1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphofructokinase
publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
4JEMA 4LJRA 2IZ5A 3MAJA 3OPYA 3U39A 4OHRA 2F64A 3OPYB 4PFKA 3O8NA 3O8LA 4RH3A 3O8OA 1S2LA 4FYIA 2F67A 1S2DA 4I36A 4LJKA 4JELA 2Q4DA 1S3FA 4MEJA 4JENA 3QUAA 4FYHA 4U1RA 2PMBA 2Q4OA 1RCUA 4LJLA 4NPAA 4MCJA 1KZHA 4P5DA 2IZ6A 1WEKA 3UQZA 1F8YA 4I4IA 1PFKA 2A33A 2IZ7A 5AJTA 4KXLA 5AJUA 2F2TA 3K2QA 3SBXA 1MTOA 1YDHA 4OHBA 2KHZA 1ZXXA 3GH1A 2F62A 4KXMA 2A0KA 1S2GA 3HNOA 6PFKA 1S2IA 4P5EA 4KXNA 3BQ9A 4WL0A 4FYKA 1T35A 1F8XA 2HIGA 2PFKA 2F48A 2NX2A 4A3SA 1WEHA 3F5MA 4HX9A 2KLHA 4I7EA 3EHDA 3IMKA 3O8OB 3PFKA 5ITSA
chains in the Genus database with same CATH superfamily
3DAFA 1E2IA 3F7TA 3ZE1B 5G3YA 4G0MA 2DW4A 4RMNA 2C29D 1JKXA 1XMOB 3C24A 3HGTA 4KT5C 4YAIA 2RIPA 1DPGA 2IPMA 3BROA 2YJNA 2PUGA 2H1IA 4WEOA 1X3UA 4DLYA 1UPAA 4HH1A 4QXPA 2PGNA 1WHTB 4KIFA 2H92A 4YG2F 1GUFA 3G82C 4PQEA 3MVPA 4B3AA 5AJUA 1JH8A 1GG2A 1VE6A 1K8RA 4OJNA 5DWDA 3E18A 5EGOA 5FPYA 2A6PA 3JARB 1QTNA 1NXVA 3A4VA 1O9HA 3ZJYA 2X0EA 4B6SA 1L5NA 3GTPJ 1VM6A 3FCXA 5F5LA 1GLGA 3K05A 3DMRA 4GX2A 3JZIA 2HYDA 2OE2A 1JEEA 1XAIA 4M38A 3REQA 3QFSA 5E1WA 2J9ZB 2WUEA 4FOPA 4TTSA 3LYUA 5FUVA 1OH5A 4OGKA 5ARBA 3O2QB 2PN1A 2PL1A 1TWGJ 2RQPA 3JPYA 5LMUB 3I6ZA 2W8BA 3WHLA 3H35A 3LKZA 2HA2A 2OTJI 3OLZA 3MMZA 3L2WA 3WSWA 5CFOA 1SAYA 5K0LA 5J8CA 3QUAA 4JA2A 3WNBA 4TXLA 4IRGA 5L3CA 2H7VA 4ZC1A 4IHSA 3DT8A 2FXVA 1DPFA 1VKRA 1KXZA 1XZBA 1H1TA 2GBCA 5AI4A 5LRRA 5JCJA 3H6GA 1UWVA 4BQFA 1IBLB 1NE7A 2OEPA 4BP3A 4R98A 1UZLA 5EKXA 1U0SY 4A5SA 3I1IA 4KO8A 2VYND 3RIHA 1JALA 2AG0A 2EZ4A 4FX5A 1UIMA 2F1HA 4OMFG 2R7NA 3UJHA 1ZUHA 3D2LA 3MSXA 4ZO8A 2W7NA 3RKXA 2QG6A 4XKJA 2WT4A 4DKJA 1VBMA 1TP4A 3DB2A 4TXNA 4IMJB 3R5TA 2M3AA 2JGDB 3FN4A 5A04A 5HNHA 2CMGA 1Q0ZA 4CQNA 4BO0A 2NVBA 5L3DA 5NLLA 3JSXA 1ZKMA 4LGWA 3W34A 2J0QA 3CJRB 4LSWA 2X6YA 3I4LA 2ZB3A 4X65B 1NVAA 2VJMA 5JU6A 4XD7D 3OTGA 3G5AA 4NK4A 3THXA 3TCNA 1YTUA 3IWZA 2HGZA 4DG5A 4X8LA 1MT0A 4JLUA 4QDTA 1FX0A 3WFIA 4KIUA 4BFUA 1SR8A 2TDXA 2ZVPX 1CDZA 5J4KA 4E7ZA 3V4VB 1YJQA 1AZTA 1RUOA 2CMPA 1OX4B 1XPXA 2Y9YA 5EIFA 4Y2TA 3K0EA 1VI5A 4NDLA 4CT4B 1V95A 3DTVA 2HWYA 3UKDA 4OMZA 4DV5B 4C4YA 3MN1A 1G66A 4EUNA 4E7KA 1ZLXA 3MTBA 4BQNA 2Y0SN 3I62A 3BFKA 1RXWA 2FHSA 2DTRA 1C3OA 5DHUA 1RC9A 4EJFA 1N2EA 2XGOA 2JH3A 4PBRA 4MR8B 4UVAA 2XMBA 4OI2A 3SYKA 3W2IA 2V1UA 3FOAA 4H1UA 4G0XA 3E1SA 1EBFA 4DDUA 3V32A 3LUCA 2J33A 4PN7A 3F5DA 2EZKA 4TKVB 2XVYA 4MYHA 4NPHA 2SECE 4FMDB 2CUEA 2H6BA 2DFKB 4OSEA 3AP3A 4CWAA 1BEEA 4XLPF 1JTVA 2I78A 1AQJA 4XLFA 3ZU3A 4IR7A 1ESEA 1R6TA 5DNEA 2B78A 4RPJA 1UT5A 4ZVKA 3ZOBA 3RSCA 1TJPB 2XXAB 2XUPA 2V7PA 1X7DA 1DIAA 2R8ZA 4EATA 1LDKB 4DR5B 4RVDA 1P4WA 2OV1A 2NNNA 1DBQA 5DM0A 3UTDA 2DK8A 1ULHA 1FRVA 2F9MA 4Q7QA 1UT6A 3S2HJ 1B16A 1MH4A 1JJ7A 1BDHA 1NF2A 2VYQA 2Y1CA 3RB8A 4GBED 4K9SA 1YASA 2KQRA 4XWAA 3W6UA 1C9MA 5EKSA 3ET4A 5JHHB 5FD6A 2PRIA 1YE8A 4M89A 1ZW1A 3KTAA 2ZXHA 4OLBA 4K6KA 3M3DA 1WMFA 5FEMA 2QZPA 3QOXA 1RQXA 5DUIA 1VQ7I 3KWMA 4ND2A 4DLRA 5BSRA 2HU5A 3ZIDA 1KVUA 4KAXA 4F04A 4MP6A 1J6UA 3OQNA 3K5WA 4TV9B 5FKJA 1JDVA 2YY5A 3QXXA 3VEPA 3FWNA 3EEYA 4XKCA 1Q11A 1T34A 2NVXJ 1YZVA 3QE2A 3EWNA 5CU7A 1MFPA 3L7IA 3HC7A 1Q57A 2GA8A 4F56A 4TXHA 3ROZA 5CBPA 1RQNA 1PR1A 2OCDA 3T7DA 3U2RA 2X9GA 1U7TA 4PC6A 3CCCA 2EWWA 1Y7IA 1HTTA 5A5VA 3L7YA 2VYFA 3I6QA 3WMWA 4EEXA 1RU3A 2VCHA 3R9KA 1YX5A 3FPEA 4MJXA 4CMAA 2OKGA 3GD5A 1Z28A 2BPOA 2DMQA 3X2FA 2I6TA 3M34A 2WY7Q 1NY5A 2A9FA 5H1YA 3P9NA 3KKQA 1WCMJ 2VF5X 1J8MF 2ZBGA 3TQHA 5IF9A 1YJCA 1AOYA 1ST2A 4FR2A 3QVVA 3SQMA 3BL5A 4C7BA 1UK9A 2NUTA 5LN1A 4G1EB 1B4AA 1RI2A 2ZFWA 4HXFB 1VJRA 3WLHA 1I3KA 2XMQA 3QUTA 3DJYA 4BUCA 1BMDA 4KO4S 3NYIA 2P3SA 3CLTD 4IIGA 5M2QA 3EWIA 1XLWA 1IWOA 3UJNA 4BO8A 5BOVA 2PLNA 3QYBA 1WDKA 4LOHA 4Q0MA 4B7UA 1M2VA 3BD7A 5M3FJ 3HOZJ 4KWHA 4RVSA 3TECE 3W3ZB 3GT4A 1P91A 4XLEA 2EA2A 3JAMA 5CB4B 4BFXA 1B72B 4Z53A 5K09A 1FOKA 3P2EA 3JVEA 4P32A 1T1JA 3H7IA 2EFQA 3VR4H 4PG4A 2NZVG 3K9TA 4CRWB 1D0VA 3THWA 4MIEA 2C31A 1U9NA 5HQ3A 4MCJA 2PWBA 1ODCA 1ZIYA 4PE5B 4AUEA 4DMRA 1J70A 2RBKA 4E3ZA 3OH8A 1NMXA 3QLVA 5AVJA 1V7PC 1WJFA 4E94A 4A3FJ 3TO7A 4J8PA 3TSOA 5LC1A 1JXSA 3BRWD 2W22A 2H63A 5B1IA 4E2YA 1YRLA 2GARA 3ZI4A 4MWSA 5C1DA 4RH1A 4Y9RA 3HKBB 1BJKA 1RMYA 2DLCX 2WHPA 3WV5A 4BJ5A 4XRMA 2JL1A 3OLQA 4BAZA 4HI0E 1CJTC 1PG2A 3OOHA 5FA6A 4FFVA 3J81A 2O8FA 4XONA 1YJ9I 3FNFA 3LC1O 1PGPA 2NO6A 3A1YA 1MC8A 2OZEA 3I23A 4IXNA 2BFFB 1EXMA 4YMWA 3OYNA 3U39A 3R6GA 1W4LA 1BE1A 2ZUSA 5KWSA 3UMGA 4INOA 5CA1B 3ZU2A 2WNHA 3IEUA 4TYMA 1UELB 5CNJA 4M2LA 2PD4A 4XLZA 2AEJA 1KQ8A 1Q0SA 5GONF 2HF8A 1YACA 2Z2IA 2R7WA 1FNBA 1JX6A 5H70A 2BY2A 4WGFA 1B9NA 4FWTA 4ZXFA 1IXCA 4KBGA 2E5ZA 2VTBA 5CLQA 5E95A 3MILA 3M7GA 4DRZA 1ZYUA 2A86A 5K9ZA 3RC9A 3A1SA 4G1UC 4C01A 2O0LA 4LJ6A 4YT2A 5D7BA 1NFQA 2IUFA 2Q2VA 2CMHA 4D3YA 3S4YA 5IWCA 3HEBA 1YJ8A 3HXTA 1RKBA 1U7DA 2DKNA 3QPLA 5TS3A 4GRIA 2HK7A 1VKNA 1U8TA 2JIBA 1SOVA 3RAFC 1AZLA 3EF0A 5KWVA 3WWCA 3OQ6A 3QYFA 3QX8A 2G8NA 1SUAA 4A5NA 2VBIA 3WGZA 3AUJB 4HDMA 2XBMA 3G5TA 3A4CA 2GESA 1TJ4A 2RGNA 5TMEA 3C3BA 3HKZN 3HCDA 2PPVA 2O1WA 4TLCA 4MWCA 1GZUA 1DUXC 1TVMA 2WTXA 1DKQA 1J9GA 5JCZA 2XWJI 3ORHA 2XNDA 2HSJA 1JZSA 1G5PA 3E53A 4NUBA 1PV1A 1SKQA 1YNOA 2W37A 3WAJA 4B3RB 1BHSA 1N7HA 3EDRA 2I4NA 2PS3A 1SWVA 2OQ2A 4A3LJ 2Y48A 2OTLI 4MUEA 2GZRA 1PLJA 5J1UA 2PZ8A 5I9BA 3FSGD 5H3CA 2L9NA 2YTZA 3GJQA 5EP3A 3NAUA 3NAQA 2QMUA 2P2SA 4RV4A 2QKLB 4I50F 1H2WA 2CUTA 1SHKA 3HZRA 1YBAA 5FBZA 2YHIB 4WADA 1EPUA 4PZYA 1TIPA 1W85A 1BXGA 1DXHA 3HRHA 1XTZA 3OU6A 2H2GA 4A8JA 2Q3EA 1Q1GA 1GT0C 2W58A 3WI7A 4J7XA 4AG5A 5DGIA 1NW6A 5LJIA 2EOAA 5CB6A 3W7BA 3H1PA 5JVGF 1TADA 4BHBA 1L5SA 4GMDA 2Z57A 1E3TA 3MERA 2FWJA 4KYVA 3MMPA 3ESAA 5AONA 1OAOC 2BXZA 3LPLA 4LGMA 1ZXLA 1LW6E 3CN9A 1Q1QA 3UJ3X 4GNKA 4I99A 2DRIA 3I12A 1JR3D 5DX1A 4EB3A 3LSHA 2QZ8A 2E7ZA 3C3PA 3F22A 3V3KA 3RTRA 4CG1A 3INGA 4EG3A 3T1YB 4MIYA 1CRQA 5T3UA 2VZ8A 4F9GA 5AIAA 4KT6A 3RNOA 2CUJA 3NHKA 4UUBA 2QJFA 3VI4B 1WXXA 3PNTA 3MT7A 3R9XA 3TR0A 1M0TA 1CLUA 3NWTA 3G79A 1D2AA 4LG1A 4OHVA 3PKZA 1Q19A 4M1ZA 5K4GA 4GKJB 3R24A 1Y7HA 5IM4A 3IEIA 4JI3B 3ZXSA 1XDBA 1P29A 4RAYA 2AW5A 4UUMA 3TZ6A 1RM0A 3BLYA 3PO2J 3WDSA 1OROA 3LT0A 4PCAA 3JR3A 4A0GA 4CCYB 1ZH6A 3H1GA 2ZM6B 5DTJA 5KU1A 1T98A 1PFKA 2O5CA 1EESA 5KNCD 3K32A 4GKAA 2VPXA 2ERCA 2KLOA 2VDWB 1VSBA 2HTSA 1QQ5A 4KXMA 3DAYA 2LY9A 5ENDA 4LCBA 1ZA1A 1Z15A 3T4PA 3KJZA 5K3FB 3EPZA 1D4ZA 2QTFA 4N82A 1S6YA 3ZYZA 1QG6A 2V4MA 5THXA 3UWOA 2RE8A 2IHKA 3F8CA 1UBOS 3E4CA 1QFXA 3GLTA 3ZW9A 4BN5A 2FW6A 1TUIA 2OSBA 3TQNA 3M6UA 1PNTA 3OEHD 1C2TA 3AR4A 1NXTA 3ZE0B 3CMAI 5BXYA 5MFPA 3MJDA 1RLOA 4OWRB 1FEXA 3OY2A 3AF0A 4AIIA 2KRFA 3DZCA 1CY2A 3A70A 3CKMA 5LLDA 1WQ4A 4J16C 5AVYA 3MT8A 2VPZA 3F21A 4OV6B 3EOZA 2C2XA 1X3LA 4W5QA 3AF6A 3ESXA 3KT3A 5LYJF 3S1MJ 1ISMA 5JW6A 3DJFA 4ML3A 2HFHA 1Z2PX 2Z16A 3W2WA 2EV9A 4H18A 1JA0A 5ILOA 1IQ0A 3PUZA 3JAWB 2AFRA 2VNAA 1WQ2A 4UNOA 1B59A 4B81A 3ENNA 3HB0A 3COWA 2JD2A 5C5CA 1L4YA 4X1EA 2XRMA 4HGYA 1J9EA 2P5YA 4QPPA 3E6AA 5HZHA 2DHDA 1XN1A 3KP6A 2OBYA 2XDQB 2NTJA 4YJFB 1UH5A 2V6GA 3AM1A 2XPCA 2J3HA 3JPWA 4CPDA 3QU3A 1WU8A 3PQ5A 4DZJA 4R31A 3T35A 3E70C 2L3DA 4UAGA 4X3PA 4F5WA 5AFSA 4JD5A 4Z3OA 2OGWA 2NZXA 3USES 3ACBA 2ELKA 1NLFA 3R74A 1QLWA 2PFBA 2VT6A 1GQSA 1EZZA 3V8NA 1XO1A 3W5BA 1DG9A 4ZT3A 1X14A 3WK8A 4F9TA 2X6OA 2WAMA 3N2YA 1EQAA 4OQ4A 3O8CA 3C1AA 2FSVC 4RO0A 4XSXF 2R8EA 3MW8A 5K8IA 2X9LA 5FOUA 5AM5A 3SLKA 2IDMA 1K7AA 2NXNA 1ML4A 3ANSA 1ZRMA 1QSGA 3OYHA 4F8JA 1Z7LA 1WUIS 5J4YA 3GO5A 2OILA 1ZUD1 3WYGA 4ZT4A 5DISB 3UA4A 2W6JA 4EX7A 5JE8A 1CUAA 2AGVA 4B5LA 3DL7A 4MUHA 2B34A 1D3AA 4D4HA 4AXXA 1WE2A 3DNFA 4PHTA 2ZIFA 4K9DA 4GZ5A 2ZMEB 4BV9A 4W7IA 4YRFA 4EFLA 2NU9B 1H2YA 1YZQA 5A3JA 5F0HA 1X3SA 4G6QA 3CJNA 4INAA 1ML3A 3TX6A 1OC4A 4I76A 2W2OA 3K92A 3EUHC 1V16B 1RZVA 3EGDB 5ALLA 2UXBB 2Y93A 2H7YA 1WV1A 4EO7A 3BDIA 1J8VA 4QUBA 4K26A 1GRRA 1MKMA 2AFIB 1IVSA 1BI0A 2AN9A 5CB0A 3ZQIA 4MRPA 5T8KC 3WA7A 3AEUA 3B38A 3AVUA 1Y37A 3M8EA 3IT1A 2WTBA 4OIFA 1GNRA 5J1SB 2RAFA 2V45A 4FDAA 2AR9A 4G8JA 4AF6A 2VXYA 3I1YA 1DFHA 2Q1YA 4LRUA 4YP6A 4OBWA 3V2UA 1I1GA 3QWAA 1PGJA 1Q0HA 1ULSA 2V5AA 3F47A 3ETCA 1T36A 4X7RA 2F5EA 1P4HA 3T1VA 2VAMA 3GLRA 4JLDA 721PA 3I58A 3A1NA 4CU2A 4CV1A 2H57A 1WB9A 2G76A 3QEMA 2ZJ5A 3NUZA 5KIAA 4OXXA 4XH9B 4AWXA 2LW7A 3QMVA 3GT3A 3A32A 3A0HC 3H5RA 2G5TA 4TVKA 3PA8A 4NYMR 1DEAA 3JWJA 3VH4A 3RC8A 5KSYA 2DFVA 3WKCA 2JLBA 4MWOA 1RC1A 5LP6B 1G8SA 2C03A 1XLUA 3DUWA 2WDPA 1HG0A 2I7DA 3H1FA 2VK2A 3KKLA 2NQTA 2XRNA 4DSNA 4DIKA 3JYLA 3LHFA 1R0KA 3WKDA 2GN4A 5EDNA 5DYIA 1TYZA 3HZZA 4XYLA 4J94A 4BUZA 2VP3A 4PYMA 3VPRA 3DMTA 2V79A 3DE0X 3SJUA 5FL7A 3FHTA 4HLXA 3QKWA 2PGLA 1T0PA 1E3WA 5EIHA 2MSNA 2EWVA 5K01A 3T5GA 1T3TA 4G0NA 3RG8A 1NJ2A 2AXTC 4NAVA 3KPWA 2Q9BA 2P1ZA 3F4KA 4QGHA 3C48A 3S68A 4B3DA 3M2TA 2L82A 1CSEE 3LY7A 2FJPA 4I9NA 1XQ1A 1GUBA 3VTKA 3KHKA 3CLTC 3VU0A 2Y92A 2AR7A 5ALDA 2O8BB 1YI8A 1PUFB 3V8KA 1TM4E 1L7BA 3ZVRA 1M5UA 4IHAA 3NBUA 1YNSA 4N5HX 4B3JA 3ER9A 3GFIA 5LUBA 1RXEA 4INZA 4GVLA 3OAAA 3EC7A 3DE1X 2HPAA 2DPYA 3K5HA 1ZK4A 4OI0A 4F06A 1CUVA 2GM4A 4X6LA 4HRAA 4KKXB 2RK6A 4CDRA 4M3NA 2X1MA 2VB6A 2X0KA 1QG0A 4U7TB 1PVOA 3C74A 3ABLH 3QKSA 2X77A 2B2NA 1SNYA 1GCGA 3Q10A 3ZGKA 4DT1A 5ALVA 4GMKA 1PK7A 3OF3A 2AD1A 4DCNA 4D9IA 1ODSA 3HFSA 3GTJJ 4UDNA 2QZJA 1OFHA 4DR1B 2FFRA 4ZAVA 4DCMA 4FFRA 1CY6A 2BHTA 3PC8A 1XD2B 3ITKA 2XRZA 2QL9A 5BNWA 1ZBDA 1IBKB 1UMQA 4N7JA 2CMDA 4YC7A 5A7GA 1NK3P 1O1YA 2PS0A 4KIWA 4FFWA 4JODA 3CO6C 1NXXA 3EZNA 5HIIA 4AZ3B 2AE2A 1TVKA 3PUJA 1EQ2A 3K4CA 3HXPA 4PHFA 1XPOA 3NDBB 3CCQI 3KZNA 3NIWA 1OFVA 3KSDO 4PC2A 4EQ6B 2YUSA 3RKQA 2XSJC 2F9FA 3BGIA 4D25A 1XKQA 3NOXA 1UJMA 3HNRA 5EXSA 1D0ZA 4DUGA 1BZYA 1MHTA 4MI3A 1AHNA 1SXGA 4RK6A 5HF9A 1N3LA 4DVJA 1GT6A 3EQ9A 4QA9A 2C8KA 2QLMA 1DP4A 3FYUA 5IAAA 2YUIA 3IB3A 1GILA 3WO1A 2FFBA 4BEJA 2Q9AA 4TTIA 4MR7A 3SQNA 3B2EA 3H6HA 1GKIA 2M2EA 3ZS9A 3EUEA 2XZDA 2IEKA 4TYNA 2D2EA 1MSFC 4BVHA 2AK3A 3D0SA 2YJGA 3QVOA 1GUYA 3QZUA 1OCZH 3CUQC 2WKSA 1O6FA 2JJ8A 1GTSA 3E5UA 3K0LA 4IF4A 2JFWA 2R7RA 3ORYA 1B8PA 4CM4B 2ZATA 4RDXA 4UHKA 4RTNA 4CMIB 3GTQJ 1T3HA 3GJSA 1RM4A 1E5VA 3ZXUB 1N2IA 3Q0EA 5K4AA 2AI1A 4QFCA 3VOEA 2VTDA 4Q3OA 3U3RA 1NM5C 3WDMA 3HXLA 5JY6A 5CHYA 1F2VA 3K6SA 5I7EA 4I2OA 1PCXA 2Y30A 1KSJA 1X42A 3M07A 3WL3A 4ZVMA 3FVWA 3OE7D 3O2SB 1Y5LA 5AUOB 3RG2A 5DK4A 3WRVA 3TO9A 3RR2A 2ISYA 1M8KA 1ECFA 3I6BA 4Q9LA 2AZDA 1I1QB 5I8WA 4RWEA 2H8RA 4LBZA 2GHRA 2QTAA 2AXEA 2QTCA 1SBHA 5EMLA 3EISA 2FJ0A 4PSKA 4A9AA 1SHJA 2WSMA 3DO8A 5HGJA 3T5PA 5FD8A 3QUQA 2HXYA 4ZYDA 4Y52J 2B5WA 3NHUA 4OYYA 3KP7A 4AO8A 4RY9A 4MP8A 4RF4A 1JILA 3A3KA 5AUNB 2HFKA 1XLTA 2LLKA 1JMYA 1BHQ1 4FNMA 4CO8A 3HFJA 2XVXA 4G4GA 3E5RA 3T3HA 3G2KA 3AOEA 1KI9A 2XWQA 3MNFA 1YF3A 2C7PA 3VA7A 4NPAA 1SIWA 3FZGA 3G1OA 1DRJA 3PNQA 1NQTA 2J0VA 3MGCA 1R4AA 3JRWA 4ZT2A 4RA9A 2ADMA 5JXWA 4BL5A 3TW6A 4TWJA 4EEZA 3PICA 3WHKA 3SZLA 3OM9A 1QRYA 4D9MA 4BRWA 5LNK1 2VPQA 2FYTA 4DQLA 3BK1A 3VKGA 1SA0B 5DCUA 1Z5GA 1R0XA 4X0EA 3L02A 4HB3A 2YC4C 3NARA 4Z9FA 2OZUA 1HNNA 2OO5A 3HB1A 3LU1A 2VPYA 4KPFC 3AHDA 4MVJD 3L8EA 2FWRA 4A3EJ 4LW8A 3F3KA 2ME6A 2EHJA 2XMZA 1QFJA 3LRXA 3RYCB 1WTCA 1ZGWA 5KOJB 3PUYA 4Y0NA 2X6WA 5KC9A 4PAWA 2LV8A 1RIOH 4YI5A 4EHDA 3B6KA 2IV2X 4TVOA 4YCNA 5CA0B 5JATA 3QWLA 2I6SA 4KQXA 2O4UX 5IBQA 2M7BA 1J99A 1BS1A 1M6VB 3U21A 4QGGA 4G1VA 4QGSA 4G41A 4RXTA 3GVHA 1P92A 1CDDA 2P4WA 3GMEA 1Z77A 2ZU6A 3EXHC 1WB6A 4YIKA 5F4BA 1NW9B 4MP3A 4W5OA 3KQVA 4PYRA 1E8DA 4DZRA 4R7GA 1K89A 5DBIA 2GQ0A 3GFFA 1BOBA 5EJ8A 2WPDD 4BU2A 4ZQBA 2IAIA 1WL8A 4ATNA 5EA2A 4N49A 3RFXA 3Q3EA 2EV6A 2DR0A 3I83A 1P3JA 3UC9A 4CFYA 1A8IA 4Z51A 3OPVA 4IHJB 1OCRH 4N1AA 3EG5A 5HDNA 2QHXA 4UTNA 2FEZA 4JBAA 1RIFA 2B7LA 2Y71A 4QQKA 2ETXA 1GTVA 2GZ2A 2KZGA 3NC1C 4LY0A 4GC9A 4IJ5A 4QYTA 4HX7A 2POCA 3CVOA 3H1BA 4CEJA 3G9ZA 3OIWA 2DC1A 1U9IA 3HSRA 5E6UA 4UQLA 4G56A 2VK4A 3FSJX 4C07A 3SNHA 1ZOSA 2YCBA 3T5BA 2ES4A 4CZZA 3FM9A 1Z63A 2HWUA 1I80A 1A9SA 2IOQA 3SNKA 3K6GA 2CBZA 5BPDA 4YP7A 3T7JA 1OILA 1GXSB 1U8XX 2VJCA 3WU1B 5ANRB 3KL2A 3ESWB 1D1TA 1U5BB 2KPOA 4IQJA 3TCXB 2GAOA 2CDNA 1CUEA 4BVBA 5JIBA 2NX2A 1A27A 2B0JA 2BFCA 2NQ8A 3PC2A 4MMZB 3I0MA 3QTTA 1TZCA 4ESVA 4D8VA 2IPXA 1WW3A 2OB1A 2PUHA 1RKXA 3QVKA 4IKFA 2WWIA 2XY4A 2YHBA 1KU0A 3OP1A 3N07A 4UEQA 1AE1A 3FI0A 3IMEA 2RHBA 2H1CA 3W5AA 1FQWA 2XIJA 2ZRIA 1JHHA 2V97A 4GP7A 1DC5A 1R4NA 2A5DA 4R1QA 1WABA 3WTTC 1A8UA 5IDQA 3A0RB 4ZWNA 1MH9A 4ETNA 1HDEA 2E85A 2OHHA 4E5MA 1Z35A 1NNI1 3VJLA 6YASA 2QMZA 5C31A 2GJ9A 4GAEA 2BEWB 3U09A 3PNKA 4AP5A 3BOQA 4YUZA 3F23A 3P0RA 4H6WA 1SFRA 3O1JC 3G4SI 1Z3YA 2QM7A 3FNGA 5TISC 5CH8A 2NSHA 5JPIA 1EVEA 3E23A 2QE7A 3EA4A 3ETDA 1G42A 2FQ3A 1KI3A 1L1RA 2D5BA 3TINA 1JLSA 3Q6NA 3DXZA 4NFHA 4WY8A 4MAMA 4KLAA 1A5AB 4HZGA 1FYFA 4M53A 2J9FB 3LWFA 2QENA 3J7AY 1WXDA 4R2IA 4BNDA 4GWKA 4FI3C 4Q18A 3G2BA 3K0HA 4EY8A 3EFHA 4R2WA 5J59A 3WIOA 1JHAA 1W73A 3IUEA 5C35A 4CCLA 4D6PA 5A02A 2JS7A 3G71I 3KD2A 2VJKA 3K4PA 4B3CA 4I5FA 1QJCA 1EUCA 1RMTA 3W6JB 1Z17A 5F1OA 2EGGA 5J5VA 3ZKWB 1UPUA 4MUGA 2WY2D 1NMZA 4HH3C 4B76A 3M8FA 5CG1A 3KU4A 2HQSA 5EEAA 1OOEA 3ZLJA 3H2YA 1SUIA 1W34A 4H08A 1Y4UA 4HXEB 1E2XA 1FNMA 2PT9A 2QT0A 2KJQA 3I4CA 3L84A 4JX9A 3SICE 5C1BA 4BFZA 3L7LA 2NP7A 1JJ6C 4FX2A 2A3NA 4CCMA 3CVVA 1SMKA 2IPAB 2G9UA 1I3OA 4O5OA 4WFJA 3VFZA 1FSGA 3Q7IA 3RSSA 4LQCA 3NVDA 1QHXA 4IJKA 5JNRA 5JVDF 2OZ6A 2W11A 3T41A 2ZPAA 2A1UA 1BE8A 4BZQA 1QC5A 3N2LA 1KIFA 3MJHA 5ILSA 1RKUA 1NLMA 3O0TA 1RACA 2BI8A 1HCRA 2EFDB 2ZZKA 2ZJ4A 3R3UA 3L07A 1R37A 1CDEA 1JIJA 2R5WA 1J5XA 1ZIXA 1GU0A 1ZD2P 3AL3A 3FVQA 3MTIA 4AZWA 2VJLA 4YAOA 3MMNA 4O6JA 1XGSA 9ATCA 3GPDG 2Q4BA 3TGWA 3C3MA 4UNPA 4C0SA 4KICA 2KLBA 3H8SA 3HM2A 4GLOA 2NYRA 2X1CA 2CLIB 2EBFX 2Y0MA 5HIKA 3VR2A 3HBJA 4IEIA 4JBYA 4WQMA 5FO0A 4HVLA 3TDUC 4Z6YA 1CY1A 3GAZA 2JFVA 3ZE9A 3TB6A 4U7FA 5DWVA 4UARA 4ER7A 4GT1A 1B0PA 4L8LA 3ZZTA 2WZDA 4PSUA 5BOSA 3B9BA 1SXJD 1ADBA 2ZIWB 3IHWA 2JTVA 1QV7A 3QIAA 2ZT6A 2M0CA 1E1CB 4LF8B 1CWUA 4G5RA 3ZIUA 4G89A 3H18A 1MMSA 1GVDA 4UC0A 3E6MA 3STVA 3LA6A 3BHIA 1A98A 2FKAA 1BW9A 1XXHB 1U90A 4DANA 1MH1A 2FSGA 1N32B 4IQFA 3FOEC 1GPH1 4F1KA 2EZUA 3CEMA 1U0EA 4B73A 2M8EA 5CX1B 4WZ6A 3P9XA 3HSFA 1B1AA 1ZPDA 5FFMA 1J8DA 3TTWA 2VODA 4NBNA 2AG5A 1DAIA 1A69A 2A67A 3LH5A 2DX7A 4R1TA 3U9TA 3A4IA 3OQJA 1PKEA 4R5MA 3JWPA 2PZEA 2VPTA 3O8OB 5CXQA 4AYBA 2UUPA 2TSYB 1SUSA 4NMLA 2VT2A 1YR8A 4CR6A 4YHBA 4FJ2A 3QSGA 1C30B 1XSDA 4MDEA 3QX3A 2PANA 1IJWC 2AJBA 1M1NB 1CFJA 3AV0B 2PWYA 4CLOB 3H9CA 1V4VA 2RI1A 1K97A 3VZCA 3OMWA 4P2BA 4QXQA 5FTWA 3K0BA 4K6MA 3AFIA 4A8TA 3GBGA 3OG9A 5F1PA 2VJ4A 2IH4A 4G5SA 4FFBB 3VISA 4B0OA 5K8JB 4RORA 2REQB 1S29A 4P4NA 2RC5A 1XJ0A 4HX8A 3GV0A 4CA0A 1JT0A 4FK8A 1K92A 4AJOA 3FZEA 3ICPA 2EP7A 2EZ8A 5B7PA 4UCFA 1S2GA 3HR8A 1XMJA 1QKIA 4Z4QA 2ZIVB 3FAKA 2ZB9A 4KXNA 3ACDA 4RMJA 2PX9A 1Z4MA 4ROSA 1BA2A 2P91A 4J0IA 1ONSA 2CDAA 1PJ2A 5CM8B 4YJDA 1Y39A 1RBQA 3F0TA 4UB8C 3T5DA 4JGGA 4EY7A 5B7GA 1YR1A 4GSLA 2IYQA 4G7ZF 4X45A 2HB6A 4HFNA 3F3MA 2QGUA 5H0IA 1TUEA 1B1CA 4OLHA 1PSWA 1ZVVA 4OYRA 1PJ3A 2ZNYA 3ML1A 4OFWA 2ZREA 4NCHA 4BO4A 2DA2A 1MBFA 4JEUA 2IGBA 3W90A 3F9KA 2GWHA 4F4IA 2VDUE 3W9UA 5FR2A 3ROUA 4KGXA 1BXZA 1OASA 4OREX 1SBQA 1P18A 3DBHA 1NN3A 2M4GA 1EJ2A 2QTVB 1MJGM 3KV3O 3V7RA 3PHLA 3TIXB 4TS3A 5SYMA 3GQBA 4HRXA 3O8RA 1I4OA 3KUUA 1KZ1A 1E3JA 3IJ5A 3LKVA 3H1TA 1W5AA 1ZX1A 2AI2A 1A2KC 3AJEA 3T1QA 3CVXA 4O4LA 2IYTA 2KDZA 2W84A 1P6UA 1CF7B 4LE1A 2P7CB 2QQ8A 5E3NA 1W5TA 4AL4A 2EYUA 5K7FA 3CKLA 1R8JA 2Q7XA 5JAPA 5KWEA 2CK3D 3BXGA 4BDSA 2DWCA 3VYUB 2KIFA 1RHKA 1NLYA 2PCJA 4JYAB 1XEXB 2OHFA 2ZRAA 1HORA 5CW1A 1Z5UA 2H9IA 2XF8A 3SFZA 3ZVLA 4MDHA 1S7EA 2JCYA 5AUPB 2DUWA 4QHTA 3E0XA 1RI4A 3CUKA 4RTOA 4RIGA 1M74A 1OUMA 1Z0AA 3ICVA 2KHMA 4EO4A 2YUTA 4V39A 4B2YA 1JHVA 5CCDA 3IB6A 4YLGA 2HDHA 4LXYA 2AVDA 3A1UA 1U2GA 5H81A 2FQWA 4HEHA 4LX8A 3ENQA 3RRJA 1WXIA 5IHPA 4HNHA 1XNJA 4WOKA 2DWQA 3S1AB 4CM1A 2PDAA 2GCOA 1C1HA 4XB1A 3G1MA 1KJNA 5TPWB 4GGMX 5JFOA 1U6GA 1XRJA 1VZ0A 2G06A 3ONVA 4BOYA 4DNFA 4EL5A 1LRLA 1GL7A 2O2GA 4GZLA 4XLCA 1K08A 1ANKA 3IPXA 4ITRC 4I3HA 4IUYA 5BNIA 3S2SA 1WI3A 2P0WA 4X1KB 4IKEA 1Z38A 3GEBA 5F21A 4MJ3A 3QBTA 3NKLA 3CDLA 4HL6A 2CNBA 1X80A 1X1RA 5IYZF 4JSYA 2I6QA 5DHSA 2EKLA 1RAFA 4LDQA 2VQEB 1N75A 5BRNA 4D8YA 2AZ4A 1REQB 2MHCA 5CDYA 5AKHA 1KFKB 4NV1A 1ULAA 2OFFA 4KWTA 2EV0A 1F60A 4MR9B 5TQ0B 1KI6A 2Q21A 4HT3B 1KZ6A 3SDSA 4RAGA 1HFJA 4KWCA 4D97A 3BSYA 3PQ2A 5B6IA 4N5MA 1CEEA 2VBZA 1OB5A 2CUNA 5GZ3A 4IO0A 2IBTA 3WLJA 2Y0EA 3FFXA 3KOYA 3HRSA 1FW6A 4H15A 4YJKA 3U4IA 5MFZA 3O2JA 5FJJA 2HBZA 4B0PA 2HMTA 4C08A 4OBBA 2ZPTX 4JVOA 1FYEA 4H17A 3AKDA 3ABKH 2CYAA 4FDLA 2HA0A 1H42A 2ZJZA 1XHLA 4OHRA 4EKDA 3HFGA 4YP9A 1BSVA 3N8IA 3D1LA 1PFUA 5JWOA 3AR5A 2NLOA 5BN4B 3WJ2A 4IVPA 3HKEA 4MGIR 3PFGA 1QPGA 3BHNA 4C21A 5HOOA 4HWSA 4D9GA 4FFPA 1JQKA 1M1XB 1UFRA 1LPOA 3ZD7A 1PEYA 3EGOA 3O91A 1IN1A 2ZJPF 4ASUA 4KPEC 1O4XA 2ZR7A 4G3XA 4JI0B 3Q11A 3GGDA 4IIJF 4BS9A 1L7OA 1D07A 2TMGA 1I0ZA 2R7OA 2AOXA 5FBKA 1RYZA 5HK8A 3OPQA 1IDZA 3I59B 3ZTTA 1Z74A 1K3UB 3OURA 1ZFNA 5H20A 4DM3A 2RDPA 4I9UA 3OTIA 1E3MA 1P2FA 2HA3A 4LZAA 5TF4A 2CBXA 5F33A 4NKRA 1T5SA 4ZVSA 2VKQA 4A7PA 3X1DA 1UDXA 1ZUNA 4AKGA 3TFOA 1FX1A 2YIVX 2RONA 4GOMD 3AR7A 4PLZA 3K8OE 1FFXA 3A6EA 1QGPA 2CFIA 4NARA 2B7BA 1EGVB 4QAQA 3IWFA 4BNIA 1EX9A 1PQPA 1A9ZA 4B8WA 2D0DA 2O2EA 1WPQA 4ZYZA 1Y63A 3ZTWA 5BORA 4OHXA 4FXPA 4OUKX 4LDJA 3L8YA 4V02A 3U4HA 2R1VA 3PU6A 5LBQA 1C4XA 1T4CB 1JPUA 1KYZA 4YJ3A 1VLHA 1JBEA 1E9SA 1O5IA 3FXLA 3H0CA 4LRQA 1NBWB 2GPTA 3B1VA 5CEJA 4I1VA 3UHFA 1Z26A 4LQDA 3TG2A 1A72A 1BMFD 4BO5A 3HWWA 2F55A 1MXHA 1W96A 3ZP5A 2DBRA 5DIFA 2G9QA 3PQ3A 3ONQA 3UFXA 1M2NA 3KAJA 1YRNB 4ZAWA 1U0NA 4ENRA 3OT5A 2YJTD 4BBRJ 1NNUA 1B8VA 2NVUB 4MGHA 3C39A 3RU2A 1UEXC 2FZ5A 3K9NA 1F20A 2VA8A 5BP7A 3DFMA 4F38A 2KSQA 3HJEA 5G3ZA 2R7AA 4RPHA 3UUEA 2L0XA 4HYYA 4TMKA 1EA7A 5I9LA 4RXUA 1LJ9A 2X5JO 3N8NA 1UP6A 2IZ6A 2Y0CA 3VPAA 4U7PB 4K0KB 3NIDB 1G18A 1L7XA 1QMPA 3RSFA 2VTEA 1U1EA 4W8HA 1EE1A 1NPDA 4RADA 4TUYA 1NG7A 4ZVTA 5FOSA 4C1BA 2POQX 1TTHA 4CXMA 4V0KA 4A6PA 1VYVA 3F8BA 3HDGA 3NTOA 3N76A 4GI1A 4B4UA 2RKWA 2W42A 4C4ZA 3OYAA 5KQRA 1XEWX 2XOKD 3CRRA 4FS8A 5BNFA 1G2QA 3LBIA 3GROA 3UIEA 3ZMSA 3WLEA 1GV2A 3HJUA 2WD8A 3CCYA 4EYGA 2FN9A 3BIFA 1RPTA 4B46A 2ECCA 1WD7A 2P2YA 4HRVA 1E64A 1E77A 2DYSH 3FTEA 1IHUA 4G36A 5AM4A 1MAVA 4EJUA 5IBCA 4OXQA 2ORVA 1X1AA 5B4VA 4L8VA 1KDZA 5FKOA 4MFDA 1E1QD 1QGED 1Q7TA 3OE4A 4GZ3A 1C4OA 4RGVA 2QSZA 1AKNA 3R2JA 1MPXA 3LUKA 3GLHB 4XARA 2X0JA 1VL5A 4KN6A 3KOXA 1LBTA 5D3KA 1X7YA 1KS2A 1HEIA 1QP7A 1SFUA 4F1WA 4N48A 1HRKA 3K10A 3FKSA 2A0KA 1GV5A 4TX1A 2P4HX 4QUJA 5F2EA 3UMVA 2ISQA 3UAYA 3PT9A 2OP0A 1RJDA 2QG4A 1ONOA 4RAOA 1KYIA 1LFBA 2TECE 2P2NA 1WIWA 4IF6A 4RA6A 3DPIA 4BYGA 4LBYA 2VHXA 4BZXA 1N6KA 4LCJA 1S8OA 4AD8A 1EE9A 1B9MA 1I3AA 2EYQA 2J85A 1XQWA 4PSAA 2JHFA 2KDOA 5GOZA 3GUZA 4RU1A 2R7MA 5A9SB 3I54A 2I6XA 3LX5A 1IIRA 4HQLA 1PZXA 5DHQA 4BO6A 1DXOA 2CNWD 5JH7A 3PF9A 4O4JA 4GOJA 4C3JJ 3OWTA 4UAVA 1L7NA 4HMQA 2JBWA 1IDOA 1E3OC 5LL6P 4UM5A 5K5RA 1VLJA 1EH8A 2G72A 1D0SA 3RPUD 4HFRA 2AJ8A 1EFCA 2HRQA 2X19A 1SXJC 4TYWA 4TLDA 2IPQX 3KAQA 4GC5A 5ALEA 1XPUA 3HO1A 2MYSA 4I0WB 4Z99A 2HCTA 1LD3A 4LHWA 3F73A 1RWWA 2MU1A 5LZ2A 4KNYA 4RTMA 1KU9A 1PDWA 5HVQC 4KUHA 5LYJB 3OIVA 1QGZA 1BIFA 3WK9A 5AKLA 4XICA 1EKEA 3EVDA 1KEZA 3BTIA 2YR0A 1PT6A 2YIMA 1Z7EA 1JG6A 3AUKA 1Y1WJ 2BJHA 1QGYA 1XQXA 1LWNA 1QVAA 3IOYA 5JEEA 2IU4A 1SVNA 1IG7A 2I4RA 4C3HJ 3E9NA 1K1EA 2C99A 5JSZA 2YFKA 2C61A 2D0OB 2FSIA 3H4VA 4IRUB 3EXEA 3T3PB 1J1IA 1II0A 3FRIA 3N53A 1BVHA 2GLUA 1N4AA 1RJ9B 3C14C 4W9NC 2P62A 1DPRA 3DKWA 2ZUBA 2VJBA 1T0FA 4BMNA 1UXKA 2G1KA 2YYAA 4JLSA 2ZR0A 3UGQA 4OU0A 3BA1A 2Z98A 1PV2A 3EBOA 1K5DA 2HVSA 2FPIA 5T64A 1BO6A 3SVZA 2R5YB 1XCBA 1PWEA 3SZUA 3QPVA 3BDVA 1DCMA 1M1EB 2HQ5A 3VNAA 1OR7A 1UHMA 1RYDA 2XB2A 3O82A 2B1QA 1YDEA 3IUSA 3TW4A 5TC4A 4ZA2A 4G26A 1Z6QA 4JU8A 4RMHA 3EQ2A 2MIIA 3IDFA 2JJ2D 2OQVA 5FRNA 4IP0A 5BR8B 3IC7A 5G1PA 3L77A 5J6XA 4MKXA 1IN8A 4TMWA 4QJIA 2WFLA 5FBRB 1XCVA 1T25A 3D2AA 4AP6A 2GBLA 4ZREA 3IRRA 3VZSA 5EIXA 2QZ4A 5HS6A 2AYYA 5LVAA 1KQ0A 3JREA 4KGDA 2R6CA 4IFEA 2CH0A 3I52A 3AETA 1R5NA 5BS6A 1ITZA 4B3SB 2X1DA 3FOWA 2XLCA 1BH2A 1AA9A 3GIDA 2COUA 2HQ1A 1U31A 3L6DA 4AT1A 1E62A 4HDRB 5JS7A 3U26A 3IOBA 5FLXZ 4HLQB 3FGPA 2HBYA 3ZGZA 2W24A 2CVOA 3DOUA 5AMXA 3SVLA 5E4FA 4LFAB 2EU8A 2GO7A 2NSJA 2X41A 2HD4A 2V74B 5A4JA 3DGEC 3GVIA 2J5BA 1EWYA 1G2HA 4EMSA 4OYLA 5MDHA 4PFOA 1IUKA 1DAGA 1GZ4A 4AMVA 4PG5A 5JQWA 4R71A 4XOUA 4UULA 1Z5OA 1IGNA 2RH8A 5AKIA 2I5PO 3IIJA 2NO5A 1DKNA 4LHSA 5KDOA 5DK6A 1VQ8I 3FMGA 4WVLA 4I14A 3QFFA 2FG5A 3IMGA 3WICA 2O7OA 2D4HA 2OUMA 2XUDA 3NATA 2F90A 3LPAA 3ZMDA 5DRYA 2C2MA 1J75A 1RFGE 1E5XA 4GPD1 2GD6A 3S7TA 1THZA 1Z6ZA 4CNBA 3H6KA 2M45A 1NONA 3CDHA 2Y66A 4RK5A 5TVKA 4MQ5A 2IWHA 2OV7A 5A4AA 4M74A 5EP1A 5DE3A 3RYTC 3NV9A 4ZIRA 4QOJA 3WXMA 1WP4A 1R16A 1H4SA 3DE5X 1RRPA 2CJJA 1YI1A 1N92A 3SD7A 4L5YA 1QRUA 4E08A 4EYEA 2D0PB 2Y1OA 3E7FA 4YVFA 2A9JA 4DQKA 4N6NA 3ONEA 5IEBA 3UKJA 4NQWA 1LDEA 4R41A 1RCUA 3OLYA 2X85A 2LCIA 3Q8MA 1LPSA 2XKOA 1F9EA 1F4PA 1TK9A 1VPVA 3PWZA 3DEAA 3IELA 1Y4AE 4ZZDA 3V2HA 4BFSA 5GMOA 2EJTA 4F4HA 3ENWA 5BSUA 4WZAE 1GGJA 3ZWXA 2PLAA 2JNWA 1TQPA 4D2IA 3OYEA 1JJAA 5IKMA 2JIDA 4JGIA 1HYHA 1QZZA 4NNOA 1XA0A 3HADA 3A14A 2BFDB 4L08A 3OM8A 3F78A 2NXEA 5DCMA 2VQ3A 4DNCA 3LXMA 2DQKA 3BMQA 5CXUA 2WWGA 3D8SA 3FTPA 3P26A 2X0DA 2AZMA 4JHLA 4OBXA 3NDIA 2NP6A 5DMXA 1EZ4A 5CUQA 2O07A 3VU3A 3KQWA 4OFXA 4MYCA 2FN7A 3CUTA 4R2XA 5H82A 1KI7A 4BKQA 4D3ZA 4K03A 1E1KA 1FP2A 2VN8A 2PH5A 1CEQA 1VRCA 1ZVQA 3GLVA 3PR2B 4RENA 1KXJA 2Z3ZA 2BFBB 2EX1A 1IY8A 4BDZA 1OTHA 3HVUA 3LC7O 1I1SA 1YS1X 4Y2GA 4MW1A 4ND6A 5DLQC 2IOFK 1JU4A 1O58A 4QQFA 4OHBA 1T9GS 4JROA 2CQKA 1O2DA 2D5AA 4ZDOA 1NW5A 5CPBA 4MCAA 1R27A 2KYRA 5ECDA 4V0QA 3Q5FA 5JANA 3IMFA 5ITVA 3GDHA 2JH8A 2C4MA 3CG4A 4D4LA 1H8AC 4MWEA 3AIMA 5B5SA 1J42A 3IIMA 1C0LA 3DQZA 2OCEA 4C4RA 4W5TA 4M0CA 3PDHA 3EVEA 3JASB 4JBIA 5CM9C 3IKTA 3HHGA 3SOPA 2I3ZA 3IH5A 1OQAA 3CV3A 1FYVA 3COVA 4LLLA 3U7EB 1EAYA 1DT3A 4YTEA 4B9EA 2ZTVA 3RRMA 2XOXA 5EE0A 2I3DA 3BREA 5SZHB 2BEOA 4BXFA 1Q83A 2Y77A 3KSBC 1FMTA 3DOHA 4PO3X 6Q21A 3HEAA 1XN7A 2H2WA 3HPQA 4AKSA 4RL4A 3KLNA 4NAUA 1KJJA 3L41A 3URKA 5HXAA 5F73A 4N4AA 4L07A 3KSRA 2JJYA 5C5DA 1UXOA 2DEUA 3DEYX 3N59A 3DOJA 4NJMB 4WN3A 3TSWA 3R3YA 1QAQA 4C3ZA 4LS3A 4FZ3A 1DQPA 2IUEA 3N7AA 1C29B 4WOPA 3L7JA 2ZB7A 3CRZA 3CW8X 3CGGA 1YWGO 2EKBA 2QF7A 2G5GX 2PJUA 1YIOA 2MYNA 4PANA 2K9SA 1IMJA 5J47A 4NCXA 4HZFA 3AK4A 3THSA 2QSYA 4E14A 3MWKA 3GAMA 3NU1A 2BM9A 3AU8A 1Q12A 2LVSA 1OW3B 4OSPA 5IP9J 5FB3A 1WU7A 4ZU1X 3AVTA 2R92J 4UXNA 2L7FP 3WWDA 2IYVA 4BO3A 1HPLA 1Z6YA 1WPKA 4NI5A 3V55A 4YMHA 2Z6UA 1LBEA 3LMKA 2OC6A 2A0UA 2COKA 2OZVA 4FE4A 4CTJA 2P9QA 4CTOA 3L18A 3OSZA 3LECA 1K88A 1SURA 4Q34A 2P6OA 4NBKA 4B7CA 2QL7A 4YMSA 5JYBA 3OJWA 3WTZA 5JMTA 3WGYA 2GZWA 1D2CA 3HHEA 4X7MA 2MSLA 3HY3A 2DHEA 3OD1A 3JQ7A 1PWXA 4J16A 2UYQA 1A2BA 2ZAOA 5IM4F 3TBIA 3IQZA 4YJGB 1JSXA 1J4AA 1YFHA 3MCWA 3J7TA 4I3FA 3HU1A 2BDEA 1P72A 1E0JA 4AUNA 5BWLA 5DYNA 3C85A 4LY6A 2QPOA 3SSNA 4Z8XA 1SC9A 4B8ZA 5CG2A 5B3LA 3ZGVA 1M75A 3CU5A 4P4UA 4M1SA 3OMXA 4B48A 5LMNB 1ADJA 3SG0A 4DM7A 2HKXA 2ZXIA 1LRKA 1PYGA 3G6EI 3K9FC 1AUOA 3OLCX 4KAJA 1NURA 4AJIA 2J48A 4MVJP 3PTAA 1NATA 2FOKA 1Q0QA 5C37A 3OOYA 1CW2B 1I1HA 4Z54A 1KWGA 5KYUA 4QQNA 2YW2A 1E1RA 2XYRA 2NQ2C 1OFCX 2AN4A 4KXYA 4IS2A 1GVNB 4BEHA 4HF2A 1VQPI 3BTLA 4RVHA 3UR3C 2QRKA 4HTFA 4MUYA 4UXJA 5F3WB 4U2BA 3TLCA 2JEYA 1FTWA 1VKHA 1BWRA 2ZXWH 3IKVA 2FSVA 2LE0A 1S9DA 1ZD9A 5HKBA 1T2VA 4XPZA 5LLTA 5ALYA 1F38A 3SDBA 4R05A 4CKCB 2HDDA 2I4MA 2CFSA 1N6HA 1OXMA 4Z4FA 3O8NA 2H9AA 5FOWA 1ZW6A 2A14A 4EB6A 4UQOA 2XGDA 3WOHA 3TZLA 1CF2O 4W6ZA 4Y0VA 3W5HA 2H27A 1JL3A 4LN1A 4XR9A 3HVJA 3T5XA 4Q4LA 2EFOA 2I76A 5HS9A 1GADO 2C7BA 4ESFA 2HDOA 5KU7A 2BFNA 3IQWA 3OCXA 4DOZA 4UUVA 1CVIA 1SCQA 1LKZA 2E0IA 1DT5A 5BMZA 5EESA 3SY8A 4W97A 4RPKA 4MGRA 1GTJ1 1AHHA 4DIDA 3E5MA 2FMKA 1ZEMA 5A4KA 5K8CA 1V39A 1IQPA 4MX8A 1K78A 1K6OA 1Y5NA 4AMYA 3H2GA 3OJFA 2ETHA 2WJGA 3R5XA 3FE2A 2IY9A 4F2PA 3Q0VA 2VDVE 1MB0A 2X8WA 4L95C 4HKTA 1TPYA 4IH9A 4AU7A 3DULA 4P7FA 2XCUA 1W1UA 2JAHA 5E3OA 3ICWA 1XPJA 3PEFA 2GXSA 3IAXA 4AUMA 1TWAJ 3PGLA 3WODF 4BTLA 5B7QA 4YHHB 5BR4A 5F98A 1U1DA 1XB2A 5E3HA 4J91A 4G63A 1RPJA 1OCPA 1X39A 1NG6A 2QAIA 3EOAI 3FSEA 1QWSA 3RIMA 1XCPA 3VI3B 2D1TA 3STTA 4HGNA 1BMTA 4A3CJ 3N39C 3FA2A 3PDIB 3NI2A 3T5AA 1U2DC 2WR8A 1Z2DA 3B7GA 5DM7F 3A6JA 1TT5B 1C9JA 3EF1A 3G1WA 4DV4B 4O1MA 4HCJA 2L02A 3BTOA 3A04A 2C9DA 2QTHA 2FXAA 2IYSA 1TZ2A 3TZBA 4X5OA 1UDWA 1N5KA 1I3QJ 3EZLA 3VR5H 4ENVA 1J07A 1H85A 1RVDA 5EJIA 2V4ZA 1O3YA 1XSVA 5KWJA 5C4IA 3W7VA 1L4FA 2AJDA 1U3GA 3LFKA 1EK2A 4LPKA 1C80A 2ZT7A 4GI5A 3S40A 1N6OA 4O2BA 2HTFA 4YYEA 3HUFA 3QU9A 1VTKA 2GGSA 1IZZA 4I55B 4M1OA 1Z0FA 5EJMA 4US0R 1SZJG 2KIUA 1H5NA 5TLSA 3LUFA 2OBMA 1YFLA 1FNDA 3J80Z 5FP0A 1DC3A 2D2IA 3GGSA 1EXDA 2BEUB 5ALRA 4LWPA 3GJTA 3GIWA 9GPBA 4DCUA 3NHSA 2XLBA 2W98A 2VATA 3BB1A 5FL3A 5AK5A 4BH9A 5FLMJ 4KK4A 2V7BA 5D5WB 4ESBA 2Y2VA 3VR0A 2QYTA 3F0CA 3V97A 1C3XA 3FH0A 1GG9A 1GGMA 2HTEA 5BQTA 5HM6A 3C8UA 1CZHA 1QLHA 3DW1X 4UTXA 1U2WA 4CQLA 4JV5B 4B45A 3HB9A 3GMTA 5DNDA 1GGFA 2RGCA 3RVRA 3PEYA 4HWTA 2JAOA 3FMVA 1NR5A 1E7YA 1RXSA 3L0IB 2WJ6A 3ZHRA 2GEBA 4JUCA 4OCZA 1I39A 4ARSA 3W6NA 3H8WA 1VGVA 2YS7A 2CC2A 1N3YA 4A27A 1SQFA 4Q5IA 2QQAA 2QAGA 2BBYA 2QROA 3RCOA 3IA7A 5F3DA 4D44A 3KVOA 1XOIA 1SHLA 5JARA 2H4XA 6REQB 3BD6A 1HE5A 5JVDB 3QP6A 1XKTA 5M5XJ 3BQZA 3NONA 5BY2A 3V80A 2KT0A 4AO6A 1DX6A 1GPMA 3MTGA 5CFMA 4X1IB 2WLSA 4Q93A 4J4HA 3ZDBA 4FMCF 3RDPA 1V1MB 1FU8A 4AZTA 4IWNA 2ZJRF 4FX0A 3QBVA 4EOGA 5IUNC 3RVKA 1UXHA 2HO5A 4C5CA 2A8YA 1C1XA 4XCXA 3PRJA 2IT1A 4R83A 3COJA 5KYGA 3T52A 2P41A 2BSAA 3BUSA 2Y76A 2GKGA 2PSEA 4Y2UA 4YCBA 3UV7A 5E1BA 3VPDA 2XH8A 4LMPA 4D26A 2F7SA 4M9ZA 3NHRA 3GDOA 3A10A 2V6CA 1HT0A 4Y3OA 3LXXA 4XOIA 4C7JA 4ALIA 4U0KA 4I1UA 1EXVA 4Q4DA 3BP8A 4RJJA 1E2UA 3RQ4A 1XTKA 1C8BA 2HK6A 4XA8A 3GFGA 2YNMD 1YDGA 4JT4A 1P1RA 2FZVA 1UZUA 3KYBA 1FMJA 2I8DA 1NJ1A 4XSHA 4TSKA 1Z4KA 1RWKA 1N0HA 3IA2A 4URXR 3PZRA 3GTMJ 1PFVA 1ES9A 3CINA 1P0CA 2FZKA 1RBZA 3GCXA 4HNAA 3DTTA 1EFLA 2FUEA 3FI9A 3QFCA 2CE7A 3UUWA 2A7XA 3I8XA 3T15A 2L19A 2LP4Y 4UHDA 4J4BA 1XTAA 2A4KA 4BO7A 4CMEC 3FIJA 2YZMA 4CEIB 2F64A 4EG1A 2VHTA 5FO5A 2B20A 4L7VA 5LDDC 4RDHA 1AU7A 1VLLA 3U7GA 4D42A 2DY0A 4M1TA 2R9VA 1GNLA 1T5HX 1LLCA 2DOFA 5KYNA 3QA3E 3S1SA 2IX9A 4MAFA 4BNXA 3IBYA 2NUPB 3NLLA 5D2CA 4NBQA 1W0UA 1SQSA 5AHKA 3IE2A 3UOWA 2GSDA 5JRDS 1EUQA 1LNSA 3C6XA 5K0EA 4U0YA 1G291 4Y7NJ 1PR9A 4I4TB 3L06A 5HFNA 5A0VA 2W2TA 1JYFA 4RDIA 3QVUA 1K68A 4WWCA 4IPTA 5IVKA 4FDUA 4KUMA 1MEEA 2X0IA 4O2AA 1Y1PA 1N34B 5DYTA 5AJYA 3ZLTA 2GLTA 2G9VA 1TZJA 4TLBA 2R8YA 1GA4A 2VK1A 1V8DA 2C97A 3Q3IA 3HJRA 4OHKA 3T9CA 1R3DA 1SD4A 2ZJ3A 1V47A 1WJBA 5KYYB 1P0MA 3FUWA 2FPWA 2OAQ1 4MHTA 521PA 1R6RA 3K35A 4DG8A 2YCLA 4UQPA 4U3JB 3ZQLA 4W7HA 2Y9MB 2ZBUA 4NBLA 4PGMA 5CCBA 4KQKA 4LSGA 2QA5A 3SDZA 3G9TA 2Q5IA 5M5WJ 3GLIE 3DMPA 4UUPA 3FPKA 2G77B 3KQMA 3GTLJ 5DBOA 4FCWA 2DJNA 4Y6OA 3DHYA 2EIJH 3KOUA 3K8ZA 3PPWA 1GPJA 5TMPA 3ADBA 2GBGA 1EAMA 4M54A 4BQAA 2ATXA 3IUOA 4LMBA 3O8QA 2VC1A 4RZSA 4I09A 1Y6QA 3WTBA 4C0BA 2FLVA 3PUWA 4HZUA 3AYXB 3GH3A 4F6CA 1BX1A 5LNK6 4LRYA 4NE7A 1DWPA 5GP1A 3SZPA 3GJ0A 1UJ2A 1JMVA 1JDNA 2IVZA 3AF5A 1V6CA 1K7XB 2BM0A 4JENA 2J0UB 4DGQA 3E9DA 4DHEA 1ZJJA 2BGKA 2DMNA 3HXKA 2CBGA 3JSPA 2Q8PA 5EGSA 4RVOA 1WSAA 2IRWA 2ZTLA 4HXYA 3T6KA 3TRHA 5LOVA 2HT1A 2B1JA 1L5HA 3AI1A 3Q1LA 1OBCA 4RTLA 1Y1KE 2H2FA 4UBNA 1FPMA 4WAUA 1R1VA 3DKYA 3HYSA 1I10A 2QTTA 1W36B 4H7FA 2C42A 2Z3WA 2M1ZA 4L6AA 3R7LA 7MDHA 2VFAA 5JJBA 4OOEA 2WJ3A 2P9EA 5E6RB 4KXWA 3ZZUA 3PEWA 2OBXA 2P0AA 5I7UA 3NTUA 1P1HA 3OS2A 3OCZA 1JB9A 5FKKA 2IZ5A 2IX3A 4XX1A 1VQ6I 1PT5A 3OC6A 3PXBA 4PGFA 1V11B 1ZS9A 4HEA1 3L01A 4N40A 4FXOA 1KK2A 4YAJA 2ENWA 1P5HA 4UU0A 2BVLA 1XHFA 2FPKA 2KMUA 2IBDA 1H65A 4P80A 3TLEA 3I4NJ 2I6UA 2RGVA 4K6HA 4OHZA 4OK3A 1VDZA 5JYCA 4XPIB 1QO0D 3HBAA 3RUDA 3FMOB 2O5RA 1VL1A 4C87A 1H1DA 4RLSA 4AYWA 5D5VB 1KS9A 3BC8A 5KNDH 1SQGA 1M9NA 4ZEMA 4FQ5A 2WM8A 2R2AA 5IYZB 2CFXA 4NFSA 3FKIJ 1ZWLA 3CBGA 2K9QA 1CQJB 1WMBA 4WA7A 3UF0A 4JYCA 3A1DA 3IHKA 5A3VA 3ZCPA 4G0ZA 4RY0A 1MW7A 2XSDC 3JX9A 4BU0A 2AB0A 3RS5A 2PZJA 3DAPA 3P9YA 1Z4JA 3DEUA 2V8OA 2GFIA 5DPMA 3FDZB 4MW5A 5DIZA 2E5FA 5AW6A 1LJLA 4CM9D 5CR9A 3MCUA 4GCVA 1VTNC 2FRDA 5JD3A 3ZDAA 1UC8A 3W5CA 4Q05A 4I4LA 4Z2AA 1Z21A 2EIMH 4HEQA 4JCOA 4JLBA 3CWCA 3JATA 2CXPA 3N5CA 4H0EA 2AQ8A 3AIOA 3TE7A 1PX0A 3RVOA 4WZAA 1K9SA 5IZCC 1UMKA 3EH1A 1ESMA 2VQLA 1QPMA 4RAZA 1YZUA 2YX4A 5ITWA 2QN8A 1VYTA 3BDDA 1LFAA 5KTPA 4I66A 3FJ1A 1QANA 4M9RA 3AWIA 1XIVA 4R40A 3KUXA 1OXVA 2H1HA 4IKPA 4HY3A 4I4IA 3U4DA 1ORWA 1KI8A 2E4XA 4QXMA 3HO8A 3L6CA 4MVJM 1E9EA 5HDBB 2ANBA 5TT1A 3RLIA 2H08A 4E5KA 4YCSA 2GKOA 4CF7A 2Z9OA 3TPCA 3ZCSA 4CCKA 4U39A 2FVXA 1LX6A 2C4WA 3REFA 3ZCRA 2CFCA 1REPC 1YQDA 1D2MA 3L4BC 3EUKL 3QVTA 5JDIC 1B00A 1FMVA 4CN8A 4GRAA 2HU9A 1TXGA 1M2OA 2VXCA 4LYFA 4YMGA 2ODBA 4DMUB 4CL2A 1JFLA 4WXPA 2Q1ZB 4EM0B 4D9KA 2BCGY 4UUSB 5D00A 3F90A 5AVRA 4HDCA 3WZ2A 2VPIA 3B2QA 5DP2A 3JRIA 3V1KA 2YYSA 5D8DA 4H3KB 2QIPA 1ZESA 2IC5A 1R5ID 3ON5A 2VSYA 1CR6A 2I33A 4YV0A 3VR6H 1IB0A 2YZNA 5D01A 2BEJA 3LPMA 2JJ1A 1OREA 3R7SA 2O0HA 4AY3A 4Y2VA 3DEWA 4PJ0C 1TKCA 2FJ1A 2YC2C 4X64B 4QRIA 4XX0A 4C6TB 1T38A 2BGIA 1U65A 3PEUA 2PIDA 3MOIA 3HNOA 1OE0A 3BTVA 3C8MA 3E7LA 1AK9A 3P0EA 2R86A 3DB1A 4RV5A 1KDRA 1NSFA 3R4CA 3EFBA 4MV0A 3N5KA 1I30A 3TTXA 4DBRA 3ZV3A 2IXEA 3SZRA 2VDKB 5GAJA 4WJZA 2ZOSA 3STWA 2CWEA 1KQ3A 4ZI5A 3OX1A 2Q6IA 2JCBA 2IFTA 2WV1A 1E5DA 1A9XB 1U9ZA 1SQ0A 3QVGA 4O25A 4OEHA 3S8EA 3I28A 3MKZA 4MPDA 3TTSA 4YMVA 2VLIA 2L4MA 4BMXA 1BG6A 3ZHVA 1EI9A 4KNWA 1Y1LA 2PJRA 2O5VA 4EHFA 2IYAA 1T9CA 3VH2A 3CJTA 3TLXA 4X84A 2Q2WA 4EM1A 1KO5A 3W5UA 3OCCA 2X4IA 4ZVOA 5LB2A 2VH5R 2J59A 1OX6A 4G65A 3URMA 3M9WA 1GKKA 1NFFA 3DT6A 4O4IA 2XC7A 3N2IA 3BGVA 2NW6A 4ZXPA 2VEOA 5HZGA 1KRWA 2W6ID 5AW2A 3ZQGA 5EGOB 3F8FA 4NBSA 5GPAA 2RKBA 2C57A 5SZKB 1S1MA 3G59A 1OPXA 3UWMA 5K8TA 3V8QA 4DLWA 1VHDA 2V3WA 3Q72A 4TRJA 3FDYA 3RUCA 1XB4A 3WGUA 2FN3A 1UJNA 2WQ7A 3DMDA 3REQB 3TYXA 1JP7A 3WQHA 4KLZA 3TDZC 1A6IA 1XF1A 3I8SA 3JWHA 1TL8A 4EX6A 1XSXA 5KDLA 3CNOA 4HN9A 2W8BB 3C6KA 4IDEA 3NHBA 1I2CA 1E92A 1ZMXA 2IVMA 3R5JA 1JFVA 4OLAA 4NYIQ 1R6AA 1WKCA 2EH3A 4DA6A 3AZPA 1UMCB 2DLDA 3WLIA 2P5TB 3RJTA 3TTUA 1NVGA 3ENKA 4EW6A 5AJHA 1J24A 1DXQA 4LHEA 4LHYA 3PGVA 1I7NA 3K0CC 4KXLA 1S5PA 1OZ0A 1HE4A 1AB5A 3VNRA 1THTA 1GITA 2ZETA 2ISZA 4AY2A 4NC8A 2M30A 5T3YA 1TO1E 1C9YA 1L5LA 3SC6A 2PMHA 5E20A 1LDYA 1Q2UA 2IU6A 3BAZA 2PMDA 5JAUA 2IOYA 5K2OA 3G2NA 1SUCA 4QDKA 1MMFB 3GGOA 1D1SA 3TLGB 3BRCA 2HQOA 3H1AA 4OFBA 5EXTA 4LLGF 2BI4A 2QLLA 4E4RA 4R8MA 5HUJA 1FFSA 5GVSA 2AE1A 2IGTA 1MMDA 1O08A 5BRJA 1NAHA 1P4JA 2QQEA 4BCBA 1QDEA 1UBJS 1MVLA 4DCCA 4Y15A 3OFKA 2YV2A 3FZVA 2VJMB 2EIHA 3P5SA 1ENPA 2P6MA 4YP5A 2EC5A 5IEJA 3SXJA 4YMIA 1NVUQ 3THXB 1P74A 2EKZA 1AKEA 3UJCA 1T56A 1FA9A 2C98A 3UVEA 1Z18A 3D7RA 1FX0B 4LJYA 1ZQ3P 2HYJA 1E69A 4RHFA 4FHZA 1YXMA 1DELA 2ENUA 1YVPA 1LTQA 4JVLA 1Y7LA 3SKVA 1Z0KA 2CV1A 2GJSA 3TR6A 2LG4A 3BFPA 1LDJA 3R8XA 5K0NA 1JB1A 1XCGB 3UGKA 2RKOA 3A2MA 1MD9A 4HGRA 1FBNA 2PLFA 3T3MB 4QUAA 3DTVB 2M4KA 3LSRA 4PPGA 2QEQA 2UUAB 1QQBA 3KZCA 2BEVA 5JALA 1W0JA 1PR5A 3WU2C 1F1BA 3PP8A 3U7HB 1FSPA 1OXUA 3MTEA 2IPOA 3DMFA 4MYDA 2JA1A 4CLEA 1I5ZA 2Q2OA 4ZVRA 3O8DA 3HRMA 4XLNF 3SFIA 4ZH4F 1CCWA 4PLWA 4LBWA 4KH1A 5GONB 3TOSA 1TM7E 2XQFA 5CYPA 1IDN1 4WKGA 3A37A 1ZIOA 4IZOA 4EGCB 3OCYA 3JRNA 3S3NA 4C22A 1P2DA 1X2BA 1U99A 4G9EA 2O6GE 1E0KA 3OMLA 1KIAA 4G5FA 2V7QA 2NTEA 5KHAA 4IQGA 3DLBA 4RUKA 3DFFA 2CLFB 1GZDA 3MB5A 4EBBA 1ORHA 3U48A 1T8YA 4DBVO 1VB3A 4DHWA 3QHPA 4P98A 3F9IA 3PJEA 4NP6A 2DR3A 3H2ZA 4KJZA 2YW9A 1CULC 4RVGA 3F46A 1S2LA 3TFQA 5GZ6A 2PRZA 5B58T 1HETA 2E6UX 2NSYA 3R4KA 1SRQA 5KUTA 3VKVA 3BH0A 1K3TA 3NIBA 3GUUA 3M1YA 4NESA 2R96A 2OPTA 3KWJA 1V4NA 2Q2NA 3G0OA 1VHLA 1QZXA 1YC2A 4AYBN 1F0NA 1XHEA 1Y9JA 3DDUA 1P45A 2WTAA 3KTAB 3EODA 4O4LF 1ODTC 1QM5A 1UCRA 1ZCAA 2BLLA 3B9QA 4DYDA 1XZQA 4QOEA 1TKBA 1W25A 3UT5B 1FYMA 3E48A 1I3NA 4OL9A 4CV2A 4FB4A 3CPHA 4E7OA 2VO1A 2FN4A 3RHFA 2P4EA 1X19A 4IINA 2WB1A 4GOXA 1FE8A 2Q5HA 3K69A 3TKLA 5CBPB 2JCVA 4O3MA 1GL9B 1UDBA 4JGBA 1FTQA 1CP2A 2CDBA 4I50B 1DRVA 1AO0A 4Q00A 3S81A 3GCMA 4HNVA 1JA1A 4PX9A 4BX8A 2HHCA 4GR5A 4EVIA 5AJXA 3IO3A 2CEAA 3UICA 2ZI7A 1XRSB 2RHDA 2P77A 1ZRCA 5EZSA 1MB4A 4JI2B 2E37A 1UWCA 2CQ7A 3CN7A 4XIIA 4XTRA 5TY0A 1VJ1A 1FBSA 1WEKA 2NTVA 2GK7A 5BV0A 1E2JA 1KK1A 1PJZA 3RS9A 5CLLA 4BB5A 4Q01A 3S99A 4YY3B 4XE5A 4PYLA 5LB4A 1YHZA 2JAUA 2EJVA 4FHDA 3VDNB 1M1ZA 2LFBA 2GHTA 1E96A 4B32A 3WL4A 4C89A 4EHHA 2NUTB 4C5AA 4O08A 5EHQA 2B83A 1WZUA 5IT0A 4FFDA 4BXOA 4WBXC 3RF6A 5J9FA 2JQ7A 1LK0A 4ZP1A 1NXOA 1XN4A 2VJNA 2QN3A 1U3WA 3JQBC 4ISBA 1X8LA 5FIUA 5D5QA 4M76B 3A3NA 5KOHB 1U8RA 1IFXA 5A9RA 3FM5A 4QLAA 1TWFJ 3W1VA 1EJ6A 2AOUB 4E30A 4G37A 4QU5A 1M2VB 5E7QA 4JFAA 3MWGA 1PZGA 4Q1VA 3DXXA 2JGEA 5CNKA 3FZNA 2X8AA 3CZAA 1KO4A 1KORA 1PFYA 3A06A 9LDBA 1FVFA 1W7PB 2QVZX 1C7ZA 2XDVA 2JA6J 2IDJA 4I9FA 3OEEA 1MJGA 5HQ3B 3KT0A 4LSMA 3EQ6A 1MEJA 4DYHA 4J0DA 4IGAA 1I4LD 2HLHA 3I2GA 2IPNA 4MQ9F 1UDAA 3B53X 1QGUA 4IPAA 2WUWE 3W5IA 1TTPB 2OFPA 3QIVA 1PR3A 1EDZA 1TQHA 1Y3AA 1N3BA 1BC8C 1GAQA 5FXMA 4B5KA 2I29A 2PUJA 1K7CA 1ISRA 3RK4A 2ONZA 2PLRA 1LQUA 4HS9A 4KREA 2PUDA 1KJWA 3WYAA 2WHPB 4UUAA 3PENA 2O8FB 4HTAA 1IN7A 3LSKA 4TQUS 5HF6A 5CCXA 3MLAA 1Q1VA 3DM9B 4V2FA 4F60A 3ABZA 4I5EA 4IL6C 1HH4A 4ZT6A 1TM5E 3NVMB 2WJVA 1PYVA 2IU0A 3CO7C 5BN5A 5ICSA 3B3GA 4P5PA 2I2DA 4Q4JA 4LYYA 1WCYA 4DWJA 5J2UA 1SK9A 5DULA 4BE7B 2L2OA 4XFDA 1HNZB 2IXAA 2HUNA 4K9PA 5BT8A 2JIZA 2QUKA 4Q4AA 3CD6I 4WXEA 3QLUC 3DOIA 3KDPA 2UDPA 4ZI7A 4HXGA 4DYRA 3VDXA 1KNQA 1F6WA 2V58A 3HY6A 2VTBB 3BPSA 1TO2E 1GVJA 2R8RA 2A5WA 2E1MB 5F0CA 1JDPA 3BCRA 1Q84A 4EGYA 2XKPA 4N0MA 2QN7A 4X63A 2HJHA 3IT0A 1F36A 1VYHA 5B1BH 4OAQA 2W57A 1TFUA 3IJPA 2Y1FA 1GXQA 3QLEA 1GZHB 2HY7A 3RHZA 3MXOA 3JY6A 2RCYA 4NZZA 5DKFA 3TZCA 3RS8A 4I1SA 3DVSX 4RD4A 1ZNYA 3PQFA 5C80A 3L2RA 4C6RA 4L57A 3KFXA 1ZCBA 3BWVA 5JZBA 4E5YA 3DFGA 4WV3A 5ESXA 2PLWA 4CCOA 4QTTB 4GGGA 4Y7CA 4YJ3F 4ZYYA 1MIHA 3VC1A 3E3AA 5CK5A 4Y9TA 1PP8F 5F6FA 1XYVA 2I22A 4MJ7A 1WA5A 1KJQA 3FDJA 5IXYA 3EZ2A 4NENA 4EH1A 3WBFA 4MUXA 3FGZA 4BL0B 1XDWA 2C4TA 4U63A 4F5ZA 1JR3E 1EVIA 2VDLB 2WV9A 2ID7A 1XRRA 1EFPB 1H6CA 3H19A 2V7VA 4Q9IA 3WG7H 2Q0OA 2DMUA 3VOAA 3VTFA 1HNXB 2CNKA 1KOGA 3V4OA 4KI7A 1DQRA 4L6CA 1Y6RA 3JQEA 3E7XA 1DO2A 3TSAA 3U0BA 3GRFA 2OXFA 3H7AA 3QEBZ 4KN5A 4Z0PA 4DV6B 4C4AA 4RSHA 3M1EA 3OZFA 2AH5A 2B8NA 1D0IA 3VSKA 5JYEA 2VXOA 5JXHA 1C7IA 3K4NA 3LV8A 1W85B 1BXGB 3WLFA 4A8JB 1RD4A 3KYDA 3GLIA 3QGMA 1RQLA 3LOPA 2WYIA 4RK4A 4LBVA 4B40A 2FQQA 2Q4OA 4TUYF 4NULA 4X85A 3PC3A 4PIPA 1PJTA 1EDDA 1JZTA 2AQIA 1DCFA 2ID8A 3QE3A 3JALB 1F12A 3AY0A 2XIQA 1TTQB 3S44A 1YMUA 2FP3A 2P7HA 5J8FA 3CMCO 4FEYA 1GA6A 4TWZA 2W4SA 2BV3A 5BNZA 1QF7A 1N0IA 1UZCA 4MW6A 2BE5F 1GPNA 4XM1A 4LMAA 1WZ2A 1RTKA 2PQMA 2CHQA 2HSDA 4QBHA 3G5UA 4ZMSA 1N2CB 3N7UA 5ER6A 5HMLA 2QVXX 5JLWA 2FR8C 4E3WA 4X1YA 3KTFA 5JJIA 4GL2A 2G9RA 1PGQA 2JIRA 3U9SA 2O1EA 3L8CA 4MQFA 5J40A 1MCZA 3TW8A 4A6EA 3W8NA 4X3CA 3UOGA 4KR2A 3R9XB 3I3SR 3H86A 5FOVA 4H7DA 1VIYA 3I0TA 2DSNA 4XGQA 4D0LB 1SZPA 4WOJA 4QO7A 3QRWA 2VUSA 5DHFA 4P7BA 1JKRC 2QB5A 3TXAA 3HXQA 4HDSA 4KWEA 2OAZA 4FYXA 3PQ6A 5NULA 3K1NA 1HL3A 1XJWA 1UM9A 4RIFA 1VCIA 3NHLA 3D4NA 4BKPA 4G5QA 1CHNA 1UP4A 3H2BA 4RF2A 3UJAA 2XR1A 2FK8A 1OHHA 4I8DA 3RAJA 3ES9A 4YT8A 4OINF 5I6DA 4LFBB 3WJAA 1N5OX 3H9QA 3TS1A 3KB2A 3JS5A 3LUJA 2D1RA 2Y0BA 1SMTA 3F6SA 2R85A 4IW3B 1HX7A 3W06A 5JAMA 5C3EJ 4TTVA 5KQLA 3UUGA 2YXEA 3JYOA 4P38A 5JMWA 1Y5IA 1Q6YA 1WHUA 4HWKA 4JC8A 5FOQA 1CUDA 4OX9B 1Y3IA 1OWMA 3HP4A 3OCJA 5JH7F 1OY1A 1C7FA 1P5ZB 4XSVA 5U1PA 3M9AA 1TECE 2IZ1A 4E4YA 3WE3A 1SELA 4O4JF 1TA9A 4UEKA 1M8JA 1VKOA 4HG2A 3HJCA 2Q3FA 3TO5A 3H2IA 4EG5A 1IZYA 2FW0A 4WY2A 4C43A 3NB0A 3SFVA 5FTKA 2I67A 3D3WB 4JYBA 5ECGC 1Z88A 3JAKA 5K6AC 2C4HA 1JG1A 1RC0A 4W82A 2HZBA 3EEQA 2FQ1A 3BD9A 3TG8A 2MR6A 4M0LA 4R8SA 2WDZA 4RWZA 1J0BA 2NU6A 2EJCA 3BWXA 1H8HD 3TOXA 3RU7A 1P81A 1M72A 5IVIA 3UB3A 4HNTA 3KUCA 1EP3B 5LUAA 4Z7JA 1Y8ZA 5WRFA 2GH1A 1T43A 3P5BA 5IULC 4JZKA 1H0HA 2WE8A 4BUJA 1CUFA 5EIAA 1L4KA 2YVLA 1C1YA 4G6DA 1XEFA 2QUIA 1TO6A 4IX1A 3G9XA 1KZ7B 1K4TA 4B2IA 2ZCVA 3M8JA 4CMGA 3HDVA 3QXGA 1V25A 2DULA 1R0ZA 5JFTA 3TD9A 3MKWB 5KYWA 5FV7A 4OXYA 1W48A 2RI0A 4MUNA 3OIGA 1QHSA 3S2ZA 3H0DA 2GYYA 3ROGA 3JZFA 3QMWA 3GHHA 5ERXA 4WLNA 4X92A 1BW6A 4F46A 3OLVA 2NXNB 3H4MA 3ZEIA 3K6KA 1OAOA 4TRRA 1Z5ZA 5T7BA 1RHJA 6PAXA 4EITA 1FTSA 5CEFA 2O2YA 3SX0A 2WAQA 4YCCA 1O94D 4CN9A 4ZI3A 3OFND 5JD5A 3H13A 5HP4A 2HYGD 2Q1WA 3OYDA 2GK4A 2C54A 2NS8A 4C14A 1XK6A 3HH8A 3FPHA 5LQKA 4KNVA 4KR3A 1SD2A 2AUNA 2VKTA 4Y6SA 4HEA2 5JASA 1QE5A 1ZJZA 2YRFA 1K9VF 5LDGA 4C7OA 2GJAA 1VL8A 5DJ5A 1DHTA 5JD4A 1K6MA 1NN5A 3EXIA 1B2LA 1RWOA 4DQXA 2ZKLA 3KOZA 5EZQA 1OFTA 2G9WA 4G12A 3EC1A 4NCAA 2QWXA 2B9SA 3PPXA 2GCNA 3NJRA 2RAUA 2GM9A 1E1YA 3P4XA 1SU7A 1DQNA 3AEUB 4K87A 5FLKA 5I47A 1LDNA 5A4DA 3DMYA 3HSYA 4NV0A 5JJLA 4N9WA 1BDIA 4UNQA 3Q7TA 5KVRA 4BLWA 3I4PA 4GPBA 1YVUA 4DOMA 4WX9A 2HMWA 3VKWA 3M1CA 3K2IA 4YAUA 1GU1A 1UMBA 2YJ6A 4CKEA 2JVIA 4LHZA 3I6MA 1KE1A 1FLAA 1T36B 1W87A 4Y2QA 2V0GA 1J0RA 3GW8A 5K51A 3AT1A 1U2PA 1NKVA 2I9PA 1TC3C 1BRTA 2ABWA 2Q0HA 3V7CA 1UPCA 1Z2EA 4GOKA 4A4DA 2CKDA 3K70D 2G80A 3QEMB 3A36A 5IJWA 1F2DA 1YSCA 4AWXB 3N0XA 1YMQA 2ZYRA 3H9BA 4RIHA 4XL9A 3NBXX 3E27A 4Q9AA 1KSFX 4IIHA 2HKIA 2GCGA 5MF6A 3R8FA 4RGQA 1RHRA 2MC4A 1SFXA 2VYNA 3LX4A 2NU7A 2JPCA 3AEKA 1FSHA 2ZT8A 1VL6A 4JK1X 6GPBA 4LOAA 1QHHD 4EZEA 4YRRA 4GM0A 4F71A 2C9MA 5B66C 3ZZMA 3NV7A 4MVYA 2GTHA 3NFYA 3PIOF 1WLSA 1LI5A 5HLIA 2B30A 4WWHA 3NAGA 1XC7A 3TEJA 1JVBA 3S14J 4ON0A 3QU5A 3LQFA 4AS3A 2BWJA 2BE9A 4J00A 1MAUA 1E3WB 4DJJA 5C52B 2JEZA 3PDUA 2XCTB 3G3ZA 3KJHA 3EY4A 1WMDA 3K9BA 4XD7A 3OZEA 5FROA 2VJ5A 1R0BA 3D8NA 2PT7A 1HT3A 4RAFA 4YAKA 3EJWA 3OPYA 4FMCB 3JR7A 2VUIB 4AJNA 2C5HA 3SR4A 2C9OA 1TCCA 4JB0A 1POGA 2MLKA 1C7EA 3L00A 2XT6A 2X9NA 5AI8A 1HFEL 5H3LA 3IH3A 2VPWA 4LC9A 5JFRA 1IO2A 3EIUA 2IA1A 1R3UA 3WJ7A 1UFOA 3CCMI 4L4RA 1M34B 1OA1A 1K4KA 4N0QA 3KQOA 1RP1A 3ZH2A 2H1LA 2EX0A 1UODA 1U98A 1TMYA 4LJ7A 1O3TA 3BMCA 1KOFA 2I9KA 2RH4A 2OZLB 3B12A 1ZK0A 3O83A 1CEYA 3WGTA 3W3AH 5C5EA 4KI0A 3PNPA 1HZZC 2ADOA 1YDHA 3IS3A 3T06B 1Q1ZA 1XR3A 3BF7A 5AHWA 2D1QA 3BTSA 2IBMA 4JJIA 3U1DA 4L75A 4MS1A 1EZ1A 1UC4B 1HBXG 3E0QA 1OISA 4DT1B 1B14A 2V7EA 1Y9EA 2KM1A 3CSSA 1R9NA 1LS1A 4TS1A 1EM8A 2JH9A 3BMXA 4EY6A 1W4BA 2XGEA 4GMFA 2MG4A 2VNJA 2EPFA 3HZHA 3LP6A 4MQMA 3KHUA 5GVRA 2LYCA 5HLGA 1U3DA 4L16A 1UK8A 1U3EM 4DWOA 2DBYA 4K1XA 2H7CA 4U0WA 1TVKB 4A16A 1F8FA 3ICCA 1YCHA 2GXUA 1B6SA 1QKJA 3LAPA 2HOAA 5CDTA 2IIQA 5COBA 1G8FA 5KS2A 3EUHA 2A9RA 1ORDA 2NOAA 5FR1A 1MABA 1JW9B 3K1TA 3ND6A 4YFKF 3B6JA 4E2FA 1TEHA 3ZGYA 1USKA 5T8KA 3CF4A 5IYCJ 2ZR9A 1SG0A 1XFAA 1N2GA 5K20A 1M10A 2FMIA 1ZTRA 1E94E 3H3XA 1ZNZA 1QX4A 1XNGA 4CG3A 1ETXA 4LB5A 2XYGA 1FY2A 4MR7B 2IQIA 5CFRA 3IFSA 1SVOA 3H92A 1VG1A 1ZJ4A 2O2HA 2VKVA 2VHJA 1JXOA 2RHWA 5T5QA 2FUNB 5IK2D 1V9SA 3QG5A 2FPUA 4MLCA 2NVOA 4KXQA 2LTAA 1XA4A 1WSDA 1Y9DA 3FCOA 2ZYVX 4D6XA 3NM6B 2YX7A 5KQMA 5IARA 2WU4A 2H0AA 1E1MA 4UCWA 2GN1A 1WBBA 4Z3DA 4XFKA 4MARA 4OAYA 3KSUA 4R69A 3PC6A 3NO4A 2CN1A 3W4JA 1G59A 1GKUB 3K6SB 1GG5A 2HRCA 2IEDA 2CFOA 4R01A 4WBNA 2A35A 3DDWA 5GADJ 4C05A 2FHPA 5JROA 4LZJA 5IUKC 3DDZX 1Q3TA 4P0PB 4ABZA 1SBZA 2FCRA 1KEVA 3PHBE 2VPPA 3FPSA 2QLBA 3SN6A 3L7KA 4MVJE 4G5XA 2ZRCA 4H3SA 3QNMA 3O31A 1ZZGA 3FD8A 3PUHA 3V2IA 2MW8A 4F9EA 5K0SA 2X4HA 3WHIA 4JC5A 1ADFA 1XZPA 2Y0DA 4J49A 4HAIA 4ONEA 1YFZA 3RV4A 1OCEA 2HT6A 1JAXA 4JC0A 4FYIA 4DW8A 3R4VA 3Q9SA 3KP3A 1LPBB 3EE6A 2OBNA 1UWKA 3JCZA 2X8JA 1U94A 1D8JA 1S0UA 2Q99A 5IT9K 4OQFA 2VUHB 5J43A 4L9VA 5F9FA 3DBOB 3GB9A 1ZG1A 1I2AA 4CODB 1GZ3A 3OHMA 2IZ7A 2KISA 4WNIA 3RFVA 3LZ6A 4DUZB 5G0UA 3QE9Y 4RA9B 3ID6C 4ZYVA 1SK8A 4I0BA 3SLRA 5H68A 3TSYA 2M32A 1BEUB 3WG9A 1I1NA 3O8BA 2XGXA 4QM7A 1SUBA 2O3SA 3EYIA 4A91A 1FIAA 3UNXA 5HQJA 3WWPA 3N75A 3D7LA 3OQPA 1JR4A 4GICA 5B1SA 1XVVA 3T8YA 1S7OA 1BI1A 1JSLA 4BGDA 3F72A 1OX5A 4OXIA 1JTXA 2EINH 4AICA 3M49A 1GZ7A 3W6OA 3MXTA 5IJ9B 4WECA 2AJCA