HSEA 4YRFA 4AO7A 1NLFA 3BFKA 2CDRA 1DUSA 2X9LA 3NYIA 4YJFB 4CR7A 821PA 1DEKA 1ECLA 4C2MJ 3AJ8A 3UW1A 5CCXA 4UQOA 2YC2C 4OK6A 3G0CA 2NUBA 4BUCA 3D4NA 1XYYA 1JFRA 3FB4A 5IBRA 1KZ9A 1KO1A 1VG9B 4FUQA 1ICIA 3U19A 4P38A 4H3KB 4WJZA 3JRIA 3PDHA 3LKVA 3QITA 4LC1A 3FWYA 2OQ2A 5JBNA 2VTBA 4RAZA 4CYMA 2BT4A 5K0FA 4AI6A 1Y37A 2D8MA 3QOXA 3I5MA 1XROA 4XX1A 1RCTE 1XCMA 3G9ZA 4R7TA 3O8CA 3GJQA 4L50A 3AB3A 3L7CA 2XC7A 1JR6A 4OQDA 5DTJA 3DL4A 3K9WA 2WICA 3CLSC 3B6JA 4OX9Y 3E8SA 1YS7A 2NSHA 2VDNB 4I4NA 3EGIA 3HFRA 4XBFA 3C5VA 3A10A 3UICA 3UMFA 5LNK6 3TFOA 2JIDA 1R6AA 4FPXA 5BUSA 2BL4A 3AGPA 3K70D 3QZUA 2P9BA 3QF4A 4JX9A 2JS7A 4AMBA 5LQKA 1J1UA 1NBMA 3HEAA 2DFDA 3EIXA 3ZQGA 1V95A 3NPMA 1P3DA 4B34A 2A9FA 1RZ3A 1WF6A 2IU6A 1OZ0A 2HPZA 3BILA 4H4DA 4I2VA 4MWZA 2BGGA 4Y17A 1UP4A 2H4WA 2LK2A 1HT3A 3MQ0A 1SCNE 1UQUA 1Y8AA 3WHCA 2CJFA 1Y5NA 3DDWA 3NO4A 4QC2A 1AGYA 2TDXA 1XLTA 4X71A 2X51A 1S2MA 1VMDA 5A5VA 5IVKA 3VYTB 1WG8A 3G13A 1BX0A 1JIIA 1E2KA 1IUYA 4L02A 2RI6A 4FC6A 5TQ0B 3F8BA 2P9YA 3LSKA 2XAAA 4I50A 2VDOB 4UHHA 1TW3A 1OXSC 3E9EA 3K0FA 4JEUA 4FXPA 3U80A 4LDQA 4WGGA 2TYSB 3VI4B 2O3FA 2G09A 4DG9A 1YJBA 2BTOA 4EY4A 1UP7A 2O3SA 2NPOA 3EXEA 4GRDA 4KR2A 2QVZX 3R0IA 4TSFD 3S16J 2MSEB 3K1AB 4MIEA 2VKQA 3WBFA 4LMPA 1N0HA 3CH5A 3U4IA 2PGLA 1R6TA 4XB2A 3BQ9A 4QD3A 2RAVA 4TWZA 4UC0A 3F3MA 2H1FA 1ORRA 4HYEA 1X1SA 2EJRA 3HQ4O 5FWYB 3KD3A 4HRIA 1KI2A 2XF7A 5IJ9B 3PIIA 3K4JA 1J22A 1XZCA 3HB7A 1TMGE 3MEXA 3R3HA 5TXGA 3V8LA 1CUHA 4CLDA 4BX8A 5K3AA 4EG8A 1SANA 4WKOA 3WB9A 4CIVA 3J7AC 3ERMA 5JHHB 2QGFA 2I10A 1ZCFA 1C4XA 3K35A 5HILA 3R3SA 2XNCA 1ZM3A 4AJLA 3WL6A 1JS1X 4YALA 4BN0A 1GTL1 3UNGC 4BFLA 1WUYA 2YW2A 3HCCA 5EKUA 1P2DA 4YAGA 3OHSX 2WB1N 2KZGA 4BV2A 2VYFA 3HABA 4B82A 4QNRA 3VUEA 2E4VA 4LDJA 3V33A 4EKIA 4YCAA 1K4TA 1SXJD 3WK5A 3OIOA 1SU6A 3RNOA 4GYYA 3P2JA 4CI9A 1ENOA 1MX5A 1YK0A 1YHNA 3RIMA 4C03A 3EZFA 4C01A 4FISA 2BE5F 3BZKA 2H1OA 1YU9A 3HFSA 4ZYUA 4OIOF 1E6UA 1K3UB 4EI7A 4H18A 3IOMA 3P19A 3Q40A 3A4YA 2A1IA 3GA5A 4JDUA 1TAGA 4MPDA 5DLDA 3K16A 2IHNA 2AYYA 5F7JA 1NQTA 3FZGA 1K89A 1LUAA 2CQ7A 3BR0A 1Z5NA 2QLMA 1YIJI 2FSUA 3V7UA 3WL5A 1RKWA 1YNOA 1WPRA 2J32A 2R5WA 5J4LA 3GEZA 1BS2A 4E5DA 2NVUB 4EEKA 1UAGA 4YFNF 1CY6A 3DT6A 4GKAA 3BWEA 3NRBA 2A1UA 2C2YA 1LI7A 4UU7A 2O3RA 1DAPA 5IJAA 4BX3A 1ZW6A 5C1PA 2OTCA 3WB0A 5D3ZA 2VHUA 1IXKA 3T1QA 4IHAA 3T7IA 3H0KA 2ZC2A 2NG1A 1QCZA 1CFZA 3R20A 1CUGA 3QLUC 2MYPA 2QY9A 4HMPA 4JC8A 3EB9A 2QRUA 3FLMA 2PS3A 4KGZA 2XGCA 3KQYA 2FD5A 1BDBA 3Q7EA 1Q16A 4WOCA 1EXVA 1G16A 3OX3A 4W97A 3DV2A 1G8HA 3R61A 1RQNA 2PLWA 3F6CA 3I9MA 3PT5A 3HPHA 2I4TA 3KQTA 5EWJA 3G2KA 3WGQA 5FKKA 1JAHA 4E5MA 3A6EA 1A76A 3IBCA 2XRNA 4JK1X 1RXIA 1SHKA 2Y1CA 2XXAA 1NYTA 3U9LA 2PJUA 4AICA 2JKYA 1VTNC 4YP7A 1LB2A 1Q95A 3EIHA 3LRPA 4DDHA 3VA7A 1YA6A 4PZJA 4H15A 2ZJ3A 5MFPA 4KX3A 1WSBA 2AEJA 1BIAA 3BJZA 3VZQA 4ZT4A 3ZN0A 3DMNA 3O4RA 2G5GX 2YV3A 3D5QA 1GZHB 3RIHA 3TSAA 4D42A 5C51B 3C3AA 3D4BA 5JO0A 1XEXB 2VWHA 3L2WA 1KMHB 4RCYA 3N7UA 4DLVA 5CBPA 1GT91 4TYYA 2BMDA 4UB8C 2Y0SA 3QPWA 4J0CA 4G0XA 5AKJA 1ULAA 1UMQA 4HWPA 3CEMA 3LA7A 3CF6R 4MIMA 2L18A 4GECA 2YXLA 1NBEA 2CMFA 3PUVA 3F4KA 3VKWA 1POXA 5JQWA 2AJBA 2JD1A 3V1TC 3OKPA 3L09A 2H8GA 3EUKL 3KYCA 4RK4A 1ZG5A 4B35A 4D3YA 1ZGWA 1YQWA 4ZHQA 5EINA 2PE5A 2B63J 1S9DA 1P19A 1RC0A 2JFYA 2ZCJA 1E89A 4ANFA 4ER5A 2AFHB 1GNSA 1OJ7A 2X5XA 1O94C 2HA6A 4KO1S 4CLRB 1FA9A 1K0UA 4FGWA 3TBFA 3OHPA 4KAFA 4TXLA 1VJ5A 3JW8A 4GMXA 1R22A 1M0TA 4BPBA 1FDVA 1GQQA 1BXGB 1WMEA 4HOBA 2SKCA 2R8BA 2WUEA 4LJ6A 4PQGA 4DWWA 4C0HA 3QF7A 4CM6A 1WCXA 3WQHA 3OU7A 1OI7A 4CF6A 2NU7A 4K2EA 1V25A 2X8WA 2O3TA 4PWYA 4GYJA 2XNHA 4MWEA 3VFZA 3M5DA 4QOIA 3EG5A 2YSRA 1Z5ZA 3ET4A 5E8IA 4WKPA 1QCDA 2E2JJ 2PZBA 3ZWPA 2L0KA 4RPCA 2XGJA 3BWYA 4KFCA 3HR4A 2Q6OA 2QAGA 4HYQA 3LQKA 3IV7A 4LPSA 5KJEA 4FFVA 1VIYA 5JC8A 2HA7A 5DK4A 2GEKA 2A9PA 1FY7A 3MKYB 2QNBA 3LXRA 4Q4AA 3ZD8A 5JRDS 4RHXA 1BWSA 1PD0A 1WY7A 1KC1A 1X7ZB 1KJQA 4Q15A 1LD3A 1Y4DE 3JALB 2ZT7A 5JCJD 2PT7A 5G1OA 1K6MA 2V1NA 3KSZO 2OJED 2LIVA 2VXBA 4KWIA 4YYEA 5BRJA 4RAOA 2R2AA 1RWWA 3SK0A 2JJ2D 3SX0A 2UYQA 3ZY4A 4G94A 4RJIA 4B3BA 2YXEA 5A1JA 2YV4A 3T5DA 3P0JA 4RTKA 4LXIA 4X90A 2CKDA 4OLFA 4II2A 2KJBA 1F5NA 2OC9A 4IFEA 4CODB 1AV6A 5JD3A 1Z73A 4AJ4A 2C2BA 3UAWA 2D0OB 2GJ4A 4BH9A 2NXNA 1L5OA 2BCJQ 3KCNA 4ZVLA 4MUFA 5CEEA 1QHNA 4QZVA 2UV1A 2A2ZA 1QZUA 2VJOA 3AX6A 2DXIA 3JR3A 3KP1A 4EMBA 5JTUA 1FSPA 2XYVA 2X0JA 5E17F 2IYEA 2Q4EA 2WBMA 1G2IA 1VRVA 1V8BA 4RFLA 2WA2A 4X5OA 5EL0A 4KPEC 1VE6A 4LX8A 3GZ6A 4P4NA 3MTIA 3VGJA 3SY8A 3CMEI 2M8EA 2A94A 4P3YA 1E1RA 1MGTA 2ZXIA 1I4EB 1WHUA 4IJQA 3TLEA 2VL7A 3U13A 2VI6A 3DWFA 1FNNA 2YICA 2ZULA 1I94B 4MVCA 4MQMA 2BHYA 1YDEA 3OU2A 1L4NA 2I67A 4CYDA 4W4TA 3OFSA 4FNOA 3V7FA 3AXTA 1T5SA 1G60A 2CYBA 4W9NA 4AM8A 3AIKA 1OY1A 13PKA 1AQUA 4ETMA 4H7IA 3TL6A 2ZB8A 2Z30A 1XALA 2NTNA 4UVIA 3ZNQA 3U7FB 4QYIB 3O5AA 5FUWA 2H6BA 3L1HA 2RCNA 4FCTA 4RVGA 1GL6A 3OL4A 5E7JA 4A03A 3RTAA 4RXUA 1SZCA 1KDOA 3BRSA 4C3UA 3TFQA 1O0CA 4P7KA 4A8JC 1QNLA 3TF5A 3JVEA 3EPKA 2FE4A 1D9ZA 2VKDA 3ZY5A 4A0SA 3FCOA 5GPAA 3KP6A 1G3IA 3GV0A 4E7JA 2FPLA 5D84A 1U8CB 3DP7A 3A3YA 4G8XA 4K6MA 4RLHA 3CUOA 5E6RA 3GNQA 1FMCA 2NWQA 3BF8A 1UAAA 1Z0DA 2OBNA 3ZWAA 3R6LA 3PF9A 3SNHA 3FNBA 4L51A 4RMGA 4R68A 1G2QA 1B6TA 1E1MA 3WODF 3SJCA 3V32A 1PR1A 1EYZA 2D7JA 1P72A 3DJYA 4CLXA 2ZTLA 5KIAA 3OYNA 3R6WA 4BO4A 3LXUX 2MMCA 3RC2A 1C0IA 1GKLA 2H8WA 4KJZA 3OQBA 2PLNA 1YONA 3WZ2A 3OEHD 4QUAA 3ST7A 3WYDA 1P61B 1RXCA 4YJ2B 2QTWB 3Q98A 1QGED 4IXTA 4LDNA 4XWOA 5DCFA 4IZZA 1U7OA 2AD5A 2PMKA 4NDNE 3PTAA 3JTMA 4ML3A 1E1YA 3STTA 6NULA 4M8IA 4HV4A 5JD4A 4K6HA 3OYMA 1ENPA 3BPVA 2H2AA 4J3NA 2QAIA 2KL4A 1W47A 3F97A 3COPA 4L6AA 1W5SA 4MFEA 4HWGA 4Y98A 5EYPB 5JNSA 2ORVA 2B2XA 4TZ6A 4UAGA 2HIHA 2NTYC 1XR3A 3A4TA 2BI4A 1Z2AA 3H8VA 4G7ZF 2X14A 2OB2A 1LPOA 3PDIA 3PG5A 2FOKA 3HOTA 1U5CA 3DMTA 1U78A 1JV2B 3F3XA 1ATIA 1IYZA 3P9ZA 4G8JA 4LUCA 4WIAA 4BKUA 1HLGA 4IKOA 4LIUA 3TRHA 2GEBA 4NTZA 4YRZA 3LG2A 3IAS2 1TJPB 4I3HA 2CLCX 3X1XA 1Y56A 4M6VA 1NFFA 4GI5A 3QEBZ 2L9RA 2NACA 3HXTA 2YYAA 2VYNA 3SC2B 4OHYA 3Q88A 1LFPA 2C8JA 2HDHA 4LC9A 3OP1A 4GMDA 3WYNA 6REQB 1DI0A 2ETVA 3B6ZA 1CC1S 1K5PA 3N39C 2I2DA 4CFYA 2NVTJ 3W78A 1NIJA 3FSEA 1QH8A 1IE3A 2K5CA 2NN3C 4OGKA 3G7SA 1SA0B 3JR7A 1KQ0A 4BLTA 4IIJA 5BOSA 1J33A 3FHCB 1ZK8A 1CULC 1Z67A 5I48A 1YVEI 4NNJA 3GFRA 3O4VA 4XM0A 5DN6D 2H2GA 2E5NA 4Y67A 5KSWB 4HD8A 2Q0HA 5IBQA 3BICA 5HJ7A 1SCBA 4CO8A 5A4JA 2J09A 1N7HA 1DFGA 3QPCA 3EPPA 1LWNA 3L2QA 1XKQA 4UXHA 4CEHA 1KOGA 4R1NA 3PUZA 2I3ZA 5ES3A 2PG4A 3EDOA 5GWXA 1SCKA 2BLLA 5SV2A 1UXKA 2OBYA 5DS9A 4BYMA 4D3FA 2H1SA 5JH7F 1Q7EA 4IXMA 2Y77A 2P9CA 5FI0B 1T8IA 2IYNA 4DCCA 1P7ZA 2C99A 1KP3A 2A9QA 1F2TB 1OT3A 2ZE7A 3BFPA 3B1JA 4IGIA 4PZEA 1GUDA 4IHXA 3CN7A 3TZBA 3D6MA 3L01A 1IH8A 1T6XA 1GQFA 4N0EA 5H80A 4CLRA 1KYWA 5IYCJ 1Z5UA 3CUVA 3U7QB 4G67A 4GOXA 4QXQA 3WC4A 2OK8A 1HLPA 3QSYA 1KI6A 2O6GE 4US2R 5IUNC 5IS2A 4I9HA 3BPXA 3AM1A 2X1CA 2FFBA 2ZVJA 3DTIA 3QKWA 4B75A 5DM6F 3LF2A 3P2OA 3HDDA 4BIMA 3H0CA 4ETNA 2RKHA 4IUDS 3R7NA 3U4DA 3B2NA 3U4MA 2P79A 6CHYA 1CP3A 2ZR0A 3GRPA 3QPTA 4AIKA 1QGPA 2OAGA 2DJ5A 2O2GA 3ROMA 2XA1A 5HDNA 2W4MA 3RSCA 1LSOA 3AR9A 2GZSA 4XLZA 4ZEWA 5EIBD 3ODGA 5F1YA 2JH9A 1KDZA 5KNBD 4M6YA 2FXVA 1W25A 2ODAA 1IN8A 1TRKA 2ZRHA 3RFUA 4FFMA 2EFNA 4I50F 3Q41A 2WKSA 4KGVA 2BBWA 1AA7A 2E9SA 2H7YA 4JKIA 3WBKA 4CQMD 5K0EA 1I7QB 2ZRJA 5IEBA 3IVAA 3AESA 3CR7A 3CRQA 3LXXA 5EG5A 3TTSA 2M7BA 1AK1A 3N0VA 3WFZA 1U63A 1HK7A 1ZKDA 3ADOA 3CIFA 3GQBB 3Q3SA 3F98A 5EQDA 4BBAA 4RACA 3IKVA 5K01A 5K8VA 4CXMA 1RAFA 2QQBA 3DEZA 3ICPA 4LXGA 3S2EA 1KQFA 4Z4IA 1IRZA 2CUNA 2H1IA 2XUAA 3CCCA 5HKKD 1NUQA 1T9BA 2C3MA 2Q9CA 1E6EA 1UWVA 1SHTX 1ZA2A 5IF3A 5M5BA 3UPTA 4IKPA 3Q10A 3QMMA 3WGMA 2L9VA 2FY8A 3ZHTA 1O96B 4LQDA 1U2TA 3VPRA 3FSGD 5E2BA 2PH3A 4KFTA 3VR3A 2QSYA 1HYHA 2WKWA 2RHJA 1M74A 1PJBA 4CMKA 5HJ5A 3GY0A 2X9DA 2QTVB 3VH4A 1PJ8A 3OYHA 1HMYA 1E79D 1XCPA 1IBCA 4PCUA 3SBEA 3MTAA 1UCRA 3O1IC 1IAWA 3EVEA 2NVUA 1V9SA 4YRRA 5HK8A 1Y1SA 2YUIA 4ODIA 5DNCA 2XT6A 4AC0A 4O59O 2H7VA 1VSBA 4RSMA 3CE6A 5TPZA 1JEEA 2TRTA 1P39A 2BI8A 4UXJA 3CG4A 2IHUA 2UVDA 5F27A 2GWHA 1SVMA 2PZLA 3G8DA 4GO1A 5G40A 4ZZIA 2RNGA 3RG8A 4RIIA 2GKSA 3G89A 5F0CA 4J0HA 4ESHA 1FRQA 1C7QA 4KH0A 3QOYA 4UDNA 3CT6A 5IARA 4A6XA 4BRUA 2YZNA 3KLNA 3R0XA 4GYKA 2JSPA 3CJNA 3R44A 4UZFA 3UXEA 2X9QA 2HLNA 3G2MA 1FQOA 4Y1EA 3K20A 1Z0FA 1A5BB 5HKOA 1ST2A 2QTRA 1R66A 1ZHFA 4M8NE 2G04A 2QGUA 3WTBA 3O3NB 2QUKA 3MQ4A 1XC5A 1YJ8A 2YBEA 5E7QA 3WYAA 2F8SA 1VJGA 1L1EA 4RMIA 3HTXA 4MKIA 3MOGA 1O4WA 1B26A 3AYXB 1QU2A 4BB0A 3ZZ0A 3LY9A 2IYFA 1E98A 4ZI5A 3ZE2B 5JYEA 3OQPA 2EARA 1P2UA 1Z18A 4X92A 4C20A 4GWLA 2LP0A 4YG2F 1T9KA 3SFIA 4HSRA 1HLVA 3NEPX 4R2JA 4A10A 4EPYA 4A16A 1HKUA 1O08A 2BUBA 4DIFA 5FP0A 3N3BC 4CQJA 3JQ7A 4MUMA 3WP0A 3G0HA 2ZE5A 2AVDA 1VPTA 1SC3A 2GPNA 3TO9A 1V9CA 1WF3A 2C94A 3PE4A 3N86A 4PCQA 3ZNPA 1R18A 3VM6A 4B45A 1Q0RA 2PCLA 3C7TA 4P6VF 2WIKA 1NPDA 3PYMA 1X7GA 1ESMA 3GMEA 1PJSA 3RRJA 1R9TJ 5FL3A 5KOHB 2NUTB 2QQEA 4WECA 4MA0A 4PO9A 3NM6B 5C8ZA 1FOEB 1F12A 1TJ3A 2ALJA 3OZXA 3ZNNA 4L4UA 4EI8A 3UUGA 5AW9A 5I4CA 3S99A 2DHEA 3HKCB 2R0QC 3VR5A 2XVCA 2DG2A 1EP2B 2ORWA 4FYXA 1TX4B 4P33A 4WZBE 1UR5A 5DB4A 4AY5A 4IM7A 3AIOA 2AKEA 4L9SA 1TLHB 3JTGA 3MGBA 1WI9A 3NAMA 4WLUA 4GP6A 3ZI7A 4CG0A 5CBKA 2QW1A 1EM8A 3J80A 4GGMX 1E7SA 3UVEA 1NP6A 2PMUA 1ADFA 4J29A 2PI0A 1NFQA 1WCIB 2P5SA 3SVZA 3NUZA 3GHYA 4MUYA 1UMKA 4DQLA 3ZQ4A 5K1YA 1LW7A 2ZQYA 5DX0A 1GG9A 1VKZA 4JJEA 1TLLA 1RM0A 2HT6A 4JL5A 2E4ZA 3C2GA 3W2TA 3L9XA 4A26A 3S1QJ 5DP1A 4D8TA 4MITA 2XBUA 5FNZA 2BUAA 4FFBB 2LLKA 2QL9A 2QNIA 4FHTA 3WO0A 1QOZA 1YQXA 2I3AA 1QK3A 5CGQB 2E60A 5H3LA 2VOJA 3PLAE 4YDSA 3UY4A 3ZI0A 1F1ZA 4YRPA 4WCFC 1BHJA 4Q34A 3H3XA 1NBOA 5AUQA 5HQTA 5JRZA 5L45A 1OB2A 1WB9A 4AZ3B 1RQ7A 2JFFA 2WD7B 3EGDB 4KLAA 3VJLA 4HA8A 1TAUA 4DARA 4PZPA 3CCEI 1K4YA 3PRYA 5CLGA 5CLQA 3M8FA 4XQGA 5ALRA 4DCVA 5F64A 3WGVA 4G5RA 2HI3A 2PBIA 4HWKA 4L8YA 1BO6A 3EE6A 5GADJ 4F92B 3EWIA 3HYRA 3L93A 2FHPA 4NP6A 3DXYA 5K51A 1OFGA 3I45A 5TF0A 3TOCA 5IANA 5K45A 1UQTA 3U1BA 4JLVA 5JXWA 3OEWA 3MN2A 5DBFA 1XQXA 1R6RA 4IQJA 2BBOA 1XA0A 3AWIA 5ARCA 3PS9A 2JA5J 1SXJE 4URYR 3S70A 3Q5DA 2FQYA 2GN8A 4TKZA 2SNIE 4GI1A 5TVGA 3KM0A 3VKUA 2VZLA 4GSLA 3LBNA 1NVWQ 1AUPA 4OGLA 4Q93A 4YX9A 2BCEA 2JGEA 3AEKB 3ZCOA 2Q8PA 1E7RA 2LY2A 4FOSA 4WQMA 2BJWA 1HGXA 1IY2A 3DKYA 1Q15A 1SMKA 1FX0B 1UFRA 1VYVA 4XR4A 3TM5A 4DR4B 5K5QA 5FROA 3K32A 4RPGA 2B6NA 3NKVA 5L40A 4RKRA 4YRDA 3E82A 5KTNA 2KLOA 1DWUA 2PVCA 1T5HX 1RBQA 2HNAA 5FADA 1RYFA 4EDHA 3ENKA 1EM6A 1V1MA 3H2JA 1G5HA 3NHJA 4IDQA 2VSFA 2GCNA 2F4IA 1SC7A 1V8FA 3H87A 1C9JA 1N5OX 5BRNA 1GWNA 1N2SA 2BW0A 3I8OA 2G28A 1TLFA 1D2EA 5JBIA 4LBYA 5IAJA 2OECA 2WJYA 1K9VF 1ZOIA 2X15A 1HF0A 2GAAA 3M2TA 4TUYA 4CKCB 5CA1B 4KREA 3NH6A 1XVAA 1XFDA 3QVKA 2VPWA 5H81A 3TRIA 4IHSA 5AM5A 5L7TA 1V9LA 5KWSA 1TT7A 1G20A 4GM4A 4M6WB 4MB2A 4N18A 5GPBA 4RB1A 3TH5A 4HV5A 4Q4ZF 2ZDQA 3G0OA 2MH9A 1X77A 1RWVA 3DZGA 4K6OA 4PPYA 5A71A 5HQ3A 1APBA 1D1CA 5TSDA 4US1R 1OCZH 4IFIA 5DLYA 1L5KA 1R0RE 2VYVD 4D9EA 4BKOA 4EF4A 4F91B 1L1RA 1C4OA 1Y1LA 1FL9A 3CO6C 4AURA 2QX9A 2IXTA 5ELMA 3S68A 1V1MB 4L95C 2WB1A 5DYYA 5ERXA 4TQ9A 4BQAA 2E4AA 1N1GA 4IR7A 3UTCA 4M9QA 3UGQA 3F1LA 4RK0A 5KX5F 1SUFA 3NIFB 4EJFA 1EVQA 3MVPA 2YN0A 1PGJA 3HB5X 3KEOA 5FTWA 3PXGA 3THYB 4N4NB 1HE3A 2B98A 2XDAA 5J2UF 2NTEA 3BTLA 2BJVA 4QUBA 2FQ4A 4MNUA 1Y5IA 4Q7QA 1T4MA 3MD9A 1RRGA 2FZWA 5E6UB 2GK6A 5TDHA 3B52X 4KNYA 4I4TA 1E69A 1I6HJ 5IT9K 4EGZA 1JYEA 1N5RA 2RK4A 3JD0A 3PFCA 1YZVA 5FV7A 5B6IA 5BV1A 5CVCA 5BNWA 2V5VA 3LRXA 3H36A 2IZ7A 3PUKA 1DX9A 1L8XA 1NU6A 3QLVA 4I1SA 4LI0A 4NIMA 4HJRA 4L76A 2ZXHA 1X7XA 3G3EA 4PNZA 5E95A 1RI3A 1BA2A 2J85A 4AWXB 2G36A 2A61A 1DC3A 1K75A 2JVKA 1S3JA 3LSMA 3GW8A 3LZDA 1AZWA 4F9EA 2BOLA 4MHTA 1Q1BA 1ETQA 3ZIAD 3P7NA 3D6NB 3G23A 4GBGA 5EVJA 3F0TA 2H63A 2LRHA 5I8ZA 4ABTA 4BTVA 3RSNA 3WIUA 2WIAA 1FY2A 5E9QA 5M5WJ 1FFCA 2DKOA 2HQ5A 1GZ4A 4FILA 4J1NA 2I22A 1M8JA 2GBLC 3HCOA 1KGSA 1HT0A 1P9OA 2X23A 4B4DA 4F4JA 2JBHA 3LLCA 3PNOA 3UJBA 1TF5A 1ZD9A 3ZCRA 4TLDA 4RUKA 4S1OA 1VXRA 3GLGA 3LTNC 4MO9A 4MV6A 1R23A 3IRQA 3ZIAA 1G55A 3P0FA 4UM9B 1SC4A 1GP2A 4M3DA 1AKMA 2IDJA 3RKYA 4X6AJ 1M1ZA 1XCLA 2C3YA 2QZJA 2A3NA 5IBCA 4IFTA 4JK3A 5IM4F 2ID8A 1U1GA 1UOPA 3V7CA 1JKRC 4HG2A 3PP8A 3HXQA 4D6XA 4ESJA 2IGMA 4RWZA 3QPAA 4DOMA 1V96A 3IBSA 3M6MD 1B0AA 4B0PA 3EYYA 1OZAA 2QPLA 1YX3A 2YOFA 1RW4A 2Q4RA 5E9JA 2HU8A 4G23A 4UEKA 4BV3A 2C7BA 2CV1A 1AKYA 1PJLA 2CK3A 1JTYA 4BXFA 2FETA 3JQAA 4XUEA 4W9MC 1M34B 2IYUA 1SVKA 3EG9A 3IDAA 4UM9D 4M1KA 4FMCB 2LREA 1J0DA 4PXYA 4ZKEA 4D4JA 2FN9A 5D2CA 1G3UA 4ENMA 2W6JD 5AM1A 4Q3LA 2HK6A 2PIAA 2ZIEA 2E89A 3DAYA 3I2FA 4IQFA 5LYJA 2IYLD 2OXRA 3DKVA 3EWNA 3RSOA 3C15C 1UKCA 2M9MA 1R00A 1XTAA 2WAAA 3R0ZA 1FPMA 1RXSA 1O3SA 4RIEA 3DYBA 4IWNA 4N3AA 4ZZ2A 2PQ2A 1CK4A 3VPSA 1P0IA 1QO7A 2IF2A 3Q0WA 2DHDA 2FA9A 1Q1GA 1UMCA 1KDTA 1XQ9A 2IIVA 2PT5A 3CUWA 4GVXA 4HMQA 3IEUA 2OO5C 3T52A 5JS7A 5IWAB 2CFXA 1Y1WJ 2GCOA 1Z7UA 2JFXA 2PO5A 4UTXA 2KIFA 1DVRA 3E5RA 4ARBA 1NI4B 4KKVA 4M7RA 2DVMA 3QP6A 2IHBA 5GM1A 3UMCA 3SQXA 4AXBA 1B3BA 1C9KA 5LQAA 1ITYA 3FWEA 5A2QZ 1W29A 2VXDA 2P6MA 3M3PA 4KYVA 3NT5A 4RE5A 2DKFA 3DFZA 4A92A 1DIBA 2G1JA 1J5YA 5A2QK 5BPDA 2OAEA 4FK8A 2ZPUA 3T0FA 1H8AC 4FBLA 2HDDA 4M46A 3HUFA 1NURA 1GL3A 2AR0A 3MGAA 1GU0A 2FNAA 3A6GA 1G5TA 2P8JA 4F12A 3K73O 3T54A 3RZDJ 1UEIA 4ZK2A 5L4SA 4B7ZA 1RJ9B 3I37X 1MLDA 3VPAA 1DPFA 3PBKA 1N8TA 1QIJA 1ZICA 3T4EA 4HZFA 5F0HA 4S04A 2JFZA 3FVRA 1NQXA 2IOFK 3HTSB 2QU7A 2A9RA 2QYOA 3N8DA 2D2XA 2PBLA 4YMWA 3QVGB 3T3HA 1XPUA 5IAAA 4GLJA 2F1OA 1G59A 4D9KA 2DU9A 4NC7A 2DUNA 3AR7A 4ZCTA 2R7AA 1VCMA 2O6HA 4M37A 5TPWB 1AKUA 1GPJA 4HDNA 4ZOQI 2CB0A 1KONA 2WPNA 1ZQ3P 2AXTC 2EX1A 3HBAA 3OUUA 4W7IA 5FWXA 4BFWA 1X86B 2I7XA 5LVAA 3PX3A 1L0OC 4K6GA 4URUR 5DNWA 2E0IA 4DMLA 5JQGA 4I9GA 4RK6A 5EE3A 1U4OA 4MUGA 5ITZA 3AWDA 2O5CA 2CUKA 3SJAA 4WXDA 4BO1A 1IMOA 2JARA 2XECA 1T6NA 1JR4A 2VQSA 3K8YA 4MRSA 3S55A 1DRWA 4CTNA 1U0SY 3JATA 2GJAA 4G0QA 2RREA 4RNDB 5I7VA 1E3LA 1FW6A 4ZYEA 4KZKA 5AVQA 2OC4A 1PF7E 1QORA 3ASYA 3P9QA 2LCFA 3AAFA 3KL4A 4L28A 4O29A 4OBWA 3G73A 4TX1A 1G8PA 2R7VA 1MQAA 1YZYA 3REQA 4I0WB 3TD6A 2O1WA 1EUDA 1QV9A 2VJPA 5CA0A 3ZC3A 2C2MA 5JZSA 2ESHA 3MZHA 5BPIA 1U9ZA 3N76A 4P53A 4RMJA 4DWVA 1CQIB 2QMHA 1NULA 3M4JA 3NEJA 3R7DA 1K5GA 2OCDA 4AM3A 5K1ZA 4LOAA 2YOHA 4PZCA 1OLSA 1OCPA 3AFOA 2CHQA 2IOHA 5CW2A 5FA8A 4LX0A 2GDJA 4H3VA 3PQ6A 4OP2A 3CP8A 2GVNA 4QVGA 1RADA 4ABYA 4C2BA 5LQCA 3MW8A 4MV5A 5KKCA 4XD7A 5TGZA 4NOLA 3CH6A 1GA4A 3LUFA 1CJCA 4IHJB 1FYVA 5KQSA 3TAXA 5A03A 4RM2A 1R7RA 2NMVA 2W11A 4NXNB 4YP0A 2LNBA 3TDUC 2OA4A 1Z7WA 3IERA 2EP8A 4GGOA 1S7OA 4JX6A 2JTVA 3BR5A 2YDYA 5A5EA 1IZZA 2DFKB 2HSDA 2IUYA 5AIAA 3NBXX 3HJRA 4C3VA 5KOHA 1SOAA 4FCCA 3E8MA 2F5EA 1T3GA 5FLXZ 2OY0A 3DU5A 1C0PA 3G88A 4J2TA 5AVXA 3WRVA 4B74A 2FPIB 4W5QA 2WKQA 2QZ8A 1QYXA 5FTJA 3IPAA 1LTKA 3VR5D 3BOQA 2VJJA 3C5HA 1GT0C 3R5TA 1XYVA 4WDQA 4NZYA 4KQKA 4X00A 3QMVA 1HT2E 2QW8A 4CE6A 4RJKA 1NQWA 1ZN7A 5AOCA 2X8LA 3SSAA 2H65A 1MZBA 2GN6A 4MJ3A 4GGGA 1FSSA 5CAEA 2H8KA 1PKXA 2Y0MA 4YPFA 1TQMA 3K30A 1IOLA 1G18A 4HUQB 4LXHA 4U2EA 3VO1A 4C07A 1UT8A 2IF0A 2EIXA 4E5NA 2WV0A 1DZIA 2XUOA 4XJSA 3RS2A 1N1DA 3HA2A 4TS3A 5CIYA 1WXWA 1Z4NA 2OFXA 2ZJBA 3HKZN 2I99A 3L0CA 4I1UA 2HDWA 1I6MA 2BONA 2FN7A 2P6NA 2Y4NA 4FSHA 3T7DA 6AT1A 2XA2A 4M71A 5HE8A 3VSBA 2DSNA 4WINA 1DX6A 2XT9A 3W0LB 4ENQA 2BGCA 2XODA 4BJ5C 4IX7A 1OSNA 2H59A 4W82A 1H8ED 2W58A 4XX0B 5B3JA 4BMNA 3ZDAA 3S40A 2R7XA 4QYTA 5T8KC 1CIPA 3GXOA 3AZOA 1VM6A 3D7MA 2V0CA 4PSUA 5FL7A 5HR5A 2HQNA 4H3SA 4Q4JA 3W3AA 4UHCA 4WPGA 2ANBA 2RGNA 2E1PA 2QA4I 1YL5A 4Z99A 5DP2A 1K5DA 3JQ7B 3QX8A 3TZEA 4QVIA 2V9VA 5D87A 3SBOA 2DFIA 3TTVA 4LMYA 3ZEIA 1U0RA 3LC1O 3PDWA 4YRSA 1GL7A 2E6KA 3SHFA 3F5FA 4H7EA 4IRUB 4MYCA 4XYEA 5G0TA 1J39A 5A3JA 5BWNA 5KOJB 3ZCTA 2AJTA 3I2HA 4AJEA 6REQA 3CH7A 3EGVA 3PHIA 4BZPA 4EJOA 1YS2X 1OXBB 2BFCA 3TB4A 4UVAA 1VQLI 3BJRA 5JZOA 3NWTA 3CNQS 2B34A 1SZJG 3TX6A 3BE6A 2VSOA 3ZMZA 2FJ0A 1ZVVA 1EKXA 1CEYA 2L0XA 4L85A 1S8OA 5T3UA 1LV7A 3G2JA 5F2NA 1FQWA 2AX4A 4TMXA 2DT8A 5KQRA 5E1ZB 3FWKA 4XKCA 4TOIA 2DR0A 5LEJA 4JFRA 3WLFA 1A7KA 1YCFA 5A02A 5B6JA 5K8JB 1WDMA 3D31A 3G85A 1DBQA 2BPOA 2R6FA 5E3IA 2SHKA 1DRJA 3KUDA 3RC7A 4F6LA 1ENHA 4JVLA 1R0XA 2L7KA 2GEFA 3S1RJ 1OCEA 1K8XB 1QB8A 1P2VA 3DTVA 2EIJH 1ZG1A 3B6EA 3UJ6A 5CB4B 1VL1A 3DM5A 3O93A 2E4WA 3FSRA 3C1OA 2GZ2A 4NOMA 5DEIA 3D2AA 5HKKA 5NULA 4HDMA 3FWHA 4Q1DA 4R8VA 1JHMA 1X42A 5JJ5A 2R7QA 1JTXA 2Z99A 4KRXA 4ABZA 1VP9A 4O63O 3F1KA 4E7ZA 2FX2A 3LZCA 2Z1MA 1WSUA 2ANCA 3EFHA 3MCWA 3WIDA 2OU2A 3DE6X 3KQWA 2IX3A 2GXGA 3O9VA 2X86A 5C5DA 5EIHA 4MIYA 2DMPA 3TLGA 4XIJA 3MKZA 2AD1A 1PBTA 2EYQA 2V58A 3QU5A 4C0QC 1O2DA 1YB5A 3U1VA 4KXLA 1HQDA 3GTKJ 3PE6A 5DHPA 4FGSA 3INTA 3WGLA 2ISQA 3H2ZA 4AJPA 5TT0A 3K6RA 1BXRB 4KE8A 4YONB 4FKBA 3GJ7A 5F1PA 4D41A 5TMBA 2HW8A 1TQ2A 5IZCC 3MGGA 4OXRA 4M9ZA 2G9WA 4KMFA 3VVBA 4F2WA 5CFQA 1EQUA 4YB8A 5IC5A 3TJMA 3KC2A 4GP7A 5EMLA 3HO1A 2AQKA 1T8SA 3G1TA 1OBHA 3UBTA 2JIQA 2XF2A 2Z08A 1P91A 2J9RA 3JAMZ 4QTXA 5ER9A 3I2IA 4DUGD 2CNBA 1VHDA 4LSGA 4RSHA 5FF9A 5LM3A 2D5VA 4LTDA 3AG2H 3GQVA 1U2DA 2G9ZA 2QBYB 1XCVA 1WCV1 4R7ZA 4DBVO 2F00A 2Q99A 3PEEA 2DULA 4O5VA 1WVRA 2X6XA 4RB2C 1ZM7A 1YAHA 2B1IA 5JHFA 1BHQ1 1E4VA 2VJCA 4XLEA 4IRXA 4LBWA 4YYZA 3TOAA 3F7TA 1BJKA 2XB6A 3GLFE 3EH1A 3G4SI 3K9BA 2IV2X 3T3EA 4E4YA 1FMFA 4LJ4A 4LTMA 4N1AA 5D7BA 5KJCA 3WA6A 1XGOA 1LJ9A 4XKJA 2HJRA 4F85A 3RIEA 4DNOA 2HGSA 3BCHA 2EJUA 2GZAA 2PKQP 1C7EA 1V1RB 2IS2A 2ZAIA 3NYQA 4P93A 4XIIA 5ECWA 1S2OA 2WVAA 3DOUA 5IG2A 2L17A 2VBZA 3A25A 3K0AA 4P4UA 4H1HA 3CF4G 3LCJA 1J0CA 4ZO4A 3SX2A 3HHPA 1D2GA 4DUGA 3PWZA 5IXYA 4IZIA 3QKIA 2AHQA 3EA5A 2VNJA 1T34A 2MH2A 4DDMA 2XTNA 2XQIA 4CV2A 4HFJA 4NFHA 4GR4A 5J2TA 3A3NA 1W44A 3JALA 4G89A 4INAA 4R2HA 1KSJA 3EETA 4A5MA 2XUHA 3KSMA 4A93J 3K9GA 1MO2A 1PEKE 1VDMA 3QTTA 3OS0A 1PJQA 4B5KA 4QRDA 4D6YA 4TQGA 4G1MB 5LOVB 3V7SA 2HA4A 4J00A 2BEWB 2W6NA 4Q1AA 1UJ2A 3NC4A 4CF3A 3ZDDA 3BZCA 4BQQA 4KGDA 2HRCA 2ZYWX 3TXYA 4M73A 3K0HA 4RK1A 2C9CA 1W0UA 1NC1A 2PAFA 2W2TA 2ZANA 3K6KA 1I1HA 3W9SA 4RQAA 3EZGA 5ICEA 3TQRA 3WJ2A 3IEKA 5IFKA 2N47A 2PGAA 4YLYA 3BH0A 4LBZA 2WK1A 4O33A 1VC2A 5F77A 3M6FA 1FVOA 1KMIY 4FEGA 2O2IA 2Z16A 1YMQA 1UT5A 1J2XA 3Q2OA 3U37A 4EYOA 1J7JA 3JD1A 1FSEA 4DA9A 1YJQA 1IOZA 1DX4A 1F06A 2IE8A 3PNPA 3LCVB 3C6MA 4U5XA 5C3UA 1GNPA 4FNGA 4C0BA 4MQFB 4CM5A 1NVDA 1R4NB 3QFHA 4G01B 2BGRA 4DRXA 5AI5A 1IDYA 3OKCA 1FP4A 4HN4B 4N12A 2R66A 1W6RA 2UYYA 2R5FA 2Z9CA 2Z8YA 4FNMA 3KOYA 2PMZN 1V5GA 1BA3A 1ZUNB 4DM7A 4DJJA 3GL9A 1EFCA 1N6PA 1U8BA 2PKEA 3CEPB 3MIIA 3N2IA 4QJBA 2XRFA 4MGZR 4MV1A 1NJ5A 5FFXA 3KYCB 1CUUA 4EL0A 2Q6LA 4RC9A 3CB2A 3KB6A 4C87A 1JSRA 3GDHA 4PEVA 5D3MB 1J0AA 2DPYA 3OX1A 2XSJC 3T5MA 1LRLA 2I6UA 4KE7A 4UDOA 4MUNA 1ZRFA 4ND4A 5CFOA 2C97A 3C7CB 3C98A 4NU5A 2QJOA 1W75A 2Z2JA 2CGPA 2Q2EA 2FPKA 4FFNA 3N0TA 1M1YA 1B73A 1EGMB 2YYZA 5CDFE 1F0KA 2CCGA 2D2IA 2Q29A 1ZJ5A 2X0IA 4L9NA 1CX9B 3D7KA 3K1AA 1YZFA 2RV8A 4BE7B 3E6CC 3U4CA 4RGSA 3JRHA 2XD9A 4X44A 3CDIA 4ZI7A 4DB4A 1A4RA 1M7GA 3AONB 5KYXA 1EUDB 2N3ZA 4E5UA 3M7GA 1KE1A 5F0FA 1UKVY 4U02A 5AJUA 2FSSA 1IRIA 1DMRA 3RUEA 3A1DA 2DI3A 1YB4A 2BFAA 1MOSA 4B7UA 2V3VA 4PWZA 3IT3A 2XUBA 1YCHA 2RBGA 3ZIDA 3GUVA 3AUXA 1KXZA 1TAQA 1Y7IA 2ZNYA 2BFBB 5DLPA 5K3DA 4BEHB 3VAZA 4A2QA 2R8EA 3M6AA 2QGZA 1EHIA 4UU1A 3VHLB 1ZRDA 1DFIA 4F55A 2AWOA 3CRMA 2EV5A 3AUKA 3T5TA 3WHKA 4E6KG 4RD3A 1LH0A 1UXIA 4GHWA 6PAXA 4H4CA 4NPHA 4CL8A 1AQJA 2JLWA 4C9YA 1NVAA 1G8XA 2ZBQA 4FT4A 2ACJA 3OQIB 3UC9A 4Z6KA 5FX2A 2COUA 2FA5A 3NWJA 4OYRA 4RH3A 4DCUA 4TN1A 3RU9A 2WT8A 3INGA 1TADA 2W0MA 2PJRA 4IFBA 3OT1A 5K3FA 2RAEA 1YRNB 1TUEA 2WSBA 4TQAA 4K2AA 5BVHB 4A3LJ 1JH8A 4OHRA 4CQLB 2B8NA 1IY1A 3DMPA 4DIUA 1NQVA 1A8UA 2CNOA 3KQPA 3PIDA 3GYBA 2PZEA 4KWEA 1MF7A 2CEKA 2QDKA 1YR8A 2OBBA 1CZOA 1TVCA 5DCMB 3EIWA 1T35A 1JW9B 2V03A 3HM2A 3HJBA 4Q3NA 2CO5A 3G5UA 4J76A 4QYSA 1YTYA 2GYWA 3QYEA 2WSSA 5HF5A 3SFTA 3ICQB 4OIPF 1HSZA 2BKAA 1TA0A 1QV7A 2QLLA 4W6QA 1WAMA 4NBLA 5FFMA 2FAXA 1GZVA 4M74A 2G88A 2JPDA 2AXNA 1OFUA 1WMFA 4UE3S 3NBYC 5K6TA 4GKJB 4GKVA 4R41A 2ISCA 3TRKA 2WP0A 3WGOA 4EV0A 4F04A 1NXPA 4FCVA 1Z3YA 4NLLA 2H6EA 3KQHA 1MH3A 2QVOA 3ZRGA 4U88A 4D97A 4EB3A 3WU1B 3TLJA 3RSQA 3WI7A 1K2VN 2QQ8A 3ERED 4LOIA 3G0DA 5MFZA 3QOPA 4ETSA 3BRQA 1N9GB 5IBPA 4ZJPA 2C84A 1GUAA 3HLKA 3CP2A 4PK4A 3U40A 1RHJA 4O4HA 4GFDA 1ISGA 3VO8A 2Q2WA 4A8JB 4NXMB 2XVXA 3M1EA 3SQMA 2D45A 3MTBA 3QXGA 3PQFA 2WT9A 5CNKA 4ZH4F 1OWMA 1GNTA 3A1EA 4R3UC 5CRIA 2AZXA 5DGIA 3RRFA 4R8RA 2JAOA 3AJRA 1QH1B 1B9MA 2FZLA 2BLNA 2Z5FA 3HCAA 4I9UA 3GFGA 4JT8A 2IV7A 3ZW9A 4DILA 2V3CC 3G8BA 5KSOA 4BNKA 4XQCA 4EHBA 2X58A 1WB5A 1GKYA 4ANJA 1U11A 4NNPA 1R5ID 4CHUA 2HNHA 2I7TA 2IXGA 3O47A 1JSXA 4MAFA 3WRXA 5BW4A 5BWOA 1WZUA 3IP5A 4TKUA 3K6GA 3EUHA 4A3MJ 2XE7A 3TNFA 1GQSA 1SAUA 1M1XB 2VB6A 5DO9A 1IC8A 3NV9A 3N2GA 1BU8A 2HT1A 4LLLA 3TOZA 1SD6A 1XSEA 5AT1A 4BE4A 2RGEA 3L7MA 1VQNI 3R23A 2O8DB 4PLZA 3SSNA 1DCKA 4BFTA 4D74A 3GLUA 3AG4H 1NTOA 1RAGA 2GK3A 4FZJA 4QL3A 3ND9A 1G3YA 4JEIA 1RJGA 1SHJA 2FXIA 2V4ZA 1VNDA 1FNBA 1Y1QA 5K3CA 4BKMA 4EYKA 3RIXA 4W7HA 2AKYA 2Z95A 3GLGB 3VR4A 2XRLA 4ECEA 2MMGA 3SKYA 3SOPA 1FDSA 3OYCA 3KTAB 5TC4A 1W4AA 1OLXB 1Q77A 3CYFA 3H97A 4OOIA 3KPUA 3I9OA 5JJKA 2RQPA 1GXPA 2E2HJ 2MLKA 4KPYA 1QIKA 3BKWA 1CJVC 5TJHA 2UAGA 4I4LA 2VJ5A 2V1DA 2DFPA 4HEA6 4NC8A 2QZPA 4M55A 1WJGA 1W0KA 5EMJA 1P6UA 3PO2J 1JXSA 1GUFA 1Q91A 5LD2C 1XSDA 2DPDA 2GHTA 5C8DA 9LDTA 3WJ7A 3CO5A 2WY2D 2A07F 2Y0SN 3FRHA 3F49S 3QVJA 3DHNA 4CN9A 1YYVA 5CDGA 4M1TA 2E18A 4F93B 1M2NA 2HLDA 3JS5A 4F8JA 1IF1A 4HKTA 1BN7A 4YP1A 2X6RA 3R7LA 2P2GA 4A91A 5T4BA 4EJ6A 1FWZA 2YY7A 4A5OA 1II9A 2C2OA 4JZYA 5BUQA 4NX2A 1RQPA 5DW0A 2YRWA 5EJ9A 1QTIA 1VE3A 2XDVA 5JFRA 1KI7A 1P2BA 3TEFA 3HFGA 4ZCRA 1JPVA 1OWLA 3JVUA 1GEGA 3FYSA 2VA8A 1LSSA 1PAUA 3FGZA 3GEMA 3KV1A 4O2RA 3R0VA 1QGAA 2OC6A 2Q5IA 5EP4A 1T0UA 2XXBA 3DOCA 1DIRA 5K7ZA 1QH0A 4LJ5A 5B3KA 2IA0A 1B0ZA 3FIWA 5DGCA 3HCBA 3K4BA 2VBGA 1YI2I 4NEQA 5B7GA 2IEDA 1RHRA 4DNCA 2A8YA 3X2SA 3SM9A 3V34A 2VJ4A 3D7NA 2I91A 4AC9A 2OM6A 3EZLA 1FYKA 5DOZA 2M45A 5L3BA 2TRSB 4FM9A 2EAUA 1XKLA 2KT0A 5J1UA 3TRDA 1XN4A 2P2NA 1G6Q1 2K5UA 3C7KA 2DODA 1Z38A 3TINA 3MKLA 3U44A 2XWSA 4NDAA 4MSUA 2X2PA 4CMBA 3TMAA 4DVJA 5A04A 3K3PA 2OZLB 1Z6QA 3DFMA 1TEZA 1FP6A 2HUNA 1TT5B 4QBTA 1R7JA 2WTBA 5DTRA 1ZARA 3TW6A 1USSA 1KAMA 3KZNA 2J45A 3MGKA 4WOJA 2JCYA 3PQKA 4LN1A 4X1OA 3MOIA 4J1TC 1UOOA 2CXSA 2A0YA 3AI7A 4XGKA 3TZQA 1G2PA 2VSXA 3F7MA 3KZKA 2VKVA 5HDKA 2WP8J 1WHSA 1P0FA 2WUFA 2VT7A 1VJ0A 2X8JA 1K4MA 4PSVA 3GZ5A 4MYRA 4H08A 3WNBA 1XD8A 3CRNA 1BI0A 4ZYLA 2QMOA 5EHQA 2GPWA 3SKVA 1M5RA 4UEOA 1XVLA 2JKZA 3AEYA 3HVRA 3EXEB 5AW2A 4N0BA 1NVUQ 4EPRA 2EEPA 2WAFA 2OQRA 1M6WA 3IUJA 2Y1GA 3JQPA 4AQYB 3VNUA 1B1CA 1J21A 2V7QA 2D2VA 1TVKB 3HUDA 1JZQA 2OPHA 5CDSA 3B6AA 1TECE 1QHSA 3FBWA 2BE7A 5FTMA 3V8NA 4Y9UA 5JSZA 3FOFC 4NJEB 3R9XA 4LXTA 3Q6IA 1ZGGA 4RH0A 4OQLA 1IQ0A 3CXUA 5FWAA 3QEMB 1UL1X 1P1BA 3MCVA 4JGIA 4NF2A 4FC7A 5K0SA 1YQ9A 3CZMA 3OM1A 2BM9A 5H4HA 5BVHA 3M1CA 1R0YA 2DOEA 3D4OA 2XKJE 3O6VA 3TZLA 4B3XA 4FDLA 4D4IA 4GYIA 1TK2A 5HVNA 4YVFA 2PYIA 4BJ6A 3IQXA 3NDIA 1NJFA 1AS2A 2A1TR 2C7GA 4EHHA 1XEWY 5I5EA 1R5JA 4ZVSA 2V7PA 1RIOH 3DZDA 4GNKA 1NE7A 1AD2A 3H16A 1T6SA 1PZMA 4DSZA 2H3HA 4NQWA 3T1VA 4M72A 4I55A 1JFSA 4MQVA 3OIVA 3CZRA 2A5DA 5AKEA 4YRBA 2PZJA 1H4SA 3SZTA 1ZOPA 1U9JA 1O7FA 1Y33E 3N2KA 2H2HA 4WKBA 3B51X 4YO8A 5FNVA 4UEWA 4ED9A 1N5IA 4N40A 2X5KO 3K1PA 3WTTC 2I78A 1VF9A 3DEUA 2DC1A 4AO8A 4DLLA 4V2UA 5JECA 1IN5A 3FRIA 3I92A 4KZPA 1O8CA 5FBRB 3QFFA 3NP7A 4HPJB 1R0ZA 3ZE0B 2XAJA 2NVQJ 4UMVA 5D01A 1U2GC 1WXQA 2X0FA 3GZNA 4FHFA 3A7DA 4UUAA 1T5BA 2XCQA 3KZCA 2Y0DA 3LD9A 4M1ZA 2DFVA 4NWIA 1MOPA 3OD1A 4XPZA 4P3NA 4JAVC 1ISHA 4BMVA 4OMFG 1O3QA 3FPFA 1ODJA 2VZ8A 2R7KA 2EFOA 1I10A 1I2DA 1AJEA 2HWUA 4BB9A 3H1TA 1PYGA 2OORC 4XB1A 2BZTA 1NW6A 1U3UA 2JBWA 1A4UA 2V4UA 1X14A 2C2WA 3JQGB 3K5PA 3OA2A 4FX5A 3HKBA 3P5SA 4X94A 4C30A 2R6DA 4CUJA 4KIWA 4YI5A 1JUMA 2JF0A 3UAYA 3O2SB 1RWOA 2QL6A 2FSVC 4Z9FA 2WWHA 1NM5C 3ACDA 2FWPA 3SZRA 1Y0BA 3QHPA 2YVUA 1OA1A 4OHMA 3EUHC 1D0ZA 1EZZA 4EB0A 4JFAA 1G3WA 4J75A 4JA0A 3GPBA 1IM5A 1LK7A 3DE5X 1JHVA 2OP1A 3DJFA 1QRAA 3IVMA 4N6NA 5FAXA 3MTGA 3TR6A 3QODA 2PSHA 1TYZA 3TQFA 3VEPA 2X6OA 1N2ZA 2JEYA 3ES9A 4AJOA 4DBZA 2CU7A 4XAQA 1QG6A 3CJRA 4AYWA 1D4ZA 1E79A 1ND5A 4OJNA 1SFKA 2KFDA 2AG6A 3ZI4A 5DU2A 1RXVA 2QT1A 3DM9B 1XTSA 2DA5A 3LSRA 3I0ZA 2D5BA 2E1CA 3FSGA 2B2NA 4RAGA 4BNJA 3DEEA 2EFCB 3MILA 1QRSA 4ZJUA 5H8WA 1WP4A 4EW2A 4U2FA 1YITI 1AV7A 2EKZA 4ZAFA 4UMEA 5IJWA 1Z25A 2JGNA 1JT9A 3ICWA 3TS1A 1HPLA 5JHUA 1PQ4A 2JANA 3D0RA 4RELA 3TCNA 5AVSA 2W25A 4WNCA 2X4HA 1N9ZA 2JGDA 3GRCA 4QAQA 1M8FA 3JRXA 1I5ZA 3TDKA 3BERA 1D8TA 2JEOA 4HEQA 2XRMA 1RZ4A 3SZLA 4DQDA 2RHDA 3ZTTA 2RGWA 3C4JA 3CB4A 2L7MP 1TRHA 1L8OA 3H3ZA 1XB4A 2QG4A 5GQSA 1I3AA 4HX2A 4UQLA 3DE4X 2IUTA 5EIAA 2E4XA 3LAPA 4TN5A 1RRKA 4BLSA 1WDTA 5LR6A 4TYPA 3Q0VA 1DQUA 1K7XB 4D9IA 2O19A 1BC7C 4XJXA 4GICA 1XQ6A 5F12A 4TYNA 2BY1A 4N47A 1MTOA 2RE8A 2OZUA 9ANTA 2WNIA 3DNMA 3I6QA 3TQNA 1YVUA 2P77A 2Q41A 1TWAJ 1CQJA 1QHIA 1JG7A 2E1RA 3CUUA 5CYOA 5EQFA 1E1CB 3W8RA 4QUIA 4Y2JA 3WK9A 3R8XA 3T3OA 4AZWA 1GTZA 1YHZA 2EZLA 1M8PA 4J16A 4LF6B 2RG1A 3LFKA 3FIUA 1CB0A 3H3VK 2C5FA 4AF8A 4BCCA 5AIQA 3BF7A 3KQQA 1ODFA 2J1LA 2J3JA 1ONVA 3X1MA 3CNHA 3ZD6A 3QK7A 2GF2A 1A82A 2HQOA 2YXNA 2BKXA 2BE9A 3KOZA 4K6CA 1BVYF 5SICE 3ZQIA 1E1LA 1WJDA 1JKQC 2DX7A 5LWQA 3PV0A 5FB2A 4F1KA 2XCIA 3IIIA 1QLJA 4KE6A 2MCFA 4JP8A 3IUMA 2JWTA 2ZUFA 3WSWA 5C1DA 3NTXA 1XVTA 3GNLA 3WP1B 1IN6A 1XLTC 1ECJA 1T3TA 2PN1A 4B3HA 4PU0A 4B3AA 1XJWA 3PENA 4NCBA 1QS0A 1CJBA 2X3YA 4PGFA 1XZIA 3VR5H 3JQBC 5BSEA 4ZO8A 4OKIA 3E8XA 3CURA 3BD8A 3GMSA 4FDTA 4MARA 2M4KA 1JKMA 3N7TA 5DN6A 2I29A 1ZGCA 2PV0A 3OETA 4YJ3F 3BTIA 1Z88A 5JISA 1W2HA 2PUHA 2WDZA 4YXWD 3GFQA 4QBKA 4YIHA 1MIJA 5G1NA 4UVDA 4WRRA 3ASNH 4CR6A 2YINC 2QB5A 4EHJA 1SKMA 3NCHA 3OYJA 1YBMA 1HRDA 2TMGA 3QVOA 1ECCA 2AG5A 3AQ4A 2WEKA 4M1OA 3JSAA 1J2EA 4FT2A 1XWWA 1RI4A 4BE0A 2C5EA 5DTIA 3JQBA 5EAIA 3FFXA 5CB6A 4JSYA 2EGUA 4IJKA 1GSIA 1JXMA 2QM0A 4EJUA 3QYFA 2YWDA 5BSVA 4KMSA 2AZ4A 3MCZA 3G8AA 5EHIA 1KK3A 1MX1A 4LG0B 3KKKA 4QECA 2FK8A 5DN9A 1B0PA 2LZ0A 1L5YA 4CMCA 1W581 1V39A 3DOIA 5DDGA 1XPXA 4IIHA 2G4LA 1DBSA 5FTLA 2DO7A 4Q1CA 5K05A 4C78A 4GIBA 4BASA 1QPIA 3M70A 1IK6A 2ZRLA 3MB8A 4HZIA 5EXSA 4U3JA 1TZ2A 1V11A 1S0UA 4KQJA 4WA8A 5CH3A 2C9DA 1FFWA 2ZJFA 1T0BA 2HSGA 1R1DA 2ZAGA 3PJDA 1PWXA 2APJA 1AKHB 3QPBA 3TBHA 3BJMA 3BWDD 3GA7A 3FK7A 1TF7A 1NUAA 2VP2A 2WFLB 3NM4A 3UT6A 1AKRA 2PRSA 3VDMA 4BNLA 4EZEA 5JARA 2PU7A 3FMFA 4G6QA 4ZAYA 5FOQA 2OZVA 4LPKA 1H9AA 3RVPA 4J0QA 4NE7A 2X0DA 3IODA 5LRSA 1B4DA 3CSSA 3FHJA 3BDIA 1XCOA 1P9QC 1K7YA 4O4HF 4TTPA 4A5SA 5AFSA 1G19A 3H4IA 3CV3A 3M81A 4O2AF 3HY4A 3SXYA 2O8CB 5ERYA 1LPPA 2C92A 3VOAA 3UPUA 3P94A 1CR1A 1YFHA 3HBNA 4F60A 2VQHA 3Q9LA 3VGPA 3TGLA 3QLUA 4BV9A 2LH9A 1WXXA 2BFMA 1V5EA 2REBA 3DAOA 3DDNA 3GPLA 5L8VA 1OXXK 2DF8A 2W6PA 4XQEA 1F1JA 5A5FA 3H75A 3GTPJ 3CVOA 2I2AA 2X7XA 3L2RA 3SZPA 1QXSA 5E20A 3DCNA 3V3TA 3RAEC 1R6XA 4YS6A 3TLXA 5LUBA 2ZQ5A 1NN0A 2GA1A 1EWYA 1N6NA 4G4SO 3DKIA 3ONEA 4HQFA 4L16A 1VB5A 3L0DA 3GAAA 4CV0A 3CKYA 4ZIRB 4R2IA 2DY1A 2K7ZA 4UTZA 4YRCA 3HKDB 3IA2A 3C7AA 1RQXA 1Q3HA 2R47A 4RMNA 3UMBA 1M5TA 1X7DA 2J5KA 3A26A 5TX7A 2G9UA 4WUVA 3HOZJ 1BGWA 5GINE 2O2EA 4Y7NJ 3QJYA 2LKPA 1C4KA 1R6UA 1SH7A 2ESRA 1XLUA 2VP0A 1HQKA 1MG0A 4RVOA 3QVUA