1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords phosphofructokinase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
2Q4DA 3HNOA 4A3SA 4LJRA 2IZ6A 1YDHA 2PFKA 1ZXXA 4P5DA 3O8OB 4FYHA 4JEMA 1S3FA 4WL0A 1S2LA 1F8XA 1PFKA 4RH3A 2NX2A 4U1RA 1WEHA 3O8OA 1MTOA 3O8NA 4KXNA 1S2GA 3BQ9A 4LJLA 4OHRA 4I7EA 4JENA 3K2QA 4I4IA 2IZ5A 2F2TA 3U39A 2PMBA 5AJUA 2F48A 3MAJA 1RCUA 4FYKA 4NPAA 1S2IA 2KHZA 1WEKA 3SBXA 2A33A 3PFKA 4PFKA 4FYIA 3GH1A 4MCJA 3O8LA 2F67A 2Q4OA 5ITSA 4P5EA 4HX9A 4JELA 1S2DA 3QUAA 1KZHA 3EHDA 2A0KA 5AJTA 2F62A 3F5MA 2IZ7A 3UQZA 3IMKA 2HIGA 2KLHA 4KXMA 1T35A 6PFKA 3OPYB 4OHBA 1F8YA 3OPYA 4KXLA 4MEJA 4I36A 2F64A 4LJKA
chains in the Genus database with same CATH superfamily
1FBUA 4AW9A 2F4VB 1YRNA 1YS4A 3S68A 3TMYA 4BHTA 4D98A 1QKJA 1Z0XA 5EIBC 2C7QA 4KCGA 1Y1TA 1KIMA 3EF3A 2FEZA 2SICE 2W0SA 2H7CA 4QPNA 1FYWA 3OM8A 3OR1C 1IV6A 1OI3A 4IDEA 3A6DA 2QVOA 3K9GA 4WFKA 4P5DA 3WGZA 3ZDQA 5K5EA 1C30B 1OU0A 3PF8A 4CHGA 5KYUB 5IS2A 5FKLA 1E5TA 1WW8A 3HDGA 1A5JA 2JC3A 5COAA 4FXOA 1UP7A 5EIEA 1MGOA 4L75A 3THWB 2OPHA 3CP8A 1BHQ1 4MV3A 1UJ8A 4R8MA 3NGXA 3P2EA 2EKDA 1NN0A 1U1GA 4HB3A 1PR0A 1CNFA 3EC7A 3BGSA 4BP3A 1UZNA 2ACKA 4DQLA 5F52A 4DDVA 5IWCA 2NQ2C 3W8FA 1V11A 1VF9A 2P2ZA 3ZQIA 2OV3A 4HX4A 3CZPA 4OHFA 4CIAA 3D0OA 1B6RA 4G0VA 1LH0A 2PQ6A 2ZTSA 3MWYW 2ESHA 1X9HA 3R4CA 1D2GA 3ED5A 4LN1A 4BC1A 4OIPF 1VLHA 1DXHA 4GWKA 1UKAA 1G20E 3BMOB 3JQFA 4CKXA 2E4XA 3FXRA 5JAOA 3KPWA 3TEFA 4DBLE 1QG6A 3CU5A 3E7FA 4JUIA 5GJVC 4AWAA 1N6KA 1YW9A 2O0YA 2DYKA 3PPVA 3CZ9A 4KQ6A 3CWZA 5BR8B 2HZDA 4NJMB 3A6EA 3KRTA 1LV8A 1QGUB 1KA8A 1XNGA 4E70A 1YDMA 1BQEA 1PX2A 3E6MA 2A9PA 2P0AA 2VF5X 3IP8A 5TS3A 4FLEA 2AG8A 1Z74A 1UPBA 6YASA 4WA7A 5FV4A 1CB0A 1J7KA 3BTCA 2F00A 3G79A 4Y2QA 3OJXA 4IFIA 5BNTA 4LG0B 4P6VF 1V2GA 3ZVKA 1F6DA 3EZLA 2CW5A 3NOOA 3LX4A 2JAWA 4TXNA 4LIUA 4NBNA 4KOEC 1RIFA 5ED0A 3UHPA 1U04A 1MR3F 1CYDA 4OHXA 3E6CC 2CV1A 4BBAA 1N32B 4KN4X 3ZJVA 1PGOA 1VIYA 2CNWA 3BS4A 3IQHX 1JNYA 1DADA 1LLCA 2QRMA 2IYLD 3STVA 4A03A 4OHOA 2NZWA 1YD7A 2M0MA 3FWPA 1ZLYA 2GPNA 1FY7A 2DF8A 1XG1A 1YZGA 3QG1A 1BIBA 4ZDLA 2NXCA 3HYCA 1U7UA 5TJHA 1FP4B 1KO1A 1SAXA 2GGSA 5GGYA 3IJEB 3ZWVA 3JQDA 2YV5A 5K9ZA 2M1BA 1J0CA 1TA4A 5I7RA 2BOLA 1PU2A 5IK2A 4QHSA 3B1KA 5KMGA 4BNIA 1XELA 2WB1N 3I12A 1JT0A 2ZG6A 1VSTA 3IVGA 4ZKEA 1BGWA 3SQNA 1W48A 2NRAC 3H5WA 1M10A 4A3KJ 4I9FA 3QEKA 3UGQA 4K05A 5AVTA 1JEDA 1YTLA 1QR6A 2HF7A 2HNAA 3DVSX 1KO7A 4KK3A 4MLZA 4UEKA 1UFQA 3UK0A 4AUNA 3K6RA 4ZJPA 5CDFA 3U2RA 1R12A 1XNHA 4I81A 1CGPA 4A3CJ 5F1RA 2JLWA 1I4TD 4V0KA 2QA4I 3CY6A 3U0BA 1A5AB 3OM1A 3H4IA 2Q4RA 3O3CA 2CCGA 3BR2A 2VP3A 3HUGB 2BDTA 4PGMA 2KW5A 4RS4A 1E3MA 2W2PA 2K4MA 2VHZA 1AUXA 3PQ4A 3OC0A 1BDHA 1ZA1A 4LC0A 4V0OA 3CO7C 1GL3A 2IELA 4TMTA 2ZB8A 3N8GA 4J91A 2NS0A 4KXUA 5FUQA 1CZLA 1OIVA 2OGTA 3LQFA 2MC4A 3JRBA 5MF6A 4HF0A 4P4NA 3RAEC 5KJ6A 4OIMA 3QBTA 2MR5A 3LCRA 2VRWA 1PD0A 3E15A 1QQIA 4RAFA 4JOCA 3VBCA 4YCCA 1QQ7A 5FDFA 2LDXA 3BEDA 1QGZA 3EXHC 1HE8B 3N5CA 5JC8A 3TQSA 2KFDA 2VAPA 5BV2P 1B8OA 4OAYA 3L40A 1EFPA 1N1DA 2B2XA 3ZI0A 1NBHA 5TJJA 4OLJA 5FO0A 2VBXA 4AAYA 3S3NA 4XYLA 1L4KA 4ETIA 1JHZA 2YTZA 2D1VA 2QLZA 2AH5A 3GFGA 4RJKA 5BUCA 2I8CA 3FDZA 5I4KA 3S2GA 4YEDA 3DLIA 1CETA 4HNRA 3ZCXA 5AW0A 3JRIA 2BV3A 3VZCA 1HG1A 1DG9A 4PYNA 2D1QA 2AOTA 2FOXA 3DB1A 5ADVA 2JW5A 2CFIA 4PSCA 4YV2A 1C0IA 2VJAA 2FZKA 4UVBA 2OFFA 3PNMA 2O9JA 3R1IA 3UWMA 3VXKA 1QBJA 1H8ED 2REQA 3G7NA 1RYMA 2CFRA 4K28A 4ZOLA 3ZUGA 4MUBA 4JT2A 3ME5A 1C9EA 4Q93A 3COJA 1P80A 1T5LA 3R75A 4IWXA 1H65A 4M9ZA 1LUAA 2ZIFA 1W7AA 2RB4A 4N7BA 1VCOA 1JYFA 3JASA 4ZZ3A 3BCRA 2W2MA 1V95A 4CPDA 4IIBA 1EA5A 2QVBA 3S3MA 4OJNA 1ZINA 4IMRA 4X1YA 3HCPA 5HF6A 2CVOA 1E1CA 2WPDA 2ZE6A 4S1OA 4ZVNA 1R3DA 4E2XA 3HZHA 2N75A 1JQBA 4BV2A 2RH9B 3K1AA 1P1FA 2GK7A 4GOOD 1DPRA 5JFRA 4HFNA 4QREA 2DA6A 4H1HA 1DX6A 2PIAA 4R40A 1PW5A 3PRKE 1K08A 1H4SA 1XQWA 1S7GA 2F2TA 3N74A 3G2LA 4IDNA 1RC8A 3AVUA 3LSYA 4CYCA 4EJ2A 5C3MA 4F84A 1LDKB 5IMBA 1E2DA 2P79A 3D2CA 2ATVA 5DULA 5LGTA 3GRCA 2JGNA 3N2LA 3NKFA 3DL0A 2BT4A 2X77A 1RCUA 3IRQA 2BWJA 5B53A 5IJXA 1B6AA 2GPYA 2WWVD 1GGFA 3OOHA 1S9DA 4PC7A 1J1UA 1QE0A 3P9XA 5JQGB 4L5JA 1PD1A 4U2FA 4XI9A 1EFRA 4KQ9A 1C1XB 4OHKA 3DCIA 1RC9A 1ZM7A 5EHGA 4IHAA 2JKZA 2WV9A 1OB2A 3G0DA 2R5YB 3M5PA 3NWJA 4MUNA 2PJRA 4UVAA 3AP1A 1Z38A 1PG2A 1QOZA 2XUPA 3UJNA 4NOJA 1UKCA 5KO2A 1DXQA 1BS9A 3EXEA 2G06A 4LMRA 2I76A 1WCIA 1ODFA 3K1ZA 2WYIA 3VNSA 4I3FA 3ZGVA 2ETHA 1HDZA 1P2FA 3LRXA 5DSZA 3DTVD 4JASB 5ALUA 3GQBA 4GXOA 2GASA 2FA5A 2OCKA 3CCMI 1YB5A 2EX1A 1ZNXA 1RRVA 3M7IA 4C3ZA 1R7RA 5U1PA 4RMNA 2GZSA 1PG5A 3B51X 1QS0A 2BBYA 3I0NA 2YWXA 4JFRA 4MGYR 5T67A 5B4TA 2Q3FA 2PTHA 3R3ZA 2YX4A 1VKHA 2FW1A 1EK0A 3F23A 1E2JA 4D4HA 2QN6A 4UUMA 3R3HA 2Q3CA 4FI3C 3OZGA 1NLFA 1WWKA 2PFBA 2HSWA 1FRVA 2KQUA 3OESA 1FFXA 3B1FA 2KLHA 3L2QA 4NYIR 1YBFA 2D0DA 4DT1B 2HCBA 3PA6A 5GPCA 1RBMA 2WF7A 3HJHA 4X7MA 2R7LA 2DFDA 3DV0B 3L0SA 3O73A 5TQ0A 2KKOA 3SYRA 3JQAA 2Z3YA 3GLUA 4DIDA 1G16A 4IWYA 3T9AA 4RGXA 3QUBA 4L1KA 2R4TA 4GOKA 2BEVA 3OFKA 2GCPA 4OGWA 4QU9A 3T3HA 3V1TC 5DEOA 2W85A 1YKGA 1CFZA 1XMOB 4ZN6A 5JNSA 2K9QA 1GM5A 3H5LA 1KKMA 2QWWA 3NQOA 2Z57A 4ZQHA 1Q77A 3TJRA 4UVCA 1RESA 4BEJA 2O1XA 3QSGA 3KYCA 5HK9A 2CLFB 1UAGA 2G25A 3K16A 5DIZA 1AQ6A 1LK0A 1GYRA 2R8ZA 5F6FA 3FLAA 2EV9A 3QPTA 1DQUA 3CUQB 4I5FA 5JQGF 4WX2B 2G76A 5DOVA 4X8LA 5CXQA 3WRYC 2YIJA 1G8MA 3HL2A 2HPVA 2F3QA 2QWXA 1B4AA 4HWRA 1COWD 1UM9B 2DPDA 3LQYA 5A05A 3ZIAA 4AUKA 5ALYA 4FFOA 2C42A 1FIPA 2XKAA 3D2LA 1ULZA 2V3WA 1P2GA 1YRYE 4H0NA 5LQRA 3DBVO 3RD5A 4B3DA 2NN3C 5IT3A 5DT9A 1PUFB 2WJZB 1LSUA 3VODA 1R74A 1VL0A 3OCXA 4GYIA 3V32A 4EDHA 1JP7A 1KJNA 1Z07A 3E05A 2QSJA 1NN5A 2R3SA 3HOWJ 3NTUA 3PHLA 4AJ2A 9MHTA 5EWLB 2KQRA 3E58A 5IVDA 3W3ZB 5K0SA 3Q8LA 3H2HA 1OHHA 4M1OA 3RLFA 2VPRA 3U7FB 2OAZA 1N4DA 1S96A 5KOHB 1T98A 3PFBA 1BOBA 3Q7PA 1FTQA 1U31A 2I6GA 2CBZA 3P8ZA 2FX0A 3TFQA 2CNNA 3THOA 3ZGNA 3TBFA 2FZLA 5M3BA 4NMLA 1XPUA 1NUPA 2I3ZA 3KD2A 3FVRA 4FYJA 3VPSA 1EWQA 4LXUA 3NUGA 2ZBKA 4R8LA 3MLAA 3O9ZA 3E5UA 4U7DA 3AI7A 1GHTA 1K7SN 2E1PA 3DO5A 1KAQA 3CBGA 4J8PA 3C3JA 2EW2A 2KPOA 2A05A 5IW8A 3R77A 4YMIA 4L5BA 3GLHA 3ZV3A 4CWAA 4D79A 2XWQA 1U2DA 3DDUA 3IOCA 1QBGA 1VKOA 3MBIA 3OTWA 3W3AA 3U7JA 1CUDA 1N92A 3JQEA 4CZ2A 4FEAA 4KISA 4OHCA 4BO1A 1MN6A 4NV0A 5TARA 1PP8F 3TLYA 1U3VA 2BUAA 1N2GA 2ZUSA 3MBKA 3I9V6 1O3TA 1O94C 3DFZA 4E7IA 4X3PA 5FNZA 2V6MA 1G6HA 1Y1VJ 4M7WA 4HGQA 5EE1A 1VHQA 3DL7A 1C7IA 1UQRA 2ZUBA 4LX8A 2G7HA 4UHEA 1M83A 4A0FA 4C3HJ 3CTAA 1C3LA 3BPVA 3H1EA 4PZEA 3UWPA 4L8FA 2E49A 1OIXA 3PF9A 2L4MA 1U28A 2ZXFA 1TCAA 2HWXA 4JH0A 5I8ZA 5D2CA 5IX8A 4K2EA 5BO5A 2C95A 2JD0A 3PRJA 5H83A 2BSQA 3OTGA 3GBGA 4QTRA 2MSDB 3WRXC 5DCFA 2RFLA 2OXTA 3RT7A 3UXYA 5K1YA 1NZJA 2FPKA 4U7JA 3F21A 3MRVA 1O8BA 1QHIA 5C1DA 1IAVA 1PDOA 1YMUA 4GXRA 1YQWA 4R98A 2NU8A 1BE8A 5DTEA 4P96A 1TEHA 1THMA 5CHEA 1NYQA 5B3KA 3WYAA 5D87A 5IANA 3DTIA 3QLUA 5K3BA 4CCLA 5JVGF 1PWZA 4FFSA 4CR6A 3AM1A 1ITZA 1FQWA 1LRJA 4MGRA 3CX8A 3KLPX 1PKXA 4MMZB 4OHBA 1SBYA 4OHMA 2EKQA 3IWZA 3B6EA 1FFYA 4XASA 3QVMA 1Z4OA 1Y8RB 2QN7A 5JO9A 2D59A 4CL8A 5JD5A 4RS8A 4PC2A 3V3KA 2F9MA 3WGOA 1ZZGA 3G0CA 4KN7X 2HVRA 2F9LA 4IIXA 1S3IA 4KG7A 3QE9Y 3MA0A 4IHJF 2P0WA 5FO1A 4MARA 1LF5A 1AGRA 3KYIB 3PQJA 3M5WA 2AHOA 3D9QX 2ZMEC 4EHBA 1F5NA 4I01A 1Y8CA 3CNNA 4L4YA 4Z7JA 1MC5A 5BPDA 1UKBA 3NEPX 4JD5A 2LG4A 2ZIVB 3AZQA 3K8OE 4R81A 4CF6A 1AHNA 5JW6A 4FNAA 3CZMA 5FV7A 4URXR 4NAVA 1E79A 3GRAA 3I4LA 1LW7A 4RDCA 4OFXA 1Y9DA 2Z6UA 3PPYA 2G4LA 3WDSA 4QTXA 4Z9FA 1DB3A 4OFWA 1SUAA 2WI8A 4XEUA 3EUHA 2NVQJ 1Z2NX 5DM2A 3GLHB 5PGMA 5JBIA 1BX1A 4WNAA 1AKQA 1H94A 1ZK0A 2VIIA 3DE1X 4FYMA 4OREX 4Y7CA 3TBKA 3TXXA 3ICQB 1H9BA 1YCGA 2IXBA 3LL7A 3RKXA 1DVRA 1D0XA 1NW8A 3PTZA 1MJ9A 1X8JA 2RGNC 2QEXI 2ZJ4A 4O4IA 4WOJA 5JSZA 3JYOA 4LRXA 2A35A 3HYTA 1JLHA 5K0CA 1NPTO 4MTDA 2HADA 1XXLA 2QX6A 4JKIA 5LD2C 1MHPA 5DJ5A 2WAEA 1HYEA 5IT0A 1RT9A 4RLFA 1FYVA 3RC8A 4GI2A 3WIVA 4M9CA 3AU9A 3E2IA 4MQEB 5EWJB 3PIPF 1E3OC 3CJNA 1II9A 5DYNA 1J8DA 1QYRA 5K3SA 4CFYA 1MIJA 3CR8A 3Q12A 1N1MA 4RA9A 3SFTA 1GR0A 2B9SA 2HRCA 2OP1A 3AMVA 4PZDA 3LCCA 2YY6A 2ICAA 2RBEA 1XOIA 4O5AA 1A5BB 2QT1A 4Z51A 2AZ4A 3O5AA 1IE3A 4ZOEA 3QYAA 3KC2A 4FMCB 2AQKA 1BVUA 3WFZA 3FKSA 4OYLA 3IR7A 3ROMA 3ITNA 3L7BA 4K1LA 1WB9A 4DJDC 1NU8A 2DC1A 2PK3A 1Y6GA 4WZBB 3HFSA 3FOEC 3IP3A 1SC6A 1MBZA 2QGUA 5KNCD 2L02A 4UB6C 1QLHA 1U9CA 2JWTA 4QULA 3QEBZ 1X9IA 1Z7LA 1I2DA 4V0RA 1Z25A 5H9VA 3WLNA 3AJDA 4FSDA 1MH9A 3EUFA 4FXPA 2ZEJA 3GVCA 4OBBA 2PLFA 4KRXA 4B6SA 4BVBA 4GMFA 1VYTA 2HI0A 1IOLA 2IUTA 2WZBA 5GAJA 1JZSA 5U4QA 3DOFA 5K8TA 2CXRA 3PP8A 5LZ7A 4CV1A 4KE6A 5B36A 3FOFC 4MXDA 3KJXA 2XZOA 1KBZA 3ESYA 1LPQA 1ISPA 2ZFUA 4PVDA 1JFSA 1P9NA 2HQNA 4H77A 2QQ9A 2WUWE 3EGVA 4MOWA 3GELA 4BL5A 2R84A 4ER3A 1GCGA 1ZPDA 3LSPA 3PDIB 2GSWA 2WICA 1E7QA 1GZVA 2NS7A 1P91A 3IKMB 1E2UA 4PGAA 3VR5A 1SFKA 2VJ5A 1QLJA 3FTDA 5F4ZA 2BE7A 4JKYA 3MJVA 4QATA 4KLZA 5I7VA 3K0AA 4IHYA 1P1RA 2JJ7A 2JI4A 4HSGA 4Y98A 4BHPA 1JKRC 3RPQA 5EQDA 5IT4A 1J75A 1T08B 3GNLA 4ZGWA 2JVHA 1EB8A 1MMAA 5DVZA 3OTQA 1EP2B 1QK3A 3V7RA 3W06A 4L5IA 1TQ2A 3IDSA 3NCTA 5L45A 4HH4A 1T34A 1KFEB 2ZJ3A 1SCDA 2XLBA 2M3AA 2ZSBA 3M9LA 4HDNB 1E17A 4WFJA 1F7VA 1NVVR 3FDIA 3I45A 2HV9A 4ZQCB 3H0GJ 3K2BA 4HQMA 4OATA 5FA8A 2QRPA 5IP7J 2E2HJ 1P3JA 1HOXA 2Y4OA 3NCHA 4NESA 5K3CA 4B85A 1UKZA 1J0EA 4HI0E 4DWWA 2IJGX 2F1IA 3BGVA 4LDAA 4U00A 2J8ZA 3H9JA 3RHFA 9GPBA 2JRTA 3CNOA 4QGHA 3VO8A 3AVVA 5EZYA 4KOAA 3V34A 3HDDA 3GVAA 4II2A 4XR6A 1H66A 1XO1A 4MKIA 2C5EA 4Z3DA 5CUQA 4A92A 4UMVA 3TQTA 1CEQA 1QO0A 1Z05A 2GHQA 4Q15A 3FPCA 3THRA 1IZ9A 1L5LA 2ATEA 2ZYWX 3EMVA 1WP4A 3GMDA 2XTMA 3KEFA 4BJ5A 4HN2A 3J7TA 1UADA 3KLBA 4A4DA 4TMWA 4YPOA 3JWIA 4RB1A 3HFJA 4KKXB 3H2KA 2BJHA 3GUZA 3HV0A 1T3GA 1YUNA 5LU9A 1PUEE 2BGGA 1DRJA 2B37A 2IY9A 1LE8B 2QR5A 3A25A 4J49A 5FWYB 3VZDA 3ZWAA 4XWWA 1WI3A 5HTOA 5IDQA 2GRJA 2P6UA 2YQ5A 4HBZA 1MC4A 4QEZA 1GFIA 3AB8A 1F9NA 5KBYA 1HSOA 1RHQA 5M5BA 4WGGA 2FZWA 2M9HA 5KYNA 3HDTA 2R6JA 3OU6A 2WAXA 3CZQA 3I5YA 3L2CA 2HA2A 4QRHA 3SYNA 3DBHB 3L2WA 5ERIA 2FUCA 3H19A 4MK4A 1LE8A 1TD1A 2P6PA 1WKCA 4XKVA 5GINE 2QLBA 4LDZA 1ZM9A 1YVEI 2QMOA 2XUIA 4EW2A 3GWGA 4ZDWA 3RTGA 1AS3A 4IDGA 5LZ4A 4KXXA 5CJ2A 4D3ZA 4X84A 1QVTA 1F8UA 2CUNA 1JT9A 2SKDA 2W8BB 1T2KA 2VDOB 3FNQA 1DEHA 1K5HA 1TIKA 2JIOA 3K0HA 4G5XA 1OFUX 1NVUQ 2PH3A 4LYDA 3QFCA 1E2LA 1QYCA 4KR7A 2MSYA 3GBSA 3MTGA 1A9QA 3DE7X 2MSWA 4NZ9A 4PFJA 3SBXA 4E7OA 2ZRQA 1FFCA 2Z9BA 3OLVA 1ZD1A 2IYWA 2G0EA 3CVWA 5FYQA 3ZHYA 3HXKA 1RRGA 4H17A 4CDGA 5BNWA 3C3PA 1T4MA 5ITZB 5B1IA 3R9IA 1JTYA 3PFHA 1D6SA 3AILA 2GM4A 4XJXA 4BFYA 4BECA 3PTAA 4LSZA 3QU9A 4G63A 3DQVC 3F0TA 1SBNE 1JBEA 1R6TA 1XQ1A 3LMMA 2P91A 5D4RA 2VS1A 3IV5A 2WWWA 1CZUA 1YQQA 5E1OA 3WLHA 4F12A 5HHTA 1D3AA 3F3XA 3LBAA 2IYTA 3D3WB 1T25A 1OBVA 3I83A 5B1EA 3SZUA 1JT2A 1IJBA 1OTHA 1S9HA 4CTKA 1JI0A 3U56A 1GXPA 2KM1A 1F36A 1JKMA 1UK9A 2OESA 4LYEA 1DBPA 3DDWA 3L7IA 2Z6AA 4X64B 3WBFA 4MP8A 1OMIA 1J20A 4O63O 1BXRB 2RGXA 2WIFA 3PJDA 2OBPA 1NHWA 3G5LA 5EESA 3UJ3X 4G4IA 4QAQA 1QG4A 3RUHA 3E18A 3LBHA 5L3VA 2IUSA 2XHEA 3EIUA 3PR1A 4ND3A 3CH4B 4URHA 1Q1NA 2K87A 1W1IA 2VHWA 4QFMA 1JKPC 3ZMUA 1QX4A 1XB2A 1JDPA 3W2TA 5E9JA 2L9RA 1YIDA 1ETQA 1M0EA 4OINF 1JAIA 3O93A 3BDDA 2FR8A 5A3VA 5JHGB 2W83A 1NNLA 1N2OA 3AIOA 1UG2A 5EXEA 1FTYA 4QPDA 1V8FA 3JARA 2HHCA 1AV6A 3O3OB 3HBFA 2Z6QA 1TB4A 5E1XA 5M5YJ 3C6ZA 3QV2A 1NW6A 1SIBE 3DAPA 3HKDA 4G25A 3P2IA 2IV7A 3S8YA 3OU7A 4LJRA 2HU7A 4UUAA 1V6CA 1WKVA 3IWFA 2H3HA 3R61A 3OT4A 1NG1A 2PU5A 4FIZA 2V9VA 3U5ZB 3ROPA 2IHZA 3OIVA 4UBLA 1NU6A 9LDBA 1V0JA 2I2DA 1GFSA 2CYCA 4CIYA 4KPYA 3ADBA 4BQEA 4LGCA 4A5MA 4ND7A 2PUEA 5TQJA 4A2UA 1UHWA 5I45A 1LXCA 3RVRA 1WXDA 1J8QA 1GL7A 2AMJA 2HMSA 2Q0HA 1QF6A 3VYTB 5AW5A 3NBFA 4GVLA 3VSBA 5JMWA 1H8HA 1QNFA 4L9SA 3AZPA 1UBMS 1AHIA 3OL3A 1D4AA 3DOJA 3GZNA 2VB6A 1X80A 2R8XA 4J2TA 3T9FA 5C4MA 3LDHA 1BQ4A 2OBYA 3EF1A 1M3SA 1XDZA 1W49A 2YWBA 4P3KA 3AHDA 4UTPA 2ZXUA 2Y0PA 3ONEA 4D0SA 3FDXA 4PN7A 5A3QA 3IEVA 2YCLA 2V3VA 4BH9A 1HLPA 1KH3A 1JI3A 4WW0A 2IPQX 1YVPA 3PUJA 1TIBA 3VTZA 4G6DA 3N0TA 4DUYB 3ISVA 2ZI5A 3K4NA 3R6LA 1LCIA 1UK7A 4ZICA 1E9VA 3ECAA 1YQGA 2XV1A 3VI4B 2E89A 3TL4X 4D99A 4A3LJ 5IXSA 2P30A 2EV5A 2KJQA 2E4WA 2QRGA 2QMEA 3ZN2A 4P3PA 1B0PA 3M2TA 5LB2A 1IQRA 1EFKA 4NPAA 5H3LA 4ZCRA 2OQVA 2A68F 3DUWA 1I6WA 3ORQA 3R9KA 2LNDA 2OZKA 4RTPA 1B0AA 4EJOA 2LRHA 2ZVDA 4HEQA 1Y39A 3JTEA 3ORYA 5IJ9B 5K99A 2GO7A 2K3PA 2X1HA 2HGCA 2C57A 5AKXA 4PFSA 3ZS8A 2QTLA 3GOHA 2LKSA 2VE8A 3DMTA 3TRFA 3TD9A 1BW6A 1XZJA 5LQJA 4LK3A 2EFPA 3D8SA 4AD9A 1XKLA 1LEAA 3HADA 1I94B 3AVXA 3BAFA 2WTEA 1USSA 2FP4B 2X23A 3DBLB 5DTDA 5I9BA 3ABMH 2BFOA 4P7FA 4UCFA 3JR3A 4X54A 4LYHA 3S81A 3VKGA 4LBZA 3U7EB 1XEWY 2XR1A 1FBTA 4A3GJ 2P1RA 3NKVA 1T8UA 1PSDA 2PZMA 4FHGA 3GN1A 3ULQB 1AQLA 3L0YA 4PXAA 3GD5A 4IRGA 1Z5UA 1MVOA 4KN8A 3U9TA 3GLXA 4E7HA 4AP9A 1I50J 2XA1A 4CW7A 4HEJA 1NJ2A 5JNUA 2XEDA 3HBJA 1J07A 4X91A 3GTPJ 3BJZA 4B34A 2PAAA 3ZHUA 5L3SA 2NUPB 4KYIB 4JC0A 4B3XA 1EP3B 1QF7A 1E6EA 3ESZA 4DE5A 1ZG5A 2VI5A 3TRHA 3IBSA 3P7NA 5G3YA 1E7SA 3SSOA 2BZSA 1T33A 1XDUA 5DMHA 3SXJA 5C52B 3NMUF 2EX0A 4OHWA 1KFJB 3EEQA 2QGZA 1JHDA 3KUCA 2AK2A 2CF6A 2F1OA 5JE8A 3EODA 4IJWA 4O6VA 2PX8A 1RQLA 4MPRA 1A9PA 2GUGA 5K01A 2NUAB 3U81A 4KMOA 1GDTA 1H6CA 1KONA 4YRAA 3K4LA 2BXZA 1MDMA 4FX4A 3BX1A 3LBIA 5G1NA 3UANA 3A9TA 2A8YA 2G8LA 1ZP6A 1Y3IA 1ZI6A 2J6BA 3E1KA 4M55A 4PCUA 3UTDA 3WIDA 3JZAA 3O1IC 3P0JA 2YS9A 3PUYA 5HODA 5AK4A 5EXTA 1IDZA 5AVJA 2VG8A 4AYBN 2QHXA 1RMQA 4HLCA 2F1JA 1WDWB 3EWAA 3HABA 1L3CA 4LRTB 1FBNA 3P20A 2WP0A 4R7ZA 3RS2A 2D2EA 1XDSA 1PJAA 4XIIA 1ADGA 3QRFF 3ETLA 1TTPB 1I32A 1V16A 2HXYA 4BTEA 3T1TA 3HC7A 3ZWMA 2Q0XA 3Q9NA 5DV5A 1Z2EA 4Q6WA 4HNVA 2PLYA 2XA9A 4L6AA 4BO0A 4EITA 4AVZA 2BVLA 1NUQA 1WXEA 1P7WA 3NH6A 3OJ0A 3AONB 1NV9A 1BXGA 3NDPA 1GG2A 1QTRA 2FSVA 1Z0SA 4M0PA 3A1SA 2OPTA 4X92A 4OBWA 5AI5A 1W9HA 3H4VA 2P9QA 1KMHA 5CPRB 4UATA 5DDGA 4Y6QA 2DFTA 3D8NA 4JSRA 4WOBA 2FLKA 4ON0A 1X2NA 2FEOA 1VE6A 2FSUA 3RK4A 4E51A 1YMQA 2QROA 3ZV5A 1T4CA 4V1CB 5LOVA 3SWWA 2IA5A 2M34A 5BYAA 2B7EA 3D7SA 3EGIA 2B6NA 2VNKA 3K6GA 1IH8A 4G1BA 4UVIA 1USTA 4J6EA 5CXXA 1XD2B 2AJ8A 1GRNA 1XGMA 3GFQA 3WS7A 1FE8A 3T0YA 1BU8A 3ZY3A 4DZRA 1IEVA 1W9MA 3JQFC 1Q95A 2LCIA 4EHHA 4I1YA 2J3KA 3LT2A 2B0CA 3CCUI 4B31A 4HN9A 3H3FA 1D1QA 3JRFA 3K0EA 3C87A 4QDOA 4DB4A 1LJUA 4C14A 3OMXA 2R7ZJ 3TDZC 4K9NA 2GT1A 4YRVA 2XF5A 3WGVA 4LF6B 4N01A 3Q2KA 1OAOA 2D1RA 1XCJA 4IKOA 1KEEB 3MQ2A 5JCXA 1VIMA 3KXKA 4MNTA 1FDIA 1RAFA 2X6WA 1UKEA 2HQOA 2O2ZA 2QNBA 3JVIA 4OOEA 4DN6A 1SEVA 2FW6A 3FNGA 2A33A 2PZ8A 5CNIA 1SXJE 4FOTA 3W6UA 1V5IA 1BIAA 3T1BA 4WY8A 5CDYA 4L73A 1OXSC 3ZCSA 5EJCA 1HT1E 1BN5A 2BEOA 2FR8C 5A2GA 2HQAA 2Y0SN 3C2GA 2ZB7A 4K26A 1U6JA 1TNSA 4KTVE 3GIDA 5E6RA 1A4UA 1K7YA 1QIEA 2IHKA 2OT3B 2YHSA 3HP7A 1EK1A 3G4SI 5HZGA 2VC0A 1PJ2A 1APLC 2HEGA 4Y7NJ 4TV9A 3COYA 4EA9A 1ZQ9A 3AM4A 4Q21A 4WCFB 1E2PA 4QSMA 2X6YA 4YQZA 4BQIA 7ADHA 4F4IA 4I5IA 4YXFA 1OJ7A 4GPZA 4KX3A 4UAJA 4UHJA 4YQEA 1XD8A 1RJ9B 5EI5A 1NQ5A 4L8GA 5AUQA 2J33A 4N3CA 2BHZA 2ZYUX 1OZFA 2BKVA 3CCVI 4G5FA 5LN1A 3BHJA 4I55A 1N6IA 1ZN2A 1B73A 2F2EA 2IEIA 4NHOA 3TLBA 2WF9A 4POAA 4DVGA 3I62A 3LUFA 5A04A 1KETA 1QRTA 3AKZA 1D9ZA 1QP0A 1LTQA 5CLQA 1IATA 3GUHA 1ESZA 2ZWOA 1KI3A 2KYRA 2VAXA 3NTRA 3USZA 1H6DA 2V5AA 3CLTD 3HKBB 4Q4JA 3FJOA 2F8TA 1T8RA 3QQPA 3FYDA 3GNSA 4K1XA 3VDRA 4A2QA 5T4EA 3CC8A 1NPDA 2BI7A 2W4IA 3IAXA 3WKBA 2NP6A 2ESNA 2UZ0A 3W0LB 4PLVA 4BFXA 5EDNA 1LBIA 2C7RA 4CIXA 5LL6P 5IABA 3INNA 2O5VA 2C2OA 2NXJA 5F27A 4PG7A 1Q12A 1E0SA 1RHJA 1RRMA 1UBOS 3RZDJ 3FHNA 1KJIA 4HTAA 5F76A 5AXAA 4DAOA 10MHA 4DNCA 3QYFA 1E1MA 4M73A 2AWNA 3DWIA 4MV4A 4RK6A 4L5EA 2RGRA 5F64A 4K6FA 4ZCPA 4LB5A 3LKBA 4WTOA 1G8SA 1MB3A 4IHKA 5B1DA 1AGYA 1RWQA 2FPOA 3SU8A 3KBBA 1YB4A 1VE3A 3PSFA 2ZVPX 4KUMA 1KZ4A 4PSWA 3KPJA 4UNNA 2HUNA 2P6NA 3BQMB 5BWMA 4B3AA 3MZHA 3TL6A 421PA 1VQKI 1PJBA 3PWTA 4XAQA 3E3VA 1GUAA 2AFHA 2YOGA 4ZOCA 4Z9XA 1FXUA 1Z28A 3STYA 4D9CA 5JSHA 3NHPA 2PANA 3BRQA 3PUZA 1MOZA 2ZULA 3QTTA 3D7NA 3ZQ4A 1VC2A 1W47A 4K8OA 1KYZA 1X7YB 1VPVA 3HYIA 1GNTA 1E98A 3S1NJ 2WE7A 4ZGGA 2PXHA 2F3TA 3X0DA 1DI0A 4EJ6A 4O2AB 4JBXA 4D9NA 3CCFA 3PGXA 4WOKA 3SZOA 4C0WA 1N34B 2P0YA 5BYJA 4L28A 2CFTA 4B3HA 2DEUA 2DKFA 4Y6PA 4XLPF 2JFPA 4BMOB 1UELB 3ILHA 3ZP5A 1Z4NA 5C4XJ 5EJMA 2XUBA 4HDOB 3WIBA 1FPMA 4F8YA 1V9LA 2BMAA 5DNDA 1U3DA 3WRWA 2ZSIB 1RJEA 3KJHA 1ITYA 1EK5A 1LVHA 3ISTA 5HXAA 4ZHQF 3D3EA 2VPYA 4YXWA 3K0SA 2PVCA 2DVMA 3PUVA 1QHYA 1ZM2A 2GN9A 3EF0A 3THXA 2QQ8A 1U3GA 3NRVA 1ZVQA 4A82A 5AUPB 3TK1A 1EAYA 1YIJI 2IEBA 2G71A 2OCPA 4AI6A 2ATXA 2B98A 4QX6A 1XKQA 1IJKA 1WRBA 4XRSG 2VXBA 4E6PA 1Y7TA 2KHZA 2QRJA 2XVAA 4LOIA 5TR9A 3OX4A 1I7LA 1D5VA 1OYOA 4JGBA 1P5RA 5AESA 2PUFA 2CHVA 2VBGA 4G7OF 1BKSB 3RHTA 2JZOA 4M0EA 3SQLA 3WMFA 3PIRA 3IKTA 1XRRA 1F1BA 1W44A 1FNNA 3F3YA 2BBOA 3LUPA 1WP9A 4MV0A 3VR4A 2DN0A 5CURA 2FMUA 1UMCB 4CTNA 2FPPB 2HCFA 3NAQA 2D00A 1E3QA 4JP8A 1IVSA 3M8EA 2ARKA 2V4ZA 4JELA 4YBZA 4AQYB 1JEQB 1N3BA 1QAOA 3AR2A 4Y1EA 1Z83A 3HSSA 4U88A 1ZBDA 4GL4A 1KU7A 1A36A 1VKJA 2RH5A 3EZ2A 2O3FA 3B1VA 3N8HA 4LLGF 3P9QA 4BIMA 5CB4B 3ADCA 1D03A 5IOZA 2W2XA 2FI1A 5I9LA 2ZTUA 4LRYA 2H92A 2R62A 4X20A 5TPZD 2IEAA 3DEIA 1I1OA 4EOGA 3J7YJ 1T6XA 4FSXA 5DHTA 2PMZN 4MKHA 2OMKA 1R6AA 1B8VA 4YUVA 1R0WA 4DBLC 5KVSA 2A1TR 1JHYA 3KM0A 5FTKA 5LQDA 1PZFA 3LYAA 3AU8A 5KVCA 4O4LB 2X6OA 4XNFA 2ID6A 2PBFA 3BE8A 2CSUA 3NHJA 2HREA 5YASA 2R7NA 4LYGA 4BWVA 1VQ8I 1VG9B 2F90A 4DV7B 2WM9B 4AVPA 4BDTA 2VPTA 2WA2A 3Q85A 4TL9A 1EFLA 3ER8A 2N8GA 4CCKA 1F12A 2NLOA 2P40A 3LSMA 1ND5A 2AT1A 4PPYA 4OOIA 4IIJF 3UK6A 5BWLA 1XQXA 1DQYA 2XQGA 3G2OA 5AJXA 1U8RA 3QKTA 4Q00A 4GPEA 2K9LA 4U0JA 1W0CA 3JRXA 5IUNC 2J41A 4G5SA 4TV8B 1MAVA 3SVZA 1CDOA 1HT0A 5GAGJ 1PBNA 3HXPA 3N87A 4XWKA 4PTLA 4MVJD 2YMMA 1NVAA 3DAGA 3F4KA 3ROTA 2EIXA 1FFAA 4PYKA 3SYLA 4B4DA 2I9KA 3HHGA 2GBFA 3D4PA 2N42A 3GJZA 5K0JA 4W5HA 1F5SA 3B1JA 4HAZA 3E6AA 3BD6A 1O7JA 2Y1FA 3M34A 4H6XA 3AERB 4ZT5A 4E13A 3O8BA 4I4TA 3T0IA 3GNQA 4ZDJA 3PXUA 3PKJA 3NPMA 3WL4A 3WGIA 4OCZA 4M98A 4YUYA 4EPTA 3GA0A 1XZPA 4LIVA 1RBZA 5G41A 2BFFA 2W6OA 4KEAA 2XYRA 3A9RA 1A8UA 1Z26A 4LY0A 2W24A 3SR3A 4AULA 2GTIA 1W2HA 2YX7A 1T9DA 3N0XA 3Q10A 5F1OA 5B2EA 3VKHA 3C8UA 1RRJA 1AXEA 4NONA 2AXPA 4WGFA 3QLEA 4ZYHA 1R1DA 3CE9A 5JBNA 3UMGA 3ZU3A 4II3A 2DQLA 1U1IA 4XM0A 1D04A 2BE5F 2EP5A 1ORKA 4ZZLA 2V74B 2V6IA 4A1OA 4YH1A 1GDHA 1M7GA 1U2TA 1YVRA 1FDOA 5CYGA 4L8YA 3AF6A 3QI2A 1JU4A 2Y92A 3FUVA 4U5QA 2OKCA 2Y6VA 4AO6A 2AN4A 4AG5A 2Q3MA 3HCEA 3UC5A 4JQSA 2O8KA 1K4TA 5DCMA 1X0VA 3D6NB 1E2FA 3G8CA 5JPIA 3U4GA 4EI9A 5KYGA 4RULA 2XCRB 1R6BX 4RKWA 3OCYA 3RJ5A 2YQZA 3UH1A 3ZY2A 4CIWA 4YIHA 3QU6A 1F43A 1NKVA 2FSVC 2PV0A 2ZRDA 3NONA 4AZ3B 4MAMA 5JPDA 3HBLA 1T36A 1PR4A 1IOWA 2C2ZA 4KITB 4PICA 2VI6A 5DBEX 2EPFA 4YI3A 2WB1A 1TL8A 3VAYA 5DMXA 4ZCSA 4M0KA 1Q7BA 3D64A 2A1TS 3VH2A 2C92A 3I01M 4NCKA 3VOBA 3JSPA 3C41J 2BGTA 4MLPA 1D6NA 2X9QA 1MO3A 4U2CA 1OH6A 4R2LA 4G1FA 4NV3A 1HGXA 4HC4A 1KQ3A 3JQ8A 4FW8A 1RXUA 4LG1A 4XW2A 5G0SA 1EVKA 4F5YA 3ESDA 1AK9A 4F2WA 1X1PA 1BQ3A 1YS1X 3DLCA 4HDNA 3MRTA 4BY1J 1XAGA 2R1UA 2GA9A 3ST7A 1ZH6A 4L0CA 3UCXA 1T0IA 4LYAA 1AQUA 1Q0LA 4FHZA 5T6BA 1ZRNA 2OP0A 5HG0A 3D1NI 2FWJA 4D57A 4E88A 4QARA 2HWYA 4N0BA 3PHIA 2AB0A 3PFWO 2CT8A 3ACDA 3O2JA 3PSIA 2R5ZA 3DCYA 4HNAA 2V7FA 4X1IB 4AX8A 3KEQA 3W5DA 1YHYA 1NAIA 1A9SA 4H4EA 5IEJA 2BHRA 3FCXA 4AY2A 4JP1A 4XE5A 3MM4A 2JG3A 2CVZA 2O57A 2A0KA 3GDOA 3QGMA 4KLRA 4BNUA 1X1TA 2WY8Q 1G5IA 3MKWB 2GHTA 4IMJB 1R4ZA 1IBCA 4HP8A 4BE7B 2P5KA 2JBAA 3KWMA 5BNFA 3KDPA 1IZYA 3QBDA 4HF2A 3BZ6A 1OXMA 2CDNA 3A70A 4LZPA 3UKOA 3QU4A 4BWYA 4CICA 1VE5A 4C04A 3L8GA 2DG2A 4KK4A 2EWWA 2JBWA 4YGYA 1RWMA 1V8PA 3IKLA 2Y99A 1WE2A 3CRNA 2BY0A 2IWRA 5GGXA 1EIWA 3DEYX 2HRRA 3TD6A 3GTOJ 3KUDA 3GGCA 5EE9A 3W05A 4FCVA 4QUEA 1HNZB 1I01A 3RYFA 3FNIA 3H5NA 2FTKE 4WFIA 5K4GA 3QFTA 3TINA 2Q4BA 4MR9B 3VVMA 4E5MA 2IH4A 1M66A 1MJAA 3ONQA 4FWBA 4E7ZA 2EXXA 2E5NA 3H86A 3HHEA 3C5VA 4RHFA 4RSHA 3T41A 2PXCA 3BB4A 2R751 3WNVA 2V54A 1SC7A 3ITDA 4KX5A 4DIBA 3IO5A 1L6RA 1RADA 5HMMA 5IC5A 1XN1A 2BIFA 4HDUA 4GGOA 2AN5A 3S2HJ 2QTFA 2OEPA 1KQOA 2HI3A 1TVKA 4Y9TA 2C83A 2QL7A 1YI0A 2HYGD 1KFKB 2XCLA 3VO9A 4ZD6A 3H1AA 3WIOA 5A7HA 1YRBA 3W6NA 3BVPA 4DSNA 3R3VA 4AJNA 1WO8A 1U5TB 1QZTA 5E8JA 4IZZA 4GEGA 4JC4A 1Z16A 4GM0A 1VXOA 3O38A 1WCYA 5E3OA 1SH7A 1TQDA 3CVJA 1BMTA 3LNCA 4GOMD 4RCYA 4X6LA 5KWIA 1N33B 1QFZA 1TZCA 2GYUA 3DP7A 1GLVA 2H54A 2IW3A 1DP4A 2OXFA 1KZ6A 1GG9A 1J2EA 3MWMA 1E1QD 1AKVA 2WRZA 2WAMA 3OF5A 1BMQA 4PYRA 2F43A 4XGNA 3ZW8A 1E7MA 1GU7A 3DDSA 3LBYA 3JD3A 3DKKA 5G0TA 4MX8A 5D8LB 3Q15C 4PLPA 1Q44A 4AKHA 1D8JA 1RI7A 1IEXA 2VYFA 4KWTA 3UVEA 5F23A 1JHAA 3BROA 1PG0A 1O96B 1UKYA 4CKEB 4POOA 3H35A 2HM7A 3H1BA 3TX2A 3Q98A 1VBMA 1QP8A 4AMUA 2WDPA 3ROXA 3IH4A 5K5QA 4I0BA 3FX2A 3HB7A 2PKEA 3SKYA 1PJQA 4KZKA 1TQPA 5B64A 4QM6A 3C8ZA 2GR9A 4JZYA 1ZNYA 2H1KA 2ZBEA 3DDNA 2HSGA 4BNYA 4MGEA 3F46A 3A36A 4M21A 3F74A 3GR6A 3F8FA 3G23A 3H75A 4GMHA 3CLRC 3Q0TA 1QMGA 2C4KA 4JODA 4JT4A 4FDMA 3U37A 4B7UA 1RTKA 1Z6ZA 4MKRA 1GNPA 5ALOA 4AXXA 1EX9A 2WTNA 2ZS7A 3E5MA 3F98A 2J5OA 1P4GA 5IM4A 4L8LA 2Q5JA 2J3MA 4PNZA 1EHIA 3U1DA 1SHKA 2VDNB 1YB2A 1S1MA 1L4MA 1XYVA 2HCTA 2IZ1A 1T2UA 1MNMC 1MPXA 2H4FA 4LCBA 3M1IA 2W6ZA 3ZJ5A 1ZIPA 4BN0A 4HK4A 4QBHA 1DMRA 1QRAA 3PJGA 3TPFA 2D5IA 3E0QA 3ENKA 1XRNA 4F4JA 2JCYA 2B63J 1PWEA 2XVCA 1S2MA 2JJQA 1RE0A 3KZMA 3QENA 4HH0A 4OX9B 3JQ9C 1Y1LA 2VTDA 3OQ1A 4EI2A 3L0BA 1B93A 1BI2A 1PYOA 4YJHB 3WHIA 4CM9A 3REOA 2WJYA 4NX2A 3ASNH 2PUHA 3FIWA 2C9OA 4K9KA 3RGGA 4ZO9A 3WKCA 4Y67A 2C9YA 2KWIA 1FLAA 4NEQA 4F21A 1H0KA 3DT8A 1YQ9A 4I1RA 4OUDA 1XSVA 3DMFA 1BC8C 1JXAA 3HWX1 5GPBA 3EQ7A 2K5CA 6NULA 5CVTA 2H2HA 3K5PA 2ZMEB 4RO0A 3RIXA 4RIFA 1QJ4A 3TW7A 4CLRA 2V45A 1DXOA 2I2XB 4JX4A 3SZPA 3TMOA 2P3SA 2D74A 2I34A 4NC6A 2AEJA 3ER9A 5COBA 3RC1A 1TZBA 4OQNA 3TNJA 1ZH5A 4XRMA 1RCFA 4TZKA 3ESRA 4O2BF 1GL9B 2JN6A 1N2IA 3ZOKA 3HDQA 1DIBA 2QLTA 1K4SA 2P27A 3TDUC 2I5UA 3M4YA 4GP9A 1AF7A 1UC5B 1UJNA 2NVUA 5P21A 3SJCA 2B7CA 2EWVA 5G1PA 1FSHA 4PZJA 1EFRD 1WXXA 4W8GA 5AJHA 2R8BA 2ZSFA 3N2KA 4KR6A 3LA8A 4PGGA 2WHQA 2Z3WA 3QE4A 4JLNA 4ND1A 4DXHA 3H99A 3IHLA 2RVCA 1FDTA 2O2SA 4Z9AA 3I9KA 5SICE 1J42A 1CQXA 4ZO7A 1K7CA 1T5TA 2V98A 4XN3A 1KRHA 2BJWA 3IAM2 2HA5A 5C3UA 1BHSA 1WR8A 4TYMA 5KPJA 2O2CA 4FGZA 1NLUA 3SNKA 1E99A 4LJZF 4JYPA 8AT1A 3ANLA 5KYWB 1K8YB 1FP6A 2FYTA 2FMYA 3C74A 1UMQA 4O29A 4F06A 2HDDA 4JLPA 3UAOA 3CS3A 2GKOA 4DR4B 2MHCA 3N8NA 1NVKA 3ZQ6A 3DVQX 4MO7A 3RVSA 2VHVA 5JCJD 1I2BA 3NM5A 5K5OA 3S27A 1QO9A 4GSKA 3BR3A 2BKAA 2IZOA 5ADUS 1MSEC 4XMYA 4E7PA 4EPYA 4D7MA 4QHYA 4UTZA 2Q3JA 1MJ5A 3G2MA 4LBVA 5E8IA 1JSCA 5KOHA 4UUPA 2PG4A 1Q17A 4KFUA 4GQIA 5IAOA 4D9IA 3FM5A 4LW8A 1JJVA 1EGHA 2J6CA 4LVUA 3K1PA 2Q2EA 2A9QA 3T06B 1RD4A 4RZIA 1BFUA 3LLCA 4O2AF 4NHJA 3A4LA 3H0CA 3MFQA 1NUAA 1P5FA 1U2QA 3NEUA 1F6BA 4YJ2F 4Y9UA 4KPFC 2XSZD 5A5FA 5CB0A 1E7YA 2PO5A 1T4BA 2Z4TA 2M6SA 1VRCA 2CNLA 1WPQA 2XSZA 3BMQB 3I2KA 4LOHA 3KQVA 4LV8B 3RRBA 4DUPA 5TF4A 1KU6A 3K9NA 1R88A 4MR8B 4NV1A 3MCAA 4I50B 2FSHA 2R87A 3L1IA 4QHTA 3X1MA 5KQSA 3OICA 1X70A 1UWVA 2A2ZA 4LCEA 4WACA 5CA1A 1JS1X 3BF7A 2P7VB 3D4OA 2V0CA 1JLLA 3AETB 4QGAA 4RAOA 3S2FA 4DNOA 4JHXA 4EI7A 3U60B 4HA8A 2JIDA 3I28A 4G0UA 1IU9A 5AI4A 3G9UA 4GX2A 2C04A 2BEUB 4XJVA 2JH9A 4IMPA 3UMJA 3K72B 4J7CA 4ENNA 3FWKA 5E38A 4DC1A 3AHFA 1KWKA 1TAUA 4V0LA 1N6PA 2GLXA 1GPDG 3WAKA 4ZTUB 1MA0A 4XEHA 1H4QA 3RUIA 3W4JA 2B20A 1NN1A 3UEOA 1B9MA 1COWA 2BF4A 3AF1A 1NQXA 5EWMB 5FI1B 4YCJA 5HE9A 2Q1SA 4FCCA 4P2GA 3QA3E 8ABPA 5J43A 2Q21A 1HW2A 2JA7J 1K1EA 2GZMA 3E9YA 3RS5A 2VK4A 4D6YA 4EM0B 3CLUD 4PAGA 2QAGA 3IMFA 2VYQA 3TIVA 4A0ZA 1ZR4A 3ZD7A 1HW1A 4BX8A 3M07A 1S0UA 3T1YB 3GJXC 3GFTA 1KVUA 3JWJA 1SU7A 3M6XA 1GTRA 2B4AA 5IT9K 2FXVA 1M1YB 1A5TA 1DKQA 3M4XA 4CXFA 1U0OC 4MQBA 2DBRA 2ZJFA 1K27A 1XEFA 4RZ3A 5FXMA 3VTFA 4BGIA 4Z4HA 1GVNB 2PMFA 3BGWA 4GC9A 2VVTA 1OZAA 2C9ZA 2B78A 2G7ZA 2J9FA 3F5MA 2QNRA 4DLLA 2VJCA 5CFZA 4MQLA 3WSWA 2PX6A 5AVWA 3ZHTA 5D5XB 3UXEA 4KYUA 2FG5A 5H02A 4QKQA 3VJRA 5E0OA 4QASA 3N05A 1L4LA 1OI2A 1ZK3A 3PHGA 4ZYYA 1U9ZA 2L3DA 2IKSA 1ODCA 4HAVA 3WISA 4MMXB 9ABPA 2JVGA 4RDXA 1E3TA 2WB4A 5CHYA 3HJCA 1T8TA 1QZ3A 5JDCC 4M7PA 2NIPA 2WY2D 5DU2A 1KEZA 2PMWB 2IV3A 3SS9X 3SBEA 4E5NA 2BZTA 1FU4A 1IAQA 3SX0A 5JNRA 5JXJA 4HMOA 1T9GS 5DFAA 1EESA 3HG9A 3B1ZA 1RFLA 2Q3BA 4LX0A 5G40A 4Y2RA 3ZVMA 3QIAA 4HDCA 3LKVA 5KDOA 1FSZA 2TDXA 1EUDB 1IHDA 1FJLA 2OPBA 1A8IA 4CT4B 3QU3A 3KALA 3KU4A 4QLBA 1IF1A 5CDHA 2IRFG 2R7FA 5JPCA 2CQQA 1MTZA 1MOPA 5G0UA 2HLDA 4ARAA 4CIBA 3DMRA 4TVBA 2I66A 4UXIA 3S55A 1YI8A 2CHQA 3IIMA 2FF4A 2HOAA 1L5VA 4P35A 2NQTA 3IXMA 3QE2A 5LEKA 4EQZA 1EKXA 1WBJB 2ZJ6A 2JRCA 2JH3A 3HE3A 5I7EA 2HWUA 2JIZA 1YC2A 3OIWA 3QI7A 2JAOA 1CJBA 2VPXA 3QWAA 1SELA 4PW0A 3PXGA 4R1HA 1T0UA 3DTVB 4OA8A 2YQ4A 4QUIA 2ZU6A 5ESWA 4V0MA 3SVLA 4ZAGA 2L54A 5K7HA 4QYSA 3ZGZA 3K70C 2JGDB 3FYTA 1HW5A 2AKAB 2B30A 3DBHA 3I9OA 1M2KA 3IB6A 3UOWA 5JVTA 1U7HA 2G9UA 5AJWA 1ZUNB 2IXTA 1X1DA 4I02A 1PFKA 3F97A 3KR9A 3QOPA 3LLVA 4LSMA 5BQPA 1FBSA 1D5CA 1G291 4FNOA 3RANA 3RSLA 3S15J 3EEIA 3LHDA 621PA 1WHTA 3MB5A 1ZCBA 4HBLA 4M9SA 2BMJA 4BYYA 3AF0A 3PYMA 2JUCA 3RROA 2VHQA 1UK8A 3T4UA 3UJ8A 1XMVA 4O4JF 5F73A 4MNUA 2Q9AA 2ZROA 5EGOA 4NIMA 3HUFA 5I9NA 1XRSB 3HS3A 3BG3A 1D0VA 3K2QA 3GPLA 2AKEA 5B1AH 5C31A 4AZTA 3G6WA 1JFFA 4MV8A 1E9FA 1HFEL 1BFKA 2JGFA 1PEYA 1Z75A 2YY7A 3B3AA 4EB6B 2XGMA 2CLKB 3SXUA 4DA7A 1AO3A 1O95C 5FD5A 3GPDG 5JMTA 2DW4A 1E1KA 4B81A 4TQGA 3HIFA 2P3OA 2VPIA 4RS3A 2FXAA 1JEOA 2AVDA 4QGFA 1G3SA 5LVAA 3F8NA 1SHUX 1IZZA 2DETA 4BHCA 1OH7A 3RRXA 1FQKA 4CL2A 1TW2A 1IYZA 1WEKA 2LIPA 4IOKA 4H7JA 3I5UA 3U4AA 2H6CA 4EY5A 4KREA 1KK2A 4FZ3A 3QTBA 1FXSA 1KPGA 2H07A 2NUBA 5KWEA 2B8WA 1J56A 3FMVA 4F72A 4YV1A 4Q3EA 4YJ3F 1CRZA 4MUGA 2GA8A 4YUZA 5TGTA 2HA6A 2W6QA 2ZJ5A 5BW8A 2QLLA 3OZUA 1L5GB 4FI3F 1XK7A 2DJ5A 2J0VA 1K79A 2JLSA 1CJUC 4U6QA 3EARA 1TP4A 4IHWA 1DINA 2H08A 5CR9A 4A8JB 4CETA 1NTOA 3ILVA 3C48A 4QDXA 4NQWB 2SBTA 1LLUA 3L8CA 4F0JA 5A5GA 1R8JA 3OLWA 3MLEA 2BMVA 4KB5A 3CT4A 4DCCA 3G9TA 2JSPA 2H6EA 4RV4A 3RSOA 4AF6A 5HUJA 1A35A 5F08A 2VHCA 1C0LA 1U5AA 1KZHA 3ZEIA 1BH6A 3CC4I 1IVNA 3WMEA 5CJ9A 5CVVA 1S02A 2NO5A 4MFDA 4PU0A 2GPBA 4ZCLA 3QEAZ 2PXAA 2D06A 4BX0A 1SR8A 2UZAA 3OQ6A 4MRNA 3RJTA 2Q0SA 4ZCTA 5MN6A 1EVQA 1LDBA 3HXMA 1YA8A 2VPZA 2H31A 4OL9A 4KQEA 2QQ5A 3RC7A 3VRHA 5IXYA 1LDMA 5EJ6A 2HO4A 3QRWA 1XZHA 1JXMA 1BE0A 2BI8A 3CKMA 1P4HA 5TPWB 1EGMB 1GUDA 3PUIA 3S99A 5A1JA 3IBYA 3IGFA 1QRYA 1ODDA 4YPFA 2ZB2A 5FPKA 1LA2A 2QDKA 1CKEA 3AKDA 4N40A 1RYDA 1X8LA 3AFOA 4RSMA 4JI1B 3BQNB 4CKCA 4FS3A 1LWNA 3O75A 4PZPA 3BAZA 3I4CA 2GEDA 5AI6A 5BN1A 4R1UA 4Q48A 4D9GA 4BE1A 2QRVB 1ZN7A 4ZV9A 3BGIA 1PN3A 2H16A 1J09A 2XADA 2QD3A 1KGDA 4LC1A 5DO9A 4WZBA 1CFJA 4Y1FA 3IIKA 1DBVO 1RYFA 1ZRMA 3TZCA 1JA1A 1HV8A 5EZSA 3VYWA 3DMGA 1BR4A 1RYEA 4KN9S 1RQ2A 2LFBA 2JJMA 3TRIA 3QH4A 3UAGA 5KU1A 1XQVA 1J33A 2D4AA 2X8JA 4KMUX 1C4XA 2OBXA 4NPCA 1M1NB 2WYHA 2W5UA 4IDHA 1L5YA 2HB6A 3CB4A 5CQGA 2IPNA 3OY9A 1YE8A 1QA6A 3HVJA 3N59A 4G6TB 1T5OA 4X7BA 3T8YA 1LLDA 1TK2A 4LQLA 2PJDA 3I64A 2ZKZA 3QX9A 2YPRA 1IY0A 5EGOB 1V39A 3J80K 2GNOA 2RHBA 1RI4A 3HP4A 4HRYA 4CIVA 4I8DA 1Q3TA 4NABA 4W4TA 1J49A 1D0IA 3VH4A 4ITRC 4OMFG 3UMRA 1GQRA 1NDQA 3RYTC 1JFRA 2HK6A 4ZQGA 1FRQA 4XCVA 4C3OB 4MVYA 1KHTA 4RH0A 4CN9A 2OAEA 2EFQA 4XPZA 3HKZA 2M87A 1WJDA 1CY1A 4RVCA 4EG3A 3CLSD 2PCLA 1DOZA 4K46A 3ERCA 4FIDA 3PD0A 4NRDA 1TJ5A 4PUSA 2PMKA 2X2PA 4WNAB 3OMYA 3DLTA 4DMRA 5CFRA 1M76A 4HFRA 4EA7A 1DGWY 3IVCA 4XM2A 2WADA 3AF5A 2OHXA 1P77A 3NBYC 2G0AA 2X5NA 4GX0A 2G09A 4M54A 5EY5B 4ZJUA 1F06A 1ENHA 1SD1A 3OX2A 3OOYA 4I9HA 2DMQA 2JQ7A 3MQ4A 4PXYA 3K9BA 4I14A 4Q3NA 4Z6YA 2XMRA 3ZYCA 4TXMA 1S7CA 2ACWA 2PWPA 4OKNA 2V96A 2BYTA 2A9JA 3IERA 1JAXA 3TG8A 1E66A 2GZ2A 1Z6XA 4LE0A 4ND8B 5BW4A 4CQNA 3ZI7A 1Q0QA 2O8CA 4DW8A 3DWEX 3PFKA 4IXMA 1NVMB 2J5RA 4NS4A 4PFKA 5LC1A 1IRFA 3AG1H 3L7YA 2YJ6A 1USWA 1NUTA 2ZWMA 5EGNA 3BMNB 3DR3A 4JI7B 1E1NA 1XMJA 2GBLA 2LC2A 4WXCA 4A6DA 5BVHB 1ZM3A 2XAQA 2QVLA 1UZCA 1FS6A 4OGLA 1HKSA 1ORRA 4Q7LA 4U7TB 5KPDA 5EZYF 2FN8A 3F67A 3KEGA 4KXQA 4DDWA 1XL1A 4LK1F 3HVHA 3Q3VA 2ZSDA 4H4DA 4X1OA 1GSAA 4ZP1A 1VPDA 3OYIA 4PY2A 5KTOA 3V55A 1LD3A 3O6VA 2OD9A 2EJRA 4KVGA 4D8TA 1KRXA 2WOOA 3GWZA 3ESBA 1X2EA 3D0QA 3GUCA 2DRIA 1SIWA 2XXAB 1TCCA 2OQGA 4I3HA 2WKPA 3LC2O 3IXLA 1TJPB 3ULKA 5K0TA 3TZKA 3TNYA 4MWZA 3K1YA 4P2BA 3BCAA 2LSOA 5CLSA 2F59A 4GW3A 1VGRA 4Q1AA 4W6ZA 4WNCA 4BQPA 1ZVVA 1DOAA 3N9IA 3ML6A 1BA2A 1P61B 3B5JA 2CBXA 1OJLA 3DFFA 3BFPA 3MNFA 5K20A 5AICA 3IH5A 2CS3A 2AJBA 4K2AA 3CDLA 1XZIA 2H0QA 2SKEA 3GEHA 4BB5A 2QNIA 3MTBA 2OJED 4N3NA 4D3SA 1ABEA 4C4ZA 5K09A 4LJSA 5JS8A 1KYIA 4LGMA 4NZYA 3GZ5A 4QOSA 4Q4DA 3LUHA 3S29A 4J0EA 3KZ1E 2YOFA 1ZN8A 3K1JA 4B5KA 3RRYA 4C03A 2O8FB 1NASA 3NM4A 3V8VA 3NARA 3RS9A 1NNSA 4OB6A 2ABWA 2HDNB 3EGOA 3O9VA 5I5EA 4ZRDA 3EPLA 1MC1A 2DLDA 2V7TA 2VXCA 4JJ8A 1BWQA 3U3DA 2AOWA 5HWSA 2B8EA 3E9QA 3OPQA 4LZLA 2HPZA 4WLOA 4BNXA 3IDQA 1CUCA 2F6RA 1WW3A 3VPFA 1OGJA 1MZVA 3KZNA 2J46A 4R84A 3RVKA 3PVZA 1SCBA 1G2QA 4ZXFA 3GT0A 4D02A 2UYCA 2ZNYA 2BKEA 4IXDA 5A3JA 1CCWA 2OFXA 2ONYA 3G8BA 4J0IA 2VTEA 4OI4A 4L50A 4QDKA 2IYVA 4MR8A 5ER6A 3VC7A 3ZWYA 1W0KA 3TZLA 1TAGA 4OH1A 3E0XA 4JY7A 3WP1B 1JPJA 3DMTC 2Z99A 4JQOA 3GUDA 2XUHA 1CUGA 1PQYA 2M2EA 2M98A 3QQ5A 5CBPA 3VPCA 1TVKB 1HDPA 1V5GA 3CUEF 3KR2A 1MX5A 3LUJA 4L07A 4W1PA 3LVRE 4X8HA 3EXG2 3UYKA 1YZNA 3TQFA 2PUBA 3PX7A 3U5TA 2E60A 1D4ZA 1E5DA 1JILA 4E15A 4RTRA 1JAYA 2JASA 1XALA 2P2GA 2VH5R 2ZR0A 3KTOA 4I6GA 4PIMA 3RUPA 3WB2A 3TOXA 2CXOA 4CLRB 3VI3B 4WBNA 4CUGA 3IBTA 3GG9A 3KQOA 3AI3A 3IULA 2VN8A 1GGEA 4NECA 4K81B 2FJ1A 4C6TA 1L4YA 2ZK7A 1L3IA 1W5FA 5CTAA 4KWCA 3STUA 3KU1A 2QUJA 5F2OA 4PRKA 1UEJA 4MGKR 4BCCA 3N7TA 4D4MA 5KTTA 3KHKA 4LHEA 1JQLB 4GG1A 5IF9A 1HA3A 5EXPA 1GTL1 5KAPA 4RSGA 3CZRA 1YOVB 1UJCA 3H1FA 3DL4A 1HG0A 1P8JA 4RPCA 4ANFA 1U0LA 3IQZA 5BRAA 3QVTA 3ELDA 1EZ1A 1LK7A 2H0RA 3DA8A 1BFDA 4GOND 3RI3A 4EJ0A 1UZUA 4LSGA 1KOJA 2Q0OA 1ZGZA 5KC9A 1RWXA 2G8NA 2Y69H 4W9NC 2CFCA 2RE8A 2CEKA 4NWIA 2Y05A 1Y3DE 3P5SA 1J5EB 2XF8A 2JZYA 3SHFA 4MDYA 1N2ZA 2FMIA 2LK2A 1A5ZA 1L0OC 4Q3OA 1FF9A 3RRFA 2V58A 1JXOA 1MORA 5B4UA 1ZZEA 2X6TA 4RD6A 1OCOH 5DXJA 4PJLA 1XZKA 4Q9NA 2PX9A 3E27A 3VOSA 3CGGA 3LGAA 4A3BJ 4PPFA 1HBXG 3EDQA 1MMNA 3VSEA 2XIQA 1N0UA 3S7ZA 2I71A 5ITSA 1VA5A 1Y8QB 3L93A 5NLLA 4BQOA 1DKLA 2FQWA 1KFBB 1ZITA 2P90A 3A9UA 4KR2A 4KI0A 4X90A 2FPRA 5JU6A 3WRYA 5CLFA 1LSOA 2BP7A 5JWHA 2GFHA 3CB2A 4P1WA 3B5EA 4XVUA 2MGQA 1IXSB 5EVCA 1KOFA 3BA6A 3S8MA 3I58A 4CMEA 4MHTA 2Q29A 1OLTA 1C9DB 1H2ZA 1TADA 3ABLH 5JJCA 2AI3A 3QVSA 4GICA 3UJCA 3VR5D 2VJNA 4EJSA 3AI2A 3I39X 4IQ8A 4Q6BA 2AC2A 4HQRA 4Q05A 5IVHA 3QELB 1DP7P 3E2PA 4OM8A 1BX0A 1DV2A 1IAWA 3S3OA 1MB0A 2DHQA 3L82B 3SHTA 4PM4A 3DD1A 2F3PA 4EM6A 5JADA 4RVGA 3LSHA 3QELA 1KOLA 3PBKA 5FQNA 3WA7A 3IR5A 1BM9A 2CW8A 1HKTA 3G71I 1BMFD 2N0SA 2VBWA 2X2FA 3CH6A 3CE6A 1H2EA 3OE4A 3LSKA 1ZBQA 1JHPA 1TYBE 2IOHA 4H59A 1E6UA 4BIIA 2QJRA 4DIOA 3HOTA 4GAEA 2VBFA 1BR1A 4ENQA 3KJIA 1JQ3A 4DG9A 4TKLA 1A71A 1DJQA 1IONA 1XMPA 2H0AA 2J3QA 4TYNA 2GA2A 2QV7A 5IASA 4GOJA 2GD6A 3LPMA 3F8WA 4F9FA 2HKIA 3U3ZA 2WJ4A 2MJLA 3CLTC 4G8XA 1R58A 4FYHA 1AUVA 2YYYA 4EGSA 1Y33E 5CLJA 2H1HA 4NBSA 2Y75A 2QBYA 2AE1A 1XBTA 4YQFA 1GSOA 2R11A 4BP1A 5AWFC 2YZMA 2HXOA 2O0KA 4B35A 1T0BA 1Z6GA 1FY2A 3L4KA 2O7VA 2JIMA 1T13A 5CYOA 2X6RA 4ESJA 1L7QA 4F4UA 4BWFB 4DCGA 3R24A 4LWZA 3TGPA 1P9QC 1KMNA 1V25A 3LA3A 1G18A 2DWUA 2NSYA 2R4UA 4TTAA 3R4VA 2WFLB 3RTDA 3VV3A 4MICA 1Y5MA 4TLEA 4REMA 1QUEA 5DK4A 2WQZA 2JARA 1TU0A 2Q8PA 4DMLA 4IO0A 4RVFA 2Z58A 1P75A 5J40A 3AQIA 4HQNA 2IHUA 4A1FA 4Z7NB 4CKWA 3WU2C 1P92A 1U4SA 2H17A 3KAKA 3M6WA 3PQDA 2XNCA 1A5SB 3QKIA 2JI7A 2IF2A 1GAXA 3ND9A 4TV8A 3R7NA 3FRIA 3RH0A 2PCJA 3COPA 3DT9A 1PW7A 3WWYA 3ZZMA 1YKFA 2QQ0A 3PS9A 3GGGA 4RK4A 5GV8A 3RVOA 2CHUA 2Z9CA 3SPXA 5JC1A 1IXZA 1WDLA 3JVDA 4IAOA 4A0SA 1UINA 4BXOA 2LKPA 4ZMBA 3EEOA 4DHEA 1YHNA 2OB2A 4NTZA 4W5NA 1JALA 2MR6A 3OQHA 1O54A 1YYVA 2UVDA 2H9IA 3B52X 3AVPA 5HILA 4E5VA 4G4SP 4O2BB 2P8TA 3WL5A 2J3HA 1ENOA 1JPVA 2VKVA 3V8KA 1E9RA 1S2IA 1WUYA 2C00A 2XUAA 4O4LA 1SFEA 4J0HA 3CESA 1H0MA 2AI1A 5TRTA 3ZDBA 4H6VA 2B0LA 4OHYA 2ZM6B 2IU3A 3JVEA 1RCTE 2GXGA 4YRBA 1ADCA 1D1AA 2MU1A 5DLQC 4MR7A 3T99A 2PPVA 4MCAA 1PNTA 2X22A 3MT7A 4MUYA 2QPAA 2RBGA 2GEKA 4E33A 1WGXA 2GAJA 1V55H 3F96A 4FGJA 3VSCA 4QODA 3TSYA 5KVAA 1J7JA 1W0KD 4Y1GA 5CT9A 3VZBA 2VHJA 2X1VA 4B47A 1HT3A 3AR4A 4J2HA 4ARBA 1XG5A 2I4OA 3WR5A 4XVRA 1Y3HA 3B1WA 3EQ2A 3RB8A 4DILA 3CCEI 1XTIA 3C70A 4DQVA 3WK6A 1V9CA 3L7MA 3FHZA 2RHGB 4MZDA 2Z1DA 2IV2X 2CMDA 3WNBA 3B13B 3BHIA 3G13A 5JG7A 2BYVE 3SQOA 2OZPA 4BGEA 2OHIA 2RK4A 3KZCA 5A9SB 5SYNA 2UVPA 3I72A 3PC2A 4EY8A 5DGDA 4RHYA 1QZZA 1AQNA 4LFBB 1EVIA 4QJBA 3GLFA 3D81A 1U7PA 2I7XA 3OY7A 2QSYA 4EFKA 4B76A 4A73A 3KVRA 1NUUA 4Y52J 2IYYA 3C0KA 4L72A 5AOBA 4W5QA 3LT5A 3EVBA 5D86A 1HETA 2QB5A 1L3BA 3R9WA 3IKVA 1DP3A 3KUXA 4JX9A 1RC0A 1NQOA 4ZVMA 2I54A 2QQFA 1TOAA 2W2NA 2R93J 4JJ6A 1DUVG 2YSRA 2AXNA 2PKWA 3DWGA 1E2EA 3DKRA 3BJEA 5D6OA 5FKMA 2Q0QA 4PQGA 5IRCD 4NICA 4HLUC 2WK1A 4JFAA 3DGEC 1ETWA 5JLWA 3HGYA 3LYLA 4L2IB 4PGFA 5C8DA 3OEHA 2PBIA 3Q7TA 4G65A 4YO8A 1DEAA 1YZVA 2UYGA 4B6JA 5FH9A 3ZH9B 1UJ6A 4JUBA 3ZXSA 1N0HA 2BC9A 4NYJQ 1K7AA 2DOEA 1KZYC 3PT9A 4LY6A 4AP5A 2M4GA 1UZAA 1YU6A 3AVWA 2OTLI 2IOYA 1MFPA 3K2AA 3F1KA 1Y82A 3HY4A 2QT9A 3MMZA 4IUBS 1LJ9A 1ML4A 2I22A 1YJWI 2J9YB 2VSYA 1EP9A 3JATB 2ZJQF 1RXYA 3QXHA 1HWYA 4N7JA 3U4CA 4DMMA 5CEJA 4QSHA 1RACA 2AE2A 2I8LA 4FOOA 5KYVA 1V8OA 2K4BA 2WFAA 2PGLA 4C3UA 3ZXIA 4P9UA 4A93J 2YHAA 4JLAA 3L2VA 1YR8A 1RIOH 3CEAA 4QU0A 2M6LA 4X7PA 3KJGA 2H8RA 1AK2A 4B45A 1E9AA 1BROA 4RETA 4YFKF 2YIDA 1B1CA 5B66C 4HMPA 3TLMA 2MABA 1SWWA 3F5DA 2WF6A 3K94A 4RB0A 1S2LA 4X45A 3WU0A 3LUKA 4UULA 5G02A 3SS8A 5LNK6 2ZB9A 3OQOA 1VBFA 3B9PA 3PL8A 4XR4A 2ZPUA 4QLOA 2PS9A 4UMEA 1QPBA 4W63A 4ZV4A 1JIIA 3DTYA 2JDID 1SCNE 5E20A 1C7QA 1H0HA 3F9RA 4GZ3A 4XCXA 4LZNA 1OUMA 1P4AA 1EDDA 4ETNA 2JUGA 2OM6A 3LGSA 4KI7A 1ND6A 3PFIA 3F78A 4H15A 4J1NA 1LVKA 4R8SA 4DJAA 2V6BA 1BE6A 1CQJB 1ON2A 1X14A 3DOCA 3KT6A 2M5WA 4XQFA 5AKZA 4CQMD 4BLSA 4EF6A 2JZNA 4HH3C 1V11B 2PE5A 3F72A 3KL4A 4J3FA 2NACA 1G9XA 3L05A 1CF7B 3KV1A 1E2MA 1OFIA 1P18A 3PHJA 5B3AA 5FEMA 2TRSB 4BLOA 1VYUA 2VUTA 3AERA 4LTMA 3PWKA 4PX3A 4XGKA 1WVIA 4X8MA 1NRXA 4EH1A 3I9JA 2ZIUB 4GSYA 4CEJB 1JV2B 4PLWA 2HA3A 3ON5A 1NDHA 3FYUB 2DHEA 3MWJA 4UMDA 1ADYA 5ALXA 4HEHA 4CDRA 3KOZA 3CVVA 4ILEA 1QYVA 3SG0A 1U0BB 5IDXA 5JJBA 3L18A 1HZZA 3O26A 3GLFB 3HKDB 2IHTA 5H4HA 4GU5A 4TWAA 4KIUA 4Q01A 4OUDB 3KKKA 5HOEA 4QYXA 4UUTA 1ANKA 3RFVA 3O1LA 1I27A 4YJHA 2O4CA 3H6KA 2ZUTA 3ZBTA 2UUAB 1PJLA 4ZJZA 2VOPA 2FUNB 1VP3A 5EINA 3AVTA 2BY1A 1Z36A 4LNUA 1L4EA 1UF9A 3UJ9A 1RPJA 2D5AA 1NBAA 3I2IA 1PTKA 3GFBA 3INYA 3NNNA 4JOBA 2OA4A 4WZAA 1O2DA 2J59A 3A6FA 3C16C 4L85A 2HHJA 3NH9A 3FGZA 5CNKA 5DIFA 1COZA 1SD2A 3PDCA 1FTWA 3WQRA 5KTKA 5E6RB 2V55B 4PJNA 1B2RA 4ZREA 5IVPA 2W82A 3BZKA 3BF8A 2CBGA 5SYMA 5CA1F 5JRJA 1IZ1A 5CQEA 2HF9A 4BDZA 2ZJ1A 3O2QB 4IHVA 1SXJB 4FYYA 2IPOA 3GY0A 4HXYA 5AXBA 3J80A 1XAIA 2R5WA 5AKHA 4DREA 4ENTA 1L4NA 3LSJA 4CMBA 3K9TA 2QENA 1V37A 2ZR9A 3SZMA 1D8KA 5DXAA 1YTUA 4AB1A 1R0YA 4KHPB 1AKTA 3DMPA 2DMUA 3H8WA 4AU1A 3AJEA 3A3NA 5I9TA 4ZVTA 2CQNA 2M30A 3G9XA 2AC7A 3MGCA 4LZJA 3JY6A 1X7HA 5ERGB 1C9KA 4A3MJ 2MFZA 2EW8A 2G70A 4H7KA 3DFIA 3LMKA 1MW9X 1X8XA 2NAZA 1REQB 1VIDA 2JEYA 5DM4A 4UM9D 3SLGA 3LHFA 4ABTA 1O0CA 1YXMA 4IJ5A 3NV7A 3CX4A 2WBMA 3SE0A 3T52A 2L2OA 2G5CA 3T3GA 1ZTRA 1PDVA 1YDHA 3PA8A 4DLKA 2JAXA 4O2LA 1SUWA 4WX9A 1UXHA 1C9MA 1OLOA 1XD2A 5J2TF 2EGHA 1MDFA 2W9XA 4MWDA 5JYCA 1IIBA 4NU0A 1RJ9A 4S1TA 4BLWA 4N4OB 3CD6I 4F5WA 1T4CB 2X9NA 1RW4A 2E36A 5LPNA 2WM2A 1HMPA 1BCSB 3CXRA 3TKLA 3ZWWA 5I7OA 1SUDA 4K6GA 2VT2A 1CEXA 3T38A 1W34A 2M32A 1FVOA 2CD9A 3REFA 3TVTA 2LD5A 2IT1A 2PX0A 4HDRB 4R5MA 1NRWA 2YN2A 2IP2A 2C4TA 1BDMA 4E6EA 1K6XA 3MAAC 4BV9A 4FQ5A 4MKZA 4B6RA 1EH7A 3LI2A 3GRYA 3B3JA 2UUPA 3L8DA 1D1TA 3MJHA 4KQJA 4LBWA 4PYLA 4RH3A 4KDRA 4UDOA 4E0BA 4A91A 2PH1A 3S8EA 4B3MB 5LHIA 1UXIA 2Q3LA 1C8KA 3FXKA 1Z2AA 2HHLA 4H6PA 5BUZA 3BR0A 4Y2GA 2WUGA 2VN2A 2KIFA 4WWCA 1HOTA 1VM6A 3A6ZA 4P93A 1EXWA 4FN5A 4IDCA 2IP4A 5FBHA 2AHQA 3AY0A 4IV8A 3VAAA 3BMCB 1NQTA 1PV2A 4O4IF 2EFNA 4EG4A 1K68A 2ZJ7A 3SDZA 1QHHD 3WHBA 1L5MA 1GPAA 2R7DA 2GZDA 5HNFA 2IYUA 3AW9A 1LC0A 2F5EA 2F4NA 4O4HB 4QBKA 4ZANA 1K3FA 2DB3A 1T5IA 1VPTA 2VF4X 4PO9A 1E6WA 1SUFA 2NTYC 3WL8A 4YMSA 1XV5A 2BFDA 4D0LB 2AFHE 4Q3AA 6ABPA 4RFSB 5C3EJ 3LA2A 1NXVA 2ET6A 2ZR7A 1D2CA 1SVIA 3C14C 3L1HA 4JYCA 1BBYA 4E30A 2IBTA 2LVSA 4XOTA 1YZ3A 2VR1A 4RV9A 1O4XA 3KTFA 3ZE8A 4ALIA 2XGEA 4MCJA 1PWXA 4M3DA 3S2UA 3D1LA 1SN7A 3F1LA 5DLDA 3J7AC 5AIAA 5E1WA 3NZEA 2C88A 1G6KA 5CKTA 1JJ8C 1SQFA 2PS3A 3H2JA 2VLBA 3M6MD 4B4UA 4AKSA 4WNYA 4YP5A 3W1VA 4QIHA 1P1BA 1IRIA 1N6HA 2FQQA 1WY5A 2VQHA 1V5FA 2R5ZB 2CK3A 4E4HA 4NEHB 4P4SB 2QMHA 3DU5A 1NF8A 4UQOA 5ANRB 1ADFA 1I5RA 4LDNA 1JMYA 2P3QA 3BWMA 2ZRMA 4L08A 4GE3A 3ZE7A 1YDFA 2P2YA 4DIMA 3EGDA 3KJNA 2TYSB 1X8KA 2PTGA 1QIFA 3MOIA 2CJJA 2RIRA 2YFQA 1KQ8A 1T8PA 4IIDA 5EPEA 5H1YA 1LFBA 1ZAOA 1IPFA 3C3DA 3S2ZA 1EDZA 4GKKB 1VJGA 3QPWA 2NV0A 1XMXA 2P6SA 5KCMA 4GT1A 1G59A 3CRW1 3G02A 4JI4B 2EVWX 1CUFA 4TTSA 3IEKA 3PDUA 2IHVA 5J1TB 3HGMA 4D41A 4KV7A 1KO8A 1LI4A 2QMZA 5T4BA 3AG6A 1YJAA 4AMVA 1RQGA 1W5SA 1Z88A 3D6JA 3SC6A 4UCWA 1E2KA 1XDGA 5EHQA 5HJ7A 4EVIA 2P2SA 3BKXA 1XEXA 4JU9A 4OP2A 3ROUA 3D2AA 1ZRCA 1N9KA 3ETCA 1E3HA 1U1FA 2F5FA 3D1VA 3E9MA 3GYHX 1NJ1A 1LFUP 2WTMA 3LPAA 1X3ZB 4HGZA 3IPXA 4F56A 4F2HA 1S89A 2DH5A 2V7VA 3DDOA 5ULLA 3ZX5A 2XXJA 5EJ9A 4O4HF 2KE5A 3MT9A 5DRYA 3RBZA 4UU7A 3DHNA 2XCOA 3BMCA 2ZTLA 3ETEA 1BGXT 3MWLA 4HDMB 3ANXA 1PYGA 4TUYB 2ZZNA 5L3QB 3HOXJ 2DPYA 2OORC 5CVRA 2XRMA 1KEPA 4Q7EA 1WZUA 1BWPA 4XH9B 5F7OA 3T34A 3VKWA 2PZAA 1E62A 3D7LA 3SDGA 2WTBA 3LWBA 3O8RA 3KP3A 1O6ZA 5BPHA 1KHHA 1RZUA 3QVLA 3HJEA 1BXKA 3E4CA 2P4WA 1DJLA 1XYGA 3C8HA 1L4UA 1ZOIA 2EW1A 2PGNA 4FOSA 5U4XA 3QOXA 4C06A 4D46A 4EEZA 2VQSA 1AMOA 2Y1WA 2X5OA 1BRTA 4J7UA 1R50A 5CCEA 2FZCA 3EFBA 3UUGA 1MIOB 4IXWA 3NP7A 5HZKA 2M1XA 3T7AA 5F3WB 5K2OA 3DTNA 2DOKA 4LV5B 3V6LA 3ANSA 2CZQA 5BQXA 5JAPA 4S1NA 1EUCA 5CRIA 3GJQA 4ALLA 4B8ZA 2VJDA 1DNPA 2QTWB 1N36B 2J31A 4M3NA 1EDBA 2NVXJ 2FR0A 3CMEI 1L0BA 5ENDA 4R83A 2WU4A 1TKRA 3GMIA 3KAJA 3GFJA 4IR7A 4XYEA 1NH3A 3V5NA 3H05A 5JH7B 3G0HA 2Q6KA 5EJGA 4LY3A 4EVQA 3IAHA 1A4RA 3FPKA 1PVEA 3M5DA 5AYVA 5AOCA 3OT1A 1WUTA 1S8NA 2CXNA 2WILA 1OCPA 3H5IA 1CX9B 3MN2A 2PMZA 1RYYA 3CYFA 2VBCA 5LYJB 2CWWA 5E4FA 2M0CA 2E35A 5IN4A 3H1CA 2TMGA 1E3PA 5AIQA 5BMZA 2PSSA 4GUAA 5FOWA 3B6ZA 2O5CA 2BFBA 2KPMA 5DE3A 1Z15A 4HAIA 1WSDA 3ZQUA 4E07A 3QEOA 5K4HA 1V3QE 1H9CA 2HQRA 2WAOA 5D5PA 1KZ1A 4W1RA 4DSZA 5TGDA 3WGNA 4F9EA 3L7KA 4TUYF 2KS6A 3AR8A 4NBTA 1UBUS 1VQ9I 4CI9A 2GYYA 4MI9A 1QH1B 4BPRA 4MUIA 3I0ZA 2F4OB 4GD3Q 3MCTA 4IFBA 1D1SA 1YFZA 3B9QA 1OCZH 3FHTA 1LY1A 4E09A 3UO8B 1E9BA 3QITA 3VPHA 2I1LA 1RPTA 3E9CA 1SEPA 4EX7A 5IFKA 5KCZA 1GSIA 3VHQA 5EF6A 1YBAA 2NO6A 3VUFA 4LCJA 2E87A 1ZVJA 3DYIA 3R9XB 4DT1A 1WSWA 4WASA 4PYQA 2R1TA 2Z2SB 2W6NA 4ON9A 1RKUA 3AL0B 5AIBA 2OM2A 4J29A 4KSCA 1Q11A 1IUOA 4ZGBA 1QFXA 1T1GA 3M6LA 3E97A 1A2OA 3BMNA 4D7AA 3AIKA 5KNBA 1I3QJ 1PLLA 1SXHA 4PHCA 2CC2A 3PHHA 4I1VA 1GFWA 2VOOA 2RGGA 2ECBA 3ZMVA 3SF8A 3ZW9A 5C7IO 2CMHA 4AYTA 4F93B 2X2EA 1T9GR 4B6EA 1B6TA 1AN0A 2Y3IA 3PNKA 4ZYEA 4RF2A 4II7A 2Z95A 3VHLB 4KXLA 3HOVJ 1BW5A 4WK0B 3OSUA 1J2YA 1GPBA 1RU3A 2DBYA 1TX4B 3DBRA 4D44A 1KWGA 3EG5A 4YXWD 1UPCA 2COUA 3CFYA 4YRFA 5A6SA 3PFFA 5ALIA 3BYZA 3S1RJ 1Y7PA 1ZMXA 2VTBB 1O03A 1WY7A 4MFEA 1WCWA 3H2SA 3KT3A 2FWPA 4JEIA 2IZ6A 2D1HA 4UMFA 3DPTA 5F0FA 2A1IA 3NHBA 4U8GA 1CQJA 4FHEA 3X1JA 3QEJA 5J1SB 1NXSA 3DVAA 2X3UA 4GR5A 2R0QC 1ZSYA 4TQAA 3PXAA 4IHJB 1QWOA 1N2SA 4QYTA 1VL2A 5C5DA 4DKJA 5L3GA 2N9UA 4EFDA 3FLEA 3I9V1 3QVKA 4GXQA 3HCCA 3CCSI 1GA6A 2O6LA 2QRLA 4XJSA 4WHMA 3T3PB 4BU1A 2IYAA 3DFMA 3TTVA 1I4WA 3WJ2A 2DE0X 3CT6A 3N53A 4PZAA 4DY4A 3EXEB 4M8KA 4HYYA 3T9DA 4QC2A 1OV4A 3WNDA 2GJSA 2PKYX 4CL3A 1QU3A 1JEJA 1RLOA 4JITA 2JAUA 5AP9A 5IC6A 3RREA 4FWTA 5M7EA 4JWTA 1EIZA 4O02B 1KO5A 4BZWA 1T95A 3JRAA 1NBMD 1QZUA 2Y1GA 1SAUA 4B7CA 4CG2A 4B4WA 4GPTA 1J0AA 2QP9X 2ORIA 2JFZA 3UWOA 1WXQA 3HJRA 1ULYA 1E5QA 2DMPA 5HW0A 5MHTA 4NCNA 4B6QA 2E82A 4EDFA