1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
b'SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphofructokinase
publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
3U39A 2IZ6A 4U1RA 1KZHA 4KXMA 5ITSA 3F5MA 4P5EA 1T35A 4NPAA 2F2TA 4FYIA 3MAJA 4KXNA 1S3FA 1YDHA 4I4IA 2F64A 2A33A 1S2LA 3OPYA 4LJKA 3O8OB 5AJTA 4FYKA 3SBXA 1F8YA 1RCUA 3QUAA 4OHBA 1S2IA 3O8NA 1F8XA 2F62A 4JEMA 1ZXXA 2IZ7A 1WEHA 4MEJA 4A3SA 4LJRA 3IMKA 4MCJA 2F48A 3UQZA 3PFKA 3OPYB 2Q4OA 5AJUA 2Q4DA 3GH1A 4HX9A 1S2DA 3K2QA 2F67A 1PFKA 4OHRA 4JENA 1MTOA 2KHZA 2A0KA 4JELA 4KXLA 2PFKA 4FYHA 2NX2A 3BQ9A 1S2GA 3EHDA 2HIGA 4RH3A 2IZ5A 3O8LA 4I36A 4P5DA 4WL0A 3HNOA 2PMBA 4LJLA 3O8OA 2KLHA 4PFKA 4I7EA 6PFKA 1WEKA
chains in the Genus database with same CATH superfamily
1WMSA 2YX1A 2JG3A 5KTYA 1R4ZA 3GHYA 3FGOA 4KUMA 3LP5A 1MX9A 3KUXA 4EA9A 1HNWB 4XOPA 3NHLA 2QX8A 1GFZA 2IRFG 5HKKA 3B70A 1Q83A 3G0GA 4J0GA 3DW1X 1TB4A 3BXOA 3F6YA 2FPLA 2P1ZA 3WLNA 4MV4A 4KXFB 1FTGA 4D3SA 4FJ2A 3Q1KA 4PZCA 3ETEA 1QZYA 2VBGA 3GMTA 4P53A 1ZRHA 3GTQJ 3PUIA 4I1SA 4O29A 4FGZA 2XA2A 3MJEA 2F7SA 3SQWA 1EXVA 2XAAA 2G63A 2OUKA 4B71A 2G67A 4GMGA 3AP1A 3O8QA 3AJ9A 4FHZA 3RI3A 4XZ3A 5SZHB 3V1LA 3ZN1A 1AHDP 2DSTA 4ZWNA 1H2RS 2AB0A 3NI2A 5AW8A 5H3CA 3K31A 1G18A 4TKVA 3BD8A 1N2BA 2PS3A 2VWHA 3NTRA 2H09A 4J7CA 5FBLB 3VYSB 5LWQA 3FH0A 1PUFB 3KCQA 4S0XA 2V9VA 1VIYA 4P33A 3KFWX 3CTPA 4TUYA 1AG9A 3WTSC 4I8DA 1YMQA 2VOEA 2VI5A 3HB4X 4CCWA 4BX3A 3PDIB 2CJFA 3QI2A 4GD3Q 2BGNA 3SK0A 1TF7A 4FYXA 5F23A 4N9IA 4GE3A 4V38A 4EELA 4W1RA 1DAKA 3EVNA 4QBHA 3VSDA 3KAKA 4RD2A 2DWCA 3LT2A 2QY6A 2FOIA 1ZH8A 1M2FA 3JQAB 2E37A 4TLLB 3MWDA 3RE1A 1UPCA 4RAGA 1KFKB 3MUFA 2YIVX 3TR6A 2IE8A 1OFCX 4C2MJ 4DGQA 3RRBA 4O3MA 5CVEA 3TW7A 2OCXA 3QP9A 3ZCQA 4OIMA 1FSSA 1D8JA 4D0NA 4YRMA 4QVGA 2WF7A 2BCGY 3LQRA 2FHSA 4BO0A 3TJMA 4L9NA 1PCXA 2B8WA 2XITA 3WIEA 3A4LA 4EJSC 1YE3A 4AG6A 1YBMA 5FO0A 4H6PA 4YUYA 1N5RA 4MTLA 1TYCA 3L84A 1SUEA 2IXTA 3Q7PA 3TQRA 1KWKA 3LKZA 3PL8A 3MQ2A 3GNTA 4EUSA 1J5YA 2BI4A 1OWLA 2VDWB 4MW4A 4DW6A 3IE0A 3A9UA 1CDEA 2WILA 4FWIB 2X48A 4CIAA 1TM3E 1ISHA 2OG1A 2F8MA 1PW7A 2BGCA 4NYIQ 2DA4A 1BTOA 3CNNA 3GROA 3SFVA 1T3ZA 2DTEA 1BA2A 1JDBB 3VNUA 4ENVA 1N5LA 2WIKA 4ZYGA 2Y27A 3Q3SA 3NHPA 5B64A 1NNI1 1E2XA 5H3HA 3LA3A 1VI2A 8LDHA 5M3BA 4CZ2A 1INLA 3HN6A 5HF5A 1E3PA 3R5TA 2WA0A 1JR3A 2OGWA 1AH2A 1EG7A 1A96A 3CNLA 3AXTA 4KV7A 1ZQ3P 9GPBA 5JLJA 3HDHA 1FP6A 3BAZA 4Q3BA 2VPWA 1HDOA 1YS9A 2IAIA 3T3OA 3EEFA 1IZZA 4Z2YA 5HJ7A 1U7TA 2AD5A 2XASA 2Y1WA 1Y1TA 1Q7BA 1YQ9A 4OL0A 2OCAA 2CLIB 3DFUA 3JREA 2WF6A 1ZX1A 4A3DJ 1JEYA 2QV7A 5I5GA 4MA5A 4IMPA 3GLQA 4TROA 5JXWA 1ZOPA 1WI3A 3EZFA 5JJLA 1JHAA 3CJTA 2XBLA 2OYCA 5HP4A 3OYMA 2OOSA 3OP4A 1DJMA 5ITSA 3RYFA 1R64A 5K99A 4QUDA 4BDSA 3SXUA 1IBLB 2HLDD 3TB4A 3KYCB 2IV2X 2WF9A 3GDWA 4L4ZA 4O2BA 3MKZA 1ZISA 3SC3A 4ML3A 3ROZA 1HYBA 2GTIA 3HOZJ 3IEIA 2Y67A 2HQNA 2OQIA 4B6EA 2E4WA 2FQYA 1CJUC 2FN7A 4EI2A 2ZU0C 3H86A 2WD9A 1WY7A 1AU7A 3RCOA 1H3EA 4OFZA 5BWOA 3AEXA 4FNGA 2Z3WA 5F0CA 4TZTA 5AVRA 2XGMA 3W77A 5TPWA 1QHXA 1JLMA 3LKVA 3KZIC 4L8LA 3VU0A 1F6WA 2R6DA 4ENNA 2IVFA 4NBWA 1WUKS 3HGYA 3U3JA 1IOVA 1UJ2A 1OWOA 2EOAA 3CMAI 1OHHD 3BF8A 1UKAA 3K1NA 4JFAA 4WJKB 3HKEB 1D1CA 1F9EA 4UTZA 1DO0A 2RK4A 5T7BA 1YQXA 2VC1A 3JVUA 2OAGA 3DL4A 1E99A 4HTAA 3WYDA 1VXOA 4MS4B 3HVHA 1E3DA 1G6KA 4LPSA 4O6JA 3KAJA 4BVHA 4OQZA 2WU1A 5CBKA 2V7PA 1SXHA 3AMVA 3EIHA 2VEDA 1I8TA 4EB8A 4WZAE 1RLIA 5JO0A 2C4WA 4MCAA 4INJA 2XAGA 4ZHSA 1UJ6A 5CB4A 4HGQA 5JAMA 2GUGA 1NZJA 3ET4A 1GL3A 4YP0A 2BYVE 4CXFA 1IPFA 2PQMA 1M1YE 1ESZA 5DNCA 1EFRD 4WERA 1ZOSA 3JZIA 2O06A 1N5JA 4TS1A 4FC6A 1NKVA 1UAYA 3MVPA 4QPNA 5DYYA 2JLSA 5H1YA 4U8HA 821PA 3G6WA 1J9ZA 4TZ6A 4UNQA 1PBTA 5E6SA 1BC8C 3OTHA 1QIJA 1OZAA 2ODEA 1JDNA 4FT8A 2YIJA 2X9QA 2EIHA 4BLTA 3RU2A 5LPNA 3HN7A 4XWTA 1L5ZA 1FJXA 2BEVA 2M8EA 3ZCOA 3EETA 1TWFJ 3FBGA 3ZS8A 4M9ZA 1HETA 1MQAA 4FUQA 1LFDB 3FF5A 4CL0A 1HOTA 3KXPA 2W6QA 5EP1A 1JVBA 4KQIA 3DYBA 2Q2EB 2CYYA 2C2MA 2ZXIA 1J0DA 1PYDA 1SUIA 3DEEA 4KISA 3CVJA 4M37A 3OZCA 3QYJA 4PBRA 3ZCPA 2ZOSA 3T12A 4YCMA 1Z6RA 3EH1A 4ZAXA 4MJ3A 2YIMA 4F2HA 1PR2A 3IO3A 1XRQA 3Q3HA 1REPC 1BCRB 3TMOA 4JMLA 4HK4A 3PP8A 2M9HA 4HYQA 3IDZA 3IVMA 1KAOA 4LJ4A 1G291 1XA0A 2Q4TA 2EYQA 3LNCA 4CT5A 2O2GA 5IZ4A 1HBJA 2WTXA 2QEXI 2FQQA 4B74A 1FW6A 4YALA 4UDOA 3ZRGA 5K5RA 2WU3A 3D3KA 3M6WA 1QZEA 2AWNA 2ECBA 1JT2A 2QU7A 3UJHA 1JRLA 2GARA 1YBHA 3S2FA 5J1UA 5KVVA 3RDIA 1GZVA 3VSCA 3MWJA 5CU7A 2XRLA 2IS6A 4F9GA 3GCZA 4RFSB 1RQPA 1R2QA 1Z88A 3KZMA 5KSWB 3DEWA 2EFQA 1N9GB 4U0VA 1TZLA 2W0MA 3BZ6A 4YQEA 3DTEA 1M5RA 1S29A 4WJZA 1DBPA 3WMEA 1NURA 1N6KA 1GTMA 1KONA 3AVVA 3JRFA 3TD2A 1B6TA 6REQB 1PJZA 5DX8A 5AJZA 4CQMB 3NIDB 1BIFA 4H0EA 3CJRA 1CHNA 4V0MA 2SKEA 1WVGA 1UKEA 1CUHA 5GVRA 5KCZA 4BO7A 4TV9B 1UCFA 1C4WA 4FMBB 2H1RA 3DE1X 3FNBA 1C8LA 4IIDA 1FRQA 2DUNA 1Y5MA 2B30A 2LREA 3L7YA 1ECPA 4RC9A 1NG6A 2RAVA 4N0PA 5EKTA 1CY1A 5FBKA 1N2JA 3R20A 1XMIA 1JIUA 5K3SA 5JCXA 1P6XA 3C2GA 2OA4A 3WC4A 3FPEA 1IPHA 4B34A 2JLWA 1P0PA 4A8JB 1JKQC 4O2AB 4WGGA 5ALFA 2PT6A 1WMAA 2C2OA 3ZNNA 3VM6A 3U26A 1DBQA 1R8SA 4HWKA 1XPRA 3GVIA 1KEVA 3BY6A 5TS2A 4MI9A 1W9HA 1DDOA 3A2KA 2YCBA 3U6BA 2Y0SA 3LF1A 4TLBA 4WK4B 2VDLB 1QCZA 2HZBA 5GZ3A 2YVLA 4CLXA 2GEBA 1EVZA 4BUZA 1B14A 3LXRA 1H1LA 2ADFA 1NZDA 3VDXA 3URKA 3DA8A 3CVUA 10MHA 1LVHA 1IWPB 4QLCU 4MIMA 4QPJC 3GRUA 1A7KA 2JK0A 4LY3A 3GJRA 3NTOA 5EIHA 4D0GA 2A30A 2H2IA 4DCMA 5DLQC 4BAZA 3ZDZB 4X1KA 2EFDB 3VSBA 3PUJA 2WHXA 1QVVA 5IP9J 1B8IB 4B7AA 3V8RA 5CG1A 3P45A 4D5FA 2IOYA 4K88A 4TSKA 3ILHA 3RS8A 4NJEB 2BDUA 3RASA 4UXIA 2R7NA 4RVDA 3WMFA 2P5TB 4HAVA 3K9QO 4MUEA 1VHLA 1S2DA 3IEMA 1QKJA 1ZGZA 2ERYA 4NDNE 2YS6A 4HNUA 4W63A 4OATA 2KMUA 1LZLA 2JBAA 3OYCA 3DZCA 4HLDA 3PO3J 4OLJA 2QN9A 4ZI7A 2D5AA 2WP0A 1HFJA 4CHTA 4N49A 1DC4A 2P8SA 5YASA 4XLCA 3H11A 1FFXB 1A9YA 2JARA 3GDHA 2OBBA 2JZCA 2HEGA 2ZJ4A 2O14A 3OU6A 4DLYA 3H3UA 3K72B 1G1AA 2XB2A 1G64A 1NBWB 2BFOA 3GC6A 1X9GA 3CZ6A 4UBKA 4DCCA 4DLUA 4H1HA 2FCAA 5EE5B 4WNCA 4CI0B 2BUBA 1PR9A 4U2BA 4PLCA 5BWMA 3AOEA 3HEBA 4TV9F 2ZP1A 5A7GA 1FMFA 3KKEA 4CMCA 2EHDA 1NQVA 4EGFA 3KEYA 1SELA 1M83A 1YIDA 2AE1A 5CVDA 3GLIB 3MWEB 3IJEB 1USKA 4RGUA 3GDGA 3PC2A 5HWSA 4RABA 3WSWA 2HKIA 4O2AF 3CCUI 2ZIVB 2DKNA 1U8FO 3MD9A 3BGDA 4FHFA 3CX7A 4EARA 3SXJA 3N2GA 3REGA 2BOVA 4NHJA 1A9PA 1U0SY 2C4HA 2VRWA 5AIPA 4UEJA 5EJ8A 3AG3H 1MTZA 4ZEMA 4NPHA 4AX8A 3K7EA 4E11A 4Q4AB 1WJCA 2OO5C 1Q20A 4CLOB 3MINB 3BWCA 5EINA 3LYHA 3EQLF 4M87A 4HEA6 3KBBA 4KIUA 2JATA 4PIVA 1G60A 4B3AA 3K9FC 2I10A 3T5GA 3TSOA 3ZMSA 2K40A 1ND5A 5AI5A 2G04A 3L6DA 4OI2A 4F72A 3EBOA 3DAPA 4JLSA 2IYWA 2UZIR 2NXNA 1O8BA 3K20A 1CULC 2O7OA 3NUQA 2OCLA 3RKXA 2UUPA 4RYLA 1QRAA 2XSDC 2IJLA 2D3TA 2QIOA 5BURA 4KQJA 4TTRA 3HA7A 2ZIUB 4PXSA 2W2XA 1BJRE 4KXMA 3S2IA 1Q15A 4QPOA 1CUCA 2TMDA 1JHYA 3HDTA 4BNWA 3HTSB 3A31A 3P2JA 4YJ2B 2P4QA 3RVJA 1Z26A 1N3BA 1WE2A 1ZCBA 5ENZA 4MO2A 1L5HB 3V1YA 4D9MA 4BB9A 2X2EA 2HK9A 1T43A 4GECA 2FN4A 3OYLA 3II6X 5IPFA 2JRTA 3BMCB 1ZKGA 3L2RA 1H9AA 3WB1A 3RRYA 2ZJ6A 2FMIA 4ER6A 1U0OC 2BLNA 5L3QB 4GUDA 2QTTA 3TW4A 1A7JA 3ABRB 1Z9CA 3FHJA 4FILA 2HVRA 2QM3A 3PHHA 2NPIA 3QVLA 4UVAA 1SVWA 5E38A 1WVMA 2XMSA 2J0QA 4A3MJ 5G0VA 1QU3A 4Z1MA 3E8XA 1EBUA 3HJEA 2HXOA 4DLXA 4RPJA 2EFOA 5FPSA 4LV6A 3K9GA 4F2DA 2WK1A 3EGIA 2BSAA 4XGIA 3ZCXA 5U4QA 4GI5A 3BSYA 4OP1A 3G68A 3PXGA 1C0LA 1LK7A 2HOTA 1AQLA 4NE7A 2GA8A 2EERA 3QVGB 2JAHA 3K5WA 3IKMB 1G19A 3LHSA 3TZ6A 1D2EA 5EJAA 4E5DA 2H18A 4CUZA 1CP2A 2IS4A 4NV1A 2ERXA 3KV3O 2R5WA 4OQMA 5DJ5A 1T6SA 1DTWA 2ZVPX 1WJDA 4TXJA 4L9SA 1NUAA 2Q28A 4XFKA 3M5CA 4GAEA 1SKQA 3PKIA 3SF8B 3CVWA 1C4OA 3G8YA 2YZKA 1FFDA 3OSFA 3Q3JB 4IOLA 5C80A 2BHLA 4IHTA 4WCFC 1GGNA 4ZA2A 4RVGA 2BM9A 2RVCA 4KQWA 3U3DA 2ZQZA 1EDBA 3TUJC 3NWEA 4ZVVA 5EXPA 4MRMA 3MWGA 3L5OA 4MVWA 4JNKA 3BBPA 3T41A 4LJ6A 3O92A 1LBSA 3TOBA 3JRBA 5EUCA 2ISSD 2QSYA 3U9SA 3I2IA 3BERA 4LLLA 1Z5WA 1HE8B 1R1UA 4QDJA 3MD0A 4R8RA 2Q3LA 1BSVA 5H9VA 3SKXA 4B85A 1DCFA 3WXMA 2WAMA 3X43A 1W44A 3IS3A 2RREA 2HWXA 1J5EB 4TTQA 1OKKA 3PK0A 3IIIA 1O97C 2IE0A 1TRKA 2B36A 2JIPA 3GPIA 4G81A 3DKYA 4UHHA 2EKDA 4OAZA 1AJEA 3V3TA 5F4ZA 2QGFA 3WLQA 3RPUD 4X1YB 3CGWA 3ZMTA 3DV9A 2H3HA 2UV1A 3HZOA 1E0AA 1CUXA 3DBHB 3LK7A 4C88A 1S1CA 3OQBA 4RIIA 4GI1A 3PF8A 2PD4A 4DV3B 5IASA 4ZO7A 3EIFA 4YJ2F 2AG1A 4B2IA 2JBWA 2EL9A 1V7PC 1K7AA 2YY5A 1PLJA 4XB2A 1P75A 2AEFA 3M2TA 2RDPA 2ZFWA 4TWBA 1XLUA 3WRXA 2OGZA 1X70A 1II0A 1YA6A 1OR8A 4ND7A 4HBZA 3JD4A 1X7WA 2EKZA 1XC7A 2VSFA 5KNCD 2CUTA 3PKJA 1KL7A 1HXDA 2WT8A 1V7QA 4IM7A 1QAQA 5EJ5A 4CM7A 3OZTA 1X7GA 5HK9A 1NPTO 1BS2A 1JHVA 3TQTA 4XIDA 4CDMA 5B1IA 3HTXA 1Z36A 2ICWG 2B1JA 2JLRA 4C4PA 1E4OA 3RODA 3U4IA 2VR1A 5LQNA 3BXXA 4WNAA 3LHFA 2PVSA 5TPZD 2EV9A 1ZIOA 4TQ9A 4LNUA 2AH5A 3SM9A 4BTEA 4BFWA 4MHSA 2IOQA 3EQ7A 5E8JA 4M83A 3RKQA 3ZKAA 5F64A 3DWIA 4MVCA 1ZOLA 1NMQA 1YD7A 5BQ3A 3W0LB 5ICEA 4BQFA 2YC4C 3BA1A 1IVNA 2O03A 1B43A 2BFCA 4E14A 2FFAA 5JD6A 3KPYA 1V11B 1X3ZB 1DI0A 4JSYA 4CW7A 2WV1A 5CB8A 1IUOA 3MKYB 3PQ7A 3QFSA 1F8GA 4Q7LA 4EB6B 4KPYA 1EJ2A 2PZJA 3GLGE 2Y0PA 1KAMA 4BWGA 2JIZD 3IX7A 4XFDA 1ZCAA 5JC1A 4YYEA 1W4RA 1DC3A 3ENQA 2QM0A 3ZS9A 1GSIA 1V7ZA 1T0PA 1BWSA 3CRW1 3DUFA 2Z3YA 5JRDS 4LJRA 4UNOA 4FJ0A 1KDOA 4N65A 3LSJA 4ZQBA 1WQ1R 4BQEA 2WTAA 3D8SA 4HL6A 4DQXA 2PXHA 1SY7A 1JBQA 2QQFA 1P4GA 4WACA 3QU7A 3W2TA 4NL4H 1MGTA 1RABA 4UAJA 5CLFA 2ZRGA 3I9OA 1RI2A 3FHCB 4NX2A 1GN9A 1II9A 5EJIA 2ZCWA 3K9NA 4QRIA 1L4GA 1VQ1A 4J6EA 1RMQA 3JQ9C 4DA6A 3RD5A 2DFHA 3WGJA 1JFFA 3CLOA 3FSGD 4QBFA 4P54A 3EIWA 1EGAA 1IUYA 2IIBA 1NAHA 4MTEA 5ILQA 1YASA 5CA1A 3T9AA 3HCPA 1Y3FE 3QQPA 5IYZA 1MFZA 4DYHA 4E2YA 1BFDA 3H65A 1NVTA 1I1GA 1WZCA 1SXJE 2R25B 3EY9A 4WX2B 1H2HA 4LMPA 2C0QA 4IKEA 4YCBA 1DRJA 3BJAA 4PPGA 3T1NA 4JU8A 4AICA 3LUGA 3DTVD 2NXCA 1CRZA 3LX8A 5GOZA 4TV8B 2ZM5A 3P9CA 1I6WA 5DT2A 1IUFA 3AF5A 5AIAA 4ZYYA 1LTKA 5KYNA 4IP0A 4PNEA 1MO2A 3DXJF 3EAGA 4KMOA 3CKYA 3UK6A 2PBLA 4CE6A 5LMNB 2Z33A 4K2HA 1CJMA 5CJPA 1ZD9A 5ED4A 2W6ZA 1GTVA 4J0QA 3I73A 3D6HA 1S9DA 3I0NA 2B9VA 2GWHA 3MMNA 1U7OA 4PAMA 5L7TA 3LUHA 1DJNA 1D03A 2HA0A 3IILA 4RU1A 1SCQA 1PR0A 1HLGA 1BCSA 3J80A 1WOYA 3KP3A 4YI3A 3W5CA 4YLYA 1Z0SA 3Q41A 4DT1B 1C3OB 1RP1A 3VDMA 4XR6A 2NZUG 4ZEOA 3QUTA 3A4CA 1LKZA 3W3ZB 4KI0A 1D3AA 2O8EB 1E2NA 1TK9A 1E1LA 3FWEA 4Z4QA 4NATA 5CFOA 1UMBB 3LMMA 2G83A 1P7PA 2JIDA 4NQWA 5AW7A 1WZ2A 4Q3NA 1WB9A 5E1ZB 1NBOA 1XCOA 1UMQA 3RARA 4ME6A 3IQXA 1EQAA 1QK3A 1JALA 4YV0A 4KVZA 1O6BA 4NQZA 4TMYA 2PGJA 2YZMA 4YRCA 3TKAA 4JBWA 3PSIA 1IO2A 5DI3B 1C7QA 1JIJA 2CDCA 3KJEA 1XMAA 2EFNA 3PGLA 1ISFA 1S2GA 4YO7A 3RSFA 1E2LA 3PTZA 4R5MA 3VSEA 1TM4E 4JX8A 3ELDA 2YMPA 2OUMA 3WLIA 3G4SI 1MVLA 5G41A 2LPMA 4Y6OA 2F1HA 3DM5A 2MH2A 2D8MA 3L0YA 4TSFA 1S3GA 3EC1A 4CEHB 3GFTA 3WLOA 1LUAA 4XLZA 1BJKA 1OFUA 3KR1A 3OQJA 1RXEA 2Q62A 2FRDA 4LI0A 4HFMA 1T3GA 2FPGA 3CHYA 3JZMA 5HGJA 1SC9A 1CNEA 2FCRA 1P7CA 2VSNA 4IOKA 2R7XA 3QSYA 4KTVE 5L9AA 4AY3A 5J2TA 2QTZA 2RMKA 3Q6MA 1HLFA 3T06B 3ZZMA 1DIBA 4MCJA 3O4GA 3ZY4A 2Y71A 1VJTA 5HFNA 4CMKA 3V2UA 4O33A 3UICA 2WHYA 4GFBA 1XVIA 1F38A 1Y5RA 3OCVA 2V96A 4HYYA 3FTNA 1F36A 3MWLA 3R3WA 3D1JA 3ASVA 5HM6A 3HXKA 2WYVA 2I80A 4HF0A 3FFAA 3NC1C 1JV2B 2B63J 4MS1A 3TZBA 3AVQA 1O1YA 1UINA 3I0MA 4N1AA 1AM4D 2R6CA 1VI5A 5BYAA 4TV8F 3MBKA 1SD2A 4NKRA 2IA0A 3L43A 5F5NA 3DMFA 5LGNA 1OROA 4PINA 4EYQA 1FVHA 2PUAA 1P0IA 5AKJA 4YAGA 3WP0A 4K9QA 2ZS9A 3ANXA 3QWFA 4C3VA 1L8LA 2P5KA 2D0IA 3O31A 3B6CA 4JWKA 5A5GA 2NQ8A 1CQZA 4EEFG 2H0QA 4IW3B 3T9CA 5JR3A 3KIOA 3RFFA 3CC4I 1M1NB 2NNLD 4RKRA 1JSZA 5JNSA 2Q1TA 2P41A 4IICA 4Q7MB 2DT6A 2VOJA 2CSXA 2OV2A 3P9KA 1NDQA 2DYRH 2ST1A 4EZIA 4QYSA 1X1PA 5JSUA 4M8LA 1U98A 3SYLA 2J6IA 3IEVA 3R3YA 3WGQA 1TZKA 1OYVA 4HUJA 2VN8A 4QJ4A 1AO3A 2G9WA 4B3MB 1H1DA 1E3IA 2C6YA 4HAWA 1C7RA 1SZJG 4BKMA 4DZZA 1X38A 1UHSA 2RGBA 4ZCQA 1ORWA 2JAPA 1CY4A 4EY8A 3SSAA 2PEXA 4P22A 1JXQA 1CJSA 4A2WA 2TMYA 5DOZA 2NS7A 3IQHX 1I27A 1BI2A 4TVKA 3UAWA 3QX3A 2WKWA 3OQPA 4KMUX 1ZC4A 5DO9A 3OJLA 4H16A 3E9YA 1QGPA 5FWDA 1UUFA 5C7YA 5KYUB 4BUCA 1ZY2A 3Q9VA 1QTIA 3PCTA 4E6PA 1KZ4A 3OTIA 3BT7A 5E2IA 1NUUA 2QL5A 2EFJA 3IR7A 4GYGA 3OSUA 4OGGA 1NXPA 1YHNA 3WQHA 5AIQA 4D3ZA 3WFZA 1Z75A 5JNUA 2EK5A 4LY0A 1AKHB 4X85A 3TPCA 1OTHA 2VSQA 4Q1AA 3WLLA 1QHHB 1U4SA 3D5EA 4NU8X 2PS9A 3SYRA 4GNRA 4YT8A 4RK5A 5FQNA 3KAQA 4AY4A 3PFHA 4FDVA 3I28A 1YS6A 3IP5A 2C5FA 1QHFA 3UMGA 4M71A 5JVTA 5AJYA 3OCCA 5CLHA 1DAHA 1P73A 3DOJA 1WCXA 2GZDA 4MPJA 4QQRA 1IRXA 3L2UA 4NEGA 2HBRA 1XRNA 3K2ZA 4C78A 1WW8A 2AKAB 3KOXA 2ZIEA 1BHO1 3K4QA 4K28A 1JHXA 4OOEA 1NXSA 2FBIA 4A15A 1MEJA 2QCOA 3ZMZA 2P11A 1CF7B 2JJ7A 3H3XA 4R1TA 4LI3X 1KMHA 5L3DA 1YA8A 2XDWA 3HWX1 3OOUA 2R7ZJ 5EYPA 5F35A 3HGMA 2PQ6A 5B30A 1V5GA 2FEMA 1MZPA 1ISJA 2IA1A 1BYIA 3O4FA 3E8SA 1ZS9A 3WHPA 1R0BA 1H0MA 3DZKA 4C7MA 3IP9A 5C31A 4LGCA 3BQYA 2TS1A 2Z95A 5CG2A 3E9DA 2JQ7A 3CQ9A 1YQDA 3E53A 4QOEA 1GPYA 1ISPA 4Y9TA 5CCBA 1NMXA 2B7LA 1H8HA 3L93A 1V3FA 2Q3HA 3GUYA 5AYVA 2Z9OA 1RWVA 2FP4B 4P81A 5M34A 1JW9B 5I7WA 1H9GA 2EDCA 2I1WA 1TVEA 2MU1A 1MBEA 1ZINA 2ZZNA 2Z8ZA 2PUWA 5KC8A 2FN8A 5BWBA 1ZK8A 5U1PA 1EPUA 3T1YB 1N5IA 2MLGA 1KS2A 5LM3A 3I5YA 2VT6A 3EGXA 2OCPA 3CSUA 5JBIA 3WA6A 1JA0A 2PTGA 1Z37A 1EHYA 1W59A 1G4HA 4TM7A 2H4ZA 2NPFA 3RU9A 2CMDA 5FBHA 4EF4A 3J80K 5BOVA 1QQ5A 3MJFA 3K8OE 1G6Q1 2VH5R 1Y34E 2XOEA 3AKDA 5A7HA 5D00A 2R84A 4KUEA 4OYLA 2I7TA 4H1WA 2R00C 4RD6A 4CIDA 4KO8A 1Z8FA 3COZA 5AM3A 3I5MA 1FEZA 3QX9A 5F9FA 4CTMA 3HPGA 1C8BA 4PC3A 4YY3B 1E61A 1VSUA 4UM7A 1FTTA 1G8YA 4N5NA 2RH9B 3D1LA 5GP9A 5IYCJ 2KM1A 5EZGA 4HEJA 1O94A 4NOKA 2J46A 4XFJA 3L7IA 4IV0A 3PDIA 4ZMRA 4EDFA 4FYVA 4TWAA 1X7ZB 2OAQ1 1D5YA 1KRXA 2DU9A 1A0OA 3RSSA 1EP1B 5ECGC 3OMXA 4FYIA 4C3OB 2HMVA 3NOOA 3JQAA 1DG1G 3IAM1 3ETGA 3DOUA 3ETJA 5AUOB 3OS1A 3W2GA 3AJDA 3KKOA 1GAWA 1G59A 1TNDA 4P36A 1AMUA 3OPMA 3ZR4B 4X8OA 3R8FA 1P0CA 1K97A 4E94A 4ZYXA 4EW3A 2GM3A 4EUEA 4PSVA 4R2WA 2C61A 4Q37A 2PCLA 5H81A 4RTLA 4HNGA 4BPRA 4KYWA 1CR6A 3C41J 1M34B 5CGZA 2BJVA 2WDPA 2Y0CA 3RJZA 4LRYA 4RQUA 3LDHA 3CP2A 4JLPA 2H0RA 3ZGVA 1KVUA 1S2NA 2VDWA 1EUQA 1I14A 4E5MA 4NG4A 4JBHA 2P4WA 1FTYA 1JSXA 2CUFA 1G17A 1Q5PA 4WINA 1X3LA 5GZ6A 2RHLA 1FRNA 1RTTA 4Y3OA 2AQFA 3M6MD 4W8GA 5ETJA 1T98A 2PJPA 3MTDA 2J9XB 3WIVA 1KKUA 3FRHA 1PLLA 2Z2ZA 3CRVA 2WWGA 5I3CA 4GKBA 4NYJQ 4DRXB 3K1YA 4YRIA 2ZAYA 1A9ZA 3GUCA 3OM1A 1DIAA 1FB5A 2O7QA 1KHTA 1I3CA 4EW1A 2E5NA 4M49A 5CHYA 1K5HA 4QDKA 4LK1F 1G8GA 2RNGA 2B7EA 5G40A 4RFLA 1KQOA 3PQ8A 4TWIA 1Y0NA 3M34A 2FFBA 2XUBA 4M3NA 3SEFA 3BSWA 4Y6QA 2F3SA 2P6SA 4E1AA 3W8NA 5K0NA 3KXIA 3EPPA 3VKFA 1JZSA 5DBEX 4I3GA 4WI1A 4JP1A 3AM1A 4LDAA 1WHUA 4DRYA 1DC5A 3V7CA 1KYTA 4MH0R 4QSHA 1KK1A 2VZ9A 3PWTA 1ZUNB 2ZIAA 2V97A 2YV4A 1VMDA 2VQHA 1B6GA 4Y9SA 1RLJA 4ZGGA 3EQZA 4RQTA 2CZCA 3M4NA 3FZVA 4AJJA 5K3DA 2PX6A 1R1DA 4XM3A 4O25A 1YK0A 3R4CA 2A35A 1KF0A 3HG9A 2DRIA 1PF7E 2IXAA 1PK7A 2PX9A 4PN7A 3C6BA 5IVHA 2JH9A 4ZAZA 1C1YA 1LDJA 3KXLA 1RAEA 2WYUA 5EFZA 3VC7A 3I04A 2Q6KA 1BI1A 3JV7A 3EZGA 3INNA 3NHKA 3UFBA 5ADHA 2VNSA 3AM5A 2BVLA 2VXDA 4GRAA 3QU5A 1SCAA 1EDDA 2X22A 4MARA 1TUEA 5A4KA 1I7SB 3EF3A 3G2MA 1DHRA 3FMPB 3C7CB 4OLHA 3S1AB 4M3GA 3KYCA 1RRKA 4KW7A 2DI3A 3ZHUA 1IZ8A 3ET5A 4AMYA 3NC0C 4JB2A 1E0SA 5CFNA 1NQOA 3MSXA 4FSXA 5FKNA 5D7BA 3ABZA 4RZ2A 4YJKA 4Y7CA 4E5VA 4ON0A 1Q3TA 5DGXA 3E1GA 4D8UA 1SAXA 4DVJA 2JBHA 3V48A 3QE0A 5K7SA 1NNSA 4JLBA 3UMMA 1YTUA 2GKSA 3CN9A 2BY0A 1KNQA 4NOLA 5IP5A 1C7FA 3HFJA 1UDRA 2Q99A 1WXDA 4FONA 1KU0A 4RKWA 3UAYA 1GXPA 3ABUA 5DN9A 1MA3A 3N97A 3FB1A 2EV6A 2P9QA 4BASA 1AXGA 2BP7B 3C1DA 4B87A 4CG2A 1DELA 3EXIB 5J40A 1X4PA 2HU8A 1NFRA 5EQJB 1JTEA 2GJ4A 2VHXA 1B8VA 2EIKH 4NESA 3V7YA 3SBEA 3KJIA 1E3WB 3AQIA 4RJTA 1F17A 3OZBA 1JA1A 2DPYA 3KQWA 2ASEA 3DMGA 1GKIA 4MS4A 4JSTA 2DA5A 3VNSA 1H9CA 3GR6A 2PLYA 4Y4RA 5GTDA 3U7QB 2EARA 4L5AA 3QNMA 1U28A 3C1UA 2R4GA 2IW3A 3WGOA 1V25A 3H5VA 4ENKA 1T9BA 4WOJA 4S24A 2CLOB 3LSKA 2BMWA 2N8GA 1C3XA 4KE7A 5BQOA 1JAZA 3GJYA 1HF3A 3INYA 3I72A 3HPRA 5JBNA 1FFGA 5BOXA 1W46A 1IHXA 2L7ZA 2VDUE 1MC4A 3OE7D 4RELA 4L76A 2A5LA 5JYDA 3L05A 1DIHA 3OTOB 3EJWA 5IS2A 2GTHA 1SU8A 4ZN6A 3MD2A 3D0QA 3AR3A 3TNFA 4Q66C 5E20A 3R77A 2AMJA 5JAUA 1X7HA 2IHTA 3D8NA 1IUNA 3UXYA 1Z62A 1YVUA 1E98A 1GUZA 2FRHA 3U4MA 1JI0A 2OMEA 5DCYA 1NMSA 4HN2A 3SHFA 2ZBVA 2XCRB 1IC6A 3LVRE 1VG0B 3DZFA 2X6QA 1Q1QA 3CQZJ 2VHUA 3TQHA 4C4XA 4MGEA 2HA3A 2IEBA 1T0HB 1Z07A 3H6KA 5FKKA 3S1NJ 4Q9KA 3FWZA 2MR6A 1OWMA 3NAZA 2K86A 4P93A 2I1LA 2Q2EA 3QF4B 3F5FA 3VO9A 3DWEX 2D1VA 4M0LA 3ENNA 5FTKA 3I0TA 4AWAA 1BCRA 3K1PA 3SR0A 5K2OA 4RX1A 2V5VA 5IBPA 4CU2A 5JQGB 2VNIA 3GELA 1M66A 2Y05A 4G36A 4I9HA 3ZCVA 5AQEA 4D0SA 2P7CB 3PPYA 4B3SB 2BZ0A 7YASA 2V6GA 3TNDA 1DT3A 4PLGA 2WV0A 1MO5A 3EE6A 4PBSA 4EQ6B 3AZQA 521PA 4RSHA 4D9EA 1OI4A 2ZRMA 2CFOA 1VZ3A 2ZT8A 1YNSA 2QWXA 2I1VB 1NTRA 3RYRA 4MR8B 4WLNA 4E6KG 3SKVA 2Q0OA 3ZBPA 4C4AA 3F3MA 2ES4A 1CB0A 1TUBB 2CVPA 1MVNA 3WU0A 5HQJA 4RCYA 3UATA 1P33A 4RFSA 2QSZA 5P21A 3FTFA 1N9GA 2LVBA 4QPPA 4YRNA 1L0OC 1LK0A 2FPMA 3D2CA 4NPCA 4ZXPA 3PQ5A 5LZ8A 1O95C 3JD3A 4YFYA 1S6YA 3PT5A 4FR5A 4UMEA 2RGNC 1PVEA 4XSVA 1F0KA 4II7A 2VE9A 1OLUB 3ZIAA 2L0XA 3TLBA 5GV7A 4TTAA 4WWHA 3WTWC 3D5LA 3IESA 2ZBGA 2XF2A 1WEHA 5AO9A 6REQA 3WYCA 3JQDA 1CKEA 3GNQA 2QDXA 2M2EA 5DNWA 4K9KA 3CSDA 2PMFA 3M2PA 4TTTS 5CBPB 3K70C 4TV9A 1UBHS 5A3QA 1XU7A 1M7BA 2GJSA 4X1IB 5FA6A 1KWGA 4BQPA 2B99A 2E7ZA 2VIXA 3D8RA 4CM3A 1BJZA 1UKVY 4EHHA 1CR2A 1LEAA 2VJDA 2QTGA 5AJHA 2BEWB 4HDCA 3RTDA 3QH4A 5EZQA 1PKXA 4DCTA 3T5TA 1Y89A 1TJ4A 1XN7A 3HR7A 1V16A 4A8JA 4FOSA 3MUNA 3CIOA 3IB3A 4O2AA 2H92A 5SY9A 5LJLA 4RJLA 1YNOA 1RI1A 5IPAA 5I4BA 2CDAA 1HL3A 4MR7B 1XA4A 1DTEA 4JI4B 2P6UA 5FKJA 1YZNA 3Q10A 2Q0XA 1TECE 1IOWA 5CP8A 2MYSA 2HCFA 1NN0A 2QMQA 3VU8A 3B53X 1YDEA 1NVVQ 1T4DA 4HQLA 3ECSA 4PHGA 1NW5A 1GNPA 3G1LA 2LC2A 1BGXT 4DLRA 1QOZA 3AHJA 2X0DA 3PHIA 1MENA 2HR3A 2PZKA 5M5WJ 4Q01A 2PGNA 4F96A 2HDCA 5EUBA 3CEJA 3GP5A 5IKEA 2Q6VA 5E1XA 4WLOA 1OH6A 4IG9A 3DYIA 2VXZA 3EVAA 5JQGF 2Z6VA 2Y3IA 5HCUA 4XW2A 3AR4A 4G9YA 3CN7A 1WB4A 4KI7A 4NJEA 4MVJE 3DC2A 3WLKX 3GGDA 5FV7A 4HWRA 3G2PA 1Z35A 4FFVA 1GPMA 3SP1A 1JFTA 4EJ0A 2VHZA 5BT8A 2GCNA 3S2WA 5HLHA 1G3RA 1GTJ1 2CCKA 4PZDA 4ZPXA 4L3VA 3BK2A 3QPCA 2IIPA 1QYDA 4ZV9A 2DFPA 1TXGA 4AP5A 3LRPA 1GQ2A 2W6CX 2YWEA 1H4SA 2CYCA 1A1SA 5C3UA 4E88A 1YZQA 1USIA 1DEOA 2XRYA 4PPQA 4UARA 3BR6A 4D1YA 4U6NA 3PLAE 4BTLA 3JWGA 2QY9A 4QG7A 3QY9A 3QRFF 5HMLA 3WXBA 3FKSA 4HB3A 1E17A 2ZCUA 4A8HA 2HY7A 3BTCA 3G9UA 1QZTA 3CLTC 4B09A 5CXUA 3JW4A 1L4UA 2W7TA 3DQQA 1FSZA 1X2MA 1JTVA 1GA4A 3H83A 3O4IA 2AJCA 3G9QA 3AEZA 1DG3A 1VLHA 5BQFA 4OHFA 3KYJB 2DQRA 3W6ZA 2GNPA 5DM1A 3O2PE 1Q1BA 4BNGA 3CRRA 3KO8A 1COWD 1V41E 4D3XA 3U56A 1M1ZA 3W2WA 4ALIA 4X7PA 2BISA 4G5OA 1NPDA 5K45A 2JGFA 1UBCA 1KK0A 2ZE7A 1IDOA 1KO8A 3MWEA 3PUKA 4IHKA 3VFZA 1ABEA 3QFCA 5LU8A 2GCEA 3COAC 2WQ7A 3A9WA 3H36A 5DW0A 3OIGA 1J21A 1W5AA 3KP6A 2QUKA 2AQ8A 1BM9A 3SZTA 2PH5A 3I9NA 3I6YA 2UUBB 2VRNA 4LFCB 1JKMA 3TJRA 1TTPB 4LJYA 2R4TA 3OO0A 4UHBA 5JFRA 1SHLA 3ESDA 1U2TA 2PT5A 4C20A 2C3UA 1Q0UA 5BRAA 4R81A 3WGYA 2I76A 1Q22A 3LXXA 1T9DA 3K3PA 4C6RA 4Q4AA 1U3FA 4CLOA 3MINA 3N86A 3PSAA 4NMMA 2XDVA 2F2TA 3KP2A 2Q3DA 3IUMA 1ZH5A 2E4AA 1JUPA 4V0SA 2QSGX 1VB3A 1BE0A 4HTFA 4DYQA 1M2VB 1IWBB 4Q6BA 3ZQLA 1GU1A 4I14A 3FWKA 1S0UA 3H19A 4MQVA 2Z8XA 3TEFA 2YTZA 4CICA 3A8TA 2GT1A 2JSPA 1NJGA 3EUKL 4WJLA 3S2UA 1EP9A 3CMEI 3CU5A 1NI4B 1T9KA 3V8BA 4IHXA 1B4AA 5FBVB 1G3UA 5J1SB 3ZD6A 3ORFA 3ASYA 4DDVA 5CAEA 3R6LA 5HEKA 4D5CA 2DPUA 2H1KA 2RI6A 3L8FA 4XWKA 4ND8B 2HDNB 5IP7J 3PQJA 3U7IA 2YWFA 1O96B 1UOOA 1HX7A 4P6VF 3T8YA 4XUDA 1I1NA 2ATXA 1WIWA 1BC7C 2I5PO 1UDCA 4HG2A 4DM4A 4YJ2A 1V5EA 2EV0A 1MO4A 5KYKA 1GQRA 1Q84A 2NO9A 4BO1A 4IKPA 1J1IA 3PUHA 3ERMA 4BKXA 4CGYA 1QP7A 4G0UA 1I32A 1AA6A 3V7SA 4ZANA 4U2DA 5M5BA 5AT1A 3BMCA 4KICA 2XZOA 4ES6A 4ENRA 4EHBA 3EX7C 5DCUA 1SXPA 3QXJA 1KBQA 3QVXA 4OJTA 4HOBA 4PHFA 4LF5B 2O59A 1BEZA 4OAPA 1UZNA 4KYIB 4RHUA 1DIGA 4KXYA 4ZVKA 1KR5A 2ISCA 1RLOA 2WTBA 5LMCA 2PZLA 1HW2A 3M6XA 2F5VA 2FDCA 5E2BA 5KTNA 2WM2A 4J0FA 1YS2X 1LXCA 5K3OA 4H1VA 5DD8A 3F9IA 3DMPA 2D5IA 4LX8A 3BX1A 5DTDA 3KPUA 4OYRA 1VGRA 4I5DA 3QNWA 4EI7A 3L4BC 4Q9IA 3CPEA 4G65A 1RHJA 2J9YB 3ANNA 5DTQA 3PR1A 3RFVA 2XEDA 3LA2A 2GPNA 3BK7A 3O6VA 4LCEA 4DBVO 4C6SA 3I9JA 4CTJA 1XR3A 5D1NA 1SKBA 2QMYA 2PWAA 1G5PA 2FZLA 5HIMA 2IWHA 1ECBA 1J8QA 1GP2A 2WKPA 3SF8A 1XXHB 2NV0A 1O08A 2WJZB 2L2OA 1AZWA 1BOBA 4UHTA 3ETNA 3UWOA 1HMYA 2D0PB 2EZUA 2Q0HA 3W7VA 1WNFA 4HZIA 1CLUA 4AZVA 4NICA 1ETVA 4O1HA 2RBGA 4YCLA 1YDFA 3BL8A 4AKTA 1WKVA 5TMBA 1R6XA 4DR6B 2WUDA 5JZBA 2PKEA 2QPOA 4DQKA 1BJAA 3OYDA 5BN5B 1NX6A 2DEUA 1QHEA 4QYXA 2MYPA 1AF4A 3E1KA 5C18A 2XHEA 3U1KA 3GX4X 1PJSA 1Q7CA 5LNK6 3UXHA 2VHCA 4M0KA 4BNZA 2ETVA 3K4CA 5BMVB 4FQGA 4EGYA 1HRDA 1XJ5A 1Y4UA 4IMJB 2BW3B 1TYDE 1TIBA 3TEJA 5D5VB 3LC2O 4FDUA 1EXWA 3IT2A 4B6SA 4AJNA 1XFAA 4FCCA 4L72A 2QP4A 3O8DA 5CVCA 4H17A 4M9QA 5G3ZA 3FOEC 4H4CA 2Q45A 4X1YA 2ANCA 1D0ZA 5HBGA 3LWBA 2ZPAA 4WOCA 1I2BA 3O6BB 3UK1A 3FLMA 5BXYA 3R60A 3LCRA 1U3UA 1Y3BE 1LLCA 2H4JA 4YUVA 4LISA 2DMNA 5CCDA 4XCXA 2BBTA 5CRIA 4N01A 2OZEA 3V8NA 1KEWA 4E13A 2KISA 4FLFA 2IUFA 1XGNA 3PC7A 1M8KA 4B46A 1NT2A 4RVOA 4B48A 5I48A 1AUPA 1A72A 3F97A 4D8TA 1G21A 3BCBA 1YJQA 3LOPA 4HB0A 4AQDA 2G09A 4RDIA 4TLEA 2ONZA 4CL3A 3F0TA 2NXWA 4ZYWA 4BACA 1WSWA 2QMOA 1RACA 4D92A 1XTTA 1WPRA 1JI8A 3S8MA 1WJAA 4MMXB 4DV7B 3KP7A 5AXBA 1V37A 1YCFA 2WU8A 4XOUA 1RCUA 2O07A 2WC1A 2P7HA 2CW0F 4EENA 1S2IA 1S96A 2QJWA 3TQIA 3NM4A 2GEDA 3HRIA 5JRJA 1E0JA 2AN3A 3OYNA 4OEHA 2BR4A 5ELMA 16PKA 2DPMA 2ENUA 5JADA 4L8YA 1RIIA 1AKNA 3GWGA 1WXFA 1CUYA 2VJOA 3DOIA 3GBGA 4Q1EA 4X90A 2VATA 4RHCA 2RH8A 1FPQA 2YRFA 2FR8C 3AVXA 5AJWA 3I5UA 4L3OA 1HXHA 2JJ2D 2ZB9A 2GEKA 2L18A 1M54A 3IH5A 3K4JA 3AF4A 2XC7A 2Q3BA 1TLTA 1V11A 3OC6A 4AL4A 2W4QA 3N7AA 4EB6A 2OY0A 4UB8C 4W4TA 2PA0A 1FY2A 1R18A 3SVZA 5B3AA 1Z0DA 3BA6A 1TW3A 4BAYA 5JDCC 3STTA 2PGXA 1XV5A 1J2RA 3AK4A 2LTPA 4MCIA 4F4HA 5CQGA 1IMOA 1R00A 1DP7P 3BH6A 2GCOB 2G0EA 3GFMA 3BB3A 2DY1A 5FUVA 3ESWB 3VODA 4N5MA 2GKGA 2CNBA 3AINA 3IJRA 3LZ6A 4RJ2A 4LE0A 1DV2A 2DOEA 1RIOH 1AO0A 2QB5A 1J8MF 1XXLA 4J0HA 2YWRA 3BXZA 1I9GA 2OUIA 2ZMEB 3MW8A 4GXRA 3RRZA 3W2VA 2P5YA 3H0DA 1RR8C 3KQLA 2PV7A 5ICSA 2QNRA 3AVYA 1U3GA 1S72I 2GAUA 4CKYA 3MFQA 3OZ7A 3RVBA 1DU0A 3Q9UA 2DJNA 4BVFA 4MKZA 2WG2A 3O8LA 4U9HS 1RPTA 2GBFA 5G0TA 3R3XA 1FNBA 2ZR9A 3IUOA 4UMVA 3DTVB 4BZWA 1C1XB 4CMGA 3LAPA 1JECA 1YWGO 3G13A 2VO1A 3U1TA 4TV8A 1QONA 5IBQA 4OIRF 2KMLA 3A0RB 2X3YA 1XALA 1Q1AA 4G5SA 2Z58A 1ZD2P 3LWDA 1XWFA 4QDXA 1A8PA 5CX4A 3UV3A 3C3WA 2ZCVA 3Q5FA 4B6FA 2QTBA 1AS0A 2HYGD 2O3TA 2QEQA 1N1EA 1OAOA 2TYSB 1HY3A 4JEMA 1MN6A 3WYNA 4UUVA 2VTKA 3OT4A 1NXQA 2EJBA 4IF6A 1IZ9A 2EBWA 1VJ0A 3ZHRA 5G1NA 4NSNA 2ZS7A 1RHQA 1WDMA 4IDAA 3DJYA 2HLPA 3THRA 1POWA 3VDNB 4M4SA 4DT1A 1C3OA 2YY6A 4BBRJ 1D5VA 5L40A 2H0AA 1T2VA 4PTYA 1JJ6C 1XPJA 4LVUA 1FDVA 1MRNA 3A6LA 3DEAA 3RKYA 2O8EA 3OZIA 4JL8A 1PZGA 2CB9A 5K0EA 3ROEA 2DU8A 5B6JA 1UMBA 3COYA 1YR1A 4YFKF 2D1FA 4EDHA 3MZHA 2ZYHA 1DB3A 2WJJA 2H4FA 5DHTA 3EZXA 1VCHA 3FPHA 1F8YA 1KQ8A 4AVYA 1E3EA 3QWLA 4G0YA 1Q1NA 1NW4A 4JBYA 1YQEA 4MIKA 3H9GA 1G1MA 4IXDA 3BTOA 2QLFA 4PY2A 3TX2A 4W1SA 2CWEA 3GFJA 1DTSA 1W94A 2ZT7A 1HDCA 4N0QA 1M2HA 3GDOA 3ZU6A 3PFNA 4IHJB 4CCNA 2Q5CA 5I4CA 1XSXA 3LS2A 3F6BX 4CEHA 4XN0A 4OA8A 3KQYA 4JKOA 1BMDA 3EMDA 4L9VA 1VPDA 4NEHB 4L9TA 3B36A 1R0YA 2HCJB 3S16J 3RK1A 3C5HA 2M5WA 4TKMA 2TMGA 5CX1B 3TMYA 2WB4A 4AN1A 2YZNA 1Z6XA 2WYWA 3H1AA 4N5HX 2C5BA 2J59A 3DFMA 5AVKA 2ZJOA 3EVTA 3TCKA 3TQQA 1P4WA 2JLUA 3CVYA 2YVUA 5CVRA 2FBKA 3KJZA 2DHCA 5F76A 3SC2B 4RMIA 3P2EA 2GPJA 4YCAA 1JJ7A 4RA9A 2XECA 1F3OA 2FWMX 1OMIA 2L54A 3PNVA 2G5CA 1O87A 1S3IA 3NC4A 2B1RA 2V9PA 4F4CA 4H9GA 1CXZA 1XLVA 1CF9A 4K9LA 3MUOA 1F20A 3STYA 2PSHA 1LV7A 1EX7A 2J3KA 3BK1A 4EG0A 1MW8X 1YW8A 2ARKA 2IODA 1JHDA 5BW6B 1FS4A 1GAEO 1VQLI 4G84A 4E5PA 3R7SA 1DXHA 4QBIA 3GEHA 2W4IA 3RS7A 3GJ7A 4FFNA 4YRRA 4MVYA 3TOAA 5JDIA 1Y1PA 3DLHA 4XWGA 1R23A 5ES3A 1T1GA 2CHGA 2XQFA 1PUJA 4UHEA 2PSFA 3QTLA 2B37A 1HDXA 1RWXA 4YHHB 2NN3C 1M1NA 4DCNA 3IMFA 1W9MA 3CH4B 3JQQA 4PPFA 4QL3A 2V7QA 1FJHA 4LB5A 5E8RA 2E1OA 4E21A 1PRYA 5P8WA 4LJKA 5ALGA 5EJCA 3SVTA 1RYBA 5HZKA 2D7CA 4JFRA 3VJLA 4FS8A 1H42A 1UOEA 1BVRA 2QLBA 1BR1A 5KMGB 2QRGA 1A9TA 2B78A 3MGBA 4KNVA 2WTEA 1LFAA 4Y67A 4I98B 4BNXA 4YIFA 1VNDA 4U2FA 1BRTA 2W6ID 4M6XA 1XLTC 3VV3A 3L3BA 2VTBB 2PZ8A 3M4XA 3AAFA 2F67A 1IZ7A 1Y6GA 3T3EA 1E2EA 2OHHA 3W34A 1QYRA 2BKLA 3GUDA 3GP3A 4PSUA 1QV6A 2Z0MA 3T7AA 2E18A 3Q2OA 2C7BA 2C2BA 4EEZA 2QBYB 1IJFA 3GCMA 4B5KA 1YQQA 4GGOA 5KYUA 5JAZA 2XJ9A 5HKOA 5LHIA 3SZLA 4MWZA 1V43A 4AC9A 4LX0A 4PCLA 4X65B 2PUEA 1URPA 4TV7A 2VDVE 5AVVA 4DWOA 4ZQFA 1TAUA 2EX4A 1AKHA 4Q34A 5KSYA 2XZPA 1QHHA 4F6CA 3K4MA 2DT8A 2CV1A 2XB0X 1RYZA 4EMSA 2EFPA 3L8MA 3ANTA 1E9FA 1GV2A 4XPZA 1ID1A 4NONA 1CUGA 2FI1A 4U7TB 2IK8A 2ZJ0A 4UNIA 3DBLB 1MMAA 4BMPB 1GRQA 4KWTA 2NU6A 4XJSA 2JD1A 2EG5A 2ATVA 3KZKA 2RAEA 3O82A 1XVLA 3DXXA 5L51A 1LV8A 2OTCA 1FDSA 1JDSA 3WBJA 1BWRA 2YBDA 5HA5A 3QYAA 3N8DA 2MD0A 1WXWA 1W0KD 1I6MA 5F5XA 1PR3A 4B5LA 1KPGA 4F97A 4EUNA 4INZA 3ZDXB 3ZU5A 2FPRA 5BNIA 1LQ1A 5E79C 3OT5A 3KYLA 2FWPA 1W2WB 1IDZA 2J0UB 4Q12A 1FYLA 5EIBD 1U63A 1D2RA 4RKEA 5JATA 5CB6A 1N32B 2HB6A 4L0CA 4I8XA 5J63A 3BG3A 4JY7A 4XLFA 3GTGJ 2UZKA 2ERCA 3LAJA 2G17A 3T4PA 3TEMA 3CF2A 5JS1A 2JA8J 2XB8A 3DCIA 2UZ4A 1VE1A 3KB6A 3E5NA 1DQNA 4YIHA 1X7YA 3F90A 4HGNA 3WGNA 4LJ5A 3IRVA 1MSFC 3QU2A 3HDDA 3H3ZA 5GJWC 3G5AA 3W6KB 1VLZA 3S5JA 4CMHA 3IWFA 1DZIA 3GH3A 3AVTA 3D3WB 1ODJA 4WBXC 1S01A 2ZPTX 2FKAA 2HK6A 2QL6A 4S05A 1QJCA 4L9AA 4TVOA 2A0KA 3QU6A 3G3ZA 2I5UA 2COKA 2W2OA 5I7AA 3IQIX 1XMOB 1I5ZA 1YVDA 3BZBA 2LYCA 1A9OA 3PUWA 1LBIA 3PXEA 1G7SA 3AY3A 4YAWA 1FYXA 2ZWPA 2FUCA 4DWVA 1R1VA 1IVSA 4JI2B 4IIUA 2G9RA 3EEOA 3DMHA 2CFRA 1E1RA 5F3DA 3A1VA 1L4KA 5L3ZA 5LQCA 2BZSA 4D97A 1N1GA 2IH4A 3A1UA 3EZYA 4O59O 4OXYA 2A3SA 2KHMA 1GNTA 3LDAA 2NZVG 1IHYA 3COWA 2K85A 2YJ4A 1RYYA 2C2KA 3QMWA 3PRYA 1A76A 4AUEA 1W49A 3KR0A 2AIRA 2KBFA 4MAFA 1ZEMA 2NLOA 5GJVC 4PJMA 3K0EA 4MWBA 4L27A 1GA1A 2JFOA 3S1MJ 4Q7JB 2LIPA 1QK5A 2R6R1 2HNKA 1MMDA 3UMBA 2DAPA 1GQSA 4I55B 4JB0A 4FFRA 4LXYA 4EHAA 4IRUB 5K3FB 3SBOA 3X2SA 1HDIA 1OXKB 3TSZA 2MSCB 4J1QA 2XTNA 4HSEA 4L4XA 3LI2A 2QAGB 1D07A 1SCDA 4IIGA 1FTQA 1A31A 1C3LA 4JR2A 1J07A 5C8ZA 4ZZ3A 1Z0FA 4BHBA 1GV5A 1IY8A 5EHGA 3QE3A 4OI4A 4RV5A 2ZJ2A 2X4HA 4F3QA 2R6AA 1DWPA 3VU3A 2XWPA 4V3BA 2C54A 3AU8A 2P9JA 5C52B 2A9PA 5JSQA 4OHBA 4XRFA 4KVFA 3I1YA 5BNTA 3U44B 5HRCA 3CLVA 1M34A 3TRKA 1ESEA 1G5QA 2EHJA 4IH1A 2H9YA 4TT3D 2PMZN 3LQFA 3I54A 4QUJA 3PX2A 1T1JA 4G8BA 2XNHA 1EM8B 4G07A 2WFZA 1BE8A 8OHMA 4F9TA 4CCJA 3TTXA 4RHFA 1QH0A 1IBRA 1KEEA 1LW6E 3PXBA 3LSMA 1S4MA 3BMNB 2XQKA 4LOIA 1MGPA 4FDMA 4BEWA 1SHZA 4PLPA 3JQ7B 2V7TA 1MX3A 3M4YA 3DQZA 3M4JA 4EG6A 3ZCSA 3KQPA 1NP3A 2V6JA 4L16A 4Y2UA 4DRXA 3FX2A 1SD4A 4UVBA 1NUPA 2G25A 4ZC8A 4IJ5A 4RJJA 2Y75A 3GVAA 1F14A 2FXIA 4G8CA 2LXNA 2QZJA 4U7GA 4M8NE 1NP7A 1WG8A 3P71T 4FYPA 4OH7A 3QVTA 3GT7A 1U5AA 2O50A 3EZ9A 4ZEWA 3JRWA 2Z99A 3BCAA 3UJCA 5JWRA 4R2MA 1VDZA 3V8LA 4NARA 2JI8A 1FNNA 3VHLB 4WFJA 1A1VA 1NK3P 4R2HA 3LX6A 4LOKA 2I2BA 2D13A 3N74A 2VP2A 3B6MA 2AYXA 1KU3A 5D6EA 3E2MA 4D9KA 1ZUNA 3KETA 3CVOA 3RU7A 1CPYA 3V42A 1IXSB 4BB5A 4E2WA 1O4VA 3NXSA 4AROA 3KB2A 1SU4A 1J9IA 5B53A 1TLHB 4TLCA 3I6QA 1NPYA 5AM5A 2OBNA 1S5LC 4BCCA 1WZEA 4UREA 1ENYA 1Z82A 2Q8NA 4ESHA 4UXHA 1RRCA 4P0PB 5CPBA 2XT9A 3K8YA 3SHOA 2IGTA 2C3MA 1NE2A 2B82A 5TDHA 5D7NA 1UXGA 1RRGA 4AMGA 4UOZA 1M72A 3OEWA 4FFBB 1QUFA 3RYHB 2X1DA 1WDTA 3KOZA 3F8MA 3C3MA 3UK2A 5H59A 1PU2A 3EXHC 1T4MA 4GP6A 3PO2J 3S1AA 4F5YA 3R24A 1Q16A 2NTYC 1V71A 1TX4B 3W2FA 2I8CA 5AOCA 2NYUA 5GP1A 1YJXA 1IBCA 3ZV4A 1W47A 4KK3A 5KJCA 1RCTE 1XCBA 1JXAA 1FIAA 1FOXA 4MHOA 2FXVA 1DIOB 4IGKA 4IHQA 4YRBA 1PJQA 3LSTA 4OJMX 2BFEB 4RY2A 1UK6A 4RLFA 2XOKA 3LQ2A 4QEDA 5LYYA 1OISA 1O5IA 1Y3DE 2B5VA 2BP7A 4G12A 4I6JA 4P5OA 2GZ3A 2IDKA 4M1WA 5EPOA 1GAXA 3N59A 3EXIA 1E58A 1MJFA 2ZULA 1MQ8B 3SFZA 5DK4A 3BG6A 2XRZA 4DY4A 1JHHA 2YQ5A 1EINA 3I6BA 4RULA 1U8TA 4LGMA 3IPRA 3O8NA 3OYFA 1NVWQ 3ZPLA 1ZO8A 4TRRA 1PUFA 3T52A 5C1PA 1E3WA 2VH1A 2J5OA 3EQ9A 2I4IA 2KIMA 4R51A 1QP4A 1SFOJ 1E3TA 1OU0A 3G5UA 4HF2A 3MS2A 1K4SA 4ZGBA 4U00A 3U7QA 4H77A 2OBMA 4RTKA 1GDDA 2IA2A 3W4KA 5FORA 1LFPA 3V6LA 4DLAA 4V24A 2IPMA 3FZQA 5L8VA 3QPAA 1X9IA 2NQTA 3DDCA 4C5AA 3UW1A 4NDLA 1NV8A 4DG9A 5JCPA 3EZNA 3D7RA 2BMDA 1XQYA 1JWAB 3ZOZA 1WV1A 5JHUA 1I1SA 4ZMBA 4JIGA 4DL9A 3JYHA 1OPXA 4L4UA 2DBYA 3U09A 3ZYCA 4WFKA 5ENDA 4DJEC 3A7EA 3HI4A 4JD5A 1QYCA 5JXIA 2R6JA 3GUHA 1IY2A 1UDAA 4RPGA 5H6QA 4ARBA 1CQTA 2HD4A 1U90A 5CDHA 2RKBA 2XUZA 4AF6A 3SYNA 2NTVA 1SEUA 1R5JA 3JQRA 5DHQA 3LWZA 2JLCA 3NOXA 5CM8B 1YJWI 1EWRA 4BX9A 4EFLA 1GZ4A 6GPBA 3GTOJ 1V6SA 4JELA 5KVAA 1HR0B 3UAZA 4RAYA 3MYRA 3QF4A 3WO1A 3UMSA 3FPCA 2W8BB 4PZAA 5E1DA 1W581 2H08A 3OX3A 3UJNA 3I59B 3DOOA 4A2UA 3VYUB 3O75A 3FMFA 4FOLA 5EZ5A 1L8OA 3D5SC 2FMUA 1HRKA 3EHEA 2WMDA 3GIWA 4YX9A 3HHEA 1OWPA 5JQGA 5JMTA 2B6HA 1R7JA 2PM8A 1B41A 3RVMA 1HDEA 5JC8A 2X0KA 1XZHA 5TE9A 1ZQ9A 1ABBA 2CJJA 1IRZA 4JLDA 3WR5A 2P40A 1CY8A 3YASA 5DN6D 4IL6C 3GD5A 4EQ6A 2FG7C 1OA0A 1A9SA 3R5FA 1M6HA 1U9NA 1U6KA 1RBQA 2RG1A 3OOPA 3ITEA 4INOA 5I47A 1SXJD 4MR8A 2QP3A 3WE2A 5NULA 3RI4A 4FEEA 1Z2OX 4OK5A 4RK7A 4HDVA 5ALMA 3V4GA 2F1OA 4W9NC 4BO4A 2H8KA 1TUBA 3K15A 4C0LA 3ODPA 5KVCA 2L9SA 4E70A 1OC4A 5DIZA 2KIUA 2ORIA 7REQB 3P52A 4M0DA 3ZDYB 2HIGA 1PR1A 2FSUA 3Q3EA 4PGHA 1YZLA 2X14A 2XUIA 1Y7TA 1RQ7A 2W9XA 4HUTA 2JW5A 5DRTA 1USGA 4ENSA 1V5IA 3RUHA 2WA1A 1RMYA 1VE3A 3OZVA 3BTIA 1OLUA 3JZAA 1JMVA 3CF6R 1VIMA 1KQ0A 3TW6A 3VA7A 4XLLA 2TCTA 4KFTA 3EVFA 4MA4A 3I01A 3FZYA 3JARB 4G0XA 4ZRDA 4YC7A 1XLWA 1R6VA 4PBTA 5CBPA 2XA9A 1QH1B 1VC2A 2VP3A 4P83A 3E8MA 1EE2A 4YRQA 4X1IA 1JKRC 1XZFA 1QU2A 1MW9X 3I3LA 1Q1EA 4L9WA 1ORKA 5DD4A 1E2KA 4DBLE 1NI3A 4M1KA 4RY9A 3E9NA 3A0HC 1HMPA 2BEWA 2ZUVA 2V7FA 4DV2B 4C3JJ 4MYTA 1HEYA 1SAYA 1DRVA 1B9MA 3ZD9A 4CQJA 1KU7A 4HMQA 2W7NA 4ILKA 3G02A 4HQNA 4RPIA 1BFUA 4HD8A 3C97A 4Z1OA 1PS0A 3OHPA 4MFDA 3ULKA 1C7JA 3K96A 2LGJA 3K5IA 4MR7A 1TC2A 3H5OA 4AN0A 4R3WA 2IH5A 4RO0A 1C8KA 1LJUA 1J00A 2H8GA 3TCNA 2O05A 3DLAA 2QA4I 4I99A 2AEEA 1JN0A 3KOYA 3OWTA 2Q9UA 5DXAA 3HKEA 5LCXA 4UFPA 3LVFO 1I9CA 4P4UA 1UIMA 3STUA 3K1JA 1X8LA 3JSXA 4R9NA 3S1LA 4ZCSA 2Y9ZA 3UVEA 2COMA 3C3YA 1UANA 2G3YA 3T3PB 1J59A 3SI7A 5F51A 1P8JA 5HFJA 5FULA 1GZ6A 2B2NA 1ZC3A 4W6QA 4QVIA 3DZHA 4ZEXA 5K8TA 1OFIA 1GG2A 3NTLA 5ALJA 4CCSA 3VPXA 3ZQ4A 5FI0B 1K9VF 4P4TA 2NXEA 4GL4A 1XTJA 3RHZA 2PFSA 3L0SA 2XE7A 4H6WA 4CCLA 3G89A 3D81A 2OBLA 3N6XA 4J0DA 2Z16A 1LSSA 3R7BA 1YX5A 2K9LA 2Q1ZB 4QFCA 3BTLA 2R97A 3I45A 1NG1A 4ZVTA 5HUQA 2BHYA 4ZJYA 2Y8EA 2A78A 5K1ZA 2PDAA 3EGEA 1YAJA 3OQNA 3FUWA 4PSXA 4PJNA 2R7TA 5C2JB 1JTFA 1OXSC 4IOAF 4ETSA 5MFZA 1W36D 2ZWMA 4NE9A 4N40A 4E33A 1B8NA 3RWOA 3U4CA 2LG4A 4IIEA 5E8GA 1IZYA 1YX3A 1JAYA 2X0RA 1QC5B 4JL6A 1OXVA 1JG3A 1B2RA 4JLUA 3WTVC 3U49A 3WGLA 2H3EA 2D54A 2VUTA 2RFLA 3VHQA 1YE5A 3RK4A 3DBRB 1TM5E 5TNXA 3SZUA 1N2IA 3GFPA 4QQ8A 4RV4A 2YVKA 1GVHA 3D6TB 2OSVA 4CODB 5FPTA 1TO1E 4II2A 2E49A 1XZGA 2BH9A 4QUBA 3GCWA 1EJ6A 3MMXA 5T8KC 5IAKA 1W1UA 3JYNA 3SEQA 1E8NA 1FYKA 3SDBA 2PUCA 4F7ZA 3MT0A 2LRDA 2N0SA 4CF7A 3UPUA 5CDSA 1R37A 4FQ8A 3SLKA 2A94A 1JKJB 3B8EA 3R4VA 3RHSA 4EMUA 3QWAA 3QWHA 4WX9A 3H2HA 3T9EA 3HS3A 3Q7IA 3ZBTA 5FL7D 2PN1A 2RHRA 2V4ZA 2ZB7A 1X1RA 3ZBUA 4LK3A 1DLIA 1M2VA 1J06A 4FFWA 3BDDA 2J4CA 3DCFA 2Q5JA 3GTPJ 4R79A 4IO9F 1VMKA 5JS8A 3HM2A 4W97A 1ORRA 2Y1LA 4WIAA 3RUEA 1UMKA 3MXTA 4CQMA 1WO8A 5J6XA 1QYWA 3VV2A 2P5VA 5EDNA 1ESMA 4MWOA 4GMHA 2B4KA 4ZRNA 3FG9A 4J29A 3AVUA 2ZNZA 3NONA 2I0FA 3IAUA 3GXOA 4ND8A 2W4SA 1J7JA 1C81A 2GZ2A 3WO0A 2E2HJ 1O96A 3KT6A 4MUMA 4AUKA 4YPFA 1I2AA 3D0OA 3KOOA 3IAXA 3D6JA 2BLLA 4WOBA 2H1SA 2LR0A 4X6XA 2IGKA 3K0CA 8ATCA 4JUIA 3AJ8A 3BZCA 2CK3D 5PNTA 4XSXF 2ZC2A 5D3ZA 4G86A 2FPWA 5IK2A 4ZVUA 6NULA 1VSVA 3ZHOA 4DEXA 1JE0A 2DYKA 1MD9A 2SBTA 2CFCA 2G08A 1IG3A 1U2PA 2OLKA 2IUTA 4E5SA 3I9V2 1VQKI 2Y6UA 4K6OA 4MR9B 4US1R 4G7OF 4CDGA 4NZMA 4D42A 1JZQA 1YJ5A 4KSCA 2IHJA 2PX0A 4YFXF 3W5IA 5TSDA 3H0EA 3EEBA 4BMCA 3NH9A 5BYKA 1T0JB 3L7MA 2HCBA 4HXEB 5CTJA 3KKZA 3TE7A 5L7YA 5A4IS 3JTEA 1PWEA 4HX9A 4HDSB 5K3EA 5K51A 5ESDA 2XW6A 4ISCA 4KPFC 4C43A 2BMJA 2QAJA 1Y9DA 1B8IA 5B4VA 3AERB 1N7JA 2D00A 1ISSA 5D5PA 1ZN8A 2WOJA 2WFLB 2EYUA 2QIPA 1ZU4A 3WU1B 1QP0A 4BE7B 1ZIYA 1W0JD 5FOUA 4Y13A 5DNAA 5ADUS 1XXHA 5A2GA 3GEMA 4R7TA 3RBVA 1XD7A 3W1VA 2WJPA 4UU0A 2ESNA 1U4NA 1KJ9A 5BMOA 2DT5A 4Y0VA 3OLWA 5K8VA 5A5EA 3EODA 5ALSA 4F3NA 1JB1A 2BR5A 4B4OA 1EK2A 3OMWA 4BBZA 2VJNA 3HCAA 4FNAA 1YRQA 3OZEA 1G20E 1NOIA 4Q1BA 1RPJA 4UW9A 2NGRA 3K35A 1EAMA 4E3WA 2H5IA 5G1PA 1Y8RB 4IX7A 2QRNA 4R84A 1LPOA 1WABA 1YB7A 3BJEA 1PZEA 5DH9A 1FFXA 3F7NA 1OILA 1U2QA 4A12A 1KZGB 3NU1A 2Z04A 2P4SA 3PNPA 4NFSA 1MBHA 3I04M 1T2AA 4UUQA 4DQLA 1A6IA 3LFHA 2P7IA 3UZUA 4M1ZA 1MEOA 2I2DA 3UCEA 5BMVA 2CV2A 4XYMA 2BW3A 4C0AC 4KXXA 3FVWA 3E9MA 4N18A 1WY5A 3U2QA 1U7UA 5KPJA 3R8XA 1M1UA 2RGUA 1GKKA 2YYSA 5JYBA 2V54A 5F7OA 1T9GS 4KQ1A 1UFVA 4AIDA 1ACLA 4UTXA 3GWZA 3CZQA 2O8XA 5CT5A 5D85A 5C51B 4N4NB 3SX2A 5DDGA 3VH4A 3HRMA 5FBZA 3T61A 2AI1A 1JMYA 4V1CB 4KAXA 1N8NA 1IN1A 4US0R 2Y1FA 2WTMA 4RK4A 3GLIA 4WH0A 4RMNA 1BR4A 1W76A 4K9SA 5BW8A 1E3SA 4QAJA 3OETA 4B3DA 1OWNA 2AR0A 3PRHA 3M0EA 1OFHA 1P4SA 4M8IA 5EF6A 4KYVA 4DAOA 4XB6B 2YU9J 2C8KA 3S2HJ 5K0SA 1N4AA 3AFOA 2C84A 1Y1QA 1KFEB 1XCMA 2TDXA 1Z9BA 3KLPX 1MTOA 3RRJA 5KOJB 1H93A 3QP6A 4R1HA 3PX3A 2OENG 1K2WA 2UYQA 1I51A 1YRWA 4DAEA 1QGAA 3M8JA 4DLPA 4E09A 4PAWA 3CRZA 5TPZA 3I3OA 2W90A 5TIIA 4OK6A 4R1NA 3VU1A 4G1FA 1G9XA 1G0NA 2F43B 3FE2A 1J90A 4DIKA 2NOAA 3OO1A 2V58A 4ZO6A 1EB8A 4HQEA 3C7AA 2BELA 1XZEA 4HXGA 3QVJA 4IHSA 4QEZA 4ANJA 4PXYA 1U11A 4IRIA 3PXAA 1IXYA 2RB4A 4N0MA 3R75A 4FGUA 1NQXA 1QIDA 4ZCIA 2HRBA 1U04A 1UBTS 3E0QA 1BW5A 5IC4A 1X3UA 1LEHA 3JR3A 1K1EA 3WFIA 2YNMC 2WG1A 1SB8A 1JEEA 5AWFC 3QBVA 1L5HA 3EA5A 4XTCS 5HILA 2W25A 4EEXA 4PN3A 3K4LA 3OEHD 1Z4IA 3E7FA 1U0NA 2GEVA 2GCOA 4LK0F 2ET6A 1L7OA 2HJHA 2ZYVX 3WKAA 5CM9C 5L3QA 4EG1A 1O57A 3D6NB 1CG6A 3BGIA 3PRKE 3A4TA 3DM9B 1E1YA 2FWIA 2ZYUX 5DBOA 3C1OA 3IP7A 1OLOA 3DC7A 4KRGA 2DPDA 1VJ1A 3EAQA 2FQ4A 2O2XA 3CUKA 4LXTA 2C5SA 2ZMEA 5ILGA 3N05A 3HVUA 4X8LA 3U48A 1I3KA 4WCVA 3ZDCA 2XCTB 2XWJI 3JCUC 4ZV7A 1YB5A 5LUBA 1F51E 3F78A 2K9QA 2OGSA 3Q12A 2X6XA 2UVQA 3J81k 3QVGA 2BXYA 1C1XA 1VSBA 2B3DA 4C4TA 4IIYA 3DEIA 2TRTA 2EJCA 4EJUA 1UPUA 2Q7DA 4IDDA 2IDZA 3O74A 2DLCX 1BD3A 1QGED 5IKPA 4P5DA 4W1PA 4IXMA 1B1CA 3WK5A 4I2OA 1HE4A 4L9RA 2IGOA 4JC4A 4E07A 3OQHA 1XMSA 5TEWA 4PRKA 4YONB 5JAQA 2FGKA 3AB8A 4LEIA 1I3QJ 2PGOA 4GX5A 3EDOA 2MC3A 4IG4A 3HR4A 4J9UE 2J7PD 4PYNA 4MAAA 1L1RA 1NRXA 3WNVA 1EWTA 1YU6A 4CKEB 2JIMA 4WZAB 4M9UA 4C2TA 1NBIA 1CFJA 4N82A 3KP1A 2RKWA 1RWWA 3RLFA 5EXXA 3VZBA 3DAHA 3A0UA 5AONA 3AWIA 3ND5A 2YZ2A 3IP6A 1I2MA 4TXNA 3ASNH 1ULAA 4ENJA 3T0YA 4HDKB 4IX9A 4FDLA 4HEHA 1LY1A 4J90A 4HADA 1YC5A 1Z08A 4ZHQB 1ZSNA 5DP2A 4ZMSA 1QPIA 3I0ZA 3W8RA 2PI0A 3I92A 3EMBA 3A9CA 1U2WA 2C94A 2XR1A 4PNHA 3MB8A 3KSZO 3P9YA 5BN4B 1OQAA 5KTPA 1N1DA 2AWOA 2IYSA 4G0OA 3F9RA 4K6HA 4EHFA 3U4HA 3MWKA 2IZ6A 4ETIA 5ITVA 1V1RB 3BMQB 2PG3A 1DUIA 1K6MA 2EF1A 1L2TA 3DBHA 4EW2A 1G8KA 3D8TA 4DRZA 4R6WA 2X3UA 2W2KB 3B82A 3HJBA 1QLJA 2GYWA 3ZNOA 3O8GA 4QGFA 2CF6A 2KE5A 2P30A 2VDMB 3MN2A 5A9TA 3T5AA 1CUUA 1EE1A 5EQFA 3DXYA 2B69A 2VQ6A 1F1BA 1D8AA 2NO7A 3RIRA 4KMFA 3HHGA 2BIFA 2BUCA 5SY4A 4M60A 2X6YA 1XHEA 4IR7A 2WJ3A 4UBMA 3OIUA 3DHWC 5CX1A 1XCPA 1UJNA 1QHYA 2COBA 1OZHA 4KMMA 2W42A 2P79A 3HL2A 5IUJC 1EFHA 1T33A 2ZYGA 1UZCA 2FZGA 3JR7A 3T1HB 3PDHA 1UJ5A 3SC2A 1RWQA 3USCS 2JFWA 3CRNA 4ED9A 2W6NA 1WQ4A 1QFJA 1BD4A 1JGGA 2X76A 4C01A 1VKJA 1UMDB 3DEFA 3WZMA 3ZH2A 4KLCA 1XCGB 2GXAA 1HQCA 3NCTA 4Q05A 2JWTA 4D79A 4YEJA 1ZGWA 1Z22A 4FD2A 1T36B 1YG2A 2N1BA 3DMRA 5FI1B 2P9BA 4G0WA 3NNSA 4B6QA 1QMGA 3AETB 4AG5A 4UC0A 1OW3B 3B38A 2BXZA 1U2GA 3NP7A 4TVSA 4YBRA 4ZZ0A 2EA2A 4QYTA 3W5HA 3OM9A 3DHNA 4MINA 2X2FA 5K5OA 1Z0XA 1TT0A 5ARDA 2QGUA 5JAOA 3FI0A 5EIOA 2ZYWX 3R0IA 4L0QA 1LW7A 1X87A 5D51S 2BFDB 3UWSA 4IYJA 3TBKA 5L3CA 3G2JA 3KXKA 2YJ3A 1KEUA 1E77A 4Z3KA 1X80B 4MUIA 4ZREA 5C34B 2CHEA 4G0VA 1QV7A 3HXQA 1Z6AA 4B7XA 5KMGA 2I65A 1ZLYA 3RKRA 1QVZA 2WHPB 1GT0C 1W4MA 4V2IA 1JU9A 5BMVF 1OCPA 4GW3A 1PT6A 1N6LA 1R5OA 3OYJA 3VO2A 4Y7NJ 3EQ8A 2E6UX 5K6RA 1BXKA 1U1IA 4PWYA 2XGGA 1V1MB 5B7NA 3NMUF 2AFIE 3QEOA 3NDJA 2CQ7A 1UEIA 3MOGA 2WNSA 3SIRA 2QBYA 4WKOA 3CUQC 2AUMA 4P86A 4KR2A 3OOEA 2HADA 3CX3A 4JB3A 1WD7A 5J3JA 4K6MA 3RNOA 2VAMA 1KI9A 2ZVJA 1K79A 5IDYA 2HNHA 4G0NA 1GLVA 5I9IA 1JXMA 3F67A 5IUNC 1TWGJ 3UHFA 4ZTBA 3TGNA 4BMDA 3RDPA 4BVEA 4OSPA 4Y0AA 3NWBA 1ZJ6A 4J2HA 3AONB 1L7DA 2MFZA 4MXDA 5D86A 1U0RA 1E9SA 3U40A 1N9ZA 3N9IA 4M0CA 3IIJA 4XLTA 3HPQA 1A88A 1L5YA 2QZ9A 1N2SA 2DPLA 3OU2A 1J2YA 1LTQA 3JVDA 5FTMA 4IV8A 4MVJD 2GYVA 4AKEA 1DXQA 3WHCA 4P7GA 4M3FA 1UBSB 2E48A 2WWFA 4CYCB 1L0BA 3WDLA 1W5TA 3GJTA 2PUTA 3GTLJ 1RKXA 2P35A 2VT2A 2A07F 2GR9A 3WRYC 2I6UA 1YZUA 5DNDA 4DC0A 4N3CA 5C8DA 1EUYA 1ON2A 5E1BA 3LX4A 2P9HA 1T0BA 5C35A 2OXRA 3K6KA 4B3JA 3K0KA 3PCRB 2HSGA 3QVSA 4LGYA 4WA7A 4AP6A 2AXTC 1U1CA 2RD2A 1YB4A 4QDUA 1Z2PX 5EI5A 2W57A 4QREA 4ANFA 2HREA 2ZWAA 3PE6A 3ST7A 2ZEJA 2O7NA 1ZD4A 1E4YA 1R9NA 2RAFA 2WVGA 3N6VA 2O61A 5DI3A 1V3TA 2F3UA 4D8YA 3BOQA 3EWIA 1OIWA 4J2OA 2B61A 2W2PA 4B8ZA 4FPXA 5A02A 3A1DA 1T8PA 5JE8A 3LU1A 4A2PA 5CGQB 2EP7A 4Q1VA 4EA7A 1XRMA 1J2UA 4DR3B 5E1WA 4XKJA 1FY7A 3FUCA 3M6UA 2I3ZA 4AXBA 3I34X 1QWSA 3V7UA 1M7HA 2VLIA 1U9IA 1GCIA 1X3SA 3H6GA 4CTKA 1D6SA 2YDXA 1KH2A 3HEAA 4OFWA 2OCDA 1T2NA 4CM8B 1OY1A 3L2QA 1X9HA 3S7TA 3ZWYA 5F77A 4BU0A 2IC5A 5LGUA 1K7YA 1RI4A 1KVTA 3OF2A 2F5EA 3VDRA 3K4BA 3UJ6A 4TL6A 3EXFB 2M4GA 4IH9A 5AHKA 3TOSA 4MKRA 4FGKA 2XQGA 2ZJZA 5D8KB 3DDUA 3CW2A 2HWYA 4ESBA 4D80A 1PEKE 4BPBA 1MJ9A 1AB6A 4B0PA 2RAUA 1WH5A 4I55A 5KTRA 3HYTA 1UC9A 3U62A 4EP1A 5GGXA 5K3FA 3CH5A 4V03A 3CZAA 4P2BA 1XTPA 2HOQA 1BN7A 3CUYA 3CCRI 3OCJA 2W2LD 2AZMA 1NOJA 4BRWA 1RVDA 3Q9NA 1DAIA 2H2HA 4ZDKA 4CCMA 1U6IA 3QMMA 2PRYA 2JB9A 1YMVA 2FG5A 2VQEB 1Y82A 1LA2A 3CESA 5HIAA 1EUCB 2WYOA 5AM2A 4KHPB 5H2FC 3KELA 1F5NA 2PRZA 2ECKA 3HCOA 4EM1A 2ICAA 1NNEA 2Z9BA 5T3UA 5EWLB 2RHDA 1ODLA 2BDEA 3H9UA 1UBFA 5C4GB 3FXOA 3MRVA 1AURA 3WJ2A 5KSOA 3RS4A 1J2TA 2JCYA 1R5HA 3QE2A 4OBWA 2VDJA 1UR5A 2P4UA 1A9QA 4AZWA 2WPDA 5BMZA 3V8PA 1PV1A 2COEA 2ALJA 3R5HA 3I3SR 1SG6A 2JGLA 1H2YA 2PRKA 4JR1A 1RE1A 4BC1A 3OQ6A 2UUAB 2F2EA 4NB5A 4FTWA 2J6BA 5AR1A 2ID3A 3LSIA 3IHLA 1H2WA 1J5XA 3BMNA 1OB5A 4HWOA 2ZSHB 2FPSA 1G8JA 3DOEA 2B7CA 4IDEA 1HKSA 2GZWA 1SG9A 1DS6A 3RJ5A 3L4SO 2WLSA 1VPVA 4MP3A 3KJQA 2HCRA 5GV8A 4ER3A 1K0FA 1DAGA 1R9GA 2NX2A 4M3DA 1AVTA 3RVOA 3B7GA 1EZZA 2L82A 1F5TA 3FXKA 2XIJA 2H17A 3FPSA 2PAAA 1RQ2A 4YMLA 4IHJF 4IFIA 1GIAA 4L08A 1SFKA 3AB7A 1JF8A 4MDHA 3H3VK 5H16A 4RB0A 3WISA 5ECYA 4X64B 2FZVA 2XGEA 2F3RA 1MW7A 1M33A 4FR2A 4EF6A 2YMMA 3H2BA 2HZ7A 2NNWB 3CVVA 2ZSFA 3HBNA 3JRHA 4AJ1A 3IOCA 2BMFA 4PTZA 2EGUA 3OOHA 4UOEA 3RRMA 4MHGA 3EZ2A 2G6BA 2EBUA 2AJ8A 3EPKA 3R41A 2WZCA 3LBIA 1ZG3A 4ZC3A 3NS7A 2WJ6A 5EKXA 4UVHA 3GT0A 4RHTA 2AF3C 4YUZA 2AFHE 5A2QK 4Q9HA 2QOEA 2P3SA 3B20A 1Z6GA 3OLCX 4NBKA 4NZPA 4WTOA 4BEHB 1P2VA 4RS8A 3RPQA 3QGMA 1MX5A 1CF7A 1D1PA 1CC1S 4PGFA 2H27A 2YDYA 1H23A 2W6MA 4WF2A 3CTAA 4LOCA 2XMGA 3UAGA 3ZYZA 1FLAA 5EIWA 3DE3X 3H3FA 1MOSA 2E2WA 4E7JA 4I4TB 3CDLA 2UUZA 4KIWA 4KA4A 3VMMA 1GAJA 3RYHA 3WMWA 4D82A 3NEJA 5EZ6B 2MH9A 3ZW7A 1DHTA 4JLJA 1SM4A 1JHOA 4PYJA 3H4VA 3RQ4A 1T6NA 5K0GA 3MCTA 1FJLA 1HLDA 1BKSB 1VFNA 1EM6A 3UUGA 3P9PA 1E79D 4QU8A 5DCLA 1YZHA 2FP4A 4JOMA 3ICQB 2OVBA 3NYWA 3NV7A 4EJTA 3RVLA 3VC3A 3F2IA 3QLUA 1XDUA 4X7BA 5F1KA 4A3GJ 3NH6A 2WTUA 2WUGA 1CEQA 1LRJA 2IGBA 3KT8A 4URWR 4R1OA 1K7XB 1B2LA 2BFEA 4RL6A 1ACMA 3ZXIA 1HFEL 2XF7A 1ABFA 3QRWA 1RADA 1UP7A 4TWJA 5A05A 1C0KA 1JBEA 5BN3B 1RHRA 3IVAA 2XNKA 2H1LA 2QW0X 3U3ZA 2F8LA 4PFQA 2QLLA 2ZI6A 3FISA 1KJQA 1SEPA 3QVUA 3JZFA 4IDOA 3ISTA 2HYFA 2ZJYA 1GITA 3IELA 2Z9DA 5BW4A 3HJAA 4NHOA 5EAIA 2XYVA 5GZ1A 3F5SA 4ZI3A 3FSJX 3SLRA 3M8EA 1Y8CA 1SQ0A 5HZMA 1S6LA 3R74A 2PEZA 5BSMA 2GEUA 4OMCA 3TN7A 3CB4A 4IEEA 1NU6A 1G4UR 1J5PA 4L5EA 2AN4A 1X7ZA 4AMZA 4NJMB 3PWKA 2D7DA 3ISVA 4A8TA 4K40A 4DV0B 5HM8A 4KXVA 5KYVA 1C50A 1MXHA 1YBAA 4TMXA 1Y1RA 2QSJA 1VIDA 2XMQA 1TT5B 4NWIA 2GJ8A 1F0NA 5CXSA 1QLWA 4FT2A 1APBA 1U8RA 2FAXA 3IKVA 3WU2C 3IRUA 1UKZA 2D45A 4FDAA 6PFKA 2CQXA 1WGXA