1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords phosphofructokinase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
4MCJA 3O8LA 4P5DA 1WEHA 4FYIA 1F8YA 2IZ5A 2F2TA 2PFKA 3OPYB 1YDHA 4JEMA 1S2LA 5ITSA 1WEKA 2IZ6A 4I36A 3O8NA 2NX2A 1S3FA 2F62A 3EHDA 2IZ7A 3QUAA 2Q4OA 4PFKA 4HX9A 1PFKA 4KXLA 1MTOA 1ZXXA 2PMBA 4MEJA 4WL0A 5AJUA 1KZHA 4JENA 4FYHA 1T35A 4JELA 2HIGA 5AJTA 3F5MA 3OPYA 3BQ9A 3O8OB 4P5EA 4FYKA 1RCUA 4I4IA 2A0KA 4I7EA 3U39A 2KHZA 2F48A 4KXMA 2KLHA 2Q4DA 2F67A 4LJRA 4OHBA 4LJKA 2A33A 4RH3A 3IMKA 4NPAA 3HNOA 4A3SA 1S2GA 1S2IA 4OHRA 3UQZA 3SBXA 6PFKA 4LJLA 3K2QA 1F8XA 3O8OA 4KXNA 1S2DA 4U1RA 2F64A 3PFKA 3GH1A 3MAJA
chains in the Genus database with same CATH superfamily
2V74B 1E1LA 3A14A 4ZU3A 2JLAA 3TQCA 4H6PA 4CT4B 3U56A 4DABA 4OMCA 5D3QA 3WYDA 3PJGA 5I9IA 2NPFA 1G4AE 1YUMA 4QNMA 3W2WA 3OIWA 4OEHA 2DUNA 4AKHA 3L18A 3UT5B 1DPUA 2BJVA 2EKZA 1AK1A 1YDEA 2BRUC 2HCJB 2KS6A 2PFKA 2ZOSA 2NUAB 3UK2A 1ZOPA 2HNKA 2FFQA 2PS9A 2QSHX 3D7LA 3PC4A 4M98A 1FX0A 4QHTA 1CP3A 1FNCA 2XH8A 3LNQA 3R7NA 9LDTA 4MKFA 2H92A 5JY1A 2XCTB 1E6EA 1WZUA 5KI6A 1TM4E 4RZSA 3M3PA 3N2KB 4CMEA 1IM5A 1G20E 3OWXA 1CS0A 5E20A 1ZMXA 2W90A 4DGSA 5C46F 3UY4A 5JMWA 3QVLA 1YBAA 2H1WA 3OT1B 4EM0B 3T7CA 3F6EX 4R3WA 3MWMA 3MLEA 4HF7A 1PR9A 1Z74A 2EBWA 4B6OA 4D99A 3BQMB 3E53A 3SF8A 4HQLA 1CVLA 3GLVA 3VU8A 4E1VA 2W82A 4LWPA 2Z16A 4U4AA 3I05A 2W2PA 3CRRA 1Z5NA 4JB2A 2RGWA 1SZPA 2CHFA 2EZ9A 4U00A 4CEIB 5DH9A 5B6JA 5HCIA 1HV8A 3HTSB 2VT2A 2PMUA 4FB5A 3L8GA 3IMFA 5E1OA 4MQ5A 4RGBA 5EXPA 3A2KA 1W4BA 2GEKA 3A6DA 3AB8A 4Q48A 3LHIA 4F9EA 2I7VA 2Y1FA 3X3HA 5A5VA 3BPXA 1Y1LA 3EAGA 1G5FA 2I2FA 3C1OA 2PN6A 4O1MA 2WV7A 4V24A 4B4VA 5HRUA 1CQWA 1XR3A 3P94A 1GA6A 1PJ3A 1JSCA 3I4FA 2NU6A 3SYKA 4OH1A 5LYJB 3FYUA 4S0ZA 1A5ZA 4C7KA 2GDJA 2DK8A 1BMQA 1GPWB 2RGUA 5JEEA 4NZOA 4LY9A 4GYKA 1Z0AA 4CF5A 3ILHA 4K8RB 4R1TA 3CEHA 5DLPA 2R2GA 1ZOOA 3P0EA 4Q19A 4WFIA 3E0QA 4C05A 3K6KA 2PEXA 5CPRB 1ZRCA 1KC1A 1TO2E 4G81A 2A1UA 1H1DA 2Q3MA 4KFTA 3DOEA 3JWJA 1C3VA 3A1WA 2DCEA 3P9NA 4N0DA 4OX9Y 4CV1A 4DOMA 2ILTA 2F4OB 1UDWA 5BW5A 5BVGB 4MUMA 3ADOA 1U4OA 4L75A 4A3SA 3LG2A 4YK7A 1DAHA 4F04A 1D09A 1H93A 1Z7WA 1HF0A 2Q6KA 5FPQA 3EQ9A 3VHQA 1RQGA 3O8HA 5EN4A 4XOTA 1I1OA 3ESXA 2IQIA 2QSUA 1YFJA 3T94A 5AUOB 1MB4A 3CS3A 5DHPA 1ODCA 2W48A 4KNWA 3O2NA 2I3GA 3KOUA 4B4DA 1V4VA 3UPDA 2P8SA 3DDCA 4F72A 4FQ5A 4G3XA 5JASA 1R71A 1RVV1 3K6JA 3NVAA 4LI3X 4Y8VA 4L5BA 5E18F 3TKYA 3JD4A 3K2QA 4NONA 3KPVA 4JJ4A 2Q9BA 4XVHA 4ZMRA 3WXMA 2CJJA 3WGHA 4W1QA 2HIHA 3HCWA 1W7PA 4YGXB 3T35A 3VC1A 4F6RB 2CNDA 4CMHA 3L6UA 5EMJA 4D45A 4G1FA 4L4XA 4JKIA 4RA6B 2TMKA 4I3GA 4GXTA 4EFDA 1N5MA 5ESXA 2R3SA 4BAUA 1JFLA 3EXFB 2BISA 1Y3BE 3F97A 3GGJA 3TGWA 3IQEA 5H68A 4MHGA 3B3AA 2ZJ2A 2IEYA 2ZBPA 1LK0A 3A70A 3AIIA 3GGCA 3P4UA 4MI1A 5B1DA 4RF5A 1IUYA 4ND8B 3MZHA 2WA1A 4UD6A 3J80Z 1T9HA 1KKUA 1RWPA 4MEAA 3TO5A 2RK4A 3L6RA 1RFLA 4BGEA 3OQMA 4WOCA 2ADUA 4J75A 1VL2A 2QPOA 3I1IA 1EYZA 3TJRA 5DNYB 1NHWA 4N65A 3TNLA 1DAPA 3FPCA 1QWOA 4R8KA 1PR0A 2ZIXB 3IELA 4RK7A 3VNQA 1ULTA 2XAFA 4D82A 4AIHA 1FC3A 1Z07A 2UV8A 4LHZA 3RYHB 1DKOA 2UZ0A 2JPBA 5F7ZA 3TEMA 4YNBA 1I4OA 1R0WA 1RRPA 3ASZA 5C37A 5F5NA 4F12A 4HHEA 2FWNA 4UCFA 2PXAA 3HHGA 2X8WA 3CLUD 2R8YA 3V7CA 1S3FA 4HEA2 1T3LA 3OUUA 3P0HA 4I55B 4UREA 5LGTA 1XCJA 4UULA 5AHKA 3GFFA 3M83A 4ID9A 1FVHA 1QK5A 2JIBA 1FRVA 1OQAA 3L92A 4IKOA 1F8FA 1RWNA 3JRBA 1IOVA 1YC5A 4U87A 1SBTA 4K9MA 4NCXA 3A6ZA 1IVNA 5AHXA 3F6VA 3H5RA 1Z0FA 1H5QA 1CF7B 6REQB 2VIXA 4F8EA 5CLQA 3NOOA 3KX2A 1C9NA 2H2AA 4GWGA 1YC2A 4HN2A 4QO8A 3OF5A 4RA2A 2VE9A 4F9FA 4AJLA 5ECYA 1ESZA 1XX5A 3UHPA 2HOAA 4U0WA 2BEKA 4DLRA 2KIUA 1KRXA 5EMMA 5DBFA 4JEHA 1CVIA 1MJ5A 4Q6BA 5KAMA 3I59B 1R6XA 1NPTO 2Q8NA 3B9BA 3PUVA 4US1R 2GZAA 4ZU1X 5LBIA 2ZUDA 4IIJF 4CLHA 4K6HA 3Q85A 4Q5IA 4Z4IA 1XG5A 3ASYA 4OFZA 2FAXA 2QRMA 2FVXA 4MRRA 1MEOA 2O8BB 3F8SA 4QBIA 3HKDA 3X1KA 5BV8A 4TZ6A 1P9WA 4KBFA 1SFUA 3KP5A 1D8TA 1LBHA 2BW3A 4FMBB 2JA5J 2P7IA 1W5BA 2IHJA 2W4IA 2WINI 1HL7A 2X9QA 3A3OA 3PGVA 4NBRA 3P4YA 4BATA 5K05A 2CXUA 1TCAA 2AZ4A 4FFPA 5CVTA 1WG8A 2F67A 4ZARA 3UMSA 2P62A 1LSUA 5A4JA 4PC6A 4EI7A 3QQAA 2RV8A 4A0HA 4ARBA 3ICEA 2PKWA 3EXIB 3JSXA 2Z1NA 2ODEA 3I1FA 1TTTA 4FQ7A 5LIPA 5E95A 2K5UA 1G0NA 1MD0A 2G40A 2CDAA 4DY4A 2KFDA 5E9WA 4UMFA 2C3MA 2RH4A 1LLFA 2GUGA 4Y9TA 1AM4D 4D8WA 1Y1QA 4M0CA 2PSDA 1U8RA 5L3GA 1K4KA 1YIOA 4C1NA 4OU0A 2VYNA 3M4NA 2EP5A 3THWA 1YVEI 3OKPA 2XUHA 4A2QA 3CH6A 2D59A 4PFOA 2DRIA 1AURA 5KVSA 2J5QA 3GGOA 2BZ0A 1J22A 4HS9A 4EQ6A 1D6SA 1DBQA 2FPIB 2OJED 1JMKC 3CNQS 2J7KA 4AZWA 2M7AA 3D7KA 4JJKA 3CLTD 4PZLA 4PZUA 3T3PB 1MBHA 1NVKA 4JSTA 2WM8A 2JGFA 1ZNYA 4I1RA 3S27A 3UA4A 3VHXA 5GZ3A 4F7ZA 5FL7A 4FT4A 1EIWA 5M3FJ 2FPGA 3BG6A 3GQVA 4FFOA 4MPRA 1T0FC 3PXAA 4KSYA 4WKGA 4D9FA 3VPRA 1ND6A 1ZICA 2DR0A 2GT1A 2BGRA 4C03A 2AZTA 4EHNA 3L7AA 4X54A 5K03A 5A1TA 1H22A 2GESA 2Y8EA 4PHGA 4JC8A 4EO9A 1Z4PX 4PIPA 5CYVA 1B8VA 3LUKA 4L9AA 3CLQA 5HKKA 4HDRA 4IFIA 2D2WA 4WN3A 2EV6A 5JATA 1CF4A 3L1HA 1M7BA 2P8JA 4BEHB 1ZAYA 3JU3A 3AR8A 1V5FA 3Q8MA 3R60A 5LEJA 3LO8A 5SZHB 1PE0A 1TTHA 2DH5A 4HOYA 1E2LA 3VDQA 5JFGA 4BQOA 2JPCA 1JJVA 3I64A 2IIPA 1U5TB 3DC2A 2EKDA 4HP8A 5C35A 3ZD7A 1DRJA 1EVYA 1B3RA 1P62B 4XPZA 1S2LA 5AR1A 1NJ5A 5AM3A 5I01A 3U7FB 1RZRA 3K0EA 1E9DA 1Z36A 2YS9A 3E6DA 1OC4A 1NBIA 2NM0A 1N2JA 3AKYA 5LOVB 2FZWA 2HK6A 1DAFA 3AZQA 1K89A 2I8LA 2GZ1A 5B2ZA 1W4CA 5IDXA 3TB4A 1LJ8A 4KQGA 4OOIA 1T5DX 1LFPA 5IOYA 2AOTB 5K4AA 1EUDB 5KX5B 1B8UA 3LDFA 2CNWD 4OHMA 2OPHA 3VA7A 5E4YA 3AR3A 2XAHA 3ASVA 1LX7A 4H3VA 4IDQA 2ZREA 4IHKA 4PLGA 4UBNA 5CQEA 3USZA 2O2CA 2YMMA 4Q4ZF 4W5TA 3HOSA 2OCEA 1OPXA 2B1QA 4LXXA 5CHYA 2VBYA 1I6KA 1AHNA 4ILEA 2W83A 4RQAA 4RVSA 1Q6ZA 4XGRA 1OFCX 3TOAA 2C6YA 1N6HA 1SA0A 3C4QA 4IGEA 1U7PA 1GTSA 3GEIA 5HYVA 3WLEA 2W2KB 2JCGA 1B6RA 3I0NA 1Q1QA 1E2QA 3HCCA 2OQIA 3WTWC 4M9UA 3AHEA 1GZ6A 2R8PA 3BA6A 3O8OB 3VR4A 1IFXA 4HJXA 1BMDA 2F59A 4D7MA 3M9AA 2KI5A 4S1PA 4BKRA 2E1CA 3ZPLA 4A10A 1D07A 1YBMA 1KYVA 1YOBA 3BHMA 4R2IA 4DA6A 4JLJA 3PKZA 5EYPA 1R7JA 3FXQA 1NVXQ 2HDDA 1RZUA 3B8EA 4HNGA 5KAFC 2R5YB 3QWFA 4WCDA 4B5KA 4IKEA 2X15A 3NUGA 3GUDA 5IYDJ 4UY8I 5DBOA 2VNSA 1JRLA 1RJ9B 4RLHA 4XR9A 1GNVA 1I2CA 1KI3A 2XTZA 3E61A 4G5XA 4WMLA 4Y2PA 5E9AA 1FXWF 5FOWA 4JWTA 3B5IA 3K4PA 1DC4A 3G5TA 5CFNA 5CXQA 4OQXA 4C76A 1YJNI 4H7JA 4P80A 1L5ZA 4RA9A 2VPXA 3IPCA 1ITZA 1K92A 4XSZF 3K16A 4HH3C 4UCXA 4G7OF 5B1BH 2OFWA 2OXTA 2VF7A 1B41A 1A04A 4YCJA 4WBNF 4RSGA 2O8XA 3PNQA 4G2NA 3FNFA 1WXGA 3K1MA 1NYLA 3GJ0A 1WF6A 3OTHA 3C5EA 3RRZA 3KLBA 3R3ZA 1UBEA 3IAUA 4BECA 5ISMA 3DE7X 3DL4A 3DBRA 4JWKA 2IAIA 5DT9A 2V0GA 3PL5A 4L15A 3LSYA 2GXBA 2IXEA 2ZATA 1PN3A 4P3NA 3LC0A 3A4MA 2P5YA 3IE0A 4PCAA 4WN9A 1PZFA 5EJMA 1IZZA 2IEAA 5F2EA 4AROA 4D0LB 3PR3A 5LZ9A 2IITA 3KHKA 3R3SA 2P6TA 3COWA 4U9HS 1SU4A 5TPZD 4XWWA 2P67A 1YOVA 5JNVA 3KQLA 3ZNQA 5DLQC 4CHGA 1UBMS 2A9VA 5LQDA 3ST7A 4MLOA 1E1CB 1R9JA 2VWHA 1HORA 1ODJA 1F48A 4FMCB 1H9BA 3QUSA 3H8SA 1KPGA 2X0RA 4H27A 4D7NA 1F2VA 2D06A 5C4MA 2FUKA 5BPIA 4Y18A 3IMCA 5ALNA 2LK2A 1MO5A 1W6RA 4YTEA 2XOKD 4AKIA 4QPOA 2MSKA 1AV6A 4X3OA 2X5NA 4UU7A 4MV0A 5FP0A 4Q03A 1RQ2A 3TTWA 3V34A 1CK4A 4AZ0A 4NXMB 3DSRA 3JAWA 5IOZA 2KX7A 1NMSA 2OCDA 4UZSA 1RXEA 4KQKA 5HF5A 3H2BA 3IRVA 3R61A 1Y8CA 2Z8XA 1A8HA 1H4VB 2GN6A 1E2NA 2HJWA 2VH2A 2O59A 4FUQA 3KQMA 3BJOA 2QN9A 3K20A 1WV0A 2ZIFA 3LPCA 4R8MA 4RGVA 4ZT5A 1DGRM 3WGVA 3DAHA 4W1SA 1QGUA 1L0BA 4JR2A 2VDLB 1PBNA 4BV9A 2FWMX 5K4HA 3ZWAA 4U9UA 1VQ4I 3HPHA 4UVAA 1MAVA 1DJOA 1W0CA 1HMYA 3PG5A 1CVRA 1Q1AA 1WXDA 2NAFA 1H0HA 4FGKA 3BWGA 1G8FA 4V0MA 4H0CA 4WA8A 1T5HX 2J3HA 3JQ7B 4H3KB 1BBYA 4GXNA 4PYLA 4EL5A 2W0MA 1QNTA 3LFHA 3WL8A 3A3KA 4UDOA 2GJ8A 2XMPA 3TRDA 4F3KA 3PNYA 4YCNA 1RS0A 2G4LA 2QTRA 1N2OA 3M1AA 2YRFA 3NTVA 3E3NA 2ZJAA 3RU7A 1SB8A 3ZDFA 5CA0F 3UMJA 4Q7MB 4TQUS 1CR0A 3VR5D 5ETJA 4WJLA 4IFBA 1X8KA 4L0QA 4JBLA 3E18A 4K40A 3TOXA 4CFZA 4KN4X 3DEUA 2D7CA 2G6BA 2XGOA 5A02A 1OLSB 2IYRA 4NHEA 4R1NA 2CSUA 1O4XA 1TM7E 4HVLA 2P4UA 2YN2A 2QXTA 3Q7SA 4I6JA 3LA7A 4TRJA 4V19K 1P2DA 1S1MA 1XMJA 3FCXA 3BIFA 4F45A 4A15A 4ESHA 2FJ1A 1U81A 4RKEA 4QPZA 1MH1A 1XA3A 2CGEA 4C0HA 3FMVA 4M1YA 4WJZA 1D8JA 1RQXA 2BFCB 4MPJA 2Z2SB 1U7DA 1FP2A 1Z21A 3SQNA 4RHFA 5LA6F 3O6VA 2HPMA 2WIGA 4DKXA 3G7SA 1E6WA 3ZOBA 2YN0A 1QANA 1K8QA 1KGSA 2JI8A 3KKOA 4TT3A 2PXXA 3IMKA 1CHNA 4B4WA 1GTJ1 3UWKA 2WHYA 4O25A 3HNOA 1X2EA 1JVSA 3LCMA 4MUYA 1Z75A 2OFPA 4XM1A 4G23A 2XGMA 1AB6A 1ZVJA 4C4AA 1VE3A 4HXYA 3K7EA 5FPPA 2CSOA 4LD5A 1SKUA 3CH5A 1H8HD 3P2MA 3RVQA 5C4JJ 2PM8A 1DADA 3EZ2A 1M0SA 5LZ4A 1OXKB 1RU3A 1AOXA 4L2IA 1AC5A 1ITYA 3BUSA 4MRSA 4BO6A 4GR5A 3A9RA 3NHKA 4A69C 4XQ0A 1F8UA 3GGDA 5CU7A 4M38A 1Q20A 4V1CI 2VPYA 1SD7A 1N0VC 4ZRMA 1JXSA 3PFCA 2Y0SA 4YCAA 3UTDA 4GYYA 4O3FA 3VVLA 4LLGF 2WJ4A 1NW7A 4C4YA 5MHTA 4JV5B 4MH0R 1NZDA 4B76A 1SUCA 5IKMA 1I24A 5KNDA 2AVNA 3BIJA 5JXJA 3WNQA 1C1XB 3T7TA 3OYBA 4HNAB 3D1VA 3HYLA 4FDUA 1QVWA 4HEJA 4TTVA 2DBVO 4XH9B 3CCLI 1LK7A 2WSIA 3FY4A 3HVKA 2H1FA 3REQB 5IN4A 3FTFA 5AXAA 1TP4A 4F93B 1K7EB 2G3YA 2QR2A 3DOIA 2HJVA 3JALA 3KC2A 2V58A 3IQIX 4TS1A 4IDNA 3K5WA 3G5MA 3FXOA 4B7ZA 3ZQLA 5F2NA 2FEAA 4WLFA 5ITWA 2VSQA 1XXLA 1Z0JA 1ELOA 3MMPA 4Y1RB 1M2WA 4JEUA 2EHJA 3VDMA 1QQBA 2G09A 5DM0A 4WZZA 2E48A 1Z73A 5AW2A 1OKKD 2JRTA 1E60A 1CV2A 4J4TA 4WCFB 2H94A 3MGKA 1KJJA 2IL1A 2VP2A 1Z3XA 1ZN8A 3L6DA 2J0EA 3R0AA 1AHDP 3SDZA 3IT2A 3ISTA 5B5SA 3TDZC 3EODA 5KOYA 3DE3X 2A7QA 5J23A 1L5QA 2IYXA 3AUSA 4MLCA 1Z67A 4K03A 3SC6A 2YXDA 3ANYB 3DFKA 3OIPA 3BYZA 3WRYA 2G1JA 1RADA 4C4ZA 2JVHA 4IJMA 3NYIA 1CU1A 1H1LB 5IAGA 2IZOA 1Y1SA 3VU9B 3WGKA 4X62B 4KXLA 5AKEA 4UUQA 2GCIA 2FPGB 2NG1A 2IDKA 1OFTA 2YR0A 3ELUA 1Y8ZA 2MTBA 4LV5B 1KVQA 1Y8QB 2VO1A 2EGGA 1GUAA 2HRZA 4OYHA 5KWIA 1NGSA 4NB5A 3R8XA 5A9RA 1G8XA 2GA2A 1FWZA 3F7TA 4JQZA 2J3DA 4UPEA 1EA5A 4E33A 2R1ZA 3SIXA 3BGVA 5A9SB 1EVIA 5AVQA 1T0HB 4A3CJ 1V16B 2HKOA 2O8EA 1V96A 4LG0A 1EBBA 1ZQ9A 2F1JA 3T5GA 2GMWA 1YHYA 4YAGA 1Y8AA 1N2BA 1ZM7A 2RHHA 1OJLA 3C48A 3X1MA 1FNDA 1PT9A 2ZVQX 2RKOA 3HPRA 4GPEA 1EX9A 1SQFA 2ENUA 4OM7A 5CVDA 5MGBA 1UPTA 2BP7A 1U0TA 2QRZA 4FX5A 2BELA 1MSEC 2NO1A 2YUTA 3PPVA 5CNIA 5CYPA 5HF9A 3T4EA 3ZI7A 2RCYA 1SVKA 2L18A 2QVCA 1Y5MA 2PWPA 4MRNA 1TUBA 1QGDA 1QP7A 3H19A 3SVLA 3PGJA 2QVXX 3QLUA 1R6RA 4M60A 5EE1A 1KC3A 4GKJB 1FBNA 3PXDA 5CX4A 3F6BX 4XD7D 1PFYA 4YJFB 2UXBB 1UQUA 2AKAB 2EVWX 3OETA 5AVJA 2VXDA 2CBGA 4M3EA 2JD0A 3W3AA 3COZA 2PT5A 3TDUC 3ESAA 4C7VA 2R6R1 5CEJA 1TQ2A 3OLVA 2EKLA 3QU2A 4TWRA 3R7DA 1U6JA 4FFVA 1R4AA 4Y0VA 3R8CA 3TTVA 2KWIA 1CUEA 2Z99A 1DBVO 3FGPA 3VNSA 2M9MA 2UYHA 1R88A 4ZI7F 1LD3A 1NVFA 1XYYA 1JKFA 4KYIB 4XSHA 1OX4A 2WT8A 2P68A 3DCNA 4UM5A 1YB1A 3A1UA 5A9TA 5KJCA 1O0BA 3DMHA 3OFNA 5K0EA 1X7ZB 4Q9LA 1KDYA 1CDEA 4F3NA 5AI4A 4M9QA 5KHDA 3IIEA 4GKBA 4WH0A 4BLSA 2OAGA 1YQXA 2NVXJ 2CFCA 4PX9A 4UDNA 3C15C 4QICA 5IP5A 5J1SB 1EK5A 2P3QA 3AEKA 3NHZA 3VYTB 1EP1B 4BS9A 3W9BA 1B8IA 5BY2A 1WSUA 2QBYB 1B6TA 1G5IA 5DO9A 1UKYA 3SOZA 3SFIA 1Z2OX 5IYZA 1R9TJ 1JDBC 3ORHA 2VXOA 3L0CA 3WLHA 4DV3B 3KL4A 5D4RA 3A6JA 5KJ1A 3PQFA 3GEDA 2EATA 2QPAA 1YKFA 3GDHA 3QV1A 1K8YB 4B87A 5EWLA 1DEKA 1Z56C 4JJZA 2A9PA 3ZE8A 4AUNA 2JVIA 4L4RA 5KOJB 2VT3A 1Z18A 3L6CA 4O4HB 1TTPB 2PMHA 2WSYB 3IXMA 3RNOA 1Q0LA 2YFYA 3BCAA 1RBZA 4JL6A 4PAMA 1SD6A 3OCCA 4WFQA 4DQKA 1R66A 4WRRA 1GRQA 5C7IO 2ODAA 2PBLA 2I99A 1DP4A 1H1TA 4CL2A 4DDKA 4FOOA 4ZEWA 4QM7A 1RYDA 2IHYA 3FMOB 3HEMA 3IKMB 1E7YA 1QH9A 3HN7A 1DU4A 4G07A 1FSGA 4WXCA 2ZI9A 3QYFA 2B9EA 3NEAA 5JDIC 4C5BA 3GW8A 4RO0A 1O96A 2BBSA 3EZNA 1VHQA 2CXQA 3QFFA 2ECKA 4FU0A 3RRBA 2LLKA 2J46A 1FYWA 2OYRA 3H1FA 4Q9AA 1JFFA 1GPKA 1C9MA 1G3MA 1GT91 2HQRA 3RR2A 3ZGNA 5BSHA 1EDZA 1VMEA 3LD9A 4CLDA 1WHSA 2OBMA 3SMVA 2H4JA 2YOGA 1ORIA 1PEKE 3LOUA 5F64A 1QHEA 3E7XA 4X91A 3C6QA 4Y2SA 5K3SA 5F52A 2C0PA 2NTEA 4GD3Q 3K2ZA 2XOKA 2XGEA 3MERA 1OISA 3D6MA 2XCQA 1D2MA 3HJHA 1RM3A 3N2LA 4XB6B 5JVTA 1SVIA 3GAAA 4GRAA 4TS9A 4E5VA 3WADA 1YR8A 1YRLA 1L4LA 2JFNA 3PIPF 1FEZA 3KLOA 1QPIA 1W85A 1R5ID 2BKVA 1HDDC 1L4EA 1UG2A 2XMQA 1ZVKA 3DZDA 3O3NB 4KQEA 4P7GA 3OQOA 4ZWNA 3UANA 4AZ0B 4AZ3A 1RRJA 2J8ZA 4IIYA 4R6WA 9GPBA 2XBMA 3ZBTA 4TKUB 1FTQA 1G20B 3MSXA 2W24A 2Y69H 2Y48A 1DFHA 1JLMA 1LFDB 1P4RA 1T29A 2VXCA 2E1PA 2ZI3A 2HRDA 1T2KA 1WKBA 4FHFA 4C3OB 1Y7PA 3MMZA 3GP3A 2CLDX 4G89A 3CCEI 5T41A 1QBGA 2XNDA 3W6JB 3IUQA 5BO5A 3Q6IA 1TQDA 4Y7NJ 1EJ0A 2E4XA 1HE2A 2IH5A 3DW1X 4YR9A 3H75A 3ROUA 4D81A 5JAIA 1IV6A 2OHXA 3ZI4A 1V5WA 5CXSA 4NQWB 3ICQB 3HOTA 4CR8A 1U0LA 2E55A 2OTCA 2PRJA 1M6HA 1VIMA 3CLTC 3GDWA 3V7WA 1WD5A 3FBGA 4A5OA 1W9HA 3NHBA 2HMSA 3FF5A 3OR1C 2Q2WA 2G07A 4KTTE 4OD0A 4PXSA 3ZG6A 3O0TA 1O87A 4BBZA 4M3DA 1D0ZA 2GHRA 3MS4A 3RC7A 4LC9A 1U7TA 4EYQA 1X7XA 2O6HA 4RPLA 5CG1A 2YC2C 4QOSA 5KS2A 1N8TA 3V48A 1CY4A 4PVDA 4RIEA 3IC5A 1OILA 2WMDA 4EG0A 1VA5A 2H51A 3LP6A 4DZZA 2MINA 3A01B 4JXJA 4MS3B 1KMHB 4MVJI 4UUBA 5E9QA 3WB2A 3FHTA 1W0JD 1U2QA 1WKVA 2GXSA 4C9YA 4G8DA 4GR9A 4R54A 4UQOA 1C9YA 1JG4A 4KCGA 4DBRA 4TROA 3ZGVA 3WGUA 3SDBA 3B6KA 5C1PA 2B34A 3MT7A 4IIXA 3WHBA 2CLEB 1FOYA 1UBSB 3E7LA 3ANXA 2VA9A 4FI3C 5TVGA 3THYB 4WADA 4C07A 4TLAA 1PHRA 1UK8A 2V9CA 3PHGA 3BFJA 4S12A 2MWMA 5KTOA 4F2PA 1BOFA 3G7NA 1YS6A 3ZMZA 3OM8A 2YBEA 4GX5A 4WZBE 3B82A 1ONNA 2FK8A 1PJTA 2YH2A 5FWNA 5J2TB 3CVXA 3IB6A 4RWEA 4BFWA 2Z3YA 5HJ2A 2DWCA 1RZ4A 1SCKA 3FZYA 4FCYA 4X7MA 1T0BA 2Z9DA 3PNKA 2O03A 4ZV7A 2X6WA 3LSTA 4KQFA 1A8SA 1EUZA 1ZKMA 2W6NA 4MKZA 4ZJUA 4D9EA 4PONA 1BE1A 2AR7A 4DIKA 3S28A 4ZQGA 1IY9A 2Q62A 2EEZA 4Q3DA 5TXGA 3W78A 4B3HA 3CZ5A 4WVLA 2I3AA 4AM8A 4BZWA 2CBZA 1F38A 3W3AD 4C0WA 4DCPA 2WJ6A 4YMHA 3QYEA 4WFJA 2QZSA 1GKIA 2PT7A 3T5PA 1X1QA 1N2XA 4JJ8A 4IOAF 4UM9B 4FC7A 1Q14A 2A07F 1JR2A 2X4DA 5IT9K 1H8ED 1QCDA 4Y2VA 4WFKA 3UUGA 4BHPA 3NIDB 1ZU5A 4ZAXA 3ESCA 3O7MA 3QKRA 1H42A 1I5OA 3HUUA 3JQBC 4TV8B 1TT0A 2K4BA 2FMKA 2O0MA 2XYHA 4M22A 1JZQA 3K1YA 2F62A 2M9HA 2FWJA 1VQPI 2IYOA 2Q5QA 4N01A 4TTQA 4CR7A 5ALVA 1RAGA 4DR5B 2EP8A 3VHLB 3G73A 2PJUA 3CCVI 4QLCU 2IRFG 2E18A 3O4JA 3EG5A 4FYWA 2HPHA 4EQQA 2JGJA 1O5TA 3NKVA 4W9RA 3RTBA 2C0CA 4Y6QA 3EQ2A 1VJ0A 4CDGA 2Z6VA 3WK4A 1VLJA 3EJWA 3O91A 4BQFA 4OAYA 4HNAA 4N3NA 3ZLTA 1UBTS 3U7RA 2G1UA 3B2QA 1ONSA 2GARA 3QWIA 4XUGB 1GPLA 2BHLA 5IWAB 5AJUA 3BDDA 3GZJA 3L2UA 1T9GS 3D8UA 4LGMA 3DXYA 4L3OA 1U8BA 3RBVA 3PSFA 1K6IA 1SKBA 4XIIA 2HBRA 3GUZA 1V3TA 4R4JA 3JQBA 4C3UA 3EPJA 2UZ4A 4E5NA 3KEMA 2H1LA 4MTDA 3QA9A 1P6RA 4IQ8A 1QAQA 2WYIA 5I7VA 2CJPA 3AH8A 1T5IA 1QVTA 2BAGA 3S3TA 2O5EA 1QZTA 1VFPA 3KTOA 4I5DA 3KXIA 4ZJZA 2BPOA 2H85A 1WE2A 2L7FP 2FQQA 3R6DA 4IIEA 2QPLA 4Q7JB 5DTRA 5L6MB 1YZQA 2IA0A 1VPLA 2DZDA 5ALEA 5G53C 4ER5A 1E2KA 1E6MA 1Z0ZA 1K8XB 4E2YA 2D5VA 1V11A 3F8TA 4ZAZA 5I4IA 1NPYA 1IOZA 2WSLA 2JJ2A 4RUKA 4U6QA 3PDHA 5LQAA 3W5DA 1MG0A 1YHNA 4NU5A 4CH7A 4TMXA 4AZTA 4H3SA 4PC1A 3L4KA 1AU7A 4DA4A 3L2CA 2ROQA 3B1WA 1G60A 5KVCA 2ZDHA 4EP1A 1QX4A 1UC4B 2XVZA 4NBLA 4X00A 1ZIOA 4NNJA 2XSZA 2N0SA 1JBEA 4DC9A 3UNGC 2XAQA 3MKLA 1R1DA 4V03A 5BNGA 4EATA 1QHSA 4G9GA 3DE1X 3KKLA 3HCEA 1IATA 1VBNA 2ZR7A 3QX8A 3VR4D 4OJTA 4CZ2A 1YHZA 1KI1A 4DCCA 1KJZA 2L7MP 1QG4A 1OLOA 4JP1A 4Q3CA 4G0MA 4JP5A 3VOTA 1XQYA 1CQIB 4YPVA 2C98A 2IOFK 1UFVA 4YMSA 3OIOA 4L3VA 1HQDA 4YJGB 1QYXA 5DTQA 1P75A 1KHHA 2XMZA 1G5PA 2ZP1A 3I2HA 3IR7A 2XNSA 3SEAA 3WA7A 2ZUEA 1ODSA 4UVBA 3GJSA 5EZQA 2BP7B 5D3MB 5FA8A 3TZHA 2YZ2A 4LFCB 3ZLBA 2I1LA 3MJHA 4GCVA 4KRXA 5HA5A 5EE9A 3TLGB 4MUGA 3FAZA 3H5NA 1PFUA 2I1VB 3FLAA 3NBUA 2ZBGA 4U3JB 5KWJA 1E8NA 4QO7A 3UMCA 2BV3A 3IWFA 2J3EA 3GI1A 2DODA 4R2XA 1PVEA 3FR7A 5JSHA 1JB9A 1BS2A 1TWAJ 4MUHA 4WZAA 2G7HA 2VBIA 1Z8HA 2DSNA 2F3RA 4WLEA 5D6EA 1ZH5A 2C4HA 4NOKA 4R9VA 1A7KA 3UJDA 3ZWBA 3EDQA 4J3FA 1WXEA 3BR2A 2BXZA 2QUKA 1BVHA 2QLBA 3OESA 1HSZA 3LSPA 2YYYA 5JHHB 1H3EA 4JOCA 1EU1A 1P6QA 2VZEA 2Q3CA 1EFUA 4PC7A 4R2MA 4JLDA 5G3ZA 1K78B 1I9GA 5K1ZA 5FNZA 4XRSG 4REMA 4GAEA 3AERA 3FBTA 4MA4A 3ZDZB 2VUUA 1WXQA 1YT5A 4EB6B 4W5OA 2DA2A 2QL5A 4HAIA 1JEJA 2OENG 3IUNA 1IY0A 1N0IA 1N2CA 4QYWA 3RV3A 3TR6A 4ZI7A 2LREA 5IC5A 4IQ4A 1JQ5A 2IPNA 2NZ8A 1X6VA 3VPSA 4LWOA 3OYFA 1GAEO 2B9VA 1TC3C 2IZ7A 5IT9Z 2FY8A 2PX5A 2RAPA 4ZVKA 4BFZA 2JA6J 3F6PA 5J4KA 1YL6A 2LY1A 5AVRA 3MWLA 1VPVA 3AEKB 2YPRA 5EJIA 5JMTA 1XLUA 2GD1O 1BCSA 4OKSA 4OHOA 2F90A 1I4EB 1YLFA 1A35A 1DO2A 3M2TA 4K6CA 2EIXA 4OGGA 3KSRA 3RS0A 5AVXA 3ICPA 2QD5A 4PSWA 5IDYA 3C74A 4PZPA 5JSKA 4I2NA 3R7WA 3ABLH 1LSOA 2HJGA 3GF4A 4TLCA 2I65A 4M86A 5ALYA 5CA0A 1HE1C 5TS2A 4Z53A 4IBOA 3RUPA 3ZVRA 2I7CA 3H2IA 5KOHB 2PIAA 1K7SN 2G8NA 1T8SA 2GPNA 3BTVA 3NT5A 4UEQA 3ERCA 4JR0A 5CJ2A 3QEAZ 4EZEA 4GIBA 2QD4A 2XE8A 3NKLA 5BNFA 1MMGA 2E4ZA 1JDNA 2IIVA 2OD5A 3F5MA 4HMPA 4RK6A 4DGQA 1P5RA 1FBUA 1XC7A 2ZB7A 2QVGA 3D4LA 3F9RA 4EM2A 4NMXB 4UDXX 5EEGA 1IU9A 1U98A 3WRYC 2PK3A 2RBKA 3HS3A 1FTYA 1XJCA 5TRDA 1UBLS 1TOAA 1NI4B 1FDSA 3CP2A 1I6LA 2OBXA 4U6SA 4C0SA 4PX2A 4CQJA 4BNJA 1XKTA 2G28A 2O07A 1WQ4A 2PU5A 2PV0A 3CRVA 1QIMA 2AIRA 3KT0A 3V1MA 4C1BA 3LLSA 1V1MA 5BV0A 3QI7A 5JS8A 3FWHA 1H2YA 5D5VB 1XVLA 2QENA 2WUDA 4WNAB 5KX5F 1WOMA 4IO9F 1XCGB 2WY8Q 1I5RA 2E82A 3ISVA 3O4GA 4Q7KA 4QGAA 2R1VB 3AF4A 3CINA 3H7IA 3P5BA 4HO1X 4QODA 2LV8A 4N47A 3BWXA 2IU0A 1ON1A 1E6CA 1MAAA 2D2IA 2HJHA 2JBAB 2JH3A 3N7UA 4G85A 2COBA 4NICA 3ZEAA 4BO0A 2XXAB 3NTOA 1I01A 2FSUA 1I0IA 2HMVA 1L5KA 1NP3A 5G1NA 2OHOA 4GE0A 2MR6A 1J20A 1GCGA 1QOQB 4Q66C 2WJPA 1RXWA 1AQYA 2IT0A 3CCSI 4OMYA 2GCOA 3F4LA 2WA0A 1SWVA 4FEGA 5E2BA 4BMXA 1N7JA 3LYAA 1RFGE 1T56A 1XYGA 4QECA 3ZU2A 2AXLA 3KQOA 1M2OA 1EJ2A 1Z0UA 1GR0A 2C04A 4HQEA 2RHGB 5ELLA 2MYUA 4OHPA 1ULZA 1RP1A 4JUCA 5EHIA 2H65A 1R3UA 1MAWA 2RGNC 4RD1A 4RBNA 3SLGA 3CT4A 1THZA 2DKOA 3QOPA 5HLHA 3BMCB 4EDFA 4X95A 1SURA 4CEHB 2Y68A 1N9GA 1IY2A 3KR9A 3PKJA 4OU4A 2GO7A 4NYMQ 4UCQA 1U8EA 3M33A 4KHZA 3U3MA 4Z49A 1GILA 1W88A 3E2IA 2BR5A 2XUAA 4FWBA 1ZGGA 1FP1D 4R40A 1YTYA 3OECA 4TSFD 5CT4A 2XRFA 3WZLA 1HKHA 5GADl 3WLJA 4HADA 1U0SY 4I99A 2LKCA 4TPKA 1IWPB 1NN0A 4MVJA 1DFIA 4BUZA 2GB4A 1E66A 1Z1DA 2GM3A 1X19A 5D5XB 1ZCJA 4NMWA 2OBFA 2OQRA 1N4AA 4PK4A 3ITEA 4C22A 4WBNB 4RM2A 3FKIJ 1AQIA 1TMOA 2B6HA 3N76A 4S1WA 2LFBA 2JIMA 5JSQA 3MJFA 3HUGB 4L9JA 1PYDA 1QHHA 2RJOA 5KNBH 3TOSA 2I10A 1H2RS 4I5FA 3KEQA 3NARA 4LY0A 1QMGA 3OP4A 4BMYA 3OIUA 4PRKA 3VPCA 4KJZA 3SEZA 2WHXA 1ZMTA 2LF8A 3QG5A 4GGPA 3TWOA 4F2DA 1KWKA 1LE8B 5DNEA 5K7FA 2G1KA 4V0LA 1HLPA 5EVJA 4X1KB 2YY6A 4AJJA 3M3HA 5ULLA 4AWXB 1JKOC 1TUIA 4QTTB 1KY5A 4PG8A 1NMYA 2L02A 2JD1A 3N70A 1E9BA 3PXEA 5WRFA 1IRGA 3T7EA 3EF3A 1XTUA 2J0QA 4D98A 4KR0A 5F73A 1JIVA 2OWEA 3K96A 3OKAA 4AP5A 1MABA 2FZCA 3NKFA 2FSVA 1LCIA 1YJAA 3FB1A 5EJ9A 1EFVB 4Z1OA 4ML3A 3SMQA 2HYIC 3IIIA 4EG3A 4NG5A 1T3GA 1UOEA 2O06A 2M45A 2PA0A 3CG4A 5G41A 4CJXA 1RI7A 4EB8A 1KTIA 2X3UA 2XT9A 2AG8A 4ZYTA 1C2TA 2LW7A 3DZGA 3T8YA 2R7KA 1IEXA 3DXXA 2WTUA 2OCLA 3Q2OA 4YRAA 1OI3A 1SCDA 4L6AA 1QBKC 1W5AA 3EETA 1AG9A 2A3NA 2ZKLA 4QUHA 3ZS9A 1AT1A 2NUAA 5EJEA 3BK1A 4ZCTA 2LOOA 1V4BA 2AUTA 1JKXA 2UUPA 5HOQA 4R7GA 1FSPA 1WCYA 3G71I 1YIDA 2FU4A 1CSEE 1I7LA 3O9MA 5JTUA 4L0MA 4DWVA 2YXBA 5C51B 2E49A 2FW0A 1ZFNA 1EX6A 2H0AA 2Q4RA 2K2WA 3SE7A 4C30A 5I7UA 3VODA 4HUQB 4LFAB 4ZTBA 4ZC3A 4IX9A 1GPDG 3WQRA 2FN9A 2R47A 4XQGA 3J81Z 5HKKD 3EH2A 2D0OB 5ALWA 1GDHA 2PPLA 3WQSB 1MUUA 3VYUB 3SF8B 3CVJA 1Q1HA 1C41A 4UXJA 2PVPA 1GU7A 2JDIA 4MDEA 5JS1A 1UMDB 3IODA 5E8JA 1YDWA 4URXR 2P5SA 1SAUA 1ZN9A 3W1EA 4DCGA 4I02A 2CXXA 1CY7A 3AFOA 4TUYB 5DNAA 1Y39A 1UM9B 3FSEA 2XNJA 3RD5A 4DRZA 4EFKA 3KHSA 3ABRB 1J2RA 3DYIA 1PKXA 3PL8A 2GFQA 3GGPA 1COWD 1SVNA 2W25A 4P84A 4ZYDA 2FPXA 4LI0A 5FUYA 3U7QB 5EJ5A 1SCUB 3AZOA 4ZO4A 3HBJA 1HQKA 5C3EJ 2OSBA 5AYVA 1WPGA 2OLEA 3C3AA 3EULA 1K5HA 4RC9A 4Q93A 2QB5A 1JSZA 3LFTA 2POCA 3VXKA 1LKZA 2X7JA 5T67A 4LYFA 1D0YA 4P54A 5AI8A 4BE1A 4TMYA 4EJOA 4XCQA 5ERIA 3H16A 4TTSA 1D2RA 1B8NA 1IN4A 2OM6A 4HDOB 4IVRA 5LA6B 1MC8A 4O4IA 4NABA 2AX4A 3DEFA 2AE1A 4ZVLA 1DNPA 3BMOB 1JTEA 3BM5A 4P93A 4UV9A 1DCMA 1PUJA 1UIMA 3EFOA 2E5WA 3ROTA 4I7HA 4CF6A 4ITVA 1WJAA 2CMGA 3LVQE 2JI6A 4KICA 2VUMJ 3HCNA 3R3HA 3VVCA 5HZMA 1RR6A 1J8MF 4EJSC 5HKBA 1Q0ZA 1UXIA 2PA3A 2ZJ0A 3A1YA 4Z6KA 1XJ5A 4FYIA 1KSHA 5JXHA 1E5VA 2L2OA 1OXUA 1W9MA 5DI3B 4GGOA 5F33A 1UZUA 1CD5A 5AM0A 4Y2XA 4ZT7A 5GONF 3SK0A 4DC0A 4G7ZF 1SIWA 1J24A 1GXSA 1IXYA 3A04A 3DFFA 1ZK8A 3RC9A 4YH1A 1WP9A 3HZRA 1BFKA 3DT6A 5JLJA 2BGUA 5TF0A 4JJ6A 2H0QA 4MI3A 3ZHQA 4TL7A 4BU1A 1BHO1 2ONKA 4OBWA 3PO2J 1D04A 2AXNA 5ALDA 2RB4A 4D8XA 5FQNA 4R8SA 3RIRA 1WA5A 3LBHA 3SFTA 4XN0A 2LY9A 3DFGA 5A4KA 5H9WA 4H1VA 3KCCA 4XORA 2C29D 3PPWA 4RF4A 1NP6A 3ZPXA 3WGGA 2X22A 5EHNA 1ORDA 2DCUA 3U3DA 8LDHA 1IB0A 1F4PA 2AW5A 4N4AA 2CLOB 1I5EA 5DT2A 4ETSA 3HK2A 2X9GA 1PEYA 3L2RA 3ZNNA 2K4MA 4LQCA 5P8WA 1O6GA 3FTQA 2C5SA 4GI3A 1DS6A 2NNWB 1UDBA 3TRKA 2D54A 1U02A 2O7SA 3WO1A 3ELBA 5HE8A 2L0KA 4F3TA 3BSWA 1OXSC 3LPDA 3IT1A 4UTOA 3KTFA 3R0ZA 1FTWA 5IC6A 3ZIAD 4X7PA 4BNGA 3HVUA 1OKRA 2AK2A 4RH0A 4PLCA 1TJNA 3W8RA 1MMSA 4D80A 1W36D 3NWJA 4W6QA 3BVPA 1ENZA 4UD2A 3E35A 2Z98A 4P83A 1PDNC 3DTEA 3FB4A 1JG6A 4L9SA 4JY7A 4KWIA 4UAGA 5C8YB 3BG5A 2QZJA 1ZNQO 3ESBA 3FUVA 1Q7RA 1GCIA 1O4WA 1QQTA 3GNSA 3P71T 3QQ5A 2FX3A 1QHXA 3SLKA 4HTAA 4X3CA 1T15A 2PX9A 3CM0A 1L1FA 1RPWA 4ZTJA 1US8B 2EBHX 3HYSA 4JLKA 3U4HA 1K0UA 4JCOA 4BV8A 1DG3A 2O20A 2XQKA 1S7GA 3THOA 3FH0A 1NXTA 4WZAE 1OXVA 2MSDB 2ZBFA 3KL2A 4XD7A 4BVFA 1JUMA 1RIFA 3QTLA 3IPYA 1GNRA 3EQ6A 2DKFA 4URWR 4IOMA 2ME6A 5IJ0B 5BYJA 1R0LA 1ZMBA 4BUCA 3TLAA 1I7NA 1R6BX 4AI6A 1KBQA 3OOSA 1ECFA 3GEHA 5DN6A 1FTGA 1DBPA 3SFVA 4F6LA 3HYNA 1GQQA 1IB6A 2VJMA 3M89A 4MW0A 4DIUA 4HVCA 2IHVA 2RCNA 1WGXA 1U7UA 4MR7B 2JANA 4XQFA 2AD1A 4UTPA 2PZEA 5BN5B 3I37X 5DTMA 1XLVA 4QPNA 5FFNA 2PTHA 2AHOA 3OFND 2XEDA 5DWQA 2DA6A 4CM9A 2FDCA 3TMYA 1NUSA 2WHEA 5HVNA 4FX4A 3A1EA 2ZYSA 4ENVA 4KPUB 2OGSA 3D8BA 1TT5B 5KTNA 2H4ZA 2NVUB 2HREA 1M8GA 1WHTB 4URUR 4B83A 1Y6FA 2GTIA 1G5RA 3EYAA 5JAUA 3V2IA 2JIZA 1K61A 2XB5A 1FJLA 16PKA 5EKTA 4IEFB 5A4FS 4P4NA 2LKSA 4MDYA 1NWHA 3ECSA 5FHQA 2F5EA 1LTKA 5I9TA 2PRSA 2RQQA 3GMEA 2Z33A 3T7DA 5H4GA 3V8LA 4X1OA 3MAJA 5CPBA 3S2FA 4ERXA 2EFNA 4CIAA 4NFYA 5J5AA 3WB0A 1VHWA 5A7GA 2IOFA 2XGCA 3BKXA 2CD9A 1DQPA 1Z22A 3HYIA 2KLOA 4JKOA 1F1BA 1P1JA 2A05A 2HU9A 5JS7A 3PFWO 3EPLA 4N0MA 1RZRD 1KJWA 5EZYF 4A8HA 2WD8A 1SAYA 5DGCA 5GIOE 4P3PA 4JHLA 1USWA 2RE8A 5FFMA 2IBTA 4KFRA 1I4TD 3K69A 4UNRA 3UPTA 3LBFA 4BTVA 1VQ9I 2VDJA 3JVUA 4YIHA 5BYKA 4I36A 2JD2A 4PSUA 5LP6F 2VDMB 1GUUA 4WLVA 3D54D 5IF3A 4OIPF 5DNCA 4HUJA 2TCTA 4WDRA 1YRNA 5LGUA 3ZQUA 2JK3A 2BY1A 2ZRMA 4XLEA 3B6ZA 2N75A 1Q21A 2GAAA 3IAXA 4LTNA 3G7UA 1KU6A 3DZ8A 5ARDA 1XPXA 4NU0A 5DWDA 2ZM6B 3TP3A 4NFSA 4B6RA 3VKFA 1W88B 1FSSA 4WKPA 1Q3TA 4TMZA 1R10A 2P78A 2B8EA 1OB5A 2X4GA 3W1WA 5ILSA 4J0CA 5G3YA 5BSTA 3FDFA 1BDJA 1WCMJ 1NXVA 3HKCB 3D7SA 4GNKA 3S70A 4MGEA 5FFFA 3TEFA 1NSTA 2R62A 2VKDA 1K4YA 2E3JA 2J4FA 2FGJA 4BEHA 1C3EA 3MYRA 1LSJA 3P7MA 3ND6A 3G02A 3VPAA 1AGRA 4DZTA 5KU7A 1TWGJ 4J19A 2GPTA 2W2OA 3BRQA 1XHLA 1AXEA 2C3YA 1LA2A 2FOXA 3KJNA 1KBZA 4PNZA 4WDQA 1Y4ZA 3IHWA 3AT1A 4F56A 1QR6A 3A2NA 4L85A 2UZ3A 3IC7A 3M8EA 4WBXC 2HOEA 4MZXA 3ME5A 4ZTZB 3SHTA 4PQGA 1GUDA 1T0PA 4UBOA 1BE8A 1EAMA 4YPOA 1WW3A 2QUZA 5I7HA 1GFSA 1JHFA 5D8KB 1Q91A 5AIBA 1FL9A 2O0YA 2DQLA 1E3IA 2RKHA 4N6OA 4QE3A 4XVUA 2WJYA 1LZLA 5KC9A 2A9OA 1KRWA 3FMRA 2V59A 4X6UA 2PKCA 3NT2A 2E5ZA 4D0RA 5GTDA 5JU6A 5EHGA 1R2QA 1VHLA 1FFDA 3AC0A 2C03A 1NLYA 1B1BA 4AO8A 3NTLA 3QNUA 2E21A 2ODBA 1T1SA 3QW4B 4O0MA 5EA2A 4KVGA 5DW0A 4J6FA 3NHUA 3ZU3A 5JVDA 1VSVA 3KYCA 3T1TA 3GQBA 4B79A 3H0GJ 1RAFA 3DEJA 3QHAA 3EXHA 5ARCA 5KYGA 5IJ9B 1NHGA 3U6BA 3KQHA 1R4NA 1QTRA 2JFUA 1QZEA 4YRFA 1E92A 5ILGA 2EZKA 2DETA 3ZK8A 3DQVC 4DHWA 3ER9A 3EVGA 4TYMA 3QWLA 3RPUA 3MEQA 4O08A 4NCNA 3WIBA 2W2KA 1B0ZA 5LR6A 1OCZH 3CZ6A 1BE6A 3AX6A 3G8CA 2BFPA 1FVOA 3P9YA 1M34A 2VNAA 1L8LA 4JUAA 4HGYA 5FRDA 3J81A 1ACIA 1GGHA 3QUBA 4KREA 4L5EA 2Y1GA 4HPXB 5H80A 5AQEA 4Z4QA 1GUZA 3T34A 1CR4A 2CJWA 5EYPB 2PL1A 4YY3B 4QIHA 5AK6A 4YN3A 1J8FA 2EX1A 1JG2A 5GJWC 3W9UA 4ABTA 2X7HA 1PW7A 3DKIA 2QG9A 3DO6A 1B2LA 2BTEA 1XJ0A 1LKXA 1ACLA 3TL3A 4BLWA 3GMSA 4AXXA 2KRHA 4GVLA 3OD1A 2C96A 2NXWA 2DFDA 1A4IA 2P9HA 2FPPA 2V7WA 2GF9A 3HB0A 3HEAA 3OT5A 4V2UA 3PXUA 1SKMA 2OGZA 1EWRA 3EGXA 3ML6A 2QAGB 3L9XA 4QDTA 3ZN2A 2Z58A 3HN6A 3M6LA 2CNNA 1JEEA 2HLDD 3IIMA 5H16A 2Q3LA 4MUNA 5EPUA 5F1PA 1QE3A 4CCWA 2ZSIA 4EFMA 4RY9A 3HOVJ 1E5QA 1K6EA 2QQ0A 4J7XA 2K02A 2DWQA 3H17A 1X58A 5EGOA 4E70A 1U1GA 2Y67A 3V8NA 3IULA 4E21A 5IABA 3C1DA 2MMGA 2QSYA 4B46A 4BO5A 1S8NA 1K4TA 2VUTA 4HMOA 1J2XA 2NW6A 4K28A 4MQ4A 5CIWA 1XQ6A 3F2IA 5CLJA 2OTLI 2MD5A 4KIJA 2P4QA 3NDRA 1QONA 1FRFS 2H5JA 3CRQA 3I32A 3X2SA 4YP5A 1KK3A 3TM5A 5E79C 1PW5A 3H4MA 5E3LA 2L9NA 3U7EB 4TWAA 4YDSA 1DC5A 1NX9A 1QH8B 4AIKA 2XDAA 4HDSA 1R0RE 4HZFA 1OIWA 2HGCA 2FPLA 3NEJA 4RJKA 5CCDA 4YRDA 5KYYA 1U63A 1KKMA 3HRTA 1TTYA 4EPTA 5I7SA 3WAGA 4XEHA 1OZAA 4ARIA 4RD4A 3SBDA 3FBWA 3HCAA 2DO7A 1QKIA 4FGJA 1CR2A 1E3WA 4IOLA 4FM9A 1WKCA 1H9AA 1UKCA 2JC3A 3CF4A 3GJXC 1ID8A 1CUCA 4DJAA 1IXRC 2XYPA 3DULA 4K26A 4LE0A 4A3GJ 1A5TA 1EGAA 1QTNA 2I6QA 1E9FA 2IPMA 3LUFA 3TTUA 4B73A 4E08A 1S9HA 2MFZA 1GP2A 1LBSA 3EX7C 2WPDA 4TV8F 2CY0A 4KPFC 3BR6A 1NIPA 4JJGA 4D44A 2WZQA 2ZR0A 3FXLA 2XUKA 4IVQA 5FD8A 2NO4A 1A4UA 3FX2A 3UJCA 1P61B 4RVHA 5EPOA 3I04A 3K0FB 4JQYA 4EUFA 3A36A 1H65A 3TK1A 5CA1F 1QQAA 1KR2A 1VGQA 2LH9A 2GEJA 2CHGA 5EEAA 2HB6A 3OMWA 3ZR4B 2D2XA 1BXGB 5L9AA 2OUMA 1FFGA 2C99A 2PMWB 3GLHA 1VQ6I 3MJVA 4S24A 2JIDA 3HE3A 3HJGA 4I2VA 5HSGA 5K3CA 1KFKB 2GVNA 5F9MA 2WYHA 5CDYA 1QRRA 4ZOCA 3CVWA 4LC0A 2L9RA 3H35A 4NEHB 4GDMA 3OQ1A 3A03A 2E4WA 2EA2A 3LKDA 4E88A 3ZVKA 5EQTA 2PKEA 3JZMA 3P9SA 2ANCA 3U4AA 3M6IA 1ZELA 4NDNE 1DL5A 3BRSA 3WE2A 4GNRA 4O8CA 3SR0A 3BXPA 4GC5A 3EBOA 4TMWA 2IX3A 2C7QA 6PFKA 4QT0A 3JQQA 1R74A 2YX7A 4AN1A 3ZHBA 3O74A 4E1AA 4IF6A 3HXKA 5LZ2A 1KSJA 2KP6A 2NPIA 4NWIA 1CDDA 1I30A 5FJIA 4M3NA 1ST2A 3G79A 5L4NA 3WE3A 4D1QA 2MSEB 1U65A 2WUGA 4E3ZA 3WLQA 1B3BA 5B4UA 1H2BA 3MFYA 5KQRA 1N3IA 1W36C 1DKUA 2QJFA 4X64B 1WSAA 4HN4B 4UHCA 4C7OA 1IPEA 4OVKA 1YA6A 2OY0A 2HQAA 2C20A 2WJ3A 3EQ8A 2JRCA 1CY1A 4LJSA 5DD8A 2COEA 3Q8KA 1YZGA 3DWEX 4QXQA 4E7SA 5IM4A 4WHMA 2QLJA 3LXUX 1IDZA 4NOLA 2BHYA 2JT1A 3UNXA 3F8MA 4CO8A 4E1BA 3M7IA 3CMCO 5JAZA 1QFYA 1FFSA 1WWKA 1C0PA 1TPYA 3H86A 4F85A 1G4DA 3W9SA 2VT7A 3FDYA 1KJ8A 2JNWA 2JLBA 4CM5A 4FB4A 1YFZA 2C9CA 4ZDWA 5T3UA 5JUWA 1QRSA 4DMFA 1G21A 2H4YA 2XITA 5A3SA 5DV5A 2WTAA 4HF2A 4BIIA 5DBIA 3OX3A 1IOWA 4EKEA 4A6DA 4ON0A 2FBIA 5TJ9A 4CWAA 3NAZA 2IYUA 4OLFA 4BNHA 1EP9A 2Y6UA 4BKOA 4FONA 1VYUA 4PC2A 4EY4A 1SG9A 4BVBA 1K68A 1XELA 1CG6A 2RI6A 2XMRA 5TEWA 2XNHA 1T2FA 3LT2A 1GY8A 3QUAA 2NU8A 5HOOA 1FLDA 1O94C 1BI3A 1XVAA 1RR7A 3LUHA 4ICIA 4BO8A 1HC8A 1WPKA 4NESA 3TFWA 3B13B 3I2JA 5HCUA 1UZNA 4XARA 2H2GA 1NN1A 3GNQA 4W8HA 1G8JA 4LF8B 1C1HA 2JAWA 4QUBA 4CMAA 3F9KA 3CUQC 3G17A 3L0OA 4O0LA 1ZD3A 2HCRA 4OLJA 3NPAA 4EAAA 1YMQA 2HU5A 5I4CA 4AF6A 4WA7A 3K8OE 5HNHA 5LQJA 2ZSHB 1JIXA 1T4MA 2IU6A 5AOCA 4L9NA 2J9FB 4XM2A 1ZRDA 3AQIA 5CB8A 4MWZA 4PCUA 5A7FA 4J0IA 1R15A 3ZCRA 2H6CA 1YTUA 1NLMA 3TOBA 1OU0A 4FTWA 2GCGA 4U7WA 3FBIB 1ZK1A 2EWVA 4XEUA 4E0BA 3A9WA 3EGDA 1JR3D 3RK1A 3JZIA 1D2HA 2OO5C 1HKQA 4D4KA 5HFJA 3P96A 2CVPA 3IP1A 5HF8A 2FZKA 4L9WA 4W7HA 3BP8A 1G59A 4O5VA 1LLUA 2GM5A 3ABKH 5TJJA 2ORWA 3LXXA 4N41A 1J1ZA 2D1RA 5KCMA 2ERCA 3FGZA 2EZTA 1UFRA 5DLEA 4DAOA 1QYDA 1ISHA 2QWWA 4D74A 1LDKB 3D4OA 3QELA 2FRXA 2QTMA 2SICE 4L8VA 4RAGA 1XMQB 3S3OA 3FNEA 3QF7A 1FS5A 5TMPA 2CRGA 1XMSA 1XTIA 4KK4A 2QL6A 4KN6A 4ND8A 4D79A 4JYZA 3BJZA 1QDEA 3T1HB 2AJLI 1KE1A 4QJ4A 1NE7A 1QCZA 3UMRA 4BMZA 5EE5B 1QSGA 2H00A 3K0BA 3NALA 3PHIA 1JEOA 4P55A 3HSYA 1M75A 1XV5A 2C2YA 1VQNI 2INGX 2CYBA 4G97A 4S1OA 2VJOA 2HLPA 3ZWCA 4LB6B 2I7DA 2XUOA 1H0RA 1J2EA 2AN9A 3HHPA 5BP7A 1WR8A 1FFBA 3Q7QA 4B4CA 4GMGA 4KQCA 3PTZA 4YS6A 2AMYA 5G40A 3T8TA 3ROGA 3PR2B 1CEXA 2QYTA 3VNAA 2O8EB 3OM9A 1ZI9A 4H7HA 2XYQA 5G0TA 3OE4A 1MBFA 3V6MA 1NYTA 2C0QA 3A8TA 1J8VA 2H8GA 4JOSA 4BNXA 3NO4A 2JL1A 4BHCA 1A2KC 1TJ3A 3ILYA 3WC4A 3ZZMA 5FD5A 1HQYE 2NSLA 4MWCA 4OU5A 4PICA 3VTFA 4RK1A 5IARA 4CMEC 4D8VA 4UEOA 5DM70 1Z3IX 3RREA 1ZVVA 2VYVD 2I71A 4NP6A 4RL6A 1QYVA 1XZMA 2CXNA 5FO5A 2PLYA 1I1HA 2BUCA 3MN1A 4TSKA 1YO6A 2BM1A 4MS4A 1Z0XA 4TN1A 2EBUA 3D4IA 2FPWA 1UBFA 2OUIA 2ZS8A 4R98A 3DPLC 2DMNA 1SUDA 3RW9A 6ABPA 1X39A 1BWPA 1Q7TA 1W29A 3OWTA 1ZLYA 2GHQA 4KO2S 4OI2A 1CB7A 4MDFA 1CRZA 3AQ4A 3IXQA 4Y52J 4PGHA 2YNMC 4AJ2A 4DVGA 1U9ZA 1G2QA 3G2PA 5U1PA 3TAHA 3SYNA 1KI6A 3ZGLA 2DTDA 3X0DA 4F8JA 3BA1A 1O89A 2YNMD 2MOKA 3AVOA 1CJUC 2LCFA 3G9UA 4XJXA 3HOUJ 1AKMA 3DEKA 1PVDA 3TLCA 2H1KA 3IV9A 1WF3A 3A6EA 4EW2A 2O8BA 1ZARA 2HXOA 5JYCA 3DZKA 5GP1A 2ISYA 4KIWA 4MJ7A 2L17A 3E15A 5K3FA 5KNCH 1J70A 2NTYC 3H0KA 3AIKA 3QXJA 3QYAA 1ZTRA 4PFSA 3RUCA 3ZU6A 4K9LA 2X9DA 4J00A 2DU8A 1XTJA 2B83A 1WPQA 1R6TA 5KPDA 3J7ZI 5TC4A 2VPRA 1A82A 3F7MA 1U2GC 5FOVA 1FIUA 2JJ1D 4CKWA 1G2PA 5CDSA 1ZRHA 3EE6A 2VRCA 1K6YA 2Q1YA 4I5IA 1P9QC 2Y9ZA 4MHTA 3MCTA 4JQCA 4PZ9A 1SRRA 2EIJH 5DB4A 5AHWA 5KHLB 5KMGB 2TSYB 2SBTA 3BRWD 1A9PA 4K6FA 5KQSA 2B4TO 3QBDA 1QPMA 4XRFA 4HAMA 1FXSA 1U90A 2I6UA 4MARA 3HUDA 1SKQA 1U0BB 3R5JA 4Z99A 4M6WB 1GPUA 4KV7A 3RC8A 1JFRA 1N2EA 4UPDA 3TINA 3OKFA 3AEUA 4LOAA 3GLRA 4FW8A 2JCXA 1XKXA 4ETNA 4JJ7A 3CW2A 4B3SB 3BR1A 2OLJA 3CCMI 1O3SA 4IS2A 4Q3AA 4ENSA 1SD4A 4QOIA 2F2EA 2PUFA 1UL1X 3K9LA 2L7ZA 2Z9OA 1GL6A 1PS0A 1IZ7A 2XNDD 1RQLA 2QAGA 3LXMA 1NUUA 2V79A 3MWGA 4HWPA 5E6RA 5BSFA 4LSGA 4HNUA 1R4MB 1UWVA 1USIA 3GEEA 3ITDA 3OQVA 5JFTA 1AKHA 1PG5A 2VAWA 1E69A 1D8KA 2XNKA 4BMVA 1TAQA 3FUTA 1ISFA 1SBHA 4FFLA 1ZSYA 4NJMB 4RF3A 2DQSA 2OEPA 3D0QA 3EIUA 5IUKC 3ZZTA 5BQ3A 3AVUA 4RHEA 1RYHA 3QPBA 4HWOA 3RVBA 3TD9A 4KX3A 3BH7A 5BW8A 3ZIAA 3MZ8A 1ENPA 2AXEA 2VRNA 4I8DA 3R9WA 2P1ZA 1PR3A 2A0UA 4CG2A 4ZFNA 4ZV4A 1NG7A 4O4JF 3ZMTA 4AC9A 4U9IS 4Z51A 3ABTA 3QOWA 5ICEA 2PYIA 1KDVA 4B81A 2YV5A 2DQ4A 4I50B 2DR3A 1JPUA 4YT5A 1RYNA 4DIDA 4EX6A 3ZHVA 5L4SA 3UCXA 2ACJA 2HDNB 4ZMSA 1YWGO 3CE9A 2M6KA 3E1GA 2RGBA 1BN7A 1XYVA 2NO0A 1NYQA 5DYIA 4U0YA 4DMRA 1AS3A 3A6FA 1BCRB 1N1MA 3OFJA 1VIAA 4OXKA 1OWPA 3OJOA 3R3UA 2DHEA 1SBYA 2C7VA 1FFXB 1AO3A 3FFXA 2F1RA 4FE3A 4IUDS 2VKHA 3TE7A 4A2CA 1CP2A 3T7KA 4ANFA 3W0LB 4A9AA 2X0EA 2Y1WA 4G0OA 2VQ6A 1U9JA 4QREA 3W5CA 1B6GA 2HBYA 2WMOB 3I2KA 2TDXA 2LIPA 3GG2A 3HY6A 3L07A 4XD2A 5D1NA 3W3ZB 4YRMA 3TLKA 4ZIRB 3KUXA 1KQOA 3OLZA 1JDZA 4RVFA 2IYPA 1Z4IA 5NULA 5DP2A 3ESYA 2EQBA 2V6CA 2Z4RA 5EJ4A 3KELA 5IXJA 3BXXA 3CKYA 3QXSA 2OO7A 3HGTA 3P2EA 1P1BA 1THTA 2JJQA 1TQPA 2B78A 1LV8A 4YFYA 4PSCA 5I47A 2L01A 3AG2H 4ZGWA 4FMPA 4W4TA 3RUAA 3BAZA 5GQSA 3O8QA 3C4JA 3R7FA 1QOPB 4OXNA 3WTSC 1LPBB 4HH1A 2YX1A 5L40A 2YWRA 3D4NA 3M07A 2Z8YM 2IBMA 5KSYA 1Q12A 1LI5A 2ESRA 2W6ZA 3FCEA 2OQVA 1P8JA 1SKYB 1TU4A 3A02A 3HB1A 2NP6A 5F0FA 1GRVA 1T2EA 4I1YA 4G5SA 1GCAA 2VJDA 5ALSA 5EZ6B 3CRMA 5HWSA 1FFYA 1NV9A 2KQUA 2ID3A 4MVXA 1R6DA 5JD6A 1AKUA 1FU8A 4LK1F 1PAUA 5ILOA 1NQOA 3QPAA 4TYWA 2CBXA 2PCJA 5CGQB 3I54A 4BTEA 4R69A 1SUWA 1UDCA 2JPDA 2QYHA 2VK4A 2PANA 2IPLA 2VPQA 3DO5A 3LZDA 3OPXA 4PNHA 2M4KA 3FNGA 3MT0A 3KFXA 2PI0A 2FR0A 4UUNA 4V0SA 2OZLA 4N03A 3VPXA 1W7PD 1JPNA 3H9CA 3OT4A 3QP9A 2PUEA 2W84A 3ZWVA 1SVLA 3ZGKA 2BGIA 4W8OA 3I4LA 2PZLA 3LWNA 1PQUA 3DFMA 4ZHQA 1I94B 3EW9A 1ESEA 2XZTA 1OLUB 3DBRB 3F74A 2XF6A 4HFMA 4MLDA 2EZ4A 2DTRA 2GOMA 1XDGA 1XRJA 3FJOA 3U4QB 3AR9A 3M8KA 2OXIA 5JVGF 3KRTA 4L3WA 1U9OA 1UP7A 4WN9B 4YB8A 4AURA 1E1QA 1G3TA 2E7XA 1T95A 5D4SA 1WIWA 1WXXA 1YK1A 3MWYW 1Y1VJ 1QB8A 1VSBA 1UMBB 2IIQA 2Y4OA 3IPLA 1MX1A 2HMAA 2CK3D 1EQAA 5M5WJ 1AZWA 2V1NA 2W2LA 3V7SA 3CFYA 3N39C 3NH9A 3Q7PA 5KREA 3ABUA 4ALNA 3F4BA 4MQ6A 1Z9BA 4OHKA 1RKTA 2L54A 2O1SA 3ETGA 3RKUA 1CS0B 2ZFUA 2HHJA 1U11A 3KVYA 3V4OA 3V4FA 1W4MA 1Z8NA 3I0ZA 3T41A 2IA5A 2H63A 4G1CA 3TL6A 1X3LA 1P7PA 5IKPA 1K7XB 2X23A 3WMEA 1YIAA 4NPCA 3WMWA 3ZV5A 1QHYA 1TWCJ 1RM4A 2NO7A 3KXPA 4Q12A 2C82A 3HB9A 4RH3A 4BP8A 2CVQA 1TEHA 2DMPA 2IEBA 1ISGA 2VCHA 4QQRA 2FMLA 1SD1A 2L2QA 5DXFA 5KYUA 3INYA 1P8AA 2AN5A 2VP0A 2ZRDA 5SY6A 1D5WA 4KAXA 4MP8A 4BOYA 3FCYA 5F9HA 4ZDOA 1LRJA 2QTNA 4C4TA 1J56A 1IBRA 4QAQA 4EO7A 4GXQA 4OLAA 4HLYA 1KEPA 1SXJD 4HDMA 5H81A 2D2VA 1TZKA 3K9HA 2Y9PB 4Q7LA 1HT1E 1JKJB 4CM9D 4QVGA 4E13A 1FVFA 3CPEA 4BNVA 2ZQZA 4QGBA 5FKKA 2QVBA 2ESNA 3DLLF 2SNIE 1NF3A 2AG1A 2JATA 2QM0A 3FUUA 4BY1J 3GPCA 4LJLA 1P1KA 1Z13A 3SIRA 4DBZA 3ZVNA 1XVTA 3FCUB 1B6AA 2X1CA 4J90A 5H8WA 1U8UA 1NBHA 1Y4UA 1NF9A 2JFOA 3ONDA 4NAVA 4OX9B 1YBHA 4CIXA 2EFQA 3AL3A 1JBQA 1KERA 2BT4A 1TX4B 4YI5A 1PZNA 3QEMA 4QKQA 3WRXA 5K6AC 2IXTA 3B85A 1LNZA 4NMLA 5JD5A 3U9GA 4RHCA 3GLFE 5I45A 1CY8A 3KALA 4F38A 4B6SA 1AZLA 2WRZA 1NH3A 3G2KA 4QL3A 3LM8A 3V00A 3ZI0A 4JCCA 2RAEA 1Z3YA 3T5DA 4BP3A 1MKYA 3QYPA 3V8QA 2HDHA 1EKEA 5EIHA 4LIPD 4OYLA 1D5CA 1KQ8A 1E4OA 3DWFA 3T3IA 1MBGA 2VDRB 4D3YA 4ZCMA 2X9NA 1I4DD 3HV0A 2LR0A 3QQPA 4NH0A 3CQZJ 1GOTA 3HRSA 4NOJA 4E14A 4MPPA 3U2RA 3KR0A 2PWBA 2ZJ5A 1P7JA 3Q7RA 2OCKA 4NI5A 2GEUA 4OBEA 3BS4A 3X1WA 1C4WA 2VP4A 4JBNA 4DV2B 2YZNA 3DBOB 3CVOA 4IDDA 4K9QA 1WEKA 2DFPA 3FMQA 1YR3A 1P44A 4J2OA 4RDCA 4TLDA 2HQ1A 3FCOA 4DUYB 2BFCA 2C88A 2O05A 5L3VA 4BXOA 2WT4A 3CDHA 3SN6A 3DEYX 3MHTA 4MV1A 4M8IA 4ZQCB 3SJCA 3C6XA 2ZYVX 2PQMA 5K8TA 4WK0B 2HM7A 1I80A 4NC9A 3N4MA 2P1DA 2RARA 2Q4BA 3UF0A 1KSGA 1FJ2A 4ZKDA 1HYEA 1RMYA 1YIJI 3G8BA 4CTMA 4ZAYA 2GBFA 5EAIA 4FTHA 4QATA 1F5NA 1RC9A 1XSVA 3LWFA 1GG5A 3OA2A 1AIPA 2QW1A 2BY2A 1IMOA 1E8MA 1GLVA 3B3FA 3DMRA 4IV5A 1FMFA 1FPMA 3Q5GA 1FYLA 2R8OA 1L4YA 2AN4A 3B36A 1DQRA 1DPRA 3IUPA 5IHXA 1TCUA 2WIBA 5E2IA 4YUYA 1XZAA 2BWJA 2ZVDA 2B94A 1ZH8A 3CA8A 3OURA 5FA5A 2R6JA 4ZTUB 2A58A 3IP3A 2R5NA 4H4CA 4Q9JA 1KKLA 2VNKA 2XHZA 4NQZA 4AY5A 5INTA 3PUKA 2IW3A 1FYFA 1QGYA 3I62A 4DMLA 4MGZR 1JXQA 4TZTA 2X0IA 1Y6QA 3C3KA 4KJXA 4NV3A 1E17A 1P5ZB 2QRQA 3T9CA 2HTJA 5E8GA 1TVMA 1NVBA 2DYKA 1KH2A 2HEIA 2H09A 1MRNA 3OX1A 4JR1A 5BYBA 2NVYJ 3COVA 4CYCB 1T36A 4YP9A 4QBHA 2H2WA 3QOYA 4G1EB 2YIJA 4EB6A 1X1CA 5FD6A 1D7OA 2WB1A 3NP7A 3QVGA 4MUAA 1N2CB 3E22B 3SKXA 1KIMA 4JBWA 1ORHA 3LBAA 3TQOA 2EIKH 2VRCD 3ZJ4A 4DLYA 4G8CA 4ENKA 4YROA 2JARA 2Q4DA 3GO5A 3OY9A 3HB5X 3PR1A 5EC8A 1YQGA 3G1WA 4YV7A 5KYWB 3W6KB 3REOA 2J9RA 4LF4B 3N59A 2DTXA 4HH4A 5FA6A 2YSRA 2F1IA 1TK3A 1UOPA 3FOAA 1ZRSA 4F06A 2A57A 4DKJA 1TUGA 5K0JA 1GZUA 3B38A 3EF0A 1OFGA 1BMFD 3UFBA 5IN5A 4F4FA 4YRNA 3OQIA 1YI2I 1OD6A 2VJCA 2KIFA 3LUCA 4X1IB 4BFVA 4F4JA 5BN3B 5D5WB 2JB9A 3G6KA 4NZNA 5DM4A 4K2EA 1PFGA 3H9EO 3QODA 3DP7A 3EN0A 4LZWA 4KWEA 4CM8A 4E94A 2YINC 3E3AA 2AFIA 4DPLA 1KA8A 2FKNA 2VK8A 3KCQA 4HFRA 4MSUA 2DUUA 4INAA 4F6CA 3E3MA 1Z25A 2Z4TA 3DKYA 3NCTA 4D0GA 4EMSA 4FN4A 4J2TA 4DY6A 1ONPA 1DTSA 3ANTA 3D8TA 1ZD2P 2XOEA 3FVQA 1AOYA 1D4OA 1MO6A 1HFEL 1W5FA 3BBPA 4B17A 3HRKA 1RD4A 2HNBA 3PZRA 1E58A 4EO4A 1P45A 5E6RB 1OGJA 4R9SA 2WWWA 3COJA 4RJLA 2J5OA 4HK4A 5AW3A 1U2EA 1X87A 2XDQA 3M81A 1C8LA 2W2TA 3ZY5A 4RPIA 1MRZA 3O4RA 4CYDA 2NVTJ 2QTVA 1NXOA 3U9SA 1ODKA 1R0KA 2X6RA 3DQQA 3WTVC 3GB9A 4TMKA 2BW3B 3BT7A 3CH7A 1H2HA 3LHFA 1LLQA 5H2FC 2ISQA 4BNIA 3JRFA 5HP4A 4RZHA 1R0SA 4F5WA 1EF4A 5FKNA 2F43B 2ORVA 5L3DA 2FX5A 2NXJA 4N4NB 3FXAA 4AJ1A 3JQGB 2X2EA 1FZTA 2O0HA 1IDN1 3GMIA 4LTDA 4V0ME 4F5DA 1J1IA 2XHKA 2BI8A 1UBGA 1DG1G 1XFDA 3CLRC 3HXQA 4D26A 3EDCA 1I33A 2KZGA 2E35A 1FDWA 3KB1A 4K1LA 4Z0TA 3LI2A 2KJBA 2P0WA 1K3FA 2A0WA 2XE7A 3QLUC 4HKTA 5FI1B 1VKJA 3ECOA 1ORVA 3OTOB 4GWLA 3KB2A 2YMLA 4XVQA 4FSDA 4BFTA 3GBVA 3NASA 1KF0A 3PGKA 2GPSA 2PUBA 2O54A 1KZ1A 5CVVA 3LA2A 4I99C 5BOXA 3BCUA 1ZIPA 3V33A 1G41A 6Q21A 3LW8A 4A36A 4QBGB 3UHAA 2JAQA 4P3OA 4ZOLB 2DMRA 2ZXWH 4B80A 5ICMA 2ZZKA 1FFXA 4IVNA 4P58A 4FX0A 2DPMA 3P8ZA 3ZOKA 4MKRA 3UAOA 2JFQA 1ZGJA 4E09A 1FP4A 3E9YA 4D9MA 1YD7A 5C8YF 3QXHA 3AW9A 1X7WA 2UUAB 2ID4A 5FXMA 4DZPA 1M2HA 3IV6A 2HZTA 2FRDA 1PR1A 2X85A 4OHWA 3TUIC 1BX3A 1PLJA 1Z63A 2ZT7A 1E99A 1KXJA 3E5HA 2WUVA 2O1EA 3DLCA 3PLRA 1GCUA 3IKTA 1HDZA 1PLLA 2XTNA 2D0DA 5F1RA 1EX7A 2C4UA 1MQSA 2QUHA 3IDFA 3OYEA 2EARA 4LGWA 1LTQA 3T0YA 5G1OA 4OP2A 2GRAA 2FWPA 3SYMA 4Y6OA 1DJNA 2E0IA 3HM5A 4FC6A 3DGFC 1KU2A 3ERMA 3LLCA 1QHHB 5JDIA 4LY6A 1P1RA 1MIOA 2QLMA 3DF7A 4CEIA 1RI4A 1LBIA 2RG1A 4BO2A 5FFZA 5IWCA 1Z4QA 4UOZA 4LE2A 1CRWG 4O5AA 2DA3A 2HWVA 3IR5A 3KVNA 5AI6A 3PEYA 2PNFA 1GV1A 3FXRA 1C30A 3CJRA 3GZTB 4EARA 4DE5A 4OA5A 4IJ5A 3RFFA 5AVZA 5LOVA 3B02A 4C5CA 5CM8B 3VOEA 4HBZA 5T57A 3FISA 3TSOA 1MKMA 1QH0A 1T25A 1W52X 2Y71A 1DWUA 2HCTA 4KE6A 2W2NA 4BL5A 1KK0A 4U0KA 3JX9A 4HAOA 4RAFA 2VJQA 3OIGA 3Q8WA 2C54A 1VCMA 2EFPA 4HEA6 3RS4A 2XAJA 3BTCA 4HYEA 1ES9A 3THRA 5GGYA 1OVGA 4XUDA 3IERA 1VSUA 3K6SA 1BQ3A 2WY2D 3UO8B 4ZREA 4WACA 3CCUI 3INRA 3KZYA 4KQ2A 3W2GA 2WV0A 3WO0A 1DDGA 1CFJA 4JHXA 2O2JA 1P4HA 1PT8A 4YIIA 1EJ6A 3CUSA 3V1NA 4YXFA 5AOVA 3UJBA 3OE1A 3PQ4A 4JLBA 3HJFA 4LX8A 1GSOA 1UZAA 4YONB 3BXOA 5TGZA 1YB7A 3OZSA 3U1DA 1ODIA 1M74A 1U8XX 3A1NA 5BSWA 1RW4A 1Q17A 1NNI1 3R4VA 1P7VA 2OZEA 2XUQA 4RSHA 4P1ZA 4CLOA 2PX6A 2WU8A 3QMWA 4LHWA 1YL5A 3HZJA 4J2HA 4XYMA 2ZRHA 3DBHB 1QF7A 1N1DA 2J6BA 2ZXEA 3UT6A 4O59O 1FUYB 1FP6A 4DUGA 2DWOA 1EM6A 3K09C 2K3FA 3K2EA 5K9ZA 2JCSA 3DHVA 1E94E 2NU9A 4A5NA 2Z83A 2YX4A 4PINA 4BVHA 3QFRA 6PAXA 2BUBA 1UG0A 3B1XA 4XX0B 4KR2A 3VJRA 2PYDA 3A6KA 4HV6A 3QJ5A 1CULC 5DD4A 2AR0A 4PQYA 1L0OC 5B57C 4OO3A 4IQ0A 4GYJA 1YBVA 3CLVA 4RD3A 4WXHA 4F7WA 2WA2A 4R5MA 3HC7A 1DI0A 1Q3HA 1Y3HA 3DOHA 4GOXA 1WRJA 2POQX 5KYUB 3GLFB 4C3JJ 3G59A 1MBJA 1NK2P 1NW9B 2A9JA 3WK6A 2CNBA 1JEYA 1A9OA 2OR3A 1UK6A 3DL7A 1A97A 1YTLA 5LP6A 2FMIA 3T54A 1M1EB 1P1IA 2AZMA 3Q5DA 3WZ2A 1HH4A 4ABZA 5FAXA 2WIFA 2FE1A 1Y5LA 2IZ6A 2V45A 1WSDA 2DHCA 4YIKA 3R2JA 3P9XA 3CRNA 3REFA 5LLTA 3EB9A 1P9NA 1S7CA 2IF0A 2BEJA 4HGNA 2PS0A 2GS9A 2FK7A 3ANMA 3ZLVA 4ATNA 5JLWA 1K79A 1S4MA 5FRMA 3D2CA 3G49A 3VRHA 3LSRA 4LHEA 3W8EA 1O8CA 1GKLA 3HGMA 3GH3A 3B2NA 2J7PA 4KXFB 3L7MA 1AGYA 3F5QA 2C2ZA 3I9V2 3JQFA 4HA8A 5AJXA 1QCCA 3OZIA 1NTRA 5EEHA 1KH3A 1E1CA 2YY5A 2X4IA 4PPNA 3PSHA 4NRDA 1Z6YA 1SEUA 3GIDA 3KK0A 3EASA 4UHBA 4EHKA 4ZT6A 2GYVA 2JSCA 2Z1DA 1A9ZA 1EIZA 1VJ5A 3A01A 1KYQA 2QNRA 3GPBA 1TK9A 1V4NA 3STXA 5TLSA 1L3LA 3H1TA 3FHZA 2B61A 3H11B 3KSMA 5IEBA 1M0EA 1QV6A 1YRAA 4RGSA 2X3YA 4OREX 4LZLA 1U2TA 4MTEA 1LNQA 2FUEA 2QGFA 3HH8A 4TV9A 2MSNA 3TB6A 5K0LA 3WKDA 5LCXA 3OBIA 3IEVA 3DKXA 1IQRA 2OCIA 1EESA 1ZD8A 2AJBA 2VC2B 4ZZ2A 3NHWA 3HKBA 3HQ4O 1DEOA 3AG6A 2VATA 3DNFA 4X8OA 5EVCA 6AT1A 4PTZA 4DW8A 1GG2A 4OWRB 3E3LA 1R36A 3ZIDA 1LU9A 1IK6A 1NI3A 3DMTA 2OB1A 2VL8A 1MJBA 4L9RA 3TIVA 4YEJA 1H5NA 3F7OA 3RANA 4URVR 3SYLA 1I7SB 1GGEA 4LXGA 4M88A 5IU6A 3LT1A 4LPKA 5KVQA 4YAIA 4O2AF 1H2WA 2CB0A 4LEIA 3BJ6A 2STWA 4E6EA 5HS4A 2AJDA 1V45E 3DAYA 3QP5A 1PFQA 3DPTA 1PTKA 2QL9A 1ORRA 1G2OA 3ASOH 4NULA 4OKIA 1XP8A 5JO0A 5LJIA 1QZYA 3CCBA 4KLNA 3HTUA 5B5EC 3UFXB 2NNYA 1GZ4A 3PKIA 1W0TA 3I4MJ 3HFJA 4HB0A 4RXTA 2B2NA 4U39A 4Y2HA 1VLLA 3L0PA 3MTGA 3QTTA 4Q39A 3T5AA 1KYYA 1OAAA 1V7CA 2HADA 4JODA 3PHCA 5K6TA 3V1YA 3F8BA 1OIXA 3MGCA 1YRQA 1KJYA 1FUIA 1NJ2A 4D6YA 1DKPA 3KFLA 1P0QA 5BN4A 3D5SC 3E2MA 2JA7J 3MM4A 2Y0SN 4BP9A 4DL9A 5L3BA 2PRZA 2I33A 3EWAA 3DV9A 2JJ2D 3R6SA 2DMUA 3GRCA 4ER6A 1N75A 3QKIA 2V3VA 3C7DB 3FOWA 1TMYA 3T3HA 3QFCA 1I3OA 3HDQA 4A3MJ 2UZ1A 2RG7A 1GA4A 1TJYA 3RUDA 4GI2A 2VKQA 4LZOA 4DNOA 4H3HB 1YMUA 1U7ZA 1ZH2A 5AK3A 2XQVA 2C31A 3DV2A 4UVEA 5LN1A 1KU0A 1N2IA 4B3DA 2VNHA 3OQJA 4BJ6A 1F7VA 4Y30A 2HWWA 1QIIA 2FVYA 4IDEA 5K8JB 3H1EA 3TMOA 1K6XA 3M6WA 4UU8A 3AHJA 4PLYA 2X1EA 3N87A 2ZYTX 4MXDA 2DBRA 3PP8A 4NZ9A 3KVOA 3WGIA 5BN3A 2VOOA 3F5FA 3IAAA 3LHKA 5EQDA 4B3JA 4IH1A 4IL6C 1WY5A 1JHOA 2MIIA 4BDYA 2Z2IA 2Q6LA 2X3FA 3B6IA 3WV4A 2R0QC 1ZCFA 4WASA 4AW9A 3VSBA 2ZBDA 3U09A 4QFBA 3T52A 3DLBA 5GAEJ 1RTKA 2R66A 4ZDPA 3H04A 2X77A 1K88A 2QVLA 3JRNA 1E0KA 1T8UA 1UQTA 4OMDA 3GPDG 2BKXA 3TTSA 3FOFC 3WL5A 2P2ZA 4EJ2A 1JNXX 2H06A 1OTHA 4KPUA 3PX7A 2TECE 1PJBA 2H1CA 4NAUA 4WCVA 4CLEA 1R50A 4GHWA 2ZIWB 4JNKA 3LGSA 1YQEA 2IXAA 3IAEA 4LJ4A 4TLBA 3ZTTA 5J4HA 2VHZA 4ANJA 1IVYA 2IW1A 1GO2A 2C07A 4W82A 2NZUG 1KOJA 4LBYA 5FYQA 5CT6A 1RRKA 3EEOA 3D8SA 4IWNA 4B45A 2IXGA 4K88A 3E4CA 3REQA 3X1DA 4M87A 5K8VA 5FADA 1XMPA 3EZ6A 2Z2YA 2YHSA 4ITRC 5CK5A 2ZT8A 3JALB 4U5QA 5HG0A 2A5DA 4EJMA 2VDQB 3V6LA 1AN0A 1Z38A 1EFKA 3HCDA 4RV4A 2BKUA 5C3MA 2VLAA 1ZGAA 4OAQA 5J1YA 4EFNA 4LLLA 4M1ZA 3T1BA 3NRJA 4RD0A 4BEJA 1TDJA 3NHSA 4HB2A 4D0NA 3SVTA 4PJLA 3KZIC 4YWJA 4OFBA 4PQFA 3ZX4A 1O94D 2H6EA 1IJBA 4WCFA 2ZO4A 1DKLA 5HDKA 4JU9A 3T3GA 2OCCH 1VG0B 1LRLA 4LAFA 3LKBA 4WKOA 1C0LA