1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
molecule keywords phosphofructokinase
molecule tags Transferase
source organism Borrelia burgdorferi
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
3O8OB 4MEJA 1WEHA 2PMBA 4FYHA 1MTOA 3PFKA 4U1RA 2F48A 1PFKA 1ZXXA 4FYIA 1F8YA 3F5MA 4A3SA 1S3FA 3OPYB 4JENA 4PFKA 1KZHA 1RCUA 2F64A 1S2GA 2HIGA 4I7EA 4HX9A 3HNOA 2NX2A 2IZ7A 4I36A 3EHDA 2KHZA 5AJUA 2F67A 3MAJA 3UQZA 4I4IA 5ITSA 2F62A 3SBXA 2Q4DA 2PFKA 4FYKA 4JELA 4JEMA 4OHBA 6PFKA 2KLHA 4RH3A 5AJTA 4KXMA 1S2DA 3U39A 4NPAA 2F2TA 4LJRA 3GH1A 2IZ5A 3K2QA 2IZ6A 1YDHA 2Q4OA 4KXNA 3IMKA 4KXLA 3O8NA 3O8OA 1S2LA 3O8LA 3BQ9A 1T35A 2A33A 3QUAA 1WEKA 1S2IA 1F8XA 4P5DA 4LJLA 4WL0A 2A0KA 3OPYA 4OHRA 4MCJA 4P5EA 4LJKA
chains in the Genus database with same CATH superfamily
3ND6A 1SC3A 5EC8A 2XAJA 4NRDA 4NU5A 3KEYA 3TG8A 3FWPA 2VYCA 3I59A 1PIWA 3OTHA 4H0NA 1QQTA 3QVKA 3TE6A 2O0MA 4FBGA 1V5GA 1R27A 2WVJA 5IT9K 3THXA 3EXG2 1L5RA 5CURA 4E14A 3UWDA 5IAAA 3SLGA 2QTAA 3PDJA 3BUSA 3CMCO 3UFXA 1HE8B 2C4HA 2R5YB 3B3AA 1ZDMA 5BWBA 4XEHA 1AMOA 5LGTA 4RF4A 1ZRFA 1YKSA 2PE5A 4JDPA 2EZ9A 4N48A 5E8RA 3AFOA 3ZQ7A 5HGJA 4C0XA 4BXOB 3FYUA 4AN0A 4A5NA 3LTEA 1R4MB 1FSPA 2RAPA 4WXPA 5K0SA 5HBGA 1W1UA 2FRDC 1XTUA 3BIXA 3FMPB 1A7AA 4EF4A 2I3DA 3KEQA 5ICSA 5AKHA 3V00A 5AWFC 1XNRB 2EFGA 2FFHA 4IDGA 5CBKA 3RS0A 2RARA 3D54D 3TRKA 5B2EA 2D1HA 1EFCA 2A3NA 4XVUA 5IBPA 2HA4A 1PT9A 3TOXA 4UV8A 3G8DA 1PKEA 2QA5A 3BCSA 3FDJA 1AY0A 4XICA 5HKAA 5HOQA 1EM8A 4IMIB 3K4NA 4BTEA 1H65A 2I9PA 2GNAA 1Q3HA 1NONA 2Z9DA 3WQRA 3GJQA 3L8GA 3S3TA 1EFLA 2JA1A 3I9NA 2GN6A 1CUBA 3HYTA 2DUJA 3ET5A 3IR6A 3HCRA 2R5ZB 1ZK0A 1KMNA 4HXGA 5CMLA 4D3DA 5IW8A 1PHPA 2VATA 2XPCA 1J09A 1R7JA 4AAYA 2CK3A 3TQTA 3WLSA 4WOBA 2QRGA 2QTRA 3B3GA 3LCCA 4MQ5A 1USWA 3ZU2A 4QNMA 1IB0A 2R9VA 3IV9A 1CF4A 2VDUE 4NARA 4CLXA 5LMUB 4LIUA 3U81A 3FNHA 1DJLA 2KJBA 4A3LJ 5C2JB 3IQXA 3O93A 1VF9A 2F00A 1FDUA 4G09A 1YI0A 3O2NA 1XZCA 2RDMA 4K3UA 3KK0A 4AS1A 4KMUX 3T8YA 1AG9A 4CL8A 2WP8J 5AVSA 1IQPA 1XQYA 3GRZA 4I5GA 4ZOLF 4RTSA 4RV4A 2X77A 3CRW1 2ZVJA 5LKRA 3KFXA 3HSEA 1N6KA 4OQFA 1WCWA 1QC5A 4ND7A 5AHWA 3W5JA 4BNHA 2Y1DA 3EEYA 1TPYA 1ZVVA 2CF5A 3KP2A 4AQDA 4YHHB 4XX1A 3G0GA 4QYTA 3O1LA 4ZWNA 3VR4A 4ALIA 3JARA 3CJNA 3NETA 2YX1A 1F38A 5IC6A 1ID1A 1K5HA 4JGBA 5TMBA 3G1UA 3I56I 5DTMA 2GBFA 1K79A 1UT8A 3FMQA 2FR1A 3NALA 4BDSA 2IUYA 5A6SA 4LFUA 2A59A 4KDFA 4EX6A 5BSUA 4ZHQB 2ZTMA 2C5FA 3OZFA 2RMKA 3IQEA 1KZHA 1WUJS 4H3SA 1BMFA 3T0FA 1KY5A 3RJTA 1H2WA 5ILUA 1GPJA 1ABBA 2VBZA 1VCMA 3G1WA 3LP8A 2B7BA 1Y7PA 4BKXA 1MJ5A 2X48A 2N47A 1OXKB 5A0VA 2DQZA 5F2EA 4FJ2A 1H0MA 4DLVA 4R81A 1VL2A 1X38A 2IU3A 2COUA 1WCV1 2MMCA 1A9ZA 1BROA 1YXMA 1CZOA 3OMWA 4H7DA 3VU9A 3ZWAA 1O9HA 2Q7DA 4NNJA 4MITA 4UUMA 3U60B 2D1FA 1YZGA 3SHWA 3Q0EA 2OCEA 3DLAA 2QMEA 4PCLA 4WXEA 4X6AJ 1X70A 4FMDB 3VHQA 1O3QA 3NG1A 4HY3A 3L3BA 4D4JA 1SVSA 2FA9A 1MC5A 5HKLA 2WJGA 1XP5A 4QOIA 1JR2A 5FP0A 4W1PA 4EPXA 3TIXB 3LSPA 2X9NA 1RC1A 3QP6A 5I8ZA 1VTNC 4ND8A 1JXMA 2DU8A 2H4WA 3I9LA 4A2QA 2VXCA 4OD0A 1NP6A 3PUYA 3MMSA 2GAIA 3MCVA 5JS7A 4OP2A 2GYUA 2AF4C 3HXPA 2FEZA 4HX2A 4LGMA 2WWRA 2COMA 1BW6A 2O7SA 1U2DC 4WX2B 3H2YA 2HIHA 4B82A 4FX5A 4EYGA 2Y77A 2ODPA 2IZ5A 1GA1A 3QOEA 2BOLA 3BOQA 2C98A 4OGFA 3I1YA 3D3KA 1WZCA 1E2PA 3EUEA 5EQJB 3RVPA 4WKGA 5C1BA 4S24A 4CCYB 2B34A 2P9FA 1ZCZA 5TQ0A 4OI4A 5IMBA 4B3TB 5LVAA 3SS8A 1JTYA 2H5EA 5C7YA 4FTWA 4E4HA 3TIVA 2W2VA 1DRVA 1UADA 3W9YA 3SLKA 3LBAA 5KVSA 5JCPA 5AJYA 3K6GA 4EGAA 1KEEB 2VJ4A 1J0EA 2HOAA 3HVJA 3COWA 3O8CA 2PGNA 5C18A 1Z68A 3RIRA 1VHTA 1BCRA 1B74A 2AI2A 1J22A 4B2LA 2GUWA 4BJHB 3E3AA 3L4BC 2D4HA 1U28A 4AB1A 4CLEA 1TU0A 3E9MA 3U2QA 2XB5A 5SY9A 1M2OB 1NI3A 3QPWA 1SCAA 5TV2A 3CUKA 3JV7A 5FLEX 1GXSB 1J0CA 4UAVA 4EFLA 1Q2XA 4PZJA 3A58B 3OJEA 4I1SA 2CXXA 4H7EA 1JLSA 2PUDA 2EZLA 3R74A 2E1NA 1ZOSA 3TNLA 1QV7A 3DWGA 1UM9A 4LV6A 1CDDA 1A71A 3BMNB 5IH7A 5B4TA 2DFFA 3K1AB 2JLBA 2VI5A 3HY6A 3ZKWA 4H0EA 1NJSA 3MT9A 1D2NA 2AF3C 4C0BA 4BHBA 2W6ID 3K6KA 3QOFA 2XSDC 5IWAB 4ER5A 5CVCA 5E8GA 3WWYA 5FO5A 3FH0A 4TVSA 1PG2A 5D1NA 1RQ7A 1P18A 3GK3A 2Z4SA 3LUCA 1V26A 3TJRA 2EV6A 1OZ0A 2JGFA 5FL7A 4U7PB 3GFFA 1EDOA 3K9CA 4R71A 4DSOA 3KJEA 1W5SA 2W2NA 5MN5A 1XGKA 3T7KA 4PF1A 4NDNE 1ST3A 4MW9A 1RXEA 1FFDA 4W9RA 4C9YA 4HMOA 1Y81A 4PZ9A 2ZWVA 2JK0A 3FISA 2DUWA 3L00A 1D1PA 4IS2A 2JJ7A 3U4GA 1RFLA 2PUCA 3PRKE 4YUXA 4MPJA 1V54H 3AEUB 3NBZC 2F4IA 3ZE8A 2VNJA 5IVDA 3A10A 1FRNA 3JQFC 2J9RA 5L3QA 1A1VA 2VFAA 4YDSA 4LSMA 1MA3A 5K6AA 1LV8A 1SFUA 4J7XA 2HLDD 2WU3A 1CFJA 4TTIA 1SG9A 3F6CA 5AIQA 3N53A 3QA9A 3FFTA 5HF9A 2AD1A 3DFUA 3BJIC 2VJKA 1LNWA 5A6SB 4KTTE 4KFTA 2Y68A 1M66A 4KODA 5EMJA 5HUQA 4XVHA 2XNJA 4KN5A 3GBSA 1MNMC 4PU0A 2HX1A 1NXSA 1F4KA 3W9BA 2M2IA 2NSYA 3IDQA 3PIDA 1Y37A 1U81A 5E9WA 2HJRA 3HO6A 2X1HA 1LUJB 3QU2A 2V98A 1HH4A 4NCNA 2J67A 1H4VB 1SA0A 3T4PA 2G9NA 1U7PA 1HDYA 1JLLA 1A9QA 13PKA 4YP7A 3JD4A 3DYVA 3OH8A 5EG5A 5EP1A 1P1HA 3OQHA 1THZA 4C30A 3VSDA 3NYIA 2XEDA 1XX5A 4OHYA 4JQOA 1QIFA 1G17A 4YAOA 4S3MA 1XQXA 1JIVA 2ZTSA 4JQYA 4L3WA 3RS2A 1GNQA 1JIQA 5EPUA 4YCAA 4ND8B 1SPXA 2G5PA 2PN6A 1W85A 3DKYA 1T1RA 2BFNA 2O1SA 3VFZA 4LWOA 3D8NA 1DBWA 1EVLA 4BWVA 4QLBA 3FPCA 1PFUA 4JR2A 4X7MA 4I2VA 1BYUA 2IGNA 4KJXA 4DR1B 4ECEA 4BKMA 2Q3FA 1RJGA 3GTMJ 1RMYA 4G26A 3C48A 1OIVA 5IAGA 1U63A 2XKBA 4N18A 2V65A 4B73A 3T34A 1HC7A 3WHPA 3SXJA 4XKBA 3WYEA 1G5HA 2WJYA 2QNBA 1DQNA 4L9VA 3ELWA 5IT9A 3EVEA 1HC8A 4HFJA 3AUAA 1B7GO 2UZ4A 3OIOA 2NTEA 1DTWA 4CF5A 1QFZA 4DG5A 5ETJA 2BUBA 3EUFA 1OXVA 3Q7RA 2EQAA 3IBFA 1W4CA 1E1CA 4E4YA 5E95A 3I5YA 4MWGA 2ON6A 1IEVA 3F72A 3FUVA 5HHTA 2FRDA 1QIDA 4EQ6B 3ROTA 1YHQI 5F1JA 4KN8A 1KAOA 2O5RA 1IY8A 5KDOA 1JPJA 3H1TA 1QIHA 5CNIA 3GCGA 3ZYCA 1UBGA 2DY1A 3QEKA 3ZN2A 2VP6A 3SSOA 3HXQA 4WNIA 1KK3A 4YY3B 3UATA 3GBPA 3FVVA 2ZB3A 3IBGA 2HHAA 2VNAA 4B45A 4HBGA 3DTNA 1XTZA 5KNBA 2ELHA 4UHTA 5FBZA 2CRGA 3ZK8A 2HMSA 3N4MA 3A3PA 1VIAA 5J1UA 4DIMA 2DWPA 3KZVA 2IA0A 1JKMA 3FNQA 4M9CA 3BR1A 2MH2A 5K4AA 4TXMA 3STHA 3DFIA 3UMRA 3GLLA 4BQEA 3PIIA 1Y42X 4NE7A 1UM9B 2LVBA 4MZDA 3BQMB 2E2JJ 3BZUA 2OQGA 4GX2A 3CT6A 4U39A 4JBNA 3SHVA 2YH2A 3BHJA 1FOEB 3EDQA 4KXLA 2FKAA 1X86B 3S3MA 2YVQA 3P0FA 1RHMA 3MT8A 5AKKA 2ZXUA 3CLOA 1SFXA 2B6NA 2XECA 3D6FA 1JHMA 5AI0A 4YXWD 3K4LA 2Q7XA 3QI7A 4R0VA 4GD3Q 4OHFA 4M1SA 1ZOIA 4X95A 1K4MA 1I13A 1LZKA 4JP5A 1NVUQ 1IONA 1RPAA 3UAVA 2EW8A 4B0PA 4D57A 2XKPA 3SDSA 2CY0A 4O5VA 5ICCA 4QAJA 4N6NA 4RKEA 5IM4A 4DIFA 1LSOA 2PH7A 4DNQA 3R7NA 1D8KA 1VKHA 1TX4B 2A9PA 3GRYA 3CUVA 1GLVA 4BX8A 1BFUA 4CDRA 2K85A 4WECA 2J9ZB 5D1HA 2IGKA 2ZT5A 1ZJJA 3H2SA 4WBNB 3ZMUA 5IVKA 2XDQA 2M3AA 3UAXA 5LZ7A 5BNIA 1YZLA 3BT7A 5U4QA 2LG4A 3ITEA 5LOVB 3SE7A 3EK2A 1L0BA 3HSFA 3HN7A 5FUVA 3DJYA 2XNCA 4YRIA 1QZXA 4BYMA 1DGQA 4LA4A 1KFJB 4I1OA 2YRFA 3WLFA 4DBLC 2DPGA 1N3BA 3E61A 2XTNA 3HA3A 1YR9A 4RL6A 2PG3A 4D8UA 4LECA 1GTVA 4U0YA 4JYMA 4A5MA 1SVUA 3LZ6A 4JT9A 2C8VA 4YFYA 2C77A 3C1UA 3C7DB 1QVZA 4M1KA 2YASA 2OLKA 1ZD5A 3M34A 4E5PA 2DW4A 2F1JA 2FPGA 2QV7A 1NBIA 2BE5F 2JIOA 4XLZA 3RK1A 3ABZA 4G2NA 1TTPB 4A8JA 1W5AA 2WUEA 2H3HA 3OVMA 2V7GA 5IVIA 2ZKLA 4EEFG 4HV4A 4GZ5A 2X0LA 5A3JA 1AKNA 4H3KB 2CMGA 2GEKA 4LHYA 1FIPA 2QKYA 3NEPX 3BXZA 4D6YA 2E35A 1W9MA 1TUBA 1JLLB 3D6JA 2P30A 1W2GA 3EETA 4IZ6A 5K3DA 2DWCA 4DV2B 3QW4B 3I9OA 4JX8A 2AFRA 1U0BB 1LDKB 1DG3A 1QZTA 2IHYA 3VKVA 5AI6A 1KO7A 5EP4A 4JIGA 3U37A 1ZMBA 1QGUB 4QEKA 3W5BA 1QG0A 3VPBA 4IDPA 3N39C 3HOYJ 5KOIA 4P4SB 1HKTA 2MJLA 1HDGO 1MP0A 3IAS1 2IQ5A 1CVIA 1JJIA 5CLHA 3LLUA 3SZGA 1UK6A 3II6X 4C29A 1U2DA 1H1LB 2ID7A 2FQQA 4CMCA 3GVIA 2X6QA 5ADHA 3KQUA 4L6CA 2DYSH 2VC1A 3TKLA 1C9DB 4ZYHA 3AF6A 1DRWA 1RKQA 4QHYA 1Y1WJ 5KO2A 5K8VA 2R97A 5TNXA 4GR5A 3QEMA 2OFFA 2JAWA 2WF6A 1A1SA 1LSJA 4R5HA 3I4PA 3CC7I 1CNMA 3FMFA 1VJGA 4J91A 3ZJ4A 2BTOA 3OIFA 2Z5GA 3QPDA 1A9XA 3FM3A 2PAAA 1K2VN 2J5RA 4D80A 1FFHA 2M9HA 4JK3A 5ADUS 1T29A 1DTWB 1A8PA 5JBQA 1JKFA 3QLJA 4D4KA 2QP4A 1BZYA 2EYUA 3EMBA 4ISCA 4QBTA 1GHTA 1PCXA 1N6LA 3N9IA 4DQLA 4Y52J 5CCXA 5JCXA 2LP0A 2JSPA 2M7AA 3KE9A 4AS2A 4JI0B 2CXOA 4Q9IA 3ZXYA 1GL3A 2RCYA 3EHEA 1DPGA 3ORYA 4P9NA 5CPRB 1UCFA 2DPYA 2VDRB 1LLFA 3HBJA 3DVSX 5BXQC 2DMQA 3BTJA 4LBZA 2WYHA 4NQRA 2LKCA 3MHPA 3L1JA 3IAM2 1CSEE 2GEUA 4CWAA 1ZPDA 4IVPA 1X14A 2Z5FA 2B99A 2VJYA 2F3SA 1NF2A 4R8HA 4JLVA 5JWHA 1AXRA 5BY2A 2O7RA 2G25A 5IEJA 1IEXA 2R7LA 3OESA 1XZLA 4BQRA 4NONA 3DG9A 4O0MA 3VKHA 5JZOA 1GADO 1IHUA 2B0LA 1NXTA 4GI3A 5DN9A 1MTOA 2WJIA 3R0JA 2PBIA 2NTJA 1G21E 3JAWA 4MVJM 3SQNA 3EIEA 2AIRA 1V6AA 1N4DA 4UVAA 2JIRA 3OY2A 2QL7A 3H5OA 4CIDA 5BXYA 2G1KA 4YJFA 1QHYA 3LKBA 5TEVA 1DQRA 3WSTA 5LP6F 2JHFA 4JJ6A 1SAXA 2Q3BA 2GCNA 5KTSA 4FDMA 3P7MA 2F67A 5D3MB 2IKQA 1KJYA 4Q21A 1IXRC 2G40A 1MNDA 2BGMA 3PNLA 5CT5A 5EERA 5DD8A 3E4DA 3LLSA 1MW7A 1DJMA 4RKRA 4UTNA 4FHEA 1H23A 1HY3A 3TOAA 4F3YA 3ZH2A 3OJWA 2B4YA 5TXGA 1V2HE 1TMGE 3KFLA 1V1RB 1P4RA 2CN1A 2NYXA 3KZZA 2IDZA 4H4DA 4ARAA 4PLWA 2GM4A 1R16A 3KT8A 3DXFA 4ZVTA 2CWDA 4YRAA 3VYSB 4NFHA 5MFZA 3MWGA 2A7QA 3OL3A 5AICA 4MARA 3IYLW 2D62A 1YZYA 1NTCA 3FXQA 4X6LA 3TL6A 1U7UA 3JQFA 5AESA 2C3YA 1TVKA 4JI6B 4EFKA 4DWOA 2Q5OA 3OU6A 2H8WA 1R6BX 4N76A 4FGSA 3D0RA 4XRSG 5LGNA 2XAQA 1MX5A 3MKWB 5DHFA 3ICVA 3FCCA 1Y34E 4BZQA 1QK5A 3NTXA 4MKGA 4KOEC 3Q8XB 2Z9OA 4R8KA 4RY0A 3QUTA 4ZZ2A 3BIFA 3HUDA 3LDUA 4B3MB 4AECA 4BV8A 4I1PA 3JAMZ 3DYIA 4TGLA 3AEKA 4YMTA 3PEVA 3QP9A 4B6JA 1BXKA 3F74A 3CH7A 2LREA 2AUNA 2QQAA 3W79A 3CJQA 5F5LA 4YX9A 4TLDA 2YOFA 2EZ4A 4V0SA 1I1HA 5CQGA 2OZ6A 4D3FA 2BBSA 1W94A 3EDPA 1G55A 4E32A 1TCCA 1M75A 2ZP1A 5C7OO 5CB4F 2HK7A 3ESCA 4HYYA 2VE8A 2PGIA 2H54A 3UQYS 1JU3A 2NPIA 2JFNA 1TO1E 4BEVA 5ALEA 2F48A 3K1TA 4U2GA 3S1LA 3HPHA 4HC4A 1M2KA 1C30A 5AI9A 1IL0A 4KE8A 2BMVA 1QYRA 1B9MA 3W6VA 2LD4A 3C43A 5C46F 3QKSA 1YS7A 3KQLA 3L18A 4W99A 5JD4A 3PG5A 2V3VA 2OHIA 3IR5A 3OZWA 4KX5A 3DC7A 5EIFA 4I6GA 4PGGA 2VWHA 3A1CA 3BDDA 2ZJ6A 2CLIB 4UUSA 2ZPUA 3DE1X 3U3DA 2EQBA 4E4RA 5JD5A 3OHMA 2CW7A 1XRRA 3GH3A 4BMDA 1W47A 3TTUA 1DCFA 4K6HA 1JUDA 1KO1A 5J4LA 5JR3A 4RTNA 1JIJA 2C3MA 3TLJA 3VZPA 1U9NA 1ZLKA 2ZMEC 1H0KA 5T6BA 2NUAA 1PR4A 2I6UA 2QWWA 2FVXA 2WV1A 2A3SA 1KZGB 1V48A 4AN1A 1TC3C 3R3VA 3BF8A 1PZNA 2FQYA 3JAMA 4EVRA 4LVUA 3KCQA 3HDDA 1ZQ3P 1SIUA 2VQCA 1B8OA 5JATA 4G84A 3VH4A 1YZQA 4K88A 5HX7A 1E4EB 2FLVA 4UHHA 2WYIA 2VUIB 3UMCA 1R3DA 1KU2A 4WCVA 3CLHA 4URXR 1NXPA 1A9XB 3KKKA 4U7JA 3PE6A 3BL5A 4EB3A 1W25A 3W6OA 1EGVB 5JLJA 4FIDA 1OYIA 3G8CA 3QFFA 4IXNA 1Z2CA 4GRAA 3QP5A 1L7PA 2ZS8A 2FPMA 4M46A 3IT0A 3EJWA 2DDAA 3KB8A 3VH2A 1PV4A 2IZZA 6PAXA 4F4HA 3U7HB 2XRNA 2RK3A 2BTEA 2VXOA 3HZRA 2VSXA 4I8IA 2IPAB 1FVOA 3VR2A 3TGWA 2D7JA 1PF7E 2BC9A 3RYPA 2QZPA 2VN8A 3A26A 3GUZA 1S5PA 2VDJA 4PAQA 4RAGA 2VQ6A 4M0EA 2C97A 4EHAA 2E71A 3GRUA 4QAQA 4X1YB 5GGXA 3ZWVA 1ONVA 3JQAB 3PYMA 1E79D 4CEIA 1JDZA 2Y0BA 4MUJA 4F1KA 4JVMA 4Y2SA 5L8VA 1YW8A 3CJRA 3QSGA 4IUCS 4IHYA 1CQWA 2OXCA 3D4BA 3M7IA 4QOFA 2QQFA 4KPFC 5JJ5A 1DGRM 2QHXA 3RPUA 4G0UA 2EJWA 2ZUUA 1FQJA 3O9ZA 1E9VA 1A5JA 4TV8F 4RESA 1Y56A 3KWMA 3QPCA 4XLHA 3BMCA 3BE5A 1U8FO 3T99A 1RBZA 5LR6A 3WLTA 4XWAA 4IEFB 4EB6B 4XN3A 3I4NJ 4LFCB 1NMYA 4AYXA 1JJAA 2Q9BA 5TT1A 2Q5CA 2UUZA 1RWVA 4RTMA 3NW9A 4RPIA 4UCWA 1S3SA 2GZSA 1NW8A 3P9QA 5K0JA 3FMSA 1L5FA 3ADDA 4O2BF 2UYOA 4BVKA 2FV8A 1TGYA 3SFIA 1EMDA 1K68A 5FLKA 2DFVA 3AI2A 5CPFA 2YC2C 3LBHA 3OEWA 4J94A 1LTKA 1ULHA 3EXFA 3HQ4O 3O4JA 1FMLA 1ULZA 4IUBS 4WFJA 3TKYA 1EDEA 4DKJA 3TB4A 3DE5X 5EJ7A 4AWXA 4CQNA 5K9ZA 2P3QA 1MFPA 4WASA 3AR5A 4KQ2A 1OXMA 4HA8A 4PG4A 1BAPA 4CL3A 4TTVA 7REQB 3BB1A 3GLSA 3CLRC 4DUGD 1BNCA 6NULA 3I8SA 1MT3A 4UEJA 2FMIA 3VHLB 2JTVA 5FBKA 2HPHA 4YPVA 4GVPA 2G71A 5DHPA 3MSXA 2JKZA 4ZCPA 3SR4A 4L57A 1NYQA 4D3ZA 3I52A 4EHHA 1T6YA 5F7JA 2XVAA 1FNCA 2X0KA 3U6BA 2BGTA 3G3EA 3RYCA 4OSOA 3ZXSA 1YRBA 5KJFA 2WFLB 1GCOA 1SO8A 3MT7A 5JVDB 2YFKA 5EGNA 5HKKD 1O6FA 2ONJA 4D5GA 1X7HA 3BROA 2YUSA 3LUJA 4PR3A 3C7AA 1LI4A 3BG9A 1XN7A 1ZRHA 3EXEA 1FX7A 4WD3A 5ALRA 2JA2A 5DGDA 2QLTA 2CFCA 2X1CA 4Q4HB 5JAMA 4OYLA 5H02A 1WOMA 2XB0X 4GKKB 4L22A 2P9ZA 1VP9A 3CP2A 1T43A 1Z6AA 3DAYA 2R65A 4QULA 4LE0A 2L7KA 1PI3A 1XA0A 3EASA 1ETHA 1DFIA 3FROA 1EXDA 3KUUA 4A0GA 1IU9A 1CDOA 1WDLA 3P9RA 1MB0A 4IDBA 3M8KA 3PNOA 2NM0A 5IBQA 4M8NE 4Q3BA 4FJ0A 4MV3A 1Z35A 3F7MA 4R2XA 5ECYA 1R1VA 4F3TA 1VDZA 1ZIPA 1JALA 1LF0A 3ELYA 1A4XA 1PT7A 2PXXA 4BMZA 5HJEA 5K99A 4TOIA 2VPYA 4QVIA 5A9SB 3VNSA 1FX0B 2NUAB 3NTLA 4BVAA 5L45A 1D0ZA 4R8LA 1GRCA 1Z2PX 2FX0A 1W5CC 2QN6A 1UAGA 4GZLA 2I2BA 4DKXA 4E2FA 3M5CA 1J9EA 1NSTA 1JFFA 5FAKA 5IPAA 2QUJA 4YC7A 6CHYA 3HGYA 5DNWA 1I2AA 5I7EA 2E7ZA 2RI1A 3WGMA 4PSXA 3C3EA 5EJAA 2OV1A 3ABIA 3HOTA 1OWLA 2AYYA 2OQ2A 3FBTA 3HVIA 3GFJA 3EZNA 3BTSA 1ISFA 1Y1QA 2DM6A 4KQIA 3U13A 2PMBA 1GD1O 5BV2P 3AL0B 1QGAA 3L7OA 8GPBA 4IHQA 3TLGA 1J75A 5KOJA 4M1MA 3VSBA 3KU4A 3FHOA 1YZNA 5LQMA 4TVBA 2RGRA 3LA8A 2WQ6A 1KMHA 2G4VA 1EVYA 1V8PA 5JYEA 2DQRA 3EBLA 2FEKA 3LA2A 1TLTA 1K6YA 1D3YA 2XNDD 4NHEA 3LOCA 3CKLA 2IUFA 4F46A 1I30A 2PMKA 1US8A 2G0NA 3CC2I 2HT1A 3K70C 2QRHA 2XAFA 1Z8HA 2FAXA 2X8JB 2XZLA 2EIKH 3NJ8A 2HPIA 3RZDJ 4FHTA 3EQ8A 2W4QA 2GEVA 1WSAA 3VDNB 1XPUA 3EFOA 4GYYA 3W8DA 1EUCA 3LUAA 2JH9A 4X61A 4GP9A 1KQPA 1A8IA 2GPNA 4UM9D 1V25A 3NP9A 2LMDA 3H9GA 1TM5E 2D1RA 1OU0A 1G9TA 4TKUA 1XEWX 4JI3B 4H17A 4PBTA 4MR8B 4PGFA 5HRAA 3RFVA 2WUWE 1GZ3A 1EH7A 1DAEA 5AM1A 1O95C 5GADJ 2FDCA 1YS9A 1AKHA 4WVFA 2WM3A 4MQ9F 3DMPA 3OS0A 2XMSA 5C53B 1QA6A 2QG4A 2DBBA 2K4BA 1OH5A 4EOGA 4ZEVA 2IYAA 4F3NA 3NCHA 1V4RA 2JB9A 4MV5A 4C3JJ 2ZI7A 4Y3OA 4FT8A 2AXLA 3H3VK 4F2WA 1M2FA 3GCZA 4X1KA 1CK4A 4UVCA 4QDXA 3JYQA 5I7RA 3RUPA 4UU7A 5KHLB 3EWIA 5EJIA 4ALMA 1Q19A 4E07A 3EWNA 5ICEA 4LRUA 3EXFB 1LDDA 1SBNE 1ADJA 3WHBA 4MP8A 1KRHA 4K03A 3LPAA 5I4KA 1XRPA 2OK7A 4K9RA 2AMYA 4DDWA 1D1CA 2NS0A 1T10A 2X58A 1B3BA 2XRYA 3ZQKA 3IVCA 3TX2A 3ANTA 2G9VA 3JQ8B 1LCIA 4TXNA 1IVNA 3VI4B 2J41A 3LOPA 5D6EA 4CV0A 1N2OA 1IG3A 5IEBA 6GPBA 1YJQA 1AGPA 4J0CA 3DLPX 4F56A 2HDDA 3RKWA 4G4SP 3LZDA 3HEMA 3FZGA 1NGSA 1XFDA 3A9RA 5BRNA 2YUIA 1X13A 1O96A 3G1OA 3RWOA 1IM8A 4LXTA 3FXKA 1RI7A 1YRHA 2PKXA 1UBSB 2OESA 3HSRA 3RYCB 1WGXA 3GUHA 2PQMA 1P5ZB 3QSYA 4RZXA 1JHQA 3MJCA 2A7XA 2WT4A 4TS4A 4B87A 1KFEB 4FZ5A 2XYVA 2EBIA 2PZJA 4A0FA 3K35A 4BTLA 5FI0B 2GTPA 2GVNA 1V5EA 1ZW6A 2VQGA 2R8XA 3ROKA 2ZYWX 1MX9A 3V55A 3UM9A 1ORRA 1TF5A 4TUYB 1W2WB 2NV6A 2ZRNA 3CY6A 4AF6A 5AUNB 4CM9A 2FOIA 3RRYA 4X65B 3IJ5A 4A8HA 4YRMA 3RBVA 4I81A 2A84A 1ZD9A 1W2HA 1QHIA 4PDKA 3H5RA 3VSEA 4TYWA 1E2GA 2F64A 4IQ0A 5HNFA 5MF6A 1AKMA 2L18A 3FMOB 4DGSA 2ADUA 5CLFA 1IQUA 3W0LB 5SY4A 1OA0A 4IGFA 4A3DJ 2ASEA 1OMIA 3K9QO 3WL5A 3TW8A 4ROSA 2IGMA 3RAFC 1DEHA 4FUTA 4BCDA 1D2MA 1GFWA 2ZSHB 3IT1A 3C6XA 2JAUA 4DLNA 3L01A 2OVBA 4M0UA 1ZRCA 1GZ7A 5C4MA 2PRJA 4CHUA 2ZMEA 4HX8A 2V8OA 5B53A 2HJSA 4YCMA 5FHRA 4KICA 3OBBA 3L93A 3FRJA 2V7BA 3HTXA 2FPLA 5B2ZA 4WE3A 1HQCA 1EJ2A 3LUBA 1PL6A 2R1TA 1RMTA 1BU8A 4MLCA 5FKMA 4RTOA 1VGQA 3NBAA 1QHFA 4C5BA 3GEDA 4BJ6A 5B30A 3EF3A 4MPRA 5T4HA 2NS8A 1V1MA 1YRAA 3K5IA 2P9CA 5AUQA 5JI3E 2WFAA 1G3TA 2QVOA 1PT6A 3DCIA 4PGHA 1Q7EA 1U5BA 2WC2A 2K4JA 2XE4A 2FA5A 4JLSA 2ZYRA 2QE6A 4EG6A 1CS4C 5IKPA 2A4MA 3SVTA 4O2RA 3DT9A 5CX1B 2PMEA 4JAVC 4I50B 2W2MA 3NPMA 1X2NA 1RKUA 4FFWA 4KDRA 5TY0A 4MYUA 3VR5A 4FCTA 3CCFA 3GYBA 3TEDA 4JOSA 5F2OA 4NQWB 1E1LA 2D5BA 3EZLA 3F3MA 4MO9A 1OLTA 3PJEA 1BXRA 1FS6A 4RY9A 3KG2A 4L4SA 1EK1A 3B60A 4QA9A 2VYQA 3HKEA 3OOPA 5JCJA 4EZBA 4YEDA 3BP8A 2JGRA 2VH1A 1ETWA 4UREA 1SVIA 2P11A 1KZ1A 2XCSB 3PNMA 4NAVA 2G7UA 2IYPA 4ZU3A 3FJ1A 3ZZUA 3QXJA 1W5EA 5C4JJ 1QK4A 4M8IA 4OXRA 4EEXA 2BR5A 2JN6A 2K5CA 4JASB 4J00A 1E94E 1P61B 5J2UA 4B6RA 2YJ4A 1TZMA 3TLKA 3VR1A 1A9YA 4YDRA 1MBKA 1YD7A 4AY5A 1M2GA 1NVMB 1D3AA 1UG2A 4BFXA 5J23A 2HPVA 1HMPA 5SV2A 1WBJB 4Y1RA 5TT0A 4ZDOA 1U7ZA 1ZG3A 3PEWA 3NM6B 2B2XA 1FJ2A 1JQKA 1AMNA 4UFNA 2D5CA 1U1CA 2RIRA 1O97D 4OAZA 2B1IA 2YQ5A 5F27A 2PLWA 2Y8EA 4W5JA 1QF6A 4MI1A 5JLXA 1UB9A 1H9BA 4XJSA 1R8XA 1CUDA 3IB3A 1JEAA 4IWNA 1PZXA 3UGKA 3BK2A 3U4IA 5AVYA 3GMEA 2OC4A 1N78A 1C3OB 1WAMA 4GR4A 3BWMA 1FOKA 5CEEA 2DUMA 3I45A 1XYVA 1Z37A 3QFCA 3DP9A 3DKKA 2A69F 2LF7A 5EJ2A 3OZCA 4F8YA 1C3XA 3SQWA 2VYVD 1FLVA 1RBMA 5KQLA 4ARSA 3OEYA 3CDLA 1GN8A 2XJ4A 1SHTX 2GQQA 4JC8A 4JA2A 3UMBA 1I39A 2DLLA 4EKYA 5CR9A 3DVQX 1U0NA 2OCKA 2HXYA 4ZO7A 1X6VA 3QFRA 3JTEA 1QLJA 1L3BA 1RLMA 4E21A 3UK0A 2AMJA 2CLOB 2ZDQA 3V4OA 2XODA 2W43A 4UOQA 1SRQA 3I53A 1U02A 1Y89A 2HOTA 1J39A 2H1CA 1D0YA 2QXTA 2R60A 2IH5A 4QLAA 2Q1SA 4LXXA 2JCBA 2FQWA 4Z4IA 3GFRA 1JKIA 4V0NA 4MDEA 1QTIA 1U7TA 3WJAA 4G8CA 4XRGA 4L8FA 2M7BA 1O03A 1V1JA 1T9ZA 3HDJA 1QHHD 2VTDA 3KX2A 1UWLA 5AIPA 3QKRB 4LZNA 1OU4A 4I5EA 4KO4S 2BGLA 2YQZA 4GICA 4BE1A 1KSHA 3OS2A 5EJCA 1BQ4A 3KJIA 1UBTS 5IFKA 1Y7IA 4D97A 4DSUA 1MB4A 2QT1A 3IHTA 3HJGA 1R0BA 4DV0B 5EJ8A 4YFKF 1O94C 2XNSA 1U3WA 1T3TA 1WXXA 2W70A 1BDBA 1RM5A 4KXMA 4W8HA 4WCFB 2LY9A 1M2HA 5HZKA 4AWBA 2QEQA 1EJ0A 2G8LA 2Q1YA 2PGDA 1ZMTA 2DFNA 2JUGA 2UVPB 1T2FA 5ECGC 3Q5DA 3T0YA 3DCJA 1FXSA 4B3IA 1PVVA 4HBZA 4R1SA 1P73A 4YN3A 3K4JA 1G3QA 1EINA 2JGMA 5F08A 2KS6A 2JLYA 3DTVD 4P33A 4DJAA 5FWNA 1YJ5A 5EP3A 3HOXJ 3PNSA 4HN2A 3LHKA 1I2ZA 1XA3A 3ER8A 4B8WA 2GCOA 3T9AA 1K61A 4ZEWA 4CDNA 3AR8A 1P4JA 1T5BA 5HVQC 3I6BA 3ME5A 3BGWA 2FR0A 1DAPA 3LM8A 2JA8J 3I59B 4UOZA 1YIDA 4YIRX 5TQ2A 4CCLA 4A0HA 5LDGA 2WJAA 4F5DA 4LGVA 3PDCA 4ZOBA 3THXB 3WP1B 5IXSA 5ENVA 1BGVA 1HNNA 2NAPA 2ZIFA 3PIOF 2NACA 4XH9B 1WFXA 1UFVA 2CJJA 1OGYA 3N2LA 5CAEA 1E59A 4Y1EA 3L6BA 3UFXB 3P96A 3EWAA 3ZE9A 1UANA 2EG5A 2XD9A 3JY6A 3GFGA 3D2AA 1F0NA 2ODBA 3FSRA 2C00A 1F8XA 5BOVA 3FNGA 4DTCA 1QVAA 2ZJYA 3FYUB 4HPQA 1FMWA 3M1LA 2SKEA 4P4NA 5H82A 4NV1A 4WFQA 1JHRA 3QWAA 3LWFA 3PI7A 5CJPA 4W5HA 1V2GA 1Q0TA 4ZEMA 1WPXA 3RQSA 3MGAA 3L5OA 3I0MA 4FHCA 4JZKA 1Z7EA 2XSZD 2NS7A 4G3XA 1E9FA 2HMWA 1YIAA 1HF0A 3IDSA 1Q20A 4RLHA 3JZMA 4QU9A 1RRMA 1NKVA 1TADA 4DCVA 3OIQA 3TM4A 1EM8B 1JJ6C 4MA5A 5GQSA 4RPKA 4MUBA 3AYXB 1YAJA 1QYIA 3ZWOA 2O61A 4CMEC 4KWHA 4NCIA 5EINA 2CYYA 4IY1A 1ZTRA 1O77A 4DQDA 1CUGA 4MCIA 5CYPA 3DZBA 1EIZA 5GAJA 3GRVA 3PFGA 2A9OA 1AF4A 4YR7A 2ZS7A 1IC6A 2C3UA 3G9TA 1N77A 2ZSBA 3UAZA 2AN9A 4HZGA 3IJPA 1F1BA 3ECCA 5H80A 1IJKA 3CX7A 3A6LA 2CJWA 4D6PA 2GEJA 1O95A 3OYGA 1NW5A 3ZWCA 3R20A 2ZIWB 4Y1RB 3K9TA 4FQ5A 2P2DA 4PLHA 4HFRA 1C8LA 1D4OA 2BGKA 1YE8A 3KV1A 2XOKD 4EJVA 1L5SA 4ESEA 3DMHA 4G5GA 4HRXA 3CZ4A 3ONVA 2I33A 5LZ5A 1Q1QA 1FMJA 3PHGA 1E3QA 4IJUA 2NO1A 3C6QA 2ORWA 3COVA 3DD1A 4AUMA 1TQ2A 3OE7D 3F5FA 4B48A 3VPXA 3CPHA 3FSEA 3FWKA 3EULA 3WBFA 4BNWA 1P80A 2NQ2C 4YMWA 4BE0A 1WJAA 4E31A 3PPWA 2OV4A 5GM2A 4J8PA 1QC5B 2C4VA 3W90A 1NYTA 4TLMB 1UKEA 1DUVG 1FBSA 1QE0A 4F91B 3LGAA 3IVAA 1XTSA 3OCCA 1IQ0A 2N1MA 3PHCA 4HH3C 2OXIA 3JARB 3TQCA 2O3JA 1ZLYA 1UHWA 1U31A 1KU3A 3WTBA 1IWOA 1HE4A 3LA6A 2PPVA 4EPYA 2DK5A 2BLNA 3R5FA 2D2WA 2ODWA 4FXOA 4CT0A 5A3SA 4QEDA 2E9SA 3HB1A 4MKXA 4UTRA 1F9EA 3PZBA 5AHRA 5CA1A 3L43A 3LCJA 3T7EA 2ZATA 3KR0A 3BHMA 2JLZA 1AH2A 3S81A 4CFYA 1LKZA 3K32A 3MWYW 5KYUA 1I6XA 1DCMA 5IT9Z 3MJTA 2KLBA 3VU8A 1UOQA 3FCXA 5K3BA 4DIDA 2BL4A 5ESWA 4YVFA 4XOIA 2B8TA 4MUMA 1M73E 2FMXA 4X71A 1SBZA 5DHUA 2JH8A 3E6CC 2O06A 2Q4BA 2X5OA 3VU9B 5T57A 2P5VA 5C31A 3BIJA 4DSTA 3HVHA 1APLC 3BIOA 2ZJFA 2YHUA 3ZCUA 1GZHB 4RB2C 1DV1A 3IP6A 3GR6A 4ZAZA 3KZYA 1N5JA 4EZEA 1OF1A 4GXTA 3IP4B 3LL4A 4OMUA 1ENPA 4I19A 1G60A 1IAVA 3KPYA 1DOAA 4L0MA 2EGUA 2C04A 2OBLA 1K9VF 2I66A 3JYOA 3SX4A 4FMPA 2QMHA 2MLGA 2I1VB 3E23A 2PJRA 2AVNA 4HW0A 5CM8B 4GFDA 1L4FA 5FGMA 4LEIA 5JTUA 3WAKA 4NOLA 4ZT3A 3DEJA 3LECA 4R1OA 4ZV7A 3EUKL 3CO6C 4D5FA 4IOKA 4PPGA 3AL2A 5IUNC 1WY5A 3F6SA 3U7IA 2DHEA 3PIPF 2PZAA 4TT8A 1ZVQA 2OT3B 3FKJA 4RB0A 2HK8A 3LNQA 4V0QA 1O8BA 3OTGA 4FHZA 3KOWA 4J4TA 3NT5A 3VQTA 3PQ5A 3P2OA 4G12A 2HTSA 1TCUA 4A91A 1ACLA 5FV4A 2OJED 5TQ2B 1SKYE 4RENA 4N9IA 3KJXA 1NUUA 3N8IA 2YOGA 4JYZA 1PWXA 1MLDA 3UB4A 5EXPA 2OWEA 4MP3A 5TQ0B 4OJTA 4RTJA 1YNOA 5EPOA 3IKVA 3KJNA 3Q6IA 5JNRA 2XASA 1IMJA 3M5WA 3M3YJ 2ZKZA 3LQ2A 1YB7A 2FZGA 4CMJA 1KWGA 5TLSA 2FEAA 2A5LA 4R0NA 4AP6A 4ETWA 1T33A 2WEKA 3JRIA 4ZVRA 2HA0A 2ZQZA 3D3JA 4JEHA 2P90A 3FX2A 1BH2A 5K45A 2XGEA 3DHVA 4COKA 2P5YA 2Q3JA 4NB5A 2GILA 5B1YA 1U1FA 3LLMA 3STUA 3E1SA 2PI0A 3IPLA 4TMXA 5CLJA 2DBYA 4XWYA 2AI3A 1BCRB 2XRZA 4IIGA 4EI9A 4MV1A 2Z99A 2TMYA 4B83A 1XVLA 2YMQA 2X40A 2PKQO 2X6TA 1VPTA 3BK7A 4M89A 1RAGA 4RMGA 2UZ0A 1TGVA 4AYBN 4M8KA 4WF2A 3GVHA 4CIBA 5KQGA 4IH1A 2VQ3A 4XYEA 2JCGA 4TKLA 2PEYA 3SICE 1ODTC 1IJWC 5ILSA 1XWIA 2FETA 4BNVA 1STZA 5IT3A 1I4DD 2ZVDA 5JNTA 2OP1A 4RK6A 3OIYA 3AFNA 2IHZA 3P9ZA 4IKPA 3P26A 5JISA 3U6KA 4YIKA 1ITZA 2PKEA 3RG2A 2IEKA 4M1QA 5FJIA 3GEEA 1QCCA 2L42A 1NBAA 3IPXA 3ZKWB 4A1FA 1RAIA 4FGWA 2AKEA 4QTUB 1WKMA 1AXEA 2B5VA 2R0QC 3FAZA 5CNMA 3MRSA 2MSEB 4PHGA 4R84A 1HORA 4ZGWA 2CJWB 3BILA 2XF5A 2FB9A 3BJMA 1PEDA 3SC4A 3O84A 2AXTC 5I9TA 4DA9A 3E4CA 1PX0A 3UKDA 3ODPA 4NYJQ 3QX7A 4CKXA 4QARA 4OOFA 1RDFA 1N4AA 3QXSA 5ERYA 2J3IA 4BO2A 4ZCIA 1NLMA 1RYMA 3G1MA 3VPRA 5DLQC 4HSRA 1P8JA 2YCBA 1NAHA 2PYIA 4WZAE 2RNJA 2X9LA 2VRCD 3RNOA 1DB3A 4GDMA 5B1DA 3WRXC 3GCWA 1X92A 2L4MA 3IHKA 5KNCA 1GPKA 3FYSA 2NVUA 1B1CA 3ZUGA 1MEEA 3N8KA 4HOBA 1MAVA 1U7OA 2RQQA 4ESBA 3FDIA 3QEBZ 1BOBA 1R7RA 2Y71A 3WLLA 2O3RA 4F1JA 3E7LA 1JQ5A 1W76A 1GCUA 3F97A 3WXMA 3TNYA 4Z7OB 4IG9A 2P9HA 3NWPA 1HX7A 5L3QB 4NCBA 4EPVA 3V2GA 2FMUA 2P9TA 3QPSA 4RK7A 2FWIA 2ADMA 1G16A 4GLBA 2FFRA 1SH7A 1LE8A 1CJCA 1MABA 1EA7A 4KIFA 3PF9A 4KQMA 3L6EA 2VXBA 3AR9A 5EKUA 2HGSA 3H2ZA 4KGZA 4RZ2A 1L7RA 1CPYA 3A4TA 1OFTA 4QFBA 4WQMA 1FYXA 2EJVA 3GUVA 4LY6A 2YRWA 4B32A 4DNXA 3HH8A 2CL6X 4ZVMA 2IYXA 3WNZA 1VI5A 5J1RA 4FFMA 2XRMA 4XLEA 1J06A 2BHNA 2A2ZA 1LVUA 3DAPA 1NR7A 4OH7A 3HYNA 3LQ4A 4PPYA 4ZRDA 4KYIB 2ZTUA 2ST1A 5FPQA 3T9EA 2L54A 4OQMA 4ZN6A 2HREA 1O94A 5CIQA 1GSAA 1SA0B 2HBYA 3KXIA 1NJ5A 1NPYA 3GLHA 2PBFA 1EK5A 2FBHA 3VMFA 1T95A 4POOA 2RHRA 3GRPA 4RF5A 3T8TA 2RFLA 2VLIA 3ANYB 3M6AA 3CW9A 4W1RA 3WR5A 3PXXA 4II2A 4G81A 3D5TA 4E03A 2J31A 5J9FA 4MQ4A 1PLLA 3HB4X 1YQEA 3ZBQA 2FZVA 2R8BA 3PPXA 2L7FP 1W85B 2BF4A 2OVFA 1EB8A 4QXMA 4IBOA 1ISPA 1X0XA 3IQDB 4Y7NJ 2G17A 5DZSA 1R74A 3QUSA 1RKWA 5K5EA 4BC0A 2IOFK 2Y0MA 4NEHB 3OYKA 1L4EA 4JXJA 4M6WA 1S3IA 1GFIA 2JFQA 2C2BA 3MJEA 4HLXA 4R2LA 1XFAA 2RBGA 1L5OA 4M1ZA 4K1LA 1HEYA 2IVMA 4B35A 1K7XB 2FFQA 4R69A 1RYYA 3TTXA 2DHDA 4QFDA 2PLYA 1OFGA 1EAYA 5L3SA 4OKSA 3QQ5A 3ENNA 2HYFA 5KSPA 5EI5A 4PGMA 1KJ9A 1JL3A 4CF4A 1V7CA 1E1CB 3ILYA 2BKLA 4P4GA 4EO9A 2GCIA 2NNWB 1WZEA 4PE5B 1C1XA 2FPWA 3S8EA 1MR3F 1KYQA 1C4WA 4D3YA 5J2TF 2QTMA 2I4IA 3IMCA 1FJGB 1IDOA 3L4BA 1CBUA 3UIEA 5HQTA 1A95A 3H1FA 1SXJE 1F8YA 5DGTA 4JC0A 5ER6A 5HLHA 5JY6A 5JAHA 4QPNA 2DK8A 4AIDA 4HYTA 3AMVA 3ZD7A 1VL5A 2KBFA 1YK1A 3SG0A 4CG2A 2GHIA 3IAXA 3LQYA 2P3OA 2OGZA 4DZZA 2AWOA 4CMEA 3C2BA 3H8VA 3D3EA 1VPVA 2P0EA 4CI0B 2FQ4A 2B8EA 3BTIA 1RWQA 2R8EA 1J8QA 1PVDA 4BRSA 2ZQ5A 3WL8A 3A7DA 1O5IA 1CUHA 1U8TA 4QT0A 1DELA 4Y33A 4V0LA 5DW3A 2DZDA 1X58A 4O59O 4MUIA 1WSUA 4UB8C 4BFUA 2PA3A 4YQFA 1E2UA 4M71A 3R7BA 5IABA 1RYDA 2GIZA 3HRIA 3C3MA 1GUUA 2LPMA 4EW2A 2GJ8A 2R1ZA 4ZZ3A 4R0MA 4Z3DA 4XONA 4PPNA 2Q0OA 2NV2B 2D2VA 4KN7X 3SJAA 2X1DA 5I8PA 3BTLA 3D1VA 3HBFA 2WRZA 3VO1A 4XB6B 3KSZO 4H7JA 5E79C 2GOMA 2HIMA 2M30A 4NMWA 2ZCJA 2P2ZA 1EJ6A 2B7CA 3MWKA 2YWHA 1XJ0A 1GXPA 4Y13A 3W4JA 3ZCTA 3CCVI 3FK7A 4EGJA 3ZRGA 1ECJA 3IEPA 4DRZA 2DETA 1MJBA 1IIBA 1D2GA 3RGWS 3Q5GA 2QUZA 3G0OA 2PJDA 2AEJA 2XDQB 2E85A 3B20A 3PX2A 1ZCJA 4E7JA 5FLMJ 1D2AA 2PANA 2H6EA 3B9RA 1N3LA 4P2GA 3DWEX 3IIIA 3CC4I 1V41E 4J19A 5JMTA 3TIGA 4HNTA 2V9VA 4WTOA 5K7ZA 1PZHA 2W2KA 3CUTA 3T54A 4XCVA 2W2QA 3EODA 3C70A 4GUDA 1C4KA 3LS2A 5HMLA 1Z6ZA 3IALA 1PR6A 4F9TA 1DUIA 2OFWA 5BSFA 5DWVA 5CNKA 4GXNA 1N7HA 4AT1A 3ZQLA 3AB3A 3DE2X 4NPCA 2LCFA 2IHVA 4Y2TA 1R0LA 2Z2IA 2A61A 4DR3B 4MW6A 2FPGB 1CUZA 2X6OA 1ZVKA 4YCSA 5B7GA 2ZJBA 1HETA 3PIRA 4NK5A 2C7PA 3B02A 1QHEA 1T6NA 3PQFA 4D96A 1RXVA 4A8JB 2A0FA 2Z1NA 4B4WA 2VC2B 1DXHA 4XVCA 1IATA 3GFOA 4ASNA 4GBGA 1QQBA 1G8GA 1CIJA 2OPTA 3JQEA 1EX9A 4MKZA 4N1AA 1TUBB 2DAPA 3ABUA 2XROA 4DS3A 4MVJA 4ZI7F 4AUXA 2DMTA 3DBRA 3L7AA 4QU8A 2K27A 3OEHD 3FIUA 2MFZA 4KE9A 2H8RA 1BYIA 4K9QA 1L4UA 2Q3LA 2Z6VA 1CRQA 1SOAA 1C9JA 4ERXA 3FZNA 3IAS6 2EL7A 4NZZA 4UM5A 1DINA 4GX5A 3ZWYA 3PLNA 4DLBA 4I14A 2QIOA 3SFZA 3NYQA 1V3TA 5LHHA 4BGEA 2CD9A 2HF2A 5C3MA 4DVJA 4KWTA 1SHKA 4XLFA 3ZHSA 4G6DA 4P84A 1Z62A 1H94A 5D8DA 4CU2A 5BQ5A 4FB4A 3OZTA 1SCDA 3VX3A 4U4AA 3HIFA 1VL6A 1H2FA 3QEMB 4W8GA 2XADA 3QGMA 1KNQA 1VJCA 2EX1A 1GTRA 1TLLA 3KUDA 1EB9A 3TLYA 3MWDA 2Y9PB 5DCWA 2FRXA 5JPCA 2KPOA 4U2FA 3EFHA 3DULA 5DGIA 3MQ0A 4B2PA 2OCPA 3TFOA 2GO1A 2QPLA 1TMYA 3R8CA 3WHIA 1R0XA 2L3DA 3K15A 2EXXA 1R9TJ 4HYEA 2P5SA 3TDMA 4KTVE 2VOEA 3KQVA 1SUSA 4PG6A 1Z67A 2K9NA 4BO8A 1DCKA 1A8QA 3M4YA 2VJJA 3PR2B 3DE4X 4JI4B 1SC4A 4K3VA 2XIGA 5JZBA 3R0AA 1IUFA 2BSXA 5K8TA 1DC8A 2VJNA 4OMYA 3HHGA 4B84A 3ZX5A 2WJHA 1AKWA 2H1WA 5L3FA 3FMRA 3ESAA 4EO7A 3QFHA 2J5KA 3RVBA 2NOAA 1H2BA 3Q0UA 3E1GA 2UAGA 4C3OB 4PZYA 4JUDX 3A6PC 2FN7A 2XYHA 4R9UC 4M37A 4L51A 2ZUFA 4RB1A 1CB7A 4WNCA 3KP7A 4I4CA 1Y1KE 2NSDA 4CSWA 1FLDA 3K94A 3AG3H 5H9VA 3JAWB 3GAFA 4OBEA 5CH8A 4OAOA 1J8MF 3ISJA 5BYKA 1BWQA 1ZGHA 1XQVA 3IIMA 4YJFB 5L3GA 1SU7A 2HEOA 2C59A 5J5AA 1ZL2A 2AFVA 5G3YA 1GUZA 2A57A 5FPSA 1WLYA 3F9IA 4L5JA 3JSAA 4KRFA 1E9BA 2XB6A 3GFMA 1WCYA 4POAA 4BP9A 4ADSG 2XUOA 1XPXA 2ONYA 4XSVA 5SICE 1ADFA 3W2GA 1IAWA 5M5YJ 5DDIP 1LJLA 2WDPA 3PNQA 1T24A 4I5FA 3WRXA 5LXTA 3OCZA 3I32A 4C0SA 4IGAA 3MJRA 1WDKA 4X1IA 3U3ZA 2V7QD 1BQ3A 1Z0SA 4BL5A 4HAMA 5K05A 1T1EA 4NATA 4CJXA 1OSNA 4S1OA 3FJOA 1E1QD 2HR1A 1TVKB 4AZTA 1M10A 3ICCA 4LTMA 3VZCA 4B7AA 5AJWA 2BKEA 4EKEA 2Q0SA 1ZINA 1NX6A 2QSUA 1IK6A 4GS5A 2H2FA 2YYAA 1IUKA 2NNNA 5BQTA 4O02B 1VHLA 1LH0A 4REQA 1JV2B 3S5JA 5FULA 5DM60 4KC0A 3AEKB 3M70A 5EGSA 8AT1A 4FDUA 1R6XA 2LW7A 2Q0HA 3M6LA 1YACA 3HFGA 4HAVA 3CJQB 2FX2A 1F3OA 2XQIA 2O07A 4QPPA 2OHJA 4OHKA 1B93A 2RGXA 2ZI3A 5J63A 4XYLA 4O6VA 4LRQA 2FJ1A 3NHRA 3N87A 2L2OA 1WQ2A 3HJCA 1TCBA 4CKWA 1DEOA 2OZLA 4XKCA 2ERYA 1GNLA 1RHJA 2EJUA 4F3QA 4M6VA 1KY2A 1QE5A 1TE2A 2N42A 2EX0A 1C30B 4CNQA 1CY2A 1YC2A 1TTHA 4E11A 3O4FA 2R4UA 4BVFA 2IUSA 4KHZA 3MTJA 3QKSB 2OE2A 3GLKA 1YS4A 4G07A 2R62A 1GV5A 4DCNA 4MA4A 1O58A 4PYMA 5FKJA 4ONEA 3W9UA 4FFOA 3FTQA 2PFBA 1E2HA 4P34A 4YAKA 2I3BA 3LFUA 3WBKA 2B78A 5LLTA 4UUSB 3GZ6A 3MJHA 2YY7A 1PJCA 1LZLA 1EK0A 2IF2A 3SZOA 4QRIA 2CUZA 2ZPTX 5EFZA 1P60A 4QRHA 5JAPA 1Q0SA 4OI0A 4BX9A 2FF7A 2L9RA 2QNIA 4Y67A 3GLGE 4EABA 2DJNA 2XLBA 3R3ZA 3TTYA 3ECAA 4ED9A 3B5JA 3O1JC 4PQFA 3RQIA 3QODA 2HZDA 4CZCA 2WADA 1FTSA 4AMUA 1JIKA 1G6HA 2YYYA 1NOJA 4KWEA 5HFNA 4KLAA 5BORA 4V2FA 3O6BB 2IOFA 3M6VA 1P0PA 4Q66C 1UM8A 2GN4A 4I55A 3WTWC 2C83A 4XM1A 1WWXA 1BE6A 1L4BA 3DDHA 2VK1A 5H81A 1PUIA 1DQYA 3EZXA 3R5KA 2E4VA 4RHEA 1PJQA 1YSCA 3WLAA 2E5FA 2BKAA 2H17A 2XX3A 5KB3A 4IHTA 1ZD1A 2Q2WA 1T2DA 2OHHA 1IZ7A 2VC0A 4KLNA 1A82A 1KMIY 3QU6A 3OLYA 3GN1A 2OMEA 4RNDB 1T26A 4HL6A 1TYBE 4XOPA 1NVKA 2CVHA 2CG4A 2GO7A 5G0TA 2ZBPA 1YR6A 5E1ZB 5ESRA 4AIKA 3RHZA 1F1ZA 2YSRA 3IDFA 1VB3A 1MO4A 1VZ3A 5FOXA 5JXGA 3F6VA 4URVR 4IVNA 1NR1A 1U9ZA 3Q1KA 3ZV4A 3TAHA 3KZNA 3ZI4A 1ONOA 4UU0A 3VSCA 3ESWB 5I9BA 3AZOA 4IOAF 1GPDG 3MS7A 1S2GA 2ZM6B 4I9FA 4P7GA 2IEIA 2X7JA 2A07F 4ZHSA 2WTMA 4CEIB 2JD0A 3KZOA 3W2TA 5DD4A 2L02A 3CJRB 2CH0A 1MG0A 5JNWA 2OBXA 1WCMJ 3AY3A 2XDYA 2WZQA 3G59A 1KYIA 4NBNA 1K7FB 2P7HA 2XDVA 3LF1A 3HRMA 2JGEA 3OCUA 3S6JA 1B23P 1OWPA 2GBLC 4Y7DA 3ZE0B 1M2JA 4YDQA 5GM1A 2Q4TA 2XMDA 3B1YA 3BMCB 3U7EB 2WWVD 1XMPA 2P5UA 3Q7PA 1P81A 1ODDA 4IDEA 1N2EA 3AZQA 2VJDA 4AJEA 3NONA 2QLLA 1RD4A 3R3HA 2CSUA 3G5UA 2XCRB 4GOLD 4C7OA 2I62A 2FUG1 5F7ZA 2X4DA 4TL7A 1S3FA 2EZTA 3QVMA 4LCEA 4YWHA 1Y82A 2C82A 4LGWA 3TTWA 1MOPA 4J76A 1DAIA 5EZSA 3O03A 2GVDC 3GI1A 1I7PA 1TF2A 2IXEA 1IRGA 3FMGA 1RWPA 3T3NA 2K3FA 5K0GA 1Z9BA 2VBCA 3PWTA 1F6DA 1NQ5A 2DOKA 1E7YA 1XAHA 3K9BA 2BHSA 2ZUTA 4J0FA 2Q49A 3A11A 3RM3A 1NMQA 1SZPA 4RA2A 1YW7A 2PVCA 5CFQA 4AWXB 2XTZA 1DT5A 3CUUA 4RTPA 4DV3B 2HCTA 4QPOA 3WGZA 1CJUC 4DYCA 1NI5A 3VJLA 1QP7A 3BZBA 1T5IA 3FB4A 2JGKA 1A96A 2GD0A 1FBUA 1IPHA 1QO7A 4J2TA 1VKNA 5BR8B 2BI7A 3G0BA 1BA3A 2D0IA 5I4BA 3LRTA 5TPZD 1FCJA 3TIIA 4HAIA 4WXDA 4WT7A 2RHWA 3FB1A 1TYCA 2QMUA 4QNRA 1VRVA 4NOJA 2GZRA 1Y3IA 4Z4GA 5A4JA 2TRTA 4HHEA 4DWVA 4NZMA 2KRCA 1T2NA 2HVRA 2O1XA 1MIJA 1XEAA 2V7UA 5F12A 1M5TA 2Y48A 2MDTA 4EAQA 4NY1A 4REQB 1UP6A 3PA8A 3W2HA 2YZNA 5ALVA 2CHGA 3UENA 1EU1A 1XZGA 5AM4A 2JGNA 3SC3A 1BXZA 4C1BA 2WMDA 3A1YA 4ZYLA 1SHUX 2M0CA 3EXEB 4AY6A 1I7DA 4LOLA 2E4WA 5AKZA 1XAJA 2DOFA 3ZMSA 3VU0A 2ZM5A 3QVLA 4BBSJ 2QA4I 3HBAA 2OZLB 3CC8A 3KHKA 4INAA 3FDXA 3RVQA 3MTAA 2O6GE 2RH5A 2DKOA 3LLCA 3V9PA 1Q77A 3N75A 4M87A 4MI6A 2ZRIA 3AU8A 1HDEA 3UBMA 4NC7A 3T3GA 2GRUA 3UJ9A 3IEKA 2RKHA 2VKHA 3ZHYA 2CDAA 3IDZA 1CX9B 1L4YA 1DKRA 2YDYA 2JUCA 4ZI2A 5K51A 1Q1NA 4BMXA 2BWJA 1MUUA 1B8IA 4IX1A 5KHAA 2AYXA 3FKIJ 4KISA 5FUMA 4PONA 3HN2A 1M76A 1IUOA 1NL3A 3HU3A 1C7QA 4R1UA 2AOVA 3DLIA 4GMDA 3G7SA 4HH1A 4LIPD 1SKAA 1ILWA 2DF8A 2YPRA 2RK6A 4K6CA 3COZA 4UM8B 1S8FA 1WH5A 4LQCA 3CGWA 4G5SA 5L3CA 2KI5A 4H7KA 2J4CA 2EFHB 4ZDJA 4N0BA 3C2HA 3CLSD 5CVVA 1DC3A 1G98A 1VE9A 3X1XA 4KIGA 3QG5A 2BGUA 4M7OA 1KQOA 1Q17A 2QL9A 4HV6A 3DS8A 3OWOA 2MINA 2WTEA 3BRWA 3UA3A 1JFFB 4EG3A 3CRRA 2GCEA 4D4GA 5E7QA 2BGIA 1UCRA 1EP3B 1O1YA 4C7MA 4EF6A 2BFFA 4XCXA 3DPLC 3QY0A 5H8WA 5L7YA 2HCJB 2M34A 3SNKA 3Q0IA 3DLCA 4L5IA 1NR5A 1IXKA 5I45A 3IAS2 1Z1DA 5CTJA 5JYDA 2O3UA 1NUPA 2ATEA 3IP1A 4HOYA 1ICEA 3GLQA 3CNEA 2P6NA 2AQEA 3TLGB 2BFEA 5KOJB 4IQ8A 4Z4FA 1EJ9A 5EQFA 4KL8S 2RHGB 2RB4A 1OLUA 2WE8A 2ELKA 3TJMA 1KTVA 1KMHB 5JLAA 1KR2A 2ZAYA 4ZC3A 4GX1A 3JQGA 3G2HA 3OFND 1XSVA 2CJFA 4O1IA 1EXMA 4IMPA 5EIBC 2BY1A 4K86A 2VUSA 3KJZA 1EXVA 3BSWA 4DCPA 1O3YA 1DL5A 1EM6A 4BMOB 2ONKA 1US8B 3RCOA 4GEGA 4JUBA 1K0UA 4BWFB 2VHYA 1D03A 3IV6A 1PWEA 3ONFA 3WE3A 2WU4A 4YCDA 3NOQA 1XZ8A 3WHKA 1X8LA 1JZQA 4HEQA 3EFOB 3F23A 5IJ0A 1EUCB 2EKQA 2H00A 4JEUA 4I46A 3MOIA 1YKGA 2DCMA 4TKUB 2O2HA 2ZRLA 3CNHA 4MQBA 4M7WA 2RAVA 3FOFC 3UAYA 1KEVA 2LC2A 3NB0A 3V4LA 2KLOA 4IHWA 3KS9A 5E38A 1AKHB 1K86A 2FQ3A 4BWGA 5ARBA 3M1IA 2J33A 1X7ZA 5LDDC 4D1QA 2FUG6 2IPNA 2CHVA 1JYFA 5KAMA 5HTOA 4B4UA 3EQ9A 4RWZA 2C3OA 2HF8A 1SFEA 1YVPA 4PRYA 2ZRBA 2QRJA 2XQFA 2AGVA 4N8DA 1LJ9A 1K0FA 1ZSYA 3D81A 1HMYA 4ZFNA 3O82A 2JASA 5J6XA 4X1KB 1ZKGA 1VGRA 3LMKA 1BCSA 4KUEA 1XPJA 1QSGA 5GTIC 3OPXA 2VQSA 4WLNA 2RDPA 3PC4A 3OOYA 4BC1A 2A68F 2QD5A 5HQJA 1NRXA 2E1RA 1W93A 2Y69H 3L9WA 6ABPA 1VE1A 3H5AA 2XV1A 3LKVA 3WV5A 4NDAA 2X3FA 1JSRA 2JDIA 3D8BA 4KN4X 2WWYA 3W04A 2PS0A 4CLRA 4WEOA 4GXRA 3BFKA 3HJEA 4IIVA 3Q98A 3HWWA 3NIDB 2V9ZA 3F6RA 4TYQA 5L6LB 1KKUA 4ZPJA 3F3SA 1RXIA 4FW9A 1N25A 2XB8A 1P1RA 4XW2A 1PS0A 1W6UA 3SSNA 1RRJA 2OBNA 3U39A 1O96B 4LYFA 1C29B 3EAQA 5GIOE 5M34A 4BQOA 1KBZA 1R49A 3HNRA 4BQFA 4HV5A 4DNOA 4K9PA 4UMEA 1PK7A 2FUNB 3ZZTA 3NDBB 2BJHA 1N92A 2B69A 4P5DA 2J3QA 3N8DA 5E7MA 5C4IA 3PQ7A 3NTUA 3QU7A 1ETXA 3I6ZA 3PGKA 1GPUA 5AK0A 1SRRA 4ON0A 2V4MA 2VZLA 5IF9A 3PNVA 1A7UA 4R2KA 3H3JA 1OV6A 4XD2A 4RJKA 4NAUA 4PZCA 2DU9A 3RLIA 4WK4B 4HTAA 1P9OA 4CG1A 1TZLA 3ZY5A 3EJ6A 4WAUA 1E7RA 3A7EA 2GKGA 4FQ8A 2BYTA 3U0VA 5AJUA 3RTEA 3MAAC 5DBHX 4XL9A 1DPRA 4DNPA 2I5PO 1AVTA 2WD7A 3AKCA 3K1PA 3TG2A 3TXXA 3HXMA 1D1SA 3EQ2A 2JCVA 5BR4A 3V1UA 4ZKEA 1L8OA 5CGZA 4A2PA 3DOJA 4LDZA 1P0FA 2C7GA 3ZCVA 4Z53A 3P9KA 2IL1A 4RH0A 4GIBA 3DL7A 3DXXA 1TUIA 5DCMA 3TW8B 3THWA 1YTYA 1J6UA 4WEQA 4D8TA 3GLFE 2REXB 3PGMA 1OB5A 2D54A 4N03A 2OD2A 3LWBA 4YQEA 4MUNA 3OICA 1USVA 3FG9A 1S29A 1H2ZA 3HO1A 3EA5A 4RGUA 4KB5A 3FF1A 3MFKA 4G5OA 4CFZA 1I94B 2NZXA 4O4LF 3PC6A 2ZMEB 4JGIA 1T56A 2RH4A 5ALGA 2XBUA 3AM3A 5JFGA 2ISQA 2PN1A 3F8CA 2IX9A 4XLTA 4U8HA 1YR7A 4DOZA 1T4GA 5BR7A 2R1TB 3ITNA 2FWMX 1GVHA 1MB3A 2FWPA 3E9NA 4Y8VA 1ZLJA 4BXXJ 3ZWPA 4G1VA 1V1MB 4CA0A 2L82A 2VQLA 2J6HA 5HODA 3QNMA 5B1EA 5FBHA 2H9AA 4Y30A 2HWVA 1U5BB 3IOCA 1NMSA 4YGXB 3QKTA 1ZJ6A 3UUFA 2F43A 3RYIA 3L8FA 3UMFA 1ZWLA 1RQPA 3SC2A 4UBIA 5FBQB 1PJ4A 1QZZA 3ZIDA 5GONF 2KM1A 4JUFA 4KG7A 1IEWA 5ALXA 4K9MA 4LTDA 3KSRA 3H7AA 4UUAA 4ESFA 1HOTA 5U9CA 4TWJA 3ESXA 2K02A 4CIYA 1BXRB 2Z6UA 1EJBA 1CG6A 3S29A 4EW6A 3KYJB 1FNMA 2QZ4A 3BQNB 4IP0A 3HKEB 3L2RA 1AKTA 1G21A 1HZJA 2DULA 3O95A 3JQGB 1ESEA 2QUFA 1XLWA 4YJKA 2O8CA 5D5HA 4EA9A 3JZIA 4KO8A 4DV5B 1Z3CA 1EQAA 1KF0A 3B52X 5B1IA 2IYQA 2V1NA 4DZRA 4BHPA 4PNEA 3M1EA 3ENVA 4BUZA 3DO6A 1X2EA 4FKBA 1XQ1A 5J2UB 2VIIA 4YFXF 4EATA 1E3TA 1QFJA 1T0UA 3NDIA 3MMPA 1MMGA 5F0CA 2ZIAA 4NWIA 3KP5A 2GBLA 5IYCJ 4HH0A 2EK5A 1WH7A 1A4IA 2KPMA 3H1BA 2A78A 4ZMRA 5B58C 5KS2A 5IG2A 2IDKA 2C57A 1M2VA 1BKYA 3FMIA 4EKNB 2VF2A 1ZNZA 4PGAA 2ZBUA 1UMKA 2GIVA 1U8BA 3E03A 4MFDA 1AA6A 1KETA 5JXJA 2HUNA 3RCBA 5JFOA 4U0WA 4KLZA 1Q2UA 1ZGBA 1QIEA 2XGMA 3TCKA 3EYIA 5C8YF 3FTEA 4I02A 2WFZA 4MW7A 3STWA 2BFMA 2PA0A 3CRZA 1AS0A 2Y1CA 3T0IA 4PJNA 2H1OA 4JYBA 2KHMA 3HOWJ 5C37A 3F3XA 3MB8A 3H0CA 1CF9A 3PR3A 4JHLA 4HQEA 2CXSA 3GTPJ 5F35A 1B76A 2P9EA 1JH9A 2D45A 4PWYA 4MV7A 4D98A 4ZGGA 4C0WA 1K83J 1LEBA 2HU7A 1TIPA 3Q85A 1FSSA 2Z8XA 2C0CA 3C6KA 2KWIA 2FN8A 2PBZA 4DA0A 5DW0A 2EV5A 1I2DA 3A36A 3BZKA 2GA2A 4BATA 3S15J 4LSZA 3CE6A 5LWQA 3HZZA 3QQAA 2JVJA 3KRTA 1KEZA 3TZQA 4O2LA 5JBNA 2H31A 2QRMA 3HJRA 4KIBA 3LYHA 3RIEA 3FPJA 3KR9A 4U2EA 4OGKA 4K8OA 4Y0VA 3AONB 1U99A 3FUUA 3TMYA 3N58A 4LDAA 3B6MA 2C2OA 2I4OA 2YJTD 2QYTA 4KQ1A 5D4SA 1UXOA 5AKGA 4I3FA 1SC9A 5EPEA 1JFVA 3LUHA 2GK7A 3ZDRA 4D4LA 2DYRH 3T3HA 2LOOA 3A06A 3IAUA 3UJ6A 2WVGA 1JIUA 1R5BA 4XKVA 5CFZA 3AM4A 4S05A 4JL5A 3H3XA 5KYXA 3RC3A 2ACWA 4E70A 2XV4S 2AW3A 1VJ1A 3PBKA 4WNYA 4N0EA 1HLPA 3GV0A 3W6JB 4M1YA 5TC4A 2OP0A 4LGYA 4UTOA 3OQIA 2ZULA 5T5QA 2Q28A 4TSFA 5LRRA 4FT2A 1KH1A 4NPHA 1VJ0A 2X4HA 2JKVA 4F84A 5DRYA 4WHMA 2GFHA 1XR3A 1YQAA 1IOVA 4K87A 3R6DA 3BJRA 3EVZA 1TT7A 3PP8A 4NTZA 2VBFA 2X51A 5ERIA 4OSPA 2AL7A 4TROA 1G7TA 2WD7B 3CEMA 5AVWA 5FL3A 2BONA 3BQYA 2CDCA 2CNWA 3PGXA 2JVGA 3AFIA 4FDTA 1ZGWA 2ELJA 1N9KA 2KQUA 1T36A 4FS3A 3THWB 5DCLA 4R8SA 2P9JA 4GOJA 4BLQA 3ECOA 4ZCTA 4DG9A 2PX4A 3IMGA 4GI5A 1VQLI 4DLZA 2GCOB 3ZGYA 1HKQA 4LYAA 4R6WA 1H5NA 3E3OA 2WY7Q 3V7NA 1MXHA 1R6VA 4DWJA 2H29A 1UPXA 1UPFA 3ZU4A 4JEMA 4WFIA 1OCZH 2QPTA 4RAOA 1H9CA 1CT9A 1VHJA 1X19A 1MMDA 4HAXA 5TQVA 4C4ZA 2J45A 1EUDA 1QQ5A 3JD3A 4BVBA 4RETA 3TL3A 3T0GA 2F90A 4MUGA 1NXVA 4RHCA 3E27A 2O8DA 2H6BA 2I2FA 1NE2A 2VAXA 5GAEJ 5CAEB 1ETQA 5TB5A 4RCZA 2QZZA 5BQPA 2B8WA 3CLQA 3WQHA 1YZTA 3F8NA 3ZPLA 2F43B 3QIVA 2GZWA 3V33A 2R6GA 4QFMA 1F2TA 3S27A 4AJLA 2DERA 4RS3A 4OREX 4B47A 1BW5A 3WMEA 1FOWA 4RTLA 4HZFA 2F4NA 2FRHA 3UEOA 4GPD1 3GT3A 4WJZA 3ZZ1A 4CM4A 1LB2A 5EL0A 4LVOA 1KI6A 3KJHA 1JT9A 2PRKA 1S2OA 5AHKA 3PWSA 3JW4A 3C5EA 1WUKS 1MMFB 4ZDIA 3DBHA 1UAYA 4Q7JB 3ACDA 3TKAA 2MR5A 3KWFA 4Q4DA 4RS8A 3SFTA 2H1FA 5EXXA 1KBQA 2FHSA 3EVAA 1THMA 1YBMA 1GNVA 1KJQA 3ABLH 1PR0A 2POCA 4N5NA 3MYRA 3ON5A 3S1SA 3PR1A 3CVOA 3EH1A 1XYYA 3LKDA 3DQQA 1SCKA 3HZOA 1GQRA 3S2FA 1REQA 1HEIA 2XWQA 2YX7A 4OQYA 3K70B 3E3NA 4FYJA 3L7LA 5E1WA 2GAAA 1J33A 3WK5A 1XDWA 3L1KA 4LRYA 3ZW8A 2LDUA 4Y2YA 1MAUA 5DX8A 4KMOA 4AYTA 1Z73A 5G1PA 4TMZA 3FXJA 1JFLA 3G2KA 3AFHA 1JSLA 1IOZA 3C18A 2VBXA 2Y3IA 4RGVA 2Z1MA 3LW7A 2F55A 2PLFA 2Y9MB 1PZGA 2J0SA 3K9GA 1VI2A 1FFGA 1OKKD 5LZ4A 3EVFA 2Q9AA 1MB9A 1EHCA 4MS1A 3RC1A 2EFPA 5AW4A 2DBRA 1BA2A 4JLNA 4EBFA 4R7GA 1J2EA 2PUEA 4YUYA 3FWEA 4XX0A 5LRSA 5IDWA 4GOXA 4UDYX 2JJ1A 3H2KA 2E4YA 3ZOBA 1G8SA 1NLUA 1ULSA 4W6QA 2M4GA 4JZYA 1PR1A 3SYRA 1AS3A 4GVXA 3W9SA 5CDGA 4AZ0A 3LP5A 2B4AA 5K0EA 1I24A 4M53A 2W6JD 1SXGA 1T4CA 3P2IA 4RPLA 2DTEA 5DN6A 4MDYA 5BV1A 2YZGA 2C84A 1D8TA 1K5DA 4C22A 3E2MA 3DD5A 4UE3S 1FFAA 4FP9A 1PZMA 3H97A 4E15A 5D5XB 1EFUA 3ER6A 2Z3YA 3IQIX 1L5KA 3W7VA 3L6DA 1S9HA 4YCNA 5B6JA 4Z9XA 4A3SA 4TRMA 3OHSX 4C4SA 1DZIA 1U0OC 1EZZA 4CIXA 2DR2A 3SKYA 3SVLA 3QYPA 1AN9A 3D43A 4MV6A 3A32A 2D5AA 1FLIA 3R76A 3DE0X 2Q21A 3TN7A 4LX8A 1AURA 3X0DA 4O8CA 5LB4A 2MW8A 2XGCA 1JPVA 1F5NA 1B00A 2ZOSA 1FE8A 1X80A 4N6GA 4EEKA 1SB8A 2BBYA 1RADA 1CUXA 4D5EA 4G0OA 5CA1B 4R05A 3INYA 4D4MA 3CXRA 3EDMA 3UC9A 2H1LA 3IH5A 1NYRA 1NH3A 2NQTA 1A9TA 4NMMA 4QU5A 2OZVA 2D6FA 2RJOA 5KYUB 4F60A 4DAEA 3ZVLA 1JQEA 3FNFA 3GFIA 4KE7A 1XEXA 4OHRA 2XAUA 1OZAA 2Q46A 5FB3A 1V5IA 4YRFA 5BOSA 4RJTA 4DDKA 1H69A 5EWMA 2H0AA 3SAJA 3IV5A 4J0HA 4HXYA 1O89A 4QXOA 4N4OB 4JJFA 3N0XA 1QRYA 3OQIB 4BPBA 4C6TA 2OOSA 3Q6NA 1XTBA 4JLPA 2CCKA 5D6NA 3DEZA 1BOAA 2DODA 1KEPA 3E6DA 4OK5A 3LIIA 4Q00A 5F5XA 1XTAA 1FRZA 5L7WA 3DLBA 2ZRKA 4DLUA 1Z18A 3MYYA 3HXLA 4IXDA 5TGDA 2EB7A 2XGOA 3I2KA 3K2QA 1YQQA 2G4LA 3NHUA 1WMDA 2P65A 3OUZA 2H4FA 3NUZA 1T36B 2GXBA 5E7IA 2PJRB 1HYGA 4DLLA 3VNBA 3OKPA 3NAGA 1GZUA 3CURA 4PJMA 2CZGA 5JAZA 4Q7EA 4M38A 4D82A 4J1TC 1QH8A 5HP4A 2DOAA 2GARA 5JAQA 3S93A 3KZKA 3V8BA 3MKLA 2QWXA 1ZD8A 5DIFA 2ZIXA 1YQXA 2XGGA 5DYYA 1NQUA 4IWXA 1FVFA 3ELUA 1HQDA 1UPUA 2D1VA 4Y6GB 3MIZA 4B2IA 1D4ZA 2Y0SN 3ZJUA 3GJ5A 1RJWA 3R0ZA 3HI4A 4LV8B 4ZO9A 2XCQA 2O8DB 5ES4B 4OU4A 2EAUA 4TV7A 4OH1A 4FJ1A 3RPQA 1RVV1 3DOUA 2D0DA 2C9CA 5JANA 5LD2C 4COOA 2VA9A 1EFRD 4MHOA 3JR3A 2WSBA 2BDTA 2OYSA 3LUFA 2QW0X 3ZQJA 2GDZA 1UJ8A 4UQLA 4ZVPA 3ZQ4A 1GYQA 2GGSA 2CXHA 1E63A 2JGIA 1ONBA 3WGYA 1XPOA 2P6PA 4L9WA 2QAGC 2C8KA 4UXNA 5CU7A 3WNDA 1I6WA 1J5EB 3HA7A 3KVNA 3DBHB 2I6QA 3U19A 3VH1A 3KQOA 3OZ7A 3GLRA 3H3ZA 1UMBA 2V1XA 4NYIQ 4GCVA 3D0QA 3EGOA 1HNZB 1T4BA 3GMSA 4PPQA 5COAA 1XZMA 1QNTA 1R10A 3CUQC 2BFBA 4LTNA 3H7IA 1M8PA 4Q39A 2WJ6A 3OCXA 4YCCA 4C05A 4XVQA 5HJ7A 8OHMA 4U7TB 5IU6A 5BW4A 4GZ3A 1H9TA 4X64B 1XLVA 1IN6A 4ZCLA 2AE2A 1V4NA 1KQNA 1N2CE 1UJ4A 3E97A 3TNJA 3CV3A 1YW9A 3K09C 3MBOA 1H6BA 4FILA 3B70A 1YDHA 1ZW1A 4YT4A 4GOND 5I7OA 1DKLA 2ZJ2A 2I3GA 3M3DA 1R6TA 1QGPA 2FUEA 4MS1B 4US2R 5JAOA 1MXFA 3I5UA 2I76A 2I4TA 3OQBA 4ZZ0A 2F3RA 1E5XA 4YWJA 4DMHA 1AZSC 3WNVA 4XQ9A 1I3LA 1HV8A 4XX0B 2UUPA 2RN7A 5SZHB 3LVFO 4G0YA 3WWPA 4Z4EA 4BMNA 4UJ5A 3NHFA 3C2GA 2VXYA 1NKSA 3VTKA 1JEEA 5BV8A 3H0KA 4L4XA 2R2GA 1JDBC 3VNQA 1YI8A 2EDCA 3ZHOA 3L2WA 4XOTA 1KDRA 3R23A 5JI6A 3S7TA 4DLYA 1QNFA 1A36A 1T4CB 5A5FA 4UXIA 2L01A 2NVUB 1NIJA 3RROA 2XXAA 3U2RA 1EHIA 4HRVA 2YR2A 3RSOA 4EY5A 1JQJC 5CX4A 1OC2A 5ITSA 3K92A 4GPTA 4H9GA 4GE3A 5FXMA 1V3VA 4YRNA 2FCRA 4FFNA 1IGNA 3LFKA 2E19A 2E6KA 2XAHA 3ROZA 1LFAA 1OISA 4DBVO 4PS1A 3P4UA 2CT8A 4YMLA 2P7CB 4BB5A 4X97A 1J9ZA 4DCTA 1LXCA 3L4JA 1YJBA 1E4YA 2DT7B 2V1DA 3DXJF 2PZ8A 5GP1A 1LE8B 4EI7A 3WC4A 1ML3A 1MABB 3KXPA 1U3GA 5E6SA 1SC1A 5KTPA 4HB3A 3O5AA 1X80B 3OO1A 3DZFA 2CYBA 3A1UA 3JVEA 3LWDA 5CYVA 4MTEA 1FDRA 4B9EA 3C1TA 1WOYA 1ZEMA 4OOEA 4ENJA 4L8LA 3K1MA 4V2IA 4BFYA 1G5IA 4B6EA 4E33A 4PLCA 2PLAA 4L5AA 4NE9A 2OXTA 4AXBA 1MOZA 2NU6A 4L4RA 4KAAA 1UJ2A 1YB4A 2J0EA 4AY4A 1MO2A 2D06A 1XTJA 5K1ZA 4MNUA 4JLOA 3KB6A 3KLOA 4Z5XA 2C0PA 5HF5A 4KZPA 4PSDA 5GAGJ 5F98A 1VG9B 4OINF 3GTGJ 4PFSA 4Q47A 4FMCF 3C8ZA 4AKTA 1AZLA 3GLHB 5JHFA 3BFJA 1VSVA 3AWDA 1UKZA 2P7VB 3JYNA 4UBKA 4BQPA 2JBWA 3T1TA 1EYZA 2HKOA 3HRUA 5IOYA 5EYPA 1QH0A 4LRXA 1V16A 1XZPA 5C5EA 3VYUB 3DFGA 2OAEA 4C4AA 4O63O 3G9XA 4GQAA 2UZ1A 4FYPA 3JXEA 4QPJC 5KCZA 3WZ2A 3T5PA 3BKXA 1P91A 1SB9A 3UAOA 1R5GA 1U2RA 1USTA 1E2FA 5TARA 4A23A 4BLRA 4DQUA 5DNUA 1H8ED 4N3CA 2H8GA 3N59A 5KYKA 3OR1C 2WSLA 1QH8B 3RDPA 4RPHA 4NNPA 3RJ9A 4F85A 5ED0A 5GTDA 3SXYA 1KQ9A 1MBFA 1WETA 3BDVA 2OZPA 4DL9A 5ICFA 1ZZEA 4M6WB 1R0RE 4DJDC 2ZIXB 4N9WA 5EXSA 2F2TA 1MQSA 1Z0KA 3D6TB 4LB5A 5CVJA 1K6EA 2PGXA 4H4EA 1C7JA 4TTRA 1J5YA 2DOEA 1IV6A 4AULA 4KR2A 4M60A 1VLMA 3CCRI 1YT5A 5H59A 1P4WA 1KJ8A 2WNSA 2TECE 3VC3A 1SANA 3GLXA 3M3PA 4B74A 2LZ0A 1H3EA 5HIKA 1QIMA 2O1WA 3CQZJ 2EWWA 3DCYA 4ZJPA 4HH4A 5IJ9A 5TJJA 5L3SB 2QSGX 4HZUA 4FONA 4EF5A 3WHCA 2WG2A 4G41A 5EE5B 3GJ8A 1LKXA 2AXQA 5HDNA 5IULC 1RLOA 1GGJA 1CE8A 3NWEA 1BR2A 3ZDEA 1C1XB 2C9MA 3OZEA 3HVRA 3JQ9C 2OFXA 3DUWA 1L3LA 2K2WA 3KTFA 4Q1BA 5EUBA 2AN3A 5AJXA 3I2IA 1AGRA 3HB9A 2IYLD 1WQ3A 4AG5A 5LQJA 3WKDA 1SOUA 3IE2A 1BRMA 3H83A 5AW5A 4AIJA 4NHJA 1VYVA 2XHZA 1FNDA 2GX6A 1G5PA 5KKCA 4S1VA 1UMBB 2LXNA 1XKQA 3G8BA 5D7NA 3DKXA 3B6IA 2WKWA 4ND3A 2QX8A 2Q9UA 4P1ZA 2VTKA 3M6XA 3BA6A 1WG8A 1L8XA 3KVOA 5FPKA 1XMOB 2HYDA 4C7JA 4OUKX 3AKZA 3R7LA 3P1JA 1W0KA 4IRUB 3C7JA 1CJKC 1UZMA 1R5JA 1JWAB 4CF6A 1QU2A 2G6TA 3CLVA 4RGQA 3TNDA 5ERGB 3TW6A 2F5FA 3HTUA 4KOAA 1RWOA 1ZAYA 3L41A 5HFJA 3Q7SA 4H6VA 2XLCA 2NXNA 3MLBA 2AS0A 1Z2EA 1R66A 5A71A 4JOMA 3WLKX 1WHTA 4XTCS 1RYNA 2ZJZA 3ABKH 3B1VA 1Z5VA 2GKSA 5GPAA 2NSLA 2XUZA 2YVUA 4NIMA 2CNNA 1QG4A 5BQ3A 4ARVA 5LA6A 3EG9A 4UAGA 5HPYB 2HK9A 5JJIA 4LHSA 3V1YA 4A5SA 1Y33E 2IXGA 2VBIA 3Q15C 2BBTA 2XUDA 3AR4A 2ZJPF 5AKLA 3GRAA 3QKIA