1KZHA

Structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
550
structure length
550
Chain Sequence
SLFKQERQKYIPKLPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEMIQSRLNDMKKRGEYKGSFTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKPTDWIAGGVPLTMLMNMEERYGEKKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLKLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Transferase
molecule keywords phosphofructokinase
total genus 197
structure length 550
sequence length 550
chains with identical sequence B
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Phosphofructokinase; domain 3 1kzhA03
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kzhA02
1WEHA 4RH3A 4I36A 2HIGA 6PFKA 1S2DA 3O8OA 5ITSA 3O8NA 1S3FA 4JELA 1PFKA 1RCUA 3HNOA 3UQZA 4MEJA 4FYKA 4LJKA 4OHRA 4LJLA 2PMBA 2F67A 4A3SA 2Q4DA 1T35A 4I7EA 5AJTA 4JENA 1MTOA 1F8XA 3O8LA 2IZ5A 2KLHA 4KXMA 2IZ6A 2F64A 4OHBA 2KHZA 4WL0A 3K2QA 1ZXXA 2Q4OA 1F8YA 2NX2A 4U1RA 3SBXA 4P5DA 4KXNA 4P5EA 4HX9A 5AJUA 4JEMA 2A0KA 4FYHA 3EHDA 1S2LA 3U39A 2A33A 2F62A 3QUAA 1YDHA 1S2IA 1WEKA 3F5MA 1S2GA 3GH1A 4FYIA 4LJRA 3OPYB 3MAJA 4MCJA 4KXLA 4PFKA 3OPYA 3PFKA 2F2TA 1KZHA 3BQ9A 2F48A 4NPAA 3IMKA 4I4IA 2IZ7A 2PFKA 3O8OB
chains in the Genus database with same CATH superfamily
4E07A 4IF4A 4ISBA 4XJXA 1XNJA 3BTOA 2DRIA 3GIWA 1JHQA 2RGVA 1XVAA 2PY6A 3LUJA 5B36A 4BE0A 2QWXA 3A27A 1DEOA 6PFKA 2M4KA 2NS8A 3ZE2B 4L18B 1VMEA 1L7QA 1JDVA 1KONA 4FZ3A 4MV1A 1FTQA 3WL8A 5GAGJ 3V1MA 4E15A 3S2HJ 1DJLA 1LPAB 4K6GA 3TTXA 2EBIA 2X6WA 2CBZA 2J5XA 3S29A 2CSOA 4F93B 1CZNA 3ZWNA 5ECGC 1JBKA 3SCZA 2R48A 3KYBA 4A03A 1J9IA 3IHUA 1RIFA 3LUFA 2R8RA 2W2QA 3HUTA 4A6PA 3GW2A 2C2GA 2ZQZA 3GFFA 1YOVA 4YUWA 1GGNA 1ESCA 4KRGA 2M7AA 1TQIA 4BASA 5EESA 1W581 2REQA 2WTXA 2UYCA 1Z6XA 3U4QA 1IMOA 1R9JA 1E4YA 4MUBA 4F7DA 4XKCA 1LSJA 4MVJF 4CKZA 2Y0PA 5EIEA 1T6BY 3SVTA 1VFNA 3F4BA 6REQB 3WL4A 1Q77A 3V1TC 1DQYA 3SGLA 1NTCA 3A2LA 4NC9A 2Q4TA 2XHZA 4OB7A 1YE8A 5CM8B 2BFNA 4MUHA 3BOQA 3O2JA 1DWPA 4R1QA 4L15A 4MTDA 1X7GA 3WLPA 1MRZA 3EAQA 1KEKA 2ZETA 4KTTE 3PRJA 4WGFA 1SPXA 2PRJA 2B61A 4IS2A 4TZTA 2KJBA 1T91A 3A3YA 3AB3A 4JJFA 1DIRA 3VMFA 4H9GA 4IR7A 1RXIA 1SHLA 1WM1A 2NZ8A 4PDKA 2XOKD 4KXYA 4LVCA 1E3TA 4WNIA 1Y39A 3H97A 1JR3A 1BW5A 4YRQA 3NKVA 4HV4A 3GNQA 2X7XA 2XE4A 1JLRA 1XVVA 1FIPA 2VPIA 2EKBA 1C3LA 4LE2A 2Q4EA 2ZUDA 1EDBA 3LNCA 5HG0A 4RVFA 4PSDA 1Z8NA 1TUBA 4UVIA 3TAXA 4MDEA 1GG2A 1RWWA 3TBIA 4QWQA 1WTCA 4MICA 3M3YJ 4F06A 3I4PA 1K78B 2E55A 5JNTA 5KNBH 1E89A 4TQGA 2C7BA 3AETB 4ER7A 3CN7A 5K6AC 1C8LA 3H2JA 2MG4A 3GBGA 3ANTA 3L49A 5IG2A 3ZLBA 4HWSA 4LS3A 1ZONA 1OXBB 2GXQA 3LOQA 5EHIA 1DRJA 3QOYA 4A16A 1QX4A 2JFVA 1JXAA 3BF7A 4V0OA 5HRUA 5E3OA 2H4JA 5CFQA 1IBRA 1GT91 5FUYA 3KP5A 3K69A 3D5RC 3GLUA 2HK6A 2XMDA 2D8AA 4IEFB 5IC6A 1E5DA 1DPFA 3II6X 5CD1A 4ZC3A 1OLUA 1VB3A 2RQQA 1BCRB 1XTQA 2SCUB 2WYUA 4I6GA 3ZU5A 3WYDA 5KQSA 4DLTA 4UAJA 1Y8RA 1WWKA 3CVWA 1DGWY 1QNTA 4HG2A 3H0CA 3WRVA 4CKBB 5AVTA 2YIMA 1ZEMA 2QSYA 5FTWA 4MX8A 4MQFB 2YNMA 4OXIA 3K71B 3WGLA 2C2WA 2BEVA 3JARA 3NQ41 1E99A 1AN0A 1NXTA 2BHLA 2P9YA 2XCQA 3IAHA 4HSGA 5TMBA 1J1IA 2W1OA 3M4JA 2WD8A 1W4CA 2WMDA 1OA0A 1KI7A 2DE0X 5LCXA 7REQA 1MRSA 2C2MA 1X1CA 4S1NA 2VDKB 2P91A 2W0SA 1R4ZA 5ICGA 3DUFA 2OLKA 2JJQA 4LRXA 1S7AA 4RABA 1Y63A 1U8CB 3DZGA 3UAXA 3HLTA 4YRBA 1BOBA 1OH7A 3DP9A 5C8VA 1QS0B 1FEXA 3CLQA 2D7CA 1QTIA 4I46A 1A2KC 4D6XA 3ZQGA 1EKXA 3AAFA 2VOJA 3K30A 3NQOA 2HZDA 3OR2C 5KCMA 1G5QA 1S96A 1PSWA 3KCNA 4J29A 4ZQFA 3V7YA 4DR2B 3I4MJ 4MHOA 3GJ7A 4D0RA 1LFBA 1J22A 5K0TA 3HWX1 1MX1A 4HDRA 5ED4A 3Q0VA 1I2CA 1K97A 2OAGA 3KZKA 1HMYA 2P3OA 2JAPA 4S3MA 4WK6A 5DXFA 1DGRM 1U3EM 4CPDA 3LK6A 4MGRA 1E1NA 1HLPA 5AVJA 2E7ZA 4B4UA 4F1WA 5A5GA 4LXXA 2B5WA 1WD7A 2WIAA 4X7BA 5DE3A 2VIIA 5D3MA 1F0YA 3BHIA 3ND9A 1X3SA 3PQKA 5AH0A 3G1TA 5C7LO 1EUYA 1ZD3A 5BRNA 1UBKS 1ANKA 4UQLA 1M8PA 4EPWA 2ELJA 2XT9A 4YR7A 4ZYWA 3RFCA 3SQNA 4IJUA 3AH8A 4EO4A 5CD9A 1U2RA 3TNJA 4DN6A 1MQSA 2YVQA 1RI1A 1CJCA 3DTVD 2QNIA 3KV3O 4PZUA 4TRMA 1YZYA 1ZHFA 2RHCA 2OPTA 2I2AA 3BHNA 2PT7A 3HBAA 5EZYB 5AXDA 5I7UA 4IIYA 2R6AA 1OILA 1HORA 1JWAB 2KJQA 3DXFA 1CJKC 2JJ2A 2O6GE 1HYEA 2HPHA 1FDIA 3QI7A 2IXGA 2ZSHA 3AB8A 1XZFA 4D44A 1RQLA 3BDAA 1PVOA 5E17F 1UZCA 3OTGA 4CMIA 4AY2A 1OYWA 2EJBA 3NHJA 1KYYA 4V0LA 4HEQA 5IABA 4R4JA 3LSRA 3V8EA 4BQFA 5FFZA 3Q7QA 4HH0A 2APJA 4R5HA 5J1TB 2PWBA 1YQTA 1DJOA 4EY8A 4YRSA 4B3GA 5C46F 1NV8A 2QGNA 1BJKA 4J6FA 5DKFA 3TAHA 3BJOA 5J1RA 5HKKA 3TRIA 1E6WA 1H2AS 3MTIA 1GL3A 3CMYA 5AW7A 2DDAA 2VF5X 3EN0A 4LGYA 4YYEA 3ZRGA 4EKEA 4HVTA 4OJKA 2C2ZA 2O57A 2A7XA 2X7HA 4O1IA 4KR9A 3W04A 4BLWA 3AWIA 4GYWA 1FYVA 4ZVLA 3UCFA 1ODKA 1E6LA 2AOUB 4KSBA 1R0ZA 1RWNA 4QXQA 3TNDA 5CDFE 2PD4A 1CNEA 2EIMH 3NHSA 4UBKA 3LDFA 1XMAA 4N01A 1EX6A 2NU6B 1JUPA 5D5WB 1D1CA 2E87A 2JLBA 4I09A 4RA9A 1C8KA 3EZGA 3RS2A 5K0ZA 3KZ1E 5CM9C 1V8DA 2O9LA 2CFXA 3SY8A 5KAMA 2I0FA 4AJ1A 2GN4A 3P2EA 3VDMA 5LU8A 3WTCA 2FPGB 2ZREA 3GRUA 5DYGA 4NBUA 2GASA 4HAIA 5AYVA 5FIUA 4I0AA 4ZCPA 4K46A 1QQAA 3PD7A 3ZCTA 5G0WA 4NRDA 3PR1A 4M6WA 3OYIA 4DM4A 1FNMA 2I6QA 3F9IA 2H4XA 5EIHA 5BNZA 2HEOA 3ZQFA 3NTVA 2Q29A 4FC6A 5AR1A 2BCGY 5D5HA 2PZFA 3ZUGA 4DMMA 2QQ5A 4U7PB 3O3KA 2ZR8A 3W8EA 2FLVA 1Z3CA 1IDN1 3TB4A 2IEIA 1Y9DA 5IJAA 2DCEA 1QXSA 2F5DA 3R3YA 4LIPD 4MUNA 5K8JB 1XSEA 1TMYA 3GG2A 4NOKA 5KJFA 1X7XA 3L7OA 3SVZA 2KIMA 1Q84A 5A4DA 3I1JA 1H1TA 3QENA 1FTZA 2YJGA 3CPHA 4IEIA 3WL6A 3BK7A 5I7VA 1QP0A 5DBEX 2GJ8A 5AXBA 2PFKA 4R1TA 2GPTA 4MWCA 4UCWA 4MFEA 5IYZB 3U4QB 4ROTA 3OEED 1BNCA 4I08A 3D8NA 5DSXA 1HKTA 4QBTA 4UOQA 3RB8A 4EFDA 3G5UA 3P5BA 4AL4A 1ZLKA 2X5NA 2L42A 1IE3A 3S7ZA 1JWLA 2GK4A 2ZXUA 5F1OA 3WG9A 1X86B 3HI4A 4ETNA 1I51A 3A1TA 4AURA 2Q3EA 5J9FA 1AF7A 1JIIA 2FSGA 4FONA 1WFXA 1H5UA 3D81A 1MO4A 1A88A 2O8VA 2AN5A 4BO6A 2O8DB 1JE0A 1YQWA 3NP9A 2FMUA 3QMWA 1QJCA 4LDPA 3ICPA 2GD1O 3I1YA 1RLMA 5AVZA 5IXJA 4PO9A 2IA1A 1AOXA 3NI2A 1AMUA 3VPAA 2ZRAA 4ZDOA 5KC8A 2LC2A 1O9HA 3RBZA 1BE1A 4G4GA 5A4AA 3F9KA 2CCGA 2VH1A 2XGSA 3L8DA 3ACBA 2BZSA 3KG2A 1Z7GA 3AHIA 3T41A 3QXCA 1SOAA 2OFOA 1Y7PA 4JMLA 3WJ2A 1ADGA 1QQ6A 4BEHB 3ULQB 5HIMA 2VQFB 3L7MA 4JX9A 3TAUA 3VOSA 2FMHA 4C0XA 3A4YA 1R8SA 3V4ZA 2RGYA 4Q4AA 2Z16A 2P5LC 1A2BA 2Z56A 4D3YA 4RS4A 5I3CA 4MYHA 3M9AA 1VXOA 1Z28A 3V7FA 3ETGA 3RVBA 3TRFA 1QRSA 4DLLA 2H0QA 3IMFA 1BVHA 3V2IA 1VG1A 3DBRB 4URWR 5K3BA 2DBZA 2WY2D 1BIBA 1TVCA 3EFBA 4C6SA 4UDOA 4WRRA 5AI9A 1UHWA 1ILWA 1T2KA 1E3EA 1G7RA 2VFAA 3LE8A 3OI7A 5D00A 4TLMB 5TS2A 5AM3A 5CA0B 2Z1MA 5JARA 4O4IF 4QPPA 3F8NA 3ZWDA 5LP1A 1G2IA 2RC6A 1E3IA 3O9MA 1QFMA 5AK0A 2EZHA 4ENNA 2Y2ZA 2WF9A 1VQ6I 2N47A 2OCLA 3M9WA 1NC1A 2J7PA 2XNCA 4UPVA 5BSUA 4F56A 3DP7A 4HGNA 4KXNA 1EIZA 4QNRA 2A1TS 1QZTA 2NNNA 3IAM2 1RD4A 2XTJA 4M4SA 4LGWA 2ZRJA 4LXQA 4W9NA 4XCQA 4MMXB 3FUWA 5DM2A 1JZSA 3VOBA 1USGA 1QKKA 2GEBA 3VTKA 1OCEA 1T8RA 2VCHA 4RD4A 2KW5A 4MVJE 2H4HA 5J4LA 3NWPA 2JRCA 3EXHB 4JBAA 4CNQA 4MEAA 5DW0A 2A07F 4UZEA 5BWLA 3I3LA 3ILXA 2O0JA 3OQIA 3ZQIA 4UTOA 5L51A 1TQDA 1JHRA 3DMDA 5GPBA 5DM1A 3BOSA 1VC2A 1UPXA 1JLHA 1R74A 3RPUD 3GPDG 3ICCA 3OICA 5DCLA 3TLKA 3FLAA 3FPBA 1IN4A 1GO2A 2PSEA 2D62A 1ULSA 1G2OA 3P9SA 2P0WA 1Q1HA 3CEHA 4ZAYA 4KR6A 4NFYA 5P21A 1AKRA 1QIIA 5KPJA 3C2HA 1E9FA 4TMWA 4DUZB 3HACA 1KOJA 1CC1S 1IXCA 2ZW9A 3MGBA 3K9TA 1C1XB 3MILA 1M6EX 5BMOA 3A4MA 5E9JA 3HSFA 1MGOA 2QLTA 4TMZA 5JBNA 3PIPF 3N2ZB 2C54A 5CQGA 3IVGA 1NUUA 1XAHA 4RENA 4ZO4A 4ZZLA 3JQBC 3AKEA 2B1RA 1LSOA 3NETA 3QF4B 1E1RA 4PZEA 2NNYA 2O8DA 4H7PA 5EEAA 2IP4A 5DNYB 4JI7B 2A4MA 4LXTA 1WBJB 1OI4A 1Q1VA 4DOMA 3K0BA 4M7WA 2AKYA 2HBZA 2I8LA 3PHIA 4BBRJ 3AG5A 1O97C 4NV0A 4OHFA 3LBYA 3WHCA 2ZR7A 3SDZA 3E2IA 3TYXA 5LQRA 3I01M 2B69A 4QD3A 1PBNA 1F17A 4RZXA 3ZIDA 2ZBGA 3E1GA 4JL5A 4LA4A 4IP0A 2P8JA 2R8ZA 4ASNA 2LUOA 2ZTHA 3D6MA 2VNAA 4BKPA 5JLWA 2O7VA 2WJGA 1NU6A 4NFSA 3R7AA 4WWCA 2YXLA 4R1HA 3UKJA 4XDZA 2HJWA 3FDZB 3WWYA 1FDWA 2BI4A 5L8VA 3ZDAA 5HOOA 1YR3A 5K3OA 1JE8A 5E3MA 4LTMA 4PY2A 1T56A 1X1BA 1P1IA 2ID9A 3FJ1A 1JIQA 3H3JA 4FFNA 3C5EA 3ZV3A 1W0UA 1MXFA 3MTEA 4DG9A 3G73A 4WNAB 3GWGA 2ZZNA 4RXMA 1TDJA 1FTWA 3QVXA 4RGXA 2XGCA 2REOA 3NWBA 4YUYA 4M3DA 1YITI 5EXTA 2RN7A 3RJMA 3P9KA 2WSMA 5FV4A 4I50B 3QUSA 1JVSA 4KUHA 4PG4A 2O54A 5CA0F 5GIPE 4IDEA 1JQLB 2QMQA 3M1YA 3G2NA 2O2DA 4D99A 1W7PA 2I3AA 1Q5PA 5JFGA 4M8KA 2XXAB 1U1DA 1Z62A 3DKIA 3FFTA 4LYFA 5CT8A 4XSVA 3ZHSA 3RIMA 2K5CA 4FKBA 4YY3B 1JZTA 1Z15A 5AMXA 1L5NA 5KYTA 1OH5A 3D4PA 4HGOA 4EHLA 5FLKA 2IH5A 2H09A 2PHZA 1V6CA 1V4BA 1I0ZA 2VF2A 3DE5X 3EDMA 1RPAA 1XMQB 3KXPA 2IS2A 4HV6A 3OOWA 4TYMA 1ACLA 4KLNA 2R8YA 2VJLA 1E3LA 1FXSA 2Z3ZA 5DLDA 5EIWA 2AUNA 1HCRA 4NH4A 1PO7A 2VNSA 2GJAA 3C74A 3H18A 3VR2A 5EWJB 2OJED 3H11B 1C50A 4QKQA 4BEHA 1LUAA 4HAVA 3DAOA 3B70A 4LHSA 1TTYA 2OO7A 5DNWA 4CLOB 5IK2D 1N7HA 4A8JC 1FA9A 2H59A 1UIRA 4IWXA 4C01A 3NWOA 4PNHA 2J5RA 3FPFA 3ICWA 4QYXA 3OIPA 2JGIA 2CFIA 2QTWB 3QVMA 4H7FA 1XCBA 1L2TA 3BWXA 5A5FA 3ECAA 5LMNB 3ICEA 2XGOA 4HX2A 3CNQS 3NM5A 2DQZA 2OBLA 2FF4A 1QYDA 3MUNA 5J4HA 1FRFS 3K9BA 4IIXA 1S3JA 4PCUA 1R9NA 3AR2A 5FL7A 3CXRA 4F2HA 2XOEA 4HV5A 3FFBA 4M76B 1PFQA 4I01A 3QPTA 2PQMA 3TEJA 4PAOA 2PZAA 1YRLA 4R8LA 4FDVA 1HEIA 1LNWA 5K7ZA 2QUHA 3FNRA 3O95A 2IAIA 4LSZA 2UUAB 4XM1A 2CN1A 5JCPA 4IGIA 4B3AA 1M1ZA 4Q1BA 2FPPB 2H2HA 5F21A 4F7WA 3BPSA 5J3JA 2A9KA 5AONA 3IELA 2CNNA 5J43A 4RTOA 3DEIA 5G4KA 1TCUA 4IX7A 2XDVA 2R8XA 4HAMA 3L43A 5CB4A 2LR0A 2NYUA 3CH5A 5HMMA 3WNCA 4NSNA 1TW2A 2P78A 1U8RA 2P9TA 3DVRX 3LZDA 7AT1A 2CMKA 2NU9B 4O5VA 4D9EA 1TWAJ 5AQEA 5DHQA 3CZAA 4OBEA 1W93A 3Q7TA 4P98A 4EENA 1A8IA 2LF7A 4LZJA 1M74A 2KFDA 4Q7KA 2P9QA 1YQEA 2FUCA 2HCJB 1BCRA 3IR6A 4MUFA 1IZ1A 1D5YA 2EZLA 3DFGA 2BM0A 4PSUA 3UK2A 2HNBA 4JOSA 3ONFA 3NARA 4QRDA 5C9ZA 2OA0A 1IL0A 1Z2DA 3RC7A 4B3SB 2A6EF 2H07A 5AT1A 2PVCA 5MGBA 4LIUA 2GZ2A 3DBOB 3LA7A 1I5EA 5ALSA 3VVLA 3DTVB 3GLTA 4JP0A 2Q6TA 3MK31 4Z9XA 4FM9A 2FFAA 2JH3A 3IILA 4I4TB 2Z99A 3FRHA 4X44A 5FI5A 1YRHA 2VL7A 4FCCA 2QZ8A 4EA6A 3BZUA 3I6BA 5JQGF 4YJ2F 1E2PA 4PYJA 1P2UA 3GCGA 3KXLA 4X91A 1JW9B 3RVMA 5JNLA 1U9CA 2ECQA 3QKSA 5FWAA 4W9NC 2C9MA 1E7QA 4LBYA 1GP2A 4NOMA 1G4AE 4OHCA 5KPDA 1LDBA 1TW3A 2Q1XA 2WWHA 1NNSA 3IOCA 4BVGA 3S81A 4YDQA 4O1HA 1AH2A 3RKQA 4GUDA 1QM5A 4MEJA 1JPNA 3ZMVA 1SBZA 4PYQA 3SDGA 4RY8A 2TMDA 5ALJA 3UM9A 3WBFA 5J4KA 4RY9A 1YR7A 5JVTA 5LB4A 4RESA 3REGA 2CVPA 2VPRA 4TQUS 3CNOA 3H9QA 4JLSA 3U4GA 3D02A 3OETA 4AECA 3DBHB 5EJCA 1A5AB 1EA7A 4AZ0A 1G3SA 4LGMA 4D5GA 3JWEA 3F9RA 4GEKA 4MITA 4RKEA 3U1TA 5JBIA 4KFSA 4YJ2A 1SCIA 1LI7A 1ZY2A 4CU5A 1T3ZA 4OCZA 1GIAA 1FFXB 2FQYA 2VJQA 3CZRA 3E22A 1OZ0A 3K5HA 4MGKR 4Q3BA 3S68A 1FFYA 1MH9A 2RFLA 1Z12A 2RHMA 2WKWA 3GTQJ 3K09A 2QP3A 4FGUA 2JARA 4UHHA 2YXDA 4TGLA 5B58T 3WK4A 4CTJA 4IHJF 4JYZA 1BKYA 1UM9A 3GLGB 2X5KO 1PK8A 1LW7A 2ZG6A 3PVSA 4W1UA 1A5SB 1P74A 3ABSB 4G2TA 4HT3B 3WB0A 4F0JA 5EXEA 3T3IA 2ACWA 1N9GB 4WVLA 4BFLA 2B3TA 4Q3LA 1BWQA 2NUTA 2VWPA 3CF2A 2WBLC 3QPAA 2QYHA 4PEVA 3W9SA 3RAPR 4Y9SA 4RK1A 4EY4A 4F4FA 1GM5A 2KYRA 4L22A 4RANA 1P4AA 1R88A 3CW8X 4CKBA 3WHKA 2DPLA 5GIOE 3WLQA 3CZ5A 4KMUX 4ARZB 1NKTA 5IDYA 4L8VA 1BOFA 1FFHA 3KVNA 4FDTA 1WBDA 4RSMA 3WNQA 2XYVA 4GFDA 4BQSA 5BSTA 4CM4B 1E7RA 1FP7A 1RQGA 5ICFA 3O9ZA 2OG1A 1QRDA 4MO7A 4W1PA 4CCJA 2X0JA 3M4XA 3R6DA 1N2JA 4YAGA 2DERA 2HA5A 2WP8J 5ARCA 5DRTA 1LBTA 3X44A 3OIQA 1DOAA 1GJRA 2H2AA 3ZQCA 1TT7A 3HDQA 5DUIA 1DQPA 4RF4A 3KJZA 4UJ3A 2K02A 5K3DA 2ZR0A 3E0XA 5TPZD 2QD2A 4FR0A 2YH2A 1R6DA 2X0DA 3MJRA 1KWKA 4DR7B 3CO0S 4L74A 4DNFA 2YX1A 4O4HF 4E5MA 2BY0A 1N92A 3WRXA 5JMOA 1KRWA 4F1KA 4ZFNA 1KO4A 5CA1B 1NVWQ 2INGX 3LQ2A 3I39X 1WXIA 3M89A 4C3VA 2GKGA 2XMCA 4TLBA 2I4NA 5BQXA 1ZVMA 3N6XA 4O02B 4WA8A 4R1NA 2G0TA 4Y98A 5BRJA 5GY7A 3WU0A 2Q28A 3IVMA 4C7XA 3N2GB 3HXKA 3USCS 5LUAA 5HNKA 5A0VA 4NHEA 2DAPA 3ND8A 3HVUA 3WIOA 3ZZUA 3PG5A 2X9DA 1QCZA 1BH6A 3RVKA 4RKRA 4CE6A 1GQSA 3H5OA 4RPKA 3HJUA 5L7YA 1SA0A 2QMOA 1XKLA 2QTCA 1WXWA 2HMUA 3P19A 5TJ9A 3SLGA 2DFFA 2H92A 5ALKA 1IHDA 4HEJA 2V9PA 4ZH4F 4LYAA 3EW7A 3Q5DA 2DYKA 3RM3A 2QKYA 1WB5A 4BVLA 4HSRA 4B87A 4TMVA 4K2HA 4GGPA 4CMEC 3UJ7A 1ZMBA 2WWFA 5LKAA 5JNRA 5TVGA 3BSSA 1U3FA 3M1IA 3NNNA 4BQRA 1XRLA 4BE9A 2H9AA 4LYEA 4DMLA 5FJ8J 4HDAA 3PR3A 4R9RA 2Z5LA 4UUPA 4DA9A 1QVWA 1PQPA 2OXEA 5TDHA 3OYFA 1Z4JA 2Q8NA 1PFWA 3M6IA 2F3PA 4ZALA 2D74A 1E1DA 5GONB 3LUBA 1JYFA 3SYMA 3B2NA 3IVAA 4DBLE 2O8FA 4G9EA 1CY6A 3OY9A 2VZ0A 4HBZA 3DO5A 1Y3CE 3O7WA 4QFMA 2J3JA 4A8JB 3ZV5A 3Q0WA 1VA5A 5ILSA 3BWVA 2WTMA 1HW1A 1R8QA 3KVOA 3QVJA 3IPXA 3MYRA 2PKRA 3TIGA 3VPFA 3RTCA 2JGDB 2YFQA 4BB0A 2ENWA 3D8UA 5I48A 5A4KA 3DTKA 3D1VA 3OR1C 4NVRA 1ENYA 3W7BA 2BI7A 2HU5A 3MGAA 3GUCA 3PLNA 4Q9DA 3HU3A 3CYFA 1DKUA 4YRRA 3SX2A 1YJQA 2BEJA 2FUG6 4PAQA 5SZHB 4RBOA 1NG1A 5BMVA 4TSFD 4M7OA 4IG9A 3SYTA 5C31A 3F5FA 1E6CA 3IWFA 1POXA 4R8KA 4W1RA 3KAJA 1A7UA 3C2QA 2F1JA 1R2QA 3EA4A 4MI6A 3DPTA 5BNTA 1RWXA 4DSTA 4UDNA 1HLDA 1FNBA 2OV1A 2OZPA 2X2PA 4MYSA 3ORRA 4YP9A 5KS2A 4ZTJA 1EFUA 3BTJA 1TC2A 5DLYA 4ON0A 2HYIC 1W9HA 1JKJB 3INTA 1UDCA 1S72I 1P60A 3DTTA 4ESHA 2KZGA 1Z56C 2IEZA 3LQFA 4Q9KA 1KY3A 2CXNA 3T5DA 4Y1GA 4UMFA 2HIAA 4GE3A 4R9UC 2O06A 5F52A 1Z0AA 4BMOB 2MC3A 3M5WA 2ZCUA 1FNSA 4U39A 1A8QA 5C34B 3IBSA 3U40A 2G70A 2W11A 3M8KA 3UOAB 4EX6A 4PV7A 4YHHB 1IAVA 3TXXA 2PTHA 2VRNA 3GGOA 5FBKA 3U37A 3G2JA 2YIJA 3P2OA 2O9JA 3E81A 3DMNA 3URMA 1DU6A 1R9GA 2X5OA 3Q8XB 5FBVB 4IIBA 2AJTA 3MFKA 6GPBA 1YQQA 3AONB 3KFXA 4YQYA 4JJKA 4KQ6A 2DSTA 5D5PA 1M5UA 4O4JF 2IHNA 2ZEJA 3VSBA 1XTKA 5MF6A 1J7KA 2PGDA 3CNNA 2C00A 4ZQBA 5JEDA 1DTWA 3D8SA 3IT1A 4KNVA 3BE4A 3OPYB 4FSDA 3JWPA 1TZKA 4WSOA 3U7RA 4DB4A 5EP2A 1ON1A 3D0KA 4Q7EA 3O7MA 3UJ6A 4D5CA 4PFOA 1RKQA 3ZJ5A 3E82A 1I27A 1OPRA 2JFYA 4FMDB 4QFDA 2ZJQF 1G38A 2W70A 2XZOA 1E1LA 1T0IA 4PLCA 2JAOA 3DCFA 2Q3BA 3KWLA 4QFBA 4ZVQA 4E6PA 2HQSA 3CR8A 1LVUA 3IEUA 4GFBA 2FPRA 1J7JA 4WOBA 4F9EA 1UUFA 4EFNA 5KEIA 3UNGC 1KQ3A 3B48A 4FEAA 3ONEA 3LTNC 3WG7H 4RD6A 5T5QA 4G5OA 2C95A 4O4IA 1KSGA 3A26A 3RS4A 2NVQJ 3EC7A 3QK7A 4CIVA 4G6DA 3TVDA 3KOOA 3PRYA 2BKUA 3ZHQA 1Z88A 2I76A 4I3HA 2Q3HA 2NP6A 2P90A 2VLBA 5CVUA 3FIJA 1G2PA 2UVPB 3CIFA 3O8OB 3VAYA 2DKOA 3QWFA 4DV6B 3SHQA 4OFXA 3AUFA 2HQ1A 3WB2A 1SC9A 1J0BA 2H0RA 2OORC 3U7HB 2HBQA 2B37A 4GZ5A 1UBCA 2BF7A 2NVWA 1YX5A 1ESEA 5FUMA 2COBA 1NG9A 5EWJA 4RTRA 1V6SA 2HQBA 2TSYB 3LFHA 1NSYA 3KJEA 4IGKA 3H6GA 4RHXA 4XDGA 2PEYA 2WJIA 2XNDA 4A7PA 2MSEB 1ECGA 5HZKA 1T38A 4PUSA 1AGPA 1YJXA 4OQMA 1R5JA 2A0UA 1GAQA 2HV8A 2VAXA 3AHFA 2JIPA 1BEZA 3QIAA 4J2OA 4P4NA 3HJCA 1QHHD 5G02A 1UKAA 3RRZA 4CF3A 3FGPA 3GEIA 2DT8A 5KI6A 5FJIA 1L6IA 4AO6A 3OIYA 4OFZA 2ORIA 3LPAA 3EVZA 1VKRA 1KJNA 2YFKA 1X8LA 3KQSA 5SYAA 3DEYX 1FMLA 2ERCA 3EYAA 1DP4A 3MJFA 2G6TA 4P34A 1LSSA 2HM7A 2PRSA 4IHKA 5FPPA 3KP2A 3TDZC 3PPXA 3K09C 3ZX5A 1X80A 2NMVA 4FYXA 3E15A 2HXIA 1ETUA 3PI7A 3ZE1B 4OI1A 1W7AA 2R3SA 1DLIA 1F8XA 4P36A 3KE2A 3GA0A 4J1TA 3H4TA 1A0OA 1UOQA 1YDMA 2NVXJ 3DAPA 3FN4A 3OU2A 4XYLA 4OU0A 5CEJA 2OBBA 2G1KA 5JH7F 1MD0A 1XE3A 5E7MA 2ICAA 2Q5IA 3GYBA 3IBTA 4JD5A 4WK2B 5FV7A 1NUPA 1YCHA 2K7LA 2YIVX 4ALJA 1V8PA 2Q1ZB 2JGEA 1FJXA 2D7DA 4E5KA 1G8KA 3TE6A 3CCFA 5FUVA 3IEVA 3KBBA 2ZSEA 2JLSA 2Q4OA 3LYAA 5CURA 4DDUA 3AMVA 5I3ZA 2DK8A 4G6QA 2V45A 3OOYA 4RACA 1J0RA 4FHDA 3UK7A 1E5QA 4F9TA 4C3HJ 5HR5A 3HG7A 2LREA 2IPQX 1NX6A 1Z0IA 2BTOA 1DC7A 3QPVA 3WGHA 4LVOA 4J0FA 3BVPA 4M0MA 1ADJA 3L46A 2VT6A 4K87A 2EJUA 4TS1A 3ZXIA 4NULA 2GAJA 4D5EA 2LVBA 2EKLA 4TRRA 5C32A 2HMTA 5EMKA 3R5JA 5CIQA 1L5HA 2IF0A 4QDZA 3UEOA 2G9RA 1ZHHA 4XLPF 2MINA 2VI5A 3HPHA 2HXOA 2GCIA 4NYIR 3OEHD 3RYFB 2E19A 2I2FA 4XQ0A 4DLKA 2H7YA 1SIWA 1IM8A 2RONA 1JXQA 4RB0A 1KIFA 2LF8A 3BCBA 3AFIA 3WDSA 4EW1A 5I9IA 4D9FA 4IH4A 3GZ5A 3SFZA 2WZBA 4L51A 1VIVA 3UWSA 3WB1A 1NX9A 2BUAA 1MJFA 3EMDA 4K9SA 3P9YA 1RYYA 2HUNA 2X5JO 5NLLA 5EJ5A 2DHQA 5FKKA 4ICIA 5KDDA 4FGKA 5DT2A 4C0BA 1X7ZA 1Z74A 2AQFA 2UUZA 5H3HA 4B3FX 1XI2A 1E7MA 2MDTA 1EM8A 3BKWA 3QY0A 3WNDA 4E0BA 4X1EA 3Q8KA 3I3OA 2DB3A 3B85A 5B2FA 1Y4UA 2PGOA 1ZNQO 2VJPA 5K0SA 1V3TA 1VQ4I 3DZIA 5J3LA 1LD3A 2VP3A 4YRLA 5E1OA 1VZ0A 3JD2A 4BLTA 5CK5A 4KOEC 3BG7A 1X15A 3RASA 1KJQA 5TJHA 3ZGNA 4QEDA 2BFDA 2BZ1A 2FI1A 1A7KA 4KQEA 3LA3A 1WDKA 1TQ4A 3I4FA 4I9UA 4R3NA 5M04A 2PLFA 4LQLA 2KL4A 3U49A 5KJCA 3ACDA 3Q8MA 2AJBA 5G1OA 3JQGA 2H6BA 1A82A 4HOYA 2NOJB 3BEDA 3BMNB 1IJWC 2CD7A 3HA2A 3JQ9C 3CP2A 4LPSA 3RJ9A 4CM6A 4YBZA 3RARA 2F5VA 3MTGA 1QYCA 4M88A 2C29D 4X54A 4ARUA 5I4BA 2JIBA 2N3ZA 1HW5A 4K9DA 3A1FA 1CZLA 2NGRA 3HCRA 3NXKA 4XUGB 2W84A 1AOYA 5E3JA 4EOGA 4B3RB 421PA 1B00A 1T26A 4PLFA 2KISA 2IP1A 1FMCA 2J4DA 2ODEA 3ROTA 3V2GA 3ZU3A 1Q3KA 4AKIA 1SFEA 4ZWNA 1I24A 1PS9A 3B1VA 4PC2A 3FZEA 4KO1S 2A67A 1PUJA 3B3QA 2QLJA 2J4CA 3FBNB 2O3UA 3K5IA 1XVIA 4ZAGA 1YFLA 3WFZA 3I9KA 3K96A 1ZHOA 2IXBA 4G1MB 4IDBA 1UAYA 2V3VA 4IEJA 2WSIA 3PJGA 5HBGA 3ZWWA 3EYYA 3RODA 4A2QA 4B3CA 4O6JA 1XFDA 4DBQA 4AG5A 1OSNA 1A97A 2PMBA 2X13A 1C9YA 3C4QA 3HKCA 3IDOA 4IHTA 2JZCA 4X1YA 3F6VA 4YRCA 5DNCA 3DOCA 3EPZA 3AR6A 5IOYA 1LDMA 2J5BA 2QLFA 4DA8A 2RMKA 2DQSA 4MKIA 2KLBA 1TL8A 1DPUA 1BGWA 2VJCA 5NULA 2DUMA 4BNTA 4JCOA 3KJQA 2GNOA 3OE7D 2JLZA 5ICCA 4IL6C 1LB2A 3TR5A 5G53C 2YWBA 4OM8A 5JSZB 4JJEA 3DULA 2FSVA 2ES4A 2PMUA 2JJ1D 1WMDA 3NR2A 4B6OA 1UBEA 4ZMRA 2EFHB 4CLOA 2ERXA 4GSYA 2A14A 2W4QA 3FZQA 3HZHA 5I7AA 4IKOA 4F1JA 1Z5ZA 2DJ5A 5FRMA 2H16A 3LQ4A 2YOGA 3CWZA 4MRRA 1XX5A 4AUXA 1Y0BA 2PJPA 1W2WB 2VS1A 1WJCA 1QG6A 2M6SA 1QB8A 2HJVA 2X58A 2Z9DA 4J01A 3OAAD 3OUZA 4R6WA 2XIQA 3L92A 4HYQA 4J1TC 1VLMA 3S40A 2HOQA 5I9LA 5IJ9A 3PNSA 4HF0A 3I05A 3C7JA 1YZFA 5K4AA 2KBEA 2WQ6A 1C29B 1HDIA 2C3OA 1KAHA 2AOTB 4K8OA 1GPNA 3KB6A 4C2MJ 1BA3A 1FUKA 1NVVR 3ANNA 3HWWA 4HWGA 3T5GA 2P9GA 3BJZA 4UXIA 1HKHA 2ZJPF 2R8EA 4OIRF 3VJLA 3CH7A 1U04A 3R61A 1L4EA 4MXDA 3U39A 5HCIA 3AUXA 1KERA 2E1MB 3GWZA 1OZHA 5D6FA 1S2IA 1SMKA 1X58A 1PD1A 1CQZA 1YJCA 2CLFB 1X1RA 3LMMA 2FKAA 1I1OA 2QQEA 2YOHA 1E3WB 3DFIA 3LSYA 3T52A 1O5TA 3W2IA 3QQAA 4EF4A 3VYWA 3AF3A 2F59A 2NUTB 3O73A 1FY2A 3CMAI 4RZ2A 3AUKA 1RI7A 1UMQA 3ZV6A 3F90A 5KUTA 2E89A 4BV8A 3BD7A 3EGXA 4IVNA 1XJ0A 3ICQB 1SOMA 1XC7A 3GLKA 3I9FA 1TM7E 3TNFA 4BUZA 1J49A 4LOKA 4TMYA 4B6SA 2XGDA 1KY5A 1J8VA 1P0PA 2VXCA 3I9V1 2JFBA 5DCUA 4LG0B 1ZH5A 5EKSA 1DFHA 1RAEA 5JG7A 1Y1RA 5LP6C 3L41A 1HZZA 1PW7A 4RAOA 4NPAA 4C7KA 3I6MA 1REQB 3DOHA 4OGLA 3JAKB 5KMGB 1PJTA 1RHUA 3KOWA 4X97A 3WIEA 5AVVA 4WXEA 4K2EA 3OM9A 1WDMA 4EM1A 3TKLA 4ZHQA 1OH6A 2WAXA 1ZREA 2DULA 1CY4A 2K2WA 2Z2KA 2YVKA 1MFPA 3L0OA 4QUHA 1IHPA 4G0WA 3WMGA 1NW3A 4H1UA 1XKTA 3AQ4A 2QTZA 4MKFA 3HN6A 1S7CA 3IPCA 1IUOA 4KQ9A 4C7OA 2EJWA 2CFCA 3CE6A 1NXVA 1VBNA 2F6CA 1G8HA 4G0MA 4N9WA 2BJHA 4RFSB 4DIBA 2DODA 4QJIA 4Q37A 3WLNA 3RC9A 4RWZA 5IEJA 1CQWA 2YWEA 1V2GA 1PYDA 5BOSA 2IPAB 2FEWB 4NBLA 2QNBA 4CXFA 1RC0A 4U7FA 3VR5H 4E7LA 3ZCUA 3VOAA 2K85A 2HA4A 1PLLA 1XV5A 4DEXA 5K6AA 1OZGA 1UM8A 4ZYTA 4Q4ZF 2FEXA 5GONA 4EKIA 1X13A 3I55I 1T3TA 2IYAA 2OAQ1 5JVGF 4HDMB 4N9QA 4CXMA 1CGPA 1NN1A 3ISPA 4MAAA 1DWQA 2ZVPX 2CCJA 3WLSA 1D1TA 1SZCA 2VZLA 3ZQ6A 5J4VA 1OLXA 1LKXA 2ZWIA 5FP0A 3PWKA 4J19A 4IVRA 1C0EA 1LJLA 1WQ1R 3H4IA 5KYGA 2BKEA 2H2FA 4YA6A 2WKRA 1IVNA 1STZA 3KAKA 2BEWB 1M1NA 2P5SA 1R6RA 3ISJA 2OQIA 3MRXA 3ZLTA 3ZE0B 4ML3A 1BH2A 1N2BA 1M2KA 1WJGA 4TL6A 3EDQA 2PWYA 2PZJA 2NTJA 4XQFA 1T4MA 3BN3A 3FTFA 2YMLA 2YDYA 4F72A 2ZI4A 2W98A 3PL1A 4MUIA 4KHPB 3N2NA 2XAGA 1DNPA 3IVCA 5BVHB 2BXZA 3AVOA 3K0AA 4W8HA 2WF6A 4D4MA 1LZKA 3AI7A 3IAS1 3KPUA 2XGJA 5HIKA 4P9NA 4MLZA 4A2UA 4YCMA 2R5FA 1Z5PA 3PGXA 4K1XA 5LGNA 3SBDA 3KZIC 1Z8HA 2FP3A 3DZFA 3AUSA 1E18A 4C2UA 3H2YA 4HDUA 3TK1A 3QJ5A 2G8LA 2FQ3A 1OFUX 2ZUSA 1HV8A 2X1MA 5F51A 3CJNA 5HTKA 5JV5A 3CUUA 2AMFA 4H16A 4GW3A 1NJ1A 2IHUA 1OHHA 4E09A 2C84A 2D3WA 3EYIA 5EJMA 1A8SA 3G2OA 1LF5A 3FLBA 4IFEA 1RESA 1MZPA 4DGWB 1QANA 1UZMA 4UATA 5DDIP 1XZDA 4K81B 3W9BA 3RAFC 1RQRA 3TZEA 1I50J 3N6VA 3JSPA 1S2LA 3N3BC 4G8CA 1VYVA 1EFPB 5EYRA 1G6OA 5HS9A 1FOEB 3HU2A 5E6UA 5DP2A 3T4XA 1EA5A 5EHGA 4R1SA 3O74A 1MIOA 4HB4A 3FNEA 3B89A 3FR8A 2ONZA 4MLPA 4NG5A 2QE7D 3OS1A 3HP4A 3A1EA 4OPMA 5I9MA 4EKNB 3M4OJ 3MJDA 5CEEA 1RKXA 5J1SB 1S5LC 5E20A 1YHZA 4Q3DA 2ACJA 2AK3A 1PRYA 2CFTA 3QTTA 4B17A 2OD7A 1SUEA 3CTMA 3OMXA 3QE0A 1RU3A 4C6HA 2VH5R 4PO1A 2XPUA 2JUGA 5F0FA 1D9ZA 3TZKA 4TYYA 5FO5A 2H1OA 1P4RA 1YQGA 2WWXA 3I23A 3NKLA 1OR7C 4OXXA 1XTPA 4IO1A 3U7JA 2CUTA 4HYEA 2WJWA 4GLFA 1ZD1A 3D0OA 2PGAA 3U7QA 4A5NA 1ZU5A 4OWRB 1CF9A 1WUTA 2DOAA 1NJFA 3IB3A 1M9NA 1K2VN 1W73A 2XC7A 3KIOA 5BQFA 1ACJA 1E2LA 5KNDA 2VG8A 4KIFA 3VYTB 4PWZA 2DPMA 5EMLA 2ECOA 2ANBA 2YN2A 2K27A 2CB0A 2QMHA 2XQKA 4UM9D 3IKMB 3QXSA 2AK2A 4NR0A 2BONA 1V55H 1NQAO 4OYHA 4RQUA 3SR4A 4DUGD 3KQQA 4DDKA 1GSOA 1VQ1A 5DTDA 2YZ2A 3GTJJ 3QEOA 3Q3HA 4JUFA 1WCXA 1M0EA 5FRNA 5JJIA 5LYYA 1FRNA 3FOBA 5C3UA 3TUJC 3PEYA 1NMEA 3MWKA 4J2HA 4ZREA 3AY3A 3GEDA 4EEXA 5C2JB 1YRNA 3G1MA 2F4IA 3IJPA 3OQBA 4BEVA 5ELLA 1PR1A 3MCWA 1UBHS 4MCIA 1OLOA 1M66A 3VI4B 3R0AA 2CHVA 5IT4A 1N0WA 2XB6A 1EFHA 3TBHA 4BNDB 2ZNZA 2WM8A 3M7GA 3UGQA 2O1WA 4R2HA 4ABZA 3S2UA 1U3VA 4KO3S 3DMHA 1JRLA 3SHTA 3W6PA 4BKMA 4EY7A 1GXQA 3H1FA 3PYXA 2HV9A 4LJAA 1RLJA 1I5RA 2R96A 4UXJA 4ZRMA 5LZ9A 1E60A 3LQQA 4P5OA 3BIFA 3P0RA 4AXBA 3ZY2A 2YFYA 2FUEA 5KYWA 3A02A 3WXMA 4YCDA 2IQIA 1JLLA 4M6XA 2JRLA 5C1DA 1QHSA 2JRTA 4FFBB 4XPZA 5LZ4A 4YEJA 1CZUA 3C3WA 3SYNA 1N1DA 2Q4DA 3MN2A 1RYHA 4FQ7A 4RJKA 5KSOA 4ZOCA 4Q4JA 1FSEA 4LJSA 3BWMA 3K9HA 4GCVA 3GX4X 2I7VA 1A7JA 4RMNA 2OBXA 4BNJA 1Q0TA 3AVWA 3BGSA 3IPRA 5C7OO 3BH6A 3EUKL 4HWKA 4BKXA 3JASA 2I7CA 2JBAB 3KP7A 4NQWB 2CLEB 4Y3UA 4CDRA 3FJOA 3UMBA 1LQUA 2JCVA 3L8HA 3ENVA 2IEYA 4NE9A 4JI5B 4HEA1 4YK7A 3RHSA 2ENUA 3WNZA 1EGQA 3DE1X 3O4VA 4FOLA 4Q03A 2PV0A 5K0LA 2AYXA 3S2SA 4C07A 1NI4B 1W0KD 2NYXA 2WADA 1USVA 1RYNA 2WJ3A 5ALQA 4BWVA 2H1CA 2OECA 3ZCXA 5LMCA 3RYCB 2PK3A 2J0SA 2V74B 3I32A 2JEOA 2VPZA 2WU1A 4GBMA 3OFJA 1NNI1 4JJ4A 3FTCA 4HWOA 4H1WA 5I7WA 4B48A 1BFUA 1H1LB 1V3VA 1CBUA 3GG9A 4RD1A 2CW5A 1QHEA 2K9LA 3PQ2A 5FLVA 2Q2NA 1IM2A 3PCTA 2QTMA 4XAQA 4DADA 1QR2A 1QFZA 3GMSA 4G9YA 4FJ0A 5GV7A 2BD0A 2I6SA 1BG6A 4NHOA 5IJZA 5FB2A 2P8TA 5J8FA 2P6OA 3HEMA 4GL4A 3WFJA 3DXYA 3HJFA 3A1YA 2P6TA 4XEHA 3H5WA 1SCUB 1OU0A 1WR8A 4KUGA 3R9IA 4A1OA 1YXMA 1ZNWA 4DW6A 5J47A 2UV8A 4KLZA 2D5AA 2H5LA 3B3GA 4UNPA 3W1WA 4AZSA 2N1BA 5DWQA 2DBBA 1F6DA 1MXHA 3K2AA 1H6AA 5FLXZ 1GU1A 4YELA 1QWOA 3O47A 4JQCA 4I5FA 5AHRA 2VPQA 2WSLA 1Z6PA 3SZMA 3GTLJ 3E53A 2XGEA 3PC8C 4CM7A 4AB1A 1W88B 4HW0A 2VJNA 2VR1A 3QYPA 4L0CA 4MUMA 4N65A 3K9WA 2XAAA 4OSPA 3RRFA 3T7JA 2E5FA 4KR3A 3PL8A 5E7QA 4U7JA 4BO7A 2DF8A 2QTRA 1W5TA 2D13A 2VHEA 3Q2IA 4G37A 5SYNA 4M9XA 4ZC1A 1YG2A 1P2BA 5FBZA 4UV9A 2I7DA 3PX3A 4KQCA 2B0JA 2FMFA 3OX3A 3W5HA 1H1DA 3MLEA 3R6TA 2HLPA 1KH2A 3EOBI 3QKRB 1H2YA 4RLSA 3JVUA 2B2NA 3BXZA 1O1YA 1MN6A 3OZBA 4OGKA 3CO7C 3FCEA 3H9EO 4C4PA 1U7DA 1KGDA 3ONVA 5EE3A 1GN8A 4OQZA 1GUAA 3DEEA 3EVFA 2FPIA 4IOMA 2QENA 2CUEA 3NBYC 4F4HA 3ZJVA 2ZC2A 2J31A 1UEIA 4AK9A 4DILA 2RGBA 4XNFA 3DTVA 3SYKA 4B2PA 1Y37A 2P8SA 2J32A 3V3TA 3FMRA 3SOZA 1XLWA 3BGWA 3E7PA 4BY1J 3EUHC 4OP3A 2VQEB 4JELA 4ASUD 1J24A 1I3LA 4RTKA 3K35A 4KBFA 1C7FA 1LEBA 3AKYA 5FWNA 4ASUA 1H0MA 3DB1A 2MR5A 3OIUA 2PUJA 4GOOD 2UDPA 1MDMB 1T9CA 4Q7LA 4WOJA 1KKUA 2R4GA 4LMYA 2OD2A 3I6ZA 3IEXA 4L72A 5AJVB 3TKAA 2ID6A 3IHKA 1Z22A 5FOQA 5K0FA 1U2TA 3ENZA 4DS3A 2AKEA 3K94A 2ECKA 2MMGA 4OI2A 3P4UA 3E9MA 4WLOA 1UMDA 3T7DA 4N4NB 1HGXA 1V9CA 2H48A 5LLTA 1OXXK 4HXYA 3MJHA 3QX8A 5IT9A 3KSRA 4KWIA 3GXBA 1NIPA 3GJ4A 4YCLA 4PYNA 2DLCX 4GX5A 2R0QC 1PX0A 3A9CA 4H08A 4MK4A 5ALPA 4EUKA 4NMHA 1L1FA 1JU9A 4ZYVA 4Q3NA 3I9V2 5C5CA 1LUJB 5CH3A 5J2TF 1J2EA 2WF7A 1GG5A 5FLYA 4F38A 2Y75A 1LJ9A 2PLNA 3FAZA 4D7NA 2LZ0A 4UMDA 3T34A 1XTTA 3ZQJA 2DUNA 3ZBPA 1YZGA 3T3MB 1MVNA 1M34A 4FZ5A 5CCXA 1LLFA 1SBNE 2F64A 1CNFA 2FSPA 2H7CA 2ZIVB 2WM2A 2FJPA 3T4PA 5LDHA 2QROA 3TRJA 3N5CA 1GZUA 2Q2OA 2VCEA 1EAYA 1Q7TA 1SQ5A 3M6LA 2PS0A 4XIJA 1HQKA 4OOIA 1WF6A 1U90A 1R1UA 2GZ1A 2VDMB 3EXAA 2PH5A 1U63A 2Q5JA 2AZDA 5FQNA 1MJ9A 1P6UA 4FMCF 4DYVA 3RKXA 3GLIA 4GPBA 1P18A 3IP9A 3M6XA 3WYCA 5AJUA 2WIBA 3TLMA 1Y0NA 1U8ZA 1NT4A 3BJ6A 3ELDA 3E3AA 1AK2A 1XL1A 2DTDA 3AZQA 4FQGA 1ICIA 4ILKA 4R1LA 2IP2A 1M6VB 3FWKA 4HDVA 5AOBA 4XFDA 5D6OA 1HE3A 4ZT3A 2A69F 2R7NA 2BOLA 5FNVF 1FYMA 1UP6A 2ZRNA 3Q6IA 5LLSA 4E22A 4INPA 2CB9A 4JR0A 5HEKA 3UMCA 3IRQA 2ICWG 1D2MA 2X2FA 6REQA 1T2VA 2ZRBA 1CEEA 3BSWA 3WB9A 3N2EA 2O19A 3TD2A 2FYTA 2OHOA 4N40A 5CCDA 3CZ6A 4GGMX 3KQKA 1USTA 1M34E 4WX2B 4EGCB 4M1SA 4BUJA 1YJAA 3FMOB 5DGCA 3C87A 1WXQA 1ZK1A 2FEOA 2MR6A 3RPUA 3ROEA 5JIBA 2P4QA 4HY3A 4J0CA 4DR6B 4HAYA 4DE5A 4KQXA 1D6MA 4WLUA 4CCYA 5EHZA 3KYDA 2XKKA 4BQQA 2HVRA 2TECE 3L7YA 4WJKB 5D5QA 4A27A 1NJ5A 2GA9A 5BV0A 1ZH4A 4N54A 5FOTA 4V1CA 1EGHA 3VZQA 1KFEB 4CYCA 1FQKA 1GNTA 1IV8A 2G82A 2V5AA 2WPDA 3CUYA 3DLIA 4QYTA 3DZHA 1FC3A 1K4MA 2E1PA 3TJMA 2PNJA 3MQ2A 5LL6P 4HNAB 5TX7A 1JKJA 5MN4A 1EP9A 1CQIB 2AL7A 2AEMA 5EKDA 1ZKGA 3D2LA 1LBHA 4DA6A 5B64A 5JDIC 5TR9A 4IV0A 4HLNA 4P0TA 3OESA 3JYLA 2ZJZA 2OHIA 4A6DA 1W0JA 3NT2A 5D85A 3SWWA 1KJWA 4PYRA 1H8AC 1SBQA 2H65A 2P77A 2QUIA 3MXTA 2ATIA 2JFFA 3OJWA 4L85A 4ZOAA 4URVR 1SU6A 1D6SA 2NSYA 2P0YA 4WUVA 1B6SA 2OAP1 5IMSA 4ZJZA 1NUHA 1QYRA 2IYUA 2VHZA 3OURA 1II8B 1W1IA 1ZITA 2EZ4A 1HDEA 3CVXA 2QRNA 1SHTX 3KD2A 3HWSA 2ONCA 1EG2A 4IINA 4L4XA 4MQ5A 2Y69H 2AFRA 1TVKA 3EIUA 4NPHA 5K0BA 3R20A 3VKHA 5DIZA 3V9PA 2JBAA 4FINA 2W8BA 4HNRA 3ZDFA 3L09A 3KFLA 4AMBA 4UD2A 1W36B 1KO5A 1ZN9A 4NMMA 3V7RA 5COBA 1YYVA 5BV2P 3IUMA 5EEGA 2MWMA 3SKYA 1U0BB 1PNQA 2VJBA 1WUYA 3G0DA 2CDCA 5T4HA 4IHJB 4H2DA 1QGPA 4RIFA 2H2GA 4LZZA 1Z75A 3RU3A 1LTQA 1TQPA 2KMLA 2X3YA 4NARA 4Y9TA 1G3TA 4YRDA 4YXWD 2ECFA 3BIXA 1BROA 4XGNA 3VNSA 2QX6A 2LCFA 4XLFA 4L75A 2DJIA 3DFFA 2VHTA 3N86A 4YO8A 3DLLF 2LG4A 1B7GO 2X6XA 3LBAA 2P9ZA 3LT2A 4PK4A 3ANXA 4YPOA 2K9MA 1E9RA 1PR5A 2WD7B 4FHTA 2GHTA 5AUQA 3KU4A 3PDIB 1TZCA 1W36D 2JI4A 4UHTA 2PWAA 3EGOA 4U8HA 3AY0A 1ODIA 4WKOA 3R7NA 1OIXA 5JAMA 4FFSA 3N7AA 2FR1A 1BQ3A 1QHXA 3WKDA 4EHDA 1NXOA 1NF8A 1U6GA 1JDBB 1T1GA 3THOA 3ZU6A 1ZELA 2C7VA 2ONJA 1QZ3A 3B6MA 3DKVA 3T5CA 2YICA 2IPNA 5F12A 2BHTA 1LC0A 2DPYA 3JS5A 2V7VA 1NNLA 1N7IA 3EDPA 3E05A 2ME6A 4IUDS 4RA6B 4E2XA 1XHLA 3F67A 4NZYA 3H05A 3TDKA 1Z21A 3UG6A 4BJ6A 4YJFA 3QODA 1PUFB 3FNIA 4AJNA 1P17A 3BWEA 1FSZA 3PTZA 2VSXA 1ECFA 4K7JA 5JYEA 2AE2A 1ZOSA 1T0PA 1EG7A 2VJMA 2J3MA 3I6IA 4UFNA 1K6EA 5EMJA 2Q9BA 5DHUA 1IN8A 3HA5A 5H4HA 4L08A 3EG9B 1M8KA 1K83J 1SB9A 2Q1UA 3HPRA 4NCNA 3CESA 1L7MA 1M2GA 2A33A 3CZCA 1Y4ZA 3QUAA 4IQGA 5IVIA 3G2IA 5HA5A 3HDVA 1MAVA 3Q88A 1K89A 4EZEA 2BGTA 5FQOA 1IN6A 3T1VA 2RGUA 4C7VA 2OC6A 4WY8A 5DNDA 4XFJA 2VXBA 1R0CA 4U7DA 1SU4A 1E2KA 3EHEA 2XF2A 3GD5A 5DEQA 4I5EA 4Q4HB 5F4ZA 4OX9Y 4Q1CA 2B78A 4MKRA 1C4KA 2QGZA 4LJ4A 4LHEA 4QYWA 4F3CA 1ESMA 1GZ3A 4A3GJ 2YSRA 1FJHA 3OZCA 5CXQA 1ARZA 5EUCA 2Z30A 5M5YJ 4HNSA 4CZ2A 4RVUA 1TT5B 3AOEC 2YJ3A 1PN3A 3OLQA 5FO1A 2BGCA 3V4PB 2Q45A 2JFNA 3TX2A 2FW6A 4F6RA 2Z04A 3WAJA 5H7XA 1JR4A 2ZJ8A 3OTQA 3PHBE 2C4UA 2NXNA 3T0YA 1OY1A 1GARA 3STHA 1Z4IA 1WSUA 1JR3D 3ADBA 3EXG1 4JHLA 2NNWB 2WWWA 4Y1EA 3QNUA 1EUCA 5HGXA 5DH9A 3E5QA 1FDSA 1PEKE 2QLBA 3RVQA 1G42A 1G5IA 1TAQA 1JI3A 2LBPA 4OHXA 3OWXA 5TGDA 3ZD9A 3DSRA 1G2HA 2VUUA 4K6CA 4PSVA 1P4SA 5LDGA 3P0EA 4DV2B 2L9SA 3F46A 4O2AF 3EFHA 4FNOA 3DV8A 2RKOA 2J0UA 3QE9Y 3M82A 3CPSA 3TGPA 3UKGA 2UZ0A 2LXNA 3COVA 1FOYA 4R31A 3NHBA 1H2FA 2SHKA 1L7DA 2HF2A 4GSLA 2XSJC 1Q19A 4A15A 2FSVC 3BEOA 4L9WA 5EJ6A 2E2HJ 3QLVC 4EB0A 2HMAA 3CG4A 2HF9A 4GKKB 4GO1A 2AZ4A 1QZZA 4M83A 4A0RA 1Y4SA 5DCMB 3WQSB 1DHTA 1V26A 4W63A 5BS6A 4R1MA 3QTLA 4HH1A 1U78A 5T4EA 3X2QH 2GDJA 4MPRA 2G8NA 3CUTA 1GV0A 1X7DA 1C5KA 1LDJA 4NQRA 4UE2A 3DZKA 1S29A 4YCCA 4DREA 1FX7A 5K5EA 2IY8A 1FYXA 4X45A 3DBIA 5AKEA 2WNHA 4G25A 4L8LA 3NDRA 4NCIA 4EJUA 4BNCA 3K3PA 3IOMA 4BKQA 5F6FA 4R68A 3M07A 4JCCA 4FFLA 1ZSYA 2WM9B 2YWFA 2B83A 2H1HA 1U2QA 2HRBA 3BT9A 4OHWA 3RK4A 4Y2HA 4AMYA 1JKPC 1I6WA 4R83A 4RAZA 1JQ5A 2VE9A 4V19K 2P4EA 2X40A 3LYUA 5CW2A 5AKHA 2OPBA 2IA2A 1VGRA 1TYDE 2NWQA 3F6SA 4BZPA 1FYWA 4TS9A 1R50A 3QHPA 1YB7A 1RM5A 4JWKA 3KLMX 3Q12A 1NDQA 2QAGB 4FGSA 5D8LB 2VJJA 4YDSA 4PJNA 1Q1EA 3MWLA 4XFKA 2B63J 2AQEA 4TLAA 5HQJA 4RHEA 4IKEA 2BVMA 1JA9A 1QV6A 5BV7A 4M72A 3GTKJ 1L4HA 2OHJA 3RKWA 1RTKA 3ABQB 3CZ4A 3IAXA 3EDRA 3M1LA 3FK6A 2VZEA 2NPOA 2IS4A 3PFBA 3BREA 4I1IA 3ZNNA 2C20A 4V39A 5JS8A 3L9FA 2ISCA 4DNOA 1T0FA 3F3SA 1H1LA 5K05A 4AWXB 5JI6A 2M8GX 2AI2A 2FW1A 2WG1A 4HDMA 4ZAWA 3BQMB 2V7PA 4ITUA 5DUKA 3PEEA 3BUSA 3HRHA 4KWTA 4HPWA 1A5TA 2D1FA 2D4HA 2M1XA 2BIFA 2WU8A 1UKCA 3ANYB 4P08A 1XEXB 2PZMA 4NBKA 4X65B 5LYJF 1QGAA 4YUAA 5HUQA 1UBTS 3MGGA 4QUIA 3FPGA 1W76A 5CB4B 3U16A 5FNVB 4YCNA 3RT1A 3O21A 3GB9A 3T3OA 3TH5A 2VHVA 1WXGA 1BS1A 1XA3A 2C5LA 3PUYA 4NUBA 4L0ZB 2I03A 3RFFA 1VL8A 2OV7A 4URZR 1PDOA 1SKAA 1J33A 3HFJA 3KX2A 1Q7CA 3OJCA 3NBMA 3PC3A 4QVGA 4WOKA 4FYVA 1FK8A 3S15J 2R8PA 3EZFA 3DGEC 4XH9B 5TPZA 1LU9A 2E4VA 1YI0A 4I55F 1EE9A 4ZYUA 2D54A 4R54A 3WTSC 1AU7A 3CPEA 3JALB 5FEMA 1Z26A 1I0IA 3FCUB 5HKAA 5AM5A 3ZMSA 3G2BA 2A5JA 2K87A 2V7UA 2ZB4A 3V4VB 4ATNA 3DOUA 3QRWA 1JHVA 4AMZA 3R6GA 4NJEA 5HKBA 5K8LA 3H87A 1PQYA 2ZPAA 2R6JA 7ABPA 1JUSA 2RGNA 5CA0A 1FP6A 4DABA 3OT1A 3U60B 4X1KB 1F7UA 3VR4H 1T0HB 3I9NA 3S1AB 3BSFA 5A7GA 4H6PA 2C3YA 1BFKA 2W8BB 4D8XA 2NZUG 1HC7A 1ORRA 3CC7I 4Q5SF 1R00A 3UY4A 1DIGA 3FZVA 5D01A 3OPQA 5C4IA 3B1KA 3OHMA 2HZBA 4D3ZA 4EYSA 4ZCTA 4DUYB 1DUXC 1XZGA 1VI5A 3F9CA 4RZSA 4RD3A 3RKUA 2PE5A 3S93A 3KZOA 3GTPJ 4AYWA 1YIAA 2X9LA 2E4WA 3FKQA 4J7UA 2X22A 1V5IA 2EW8A 2EW1A 3HDYA 3NT5A 4R3WA 2DFHA 2LSOA 3ASNH 4RA2A 1DAFA 2J87A 2OSVA 2XMQA 2ZJYA 1QKJA 2YC2C 4XR6A 2MSNA 3BS4A 1GQFA 2FA9A 2Y1KA 1U2WA 3DAYA 3K92A 4EEZA 1A76A 4PVDA 4FFMA 1IBMB 1ZJ4A 2BEOA 3HSYA 3PT5A 4U88A 5LBTA 1X3WB 3C1DA 2G7UA 3ETEA 2BTEA 1AX9A 1CY0A 2I4IA 1FXWA 3HCEA 4MI9A 4P7JA 4UDXX 1PT7A 3U1VA 2QTHA 1FNCA 1NYTA 1VJGA 2VTDA 2RHTA 5DM70 4I99A 1ZICA 2V55B 4JLUA 2V59A 3O94A 4PO3X 5DJ5A 4DJ5X 1FFDA 5JD5A 2ZSFA 2OFFA 3AVVA 4HDSB 5AI6A 5EJ8A 3KR2A 5TIIA 3DDNA 4BO9A 3KQUA 3M3HA 3G71I 2V9KA 3GC6A 2X6TA 4PGFA 5HM8A 2HSGA 2W24A 2GWRA 4A3IJ 1NOKA 3AVUA 1SXJC 3N39C 1P3DA 2IOFA 5LQDA 4NKRA 3QWHA 2B34A 1XSDA 1C80A 4OB8A 4WINA 1DC5A 5L3VA 4KX3A 2OB2A 3WYAA 4NBSA 1RQXA 4UCQA 1FTYA 1FU7A 5HOQA 1W5EA 5ES3A 1N5RA 2BXYA 2Q1SA 3LNTA 1OIWA 5A3VA 4N1AA 1ZCAA 2NSHA 1S2OA 5IJ9B 5E3IA 3TO7A 3FOFC 3IIIA 4X63A 3NVDA 4GXTA 1Z6ZA 3G13A 3GFQA 2AG8A 3TM5A 2XRZA 2DMRA 4HJXA 3MMSA 4MHSA 3RFVA 1Y1SA 2ESHA 1B93A 1U4OA 3ZIUA 1HNNA 4O0LA 5FUWA 4EO7A 2ZIXB 4LCJA 1QF9A 4KO2S 3GLFA 2F3QA 3JD3A 1BXGB 3THYB 2R2AA 2XGMA 2WW8A 3A6HA 3DBVO 3GZ6A 2FRDC 2IEDA 3R3XA 4WERA 2ZT7A 4DZZA 4CKXA 1O6ZA 4CN9A 1Z25A 5FGMA 2OGTA 4XVRA 3TEDA 3G0HA 3AFOA 1K68A 4WNAA 1AZTA 1BS2A 4E7HA 1SCUA 2UUOA 3GJ8A 3ZBTA 3KIPA 3CCQI 3HZOA 3L01A 1TA9A 4IFBA 2ZBRA 3FPLA 2Y93A 4JSRA 4WKCA 3C6BA 4IDAA 3RAGA 3N8NA 3R23A 1Y5IA 1WU7A 1YCDA 3P0IA 1GOTA 2JK1A 4KG7A 5DHRA 3WKCA 3WWPA 5AM2A 1RWPA 1F1ZA 4LD5A 2AXQA 2NQTA 3GUYA 4QIHA 4UM7A 5AESA 4M0LA 1QU2A 4G9GA 3G6EI 1LNSA 2GUWA 5DULA 5I4CA 2HSWA 3H92A 3WK8A 1NNEA 4BS9A 3E8MA 5IYBJ 2AI1A 3F74A 4I9NA 4MQUA 5JJ5A 5KDOA 1FSHA 1VMAA 2FQWA 2XWPA 1XFAA 2I66A 3BULA 4WN9A 4X1OA 4HDQB 4OQYA 5DMHA 4D0SA 4LFAB 4CW7A 3S44A 2PXHA 1Z47A 2A9PA 2VEDA 5EPUA 4DSUA 5JISA 3UYLA 3ANSA 3CF6R 3PU6A 4WXHA 1ORVA 3PHGA 3IQIX 3TSAA 5BUSA 3D9QX 4AYXA 3U7FB 2ZR9A 2DYSH 2PBLA 4PZ0A 5JPCA 1Y8QA 4Y2UA 4UAVA 3ZJYA 2FMTA 2IU0A 4E4TA 5ICEA 1WPGA 3FCAA 1XTUA 4XR4A 3WL5A 3V8LA 4F86A 1W48A 2FLWA 3M6MD 2HY7A 3W1EA 1GPYA 4FC7A 2PRZA 3L7NA 3PFIA 1YT5A 4IRUB 3DE3X 2KDOA 4RZQA 2OA4A 4QDKA 2P6RA 2I22A 2JJMA 4HNHA 2F5FA 4UE6A 1EI9A 3RSGA 1F8UA 3T94A 2VTKA 1K3TA 3WQBA 2A5FA 5EE0A 2E21A 3R9KA 1N1MA 2WVGA 4MS4A 4QOHA 1R6VA 3B1YA 3KQWA 3PCRB 3PF9A 3BH7A 3M5CA 3CCCA 3NPAA 1YJ8A 1JV2B 4HPJB 2FZWA 3L7DA 3F97A 2NSJA 2JH9A 4XEUA 2GZHA 5JLJA 3H6HA 3KJGA 1Z8FA 2OP0A 4KIGA 2QN1A 2XQGA 4EY3A 1AUOA 4D8WA 3DAHA 4M0UA 3TSZA 1MABA 2D1HA 2VQCA 4TZKA 3Q2KA 3ZZNA 4FWBA 1JAZA 1NXQA 1NFFA 3HZRA 3IAM1 5FTJA 2QQ9A 1L3BA 5B7PA 1VSTA 3NXSA 4P7KA 1YH3A 2GYWA 2QUZA 4UUBA 1MNQA 5CU7A 2MYSA 1L8XA 2R7KA 1K4TA 3LSKA 4PGGA 4WBXC 2DTZA 5IYCJ 4WA7A 3L0IB 1TU0A 3CH4B 1HEYA 1T5DX 4C6RA 1VE1A 4O2RA 3KFWX 1T3GA 4AVZA 4I6EA 5PNTA 3OECA 1NVBA 1JLKA 4DA7A 3AINA 3Q15C 2W6JA 4GPZA 2NO9A 3FDYA 3LSHA 1NRIA 1VL2A 1GV1A 2JFHA 2RARA 5F0CA 4KVZA 3L6BA 3V46A 4ZMSA 4GGGA 1EHCA 4IRIA 3PQ6A 1DT5A 4YQEA 2FH5B 2QTAA 3JRHA 3B1WA 4IICA 3CBQA 4ENVA 1ETOA 1C0PA 1IZ9A 1WUJS 2WBMA 1IOWA 4ESVA 3H5VA 3ADCA 3ELWA 3THXA 2XVZA 1ETQA 2K7ZA 4OIFA 4PC6A 2IXEA 2W2OA 2L7ZA 1DU4A 2EG5A 3AHDA 3DHEA 1WOYA 3K6JA 4IIUA 2RNGA 4JLBA 1VQLI 1JEJA 4HLCA 2ZRQA 1NDHA 5GPAA 4RJTA 4IZOA 4D2IA 4K40A 4YJ2B 2DLLA 3NHRA 2TCTA 4QBIA 2PUTA 4ZVMA 4RPHA 2Z2IA 2HGZA 4L9RA 2JLQA 3Q9UA 5A6SA 5K09A 2VPPA 1QTQA 1CPYA 4JUDX 4P9UA 1BCSB 3KRTA 4DRXB 5GTDA 1L7AA 3DM5A 1PD0A 1M76A 4FUTA 2OORA 4L8YA 3E6DA 1EFPA 3ORYA 4LV6A 2KX7A 2EX4A 3OIGA 3J81A 3A05A 3JYHA 1NMZA 3X2SA 1A72A 2Q1TA 3I8OA 4JYBA 2AS0A 1UFVA 3JYQA 3I54A 4ADSG 1LH0A 1SG6A 4HNVA 2FPGA 5AXCA 4H6VA 2Y0SN 1VHWA 3MYYA 1OLTA 2N0SA 3TR6A 4G4SO 1SH7A 4RQBA 4X6YA 1ZVVA 1V16A 3BHMA 5AHXA 1V37A 3QFRA 4LRYA 4ZVVA 2D2VA 2VSOA 1TWFJ 4V2UA 4HVCA 4DV1B 1YE9A 3TDUC 5FD8A 3W1VA 1YO5C 2IFTA 2VPWA 1FPQA 1W44A 3C6MA 1PUXA 2PCJA 4V0RA 4Z3DA 4JP8A 4OLHA 4ES6A 5FFMA 5LEJA 5EYPA 5E8GA 3LVBA 1J9ZA 4GZ6A 1FL9A 4ESEA 1PTJC 2Z1DA 3H13A 4D0LB 4UTZA 4P6VF 1MA3A 1HT1E 1C41A 4NENB 2V6MA 5B5EC 4K0KB 1OPXA 3VEPA 3W2GA 1X7XB 1U5AA 2AOWA 2PZKA 3HVHA 4LJYA 4KLCA 4O29A 1M2WA 1P2TA 4PLVA 5EIFA 3TB6A 5AM0A 1YL6A 4YIIA 5K8TA 2V3CC 1M75A 4ID3A 5A03A 3PGA1 2GKSA 3LDHA 3NJ8A 1TC3C 4PBTA 4XUEA 5FBLB 2NXJA 4OAYA 2ORWA 2OO3A 1CYDA 4CMHA 3SHWA 2DWQA 2WFMA 3TDMA 3WMRA 5IKXA 2PAAA 4NDAA 1EESA 3B6CA 2I1LA 1T08B 4CYMA 5B7NA 3A1WA 3LBNA 1QHNA 4L0QA 1EZ4A 3P97A 3K1AB 2EILH 1CULC 1GRNA 1DJQA 3I28A 4ZCLA 4TYWA 3DKRA 5KVQA 4M6YA 3BERA 4FLEA 1LDDA 1ZEJA 1QUEA 4C0KA 5JC8A 2P6NA 3QOPA 2JW5A 4HK4A 3ZWBA 1AS0A 4B75A 3N8HA 2R9VA 1E3HA 2UYOA 4RLHA 1KTIA 2JA8J 3T5BA 5L45A 2R5YA 1KRHA 3Q87B 3PPWA 2BM8A 5L6LB 2O3JA 5FA6A 1O96B 1ISGA 1UKVY 1WTAA 3AFGA 4KFTA 2I2CA 3X1DA 1XTJA 1IQPA 1KBQA 2QMUA 4LDRA 5HDNA 2Q5CA 2X4LA 3DW1X 3O8QA 5FXMA 1ZJWA 3HFSA 5B6JA 1IZ0A 4LMPA 2GERA 3FDIA 3HLYA 4KKXB 4GBGA 2GARA 2DETA 3F0CA 2WV1A 3HB1A 2VKQA 1XIVA 2IIQA 2ONYA 2O8EA 4JJAA 4D9IA 2ZJ6A 2V6BA 5JSQA 5G4KB 2WTUA 1L4FA 4TXNA 2VJMB 2YU9J 2GJKA 1JT2A 3BD9A 3F96A 4JB2A 5AW5A 3CG0A 1IOLA 4QDOA 2VYCA 4Y8VA 5DTEA 1XMPA 2YCLA 4GBED 2AXEA 2QG9A 4QGAA 5K5OA 3NBUA 4B7AA 2E18A 4RDHA 5KNCD 3ECHA 3T4EA 4W1SA 4BVAA 3Q7IA 3NLLA 4WOCA 1WDWB 1OYIA 3ZMZA 2PX9A 2FMKA 4B34A 2MBFA 4HB0A 1XG1A 1CS4C 3DYBA 4P54A 4C6TA 2C7RA 1H8HD 2WHPB 3NKFA 1ODFA 3KTAB 1M2NA 5KYYA 1KGSA 1SVMA 2QQFA 4MLOA 3OLXA 3HG9A 2OCAA 1XNHA 4TKUB 5FKJA 3V2UA 3KLBA 2O2HA 5HQ3A 1D8TA 1Z4KA 4JL8A 5INTA 1JKRC 4OUKX 1JMKC 2OC9A 3FH0A 2QL7A 1CU1A 4GMHA 1ECPA 2C1EA 1XTZA 3TSYA 1FJ2A 4ER3A 4DQXA 1QGUB 3HCFA 3F6RA 2R7DA 3F23A 3HJTA 4QPQA 2DQRA 2JZOA 1KQPA 2A9OA 1I3NA 1CD5A 5FBWB 1KJZA 3EFOA 2PQ2A 2I6TA 1MZVA 1W6RA 4RM3A 1KFCB 2YQ4A 3BD8A 1WZCA 4M89A 1C4XA 3LU1A 2WWRA 3WGNA 2HDOA 1LPQA 4EG1A 4RE5A 3AIMA 5C37A 2PN6A 3QOFA 2QEXI 2WT4A 3S7TA 5AIBA 4L4RA 2A1UA 4DJTA 5DBGA 3RTBA 5AW6A 3ITEA 3QRFF 3RWOA 5FBQB 3T0GA 5L3SB 4CO8A 5T4FA 2DHEA 3U2RA 1XZ8A 1ABEA 1PV2A 1H2RS 2F8MA 4QQFA 5B4VA 1K5GA 1W85B 2LMDA 2IYYA 2YQ5A 3IULA 1KAEA 2C31A 3L7WA 3RBXA 3E9YA 2PEZA 1Y82A 3KKKA 1WV1A 5TLSA 4Y52J 4JKYA 4XIFA 4WXCA 4PLWA 1M73E 1YHNA 1ZH8A 1NU8A 3BSYA 1ZC3A 3JQAD 3SLRA 2ZLBA 4C0HA 2JSPA 3OO1A 1IY8A 1BRTA 2SCUA 4B79A 1BU5A 1NT2A 2Y1GA 2I5PO 1FDRA 3HYTA 3ZXUB 4LJ8A 3FGNA 1TKRA 2HKIA 2V54A 3E8XA 5HILA 4F55A 1QRRA 1NVAA 2BY2A 5EY5B 2Q5FA 2P5VA 1WKBA 1W25A 121PA 4JXKA 4TKMA 1B15A 2CW0F 3CD6I 2F1IA 2C3MA 3P27A 4OAQA 4L5AA 2JPCA 4US2R 3JR7A 4HS9A 4TQ9A 3ROZA 5EERA 2M87A 1DTWB 5CAEB 1G1AA 4MJXA 3D0QA 3R0XA 4IHWA 4TS3A 1C8VB 1UAGA 3GEZA 2XYQA 1VIAA 2CNKA 1XPXA 3HOSA 3HS3A 5HZHA 1N2ZA 2CYAA 2F43B 2I4MA 5FBRB 2FD5A 3FTEA 1L8OA 2KT0A 1TO1E 2C4MA 2VHUA 4G0PA 3VSAA 3CVUA 5HFNA 5CVCA 1FEZA 4MMYB 3U26A 4DSAA 4XYBA 2DWUA 1D6JA 4PCQA 2C04A 3A6FA 5CLJA 2M8EA 3HJAA 4J9UE 3NTUA 4JOMA 5AW8A 1AZSC 2JGAA 4Z99A 1JI0A 3SJAA 1U8BA 1YKGA 2WB1N 4FILA 5GOTA 3BMQB 4ZOLF 5TQ0B 4AICA 3CY6A 4FZVA 1YJ5A 3RYFA 2P81A 3L0PA 3TZHA 1HMPA 4XTRA 3RVPA 4E21A 3M33A 4BO0A 4KN8A 3LHSA 3K8OE 5BN5A 2R1ZA 3ZMUA 3PITA 2A6TA 1SKQA 2P65A 2Y76A 3ME5A 1X9GA 4MQ4A 4QHTA 2IPXA 3RV4A 4RDUA 4C14A 2IK8A 4N49A 1U6KA 4B82A 2FU5C 3TF5A 3ZHBA 5IRCD 2GILA 1C7JA 3EXFB 1CJVC 3L84A 4QU9A 2M0CA 4I8DA 4GXOA 4JI3B 2BDUA 5JECA 1YTUA 2WSYB 3ZD8A 3E1SA 1SELA 3KQYA 5K3FA 1FFAA 3NU1A 5JSHA 4N0BA 3NO4A 2FXVA 3ZE7A 5EQJB 2B99A 4LVUA 1AMOA 1HG1A 2C57A 3AM5A 1II0A 1HSJA 1V8OA 1NASA 3H86A 1BGVA 4KDCA 2MA3A 4YV7A 5C3EJ 4DR5B 4IO0A 3GRKA 1SCQA 2ZBEA 1WCV1 4XX0A 3CXUA 2QTVB 4WEQA 2C99A 2GI4A 2ZRCA 4RA9B 2G17A 4Y9RA 5EOVA 1ETVA 2JPBA 1GTSA 1TL7C 4JEMA 1HE5A 4G0QA 2ELKA 2KRCA 1MR3F 2IZOA 1OV6A 2WSSD 1RIOH 5JHHB 1XMKA 1QBJA 1FIAA 3N7TA 2M2IA 3LRXA 2E5WA 3A4VA 4TM7A 5EJGA 2ODAA 2AD5A 2BKVA 4TWIA 5EGSA 3WDKA 4D81A 4BGDA 1J0DA 2EV0A 4CCWA 1VLZA 1FX0A 1IATA 4ZPXA 2HMSA 4MUGA 4JIMA 4D8VA 2ZRMA 4B43A 4HLUA 2AMLA 4K9KA 4MP3A 4C4TA 2QJRA 4G67A 3WLEA 1ZJZA 5K20A 4Q9NA 4YMHA 1O94A 4ETWA 1IXKA 1L4LA 1KMNA 1SUSA 4NBNA 2BMEA 1JAYA 2EPFA 4AJLA 2VDRB 3UHFA 3PDIA 3U3MA 4ZOLB 4P3YA 1W29A 4O4JA 1SOUA 1K5HA 1UBMS 1VM6A 2IHZA 3FRJA 1XX6A 4HFNA 1EHIA 5CFRA 2J07A 3RC8A 5IT9K 2RB4A 3BZWA 5JXHA 1CZRA 3JQ9A 4EA9A 2VWQA 4M73A 1I4TD 2WPNA 2FPPA 4PAGA 3I01A 5GVSA 4XR9A 2JGLA 2A1UB 4LTDA 4LLGF 2CVHA 4QU0A 3TI9A 1KYWA 1QCDA 4KRXA 1UC4B 1QPIA 3KUKA 5I8PA 4LF5B 1NR1A 1JT6A 4C2TA 3M4YA 4E14A 1QPBA 2CXOA 5B6IA 2VKHA 1R22A 3DNMA 2R7TA 1U2GA 1Y1TA 2FXIA 2GZMA 2Y1OA 3D8HA 4RF3A 1T6NA 4WGGA 4DBLC 2PXAA 1CJMA 3CKYA 3JQBA 2IPOA 4AZ0B 1TK2A 2X0FA 3LGSA 3RRNA 2JTVA 1Z07A 4M38A 4K88A 4KXFB 5EJ9A 2YYSA 2QN9A 3GTGJ 2ZYSA 3KQPA 1OE0A 1DBWA 3X2EA 2P9CA 3B6IA 4LCEA 1TQMA 1VP3A 2FPWA 3H3XA 1OCPA 1FZPB 3KJFA 1NMXA 1PG2A 3QHAA 4MUJA 2F4OB 2ZXEA 1U8EA 1Q16A 1CUGA 1W4RA 2ZUTA 5GJCA 4EPTA 1EH5A 2A0XA 5JSKA 1IZYA 1JTXA 2E4ZA 4B6EA 4M1QA 4PYLA 5KKAA 4NEQA 4BFXA 1JEQB 4BQEA 2K3FA 5F35A 5GJWC 4N6GA 1W34A 4UAUA 3ZEAA 3IQXA 3ZGVA 3LL7A 4EHFA 3GN2A 1RHJA 5DLQC 3HRTA 3HQ4O 3DBLA 1U8AA 4Q9IA 5FOSA 5LRSA 1YU6A 2VWHA 5KKCA 2B4YA 2HZTA 4DIOA 5BPHA 1U94A 3ITNA 1ODCA 2P1DA 1IGNA 2ZAOA 3FTPA 3MSXA 4IH1A 2KIQA 1KS9A 4KXWA 5EZYF 4MPTA 3OCXA 5ERYA 4A3DJ 4D3DA 2D1QA 4BV9A 1X7YB 4I55B 3L8FA 1C81A 3I2YX 3GARA 1R4MB 1ZUNB 1ENOA 3O9VA 4YMSA 3WLKX 2QG4A 4DPMA 2MMCA 2ADUA 3B9RA 1GKLA 1IB0A 4LJ5A 3S2EA 3KSBC 1X4OA 2XF5A 1GYQA 1TM1E 3H0DA 3FKSA 3IPYA 1XELA 4A9AA 5DI3B 5DTMA 5FLXA 1TKAA 3QPBA 5A7HA 1E3OC 1OAKA 4WDQA 3HKBA 1XRSB 4UBMA 4KPFC 1DU0A 1X19A 1GNQA 2H0AA 3T1NA 1Z4QA 3EODA 5CFNA 1IN1A 4ZVSA 4JY7A 4NENA 3RZOJ 3NC0C 3QQPA 5E7JA 3FCOA 4KXXA 2B35A 1YUBA 4NIMA 1T8IA 4WCFC 3GZNB 1SC1A 1YDWA 4B09A 1XEWY 2XMGA 4IXDA 4RKQA 1NG6A 2F1KA 1RAGA 4XPIA 3VAAA 1PK9A 3REQA 1BMTA 1KYXA 1UKEA 2GM3A 3ZWMA 2DPDA 1B6TA 1EQAA 1FYEA 3D7RA 3RHFA 2FEPA 4CMEA 1R16A 4PIMA 5CYOA 4R84A 1YRAA 3PS9A 4LVNA 5BURA 2A61A 1ND5A 1U0FA 3ILVA 1UMCA 5DS9A 2WYIA 2O07A 4FVTA 3GRAA 4E08A 4K3VA 3RUDA 4A6XA 1GAEO 1IWBB 3E7LA 4JT2A 5LYJA 4EG5A 2W58A 2JA1A 3Q1LA 3RR2A 1JFVA 2CE2X 3X1XA 3Q85A 4TN5A 3GH1A 1GGMA 3Q3CA 1SKYE 1XT6A 3K1AA 1FFSA 1ZSNA 3FVRA 3Q2OA 4JVLA 4FYMA 4RNCA 3PNKA 4DUGA 2HJGA 3OD1A 2IGMA 1OB5A 1YFZA 1Z9BA 2D5LA 2CJJA 2HCFA 2V7BA 2F2TA 4CM3A 4H7JA 4E4RA 4YT2A 3H3FA 4RSGA 4ZGGA 3MUEA 3WTUC 3JQCA 4HDNB 3S32A 3F7OA 1PYOA 1SRQA 4JU8A 4G0VA 5A6SB 2QRPA 3E6BA 4F52A 3G7NA 4D97A 4JI4B 2JDIA 3HNPA 4P3OA 4WW0A 3IWZA 4FTWA 2KBFA 1C2YA 3NH9A 2EIJH 1O97D 2IUEA 1PJBA 3TVTA 4F97A 2RIRA 3DFMA 2OZ6A 4G89A 4U9UA 5CH8A 3J7AY 1SUDA 2EDCA 3STXA 2YJ6A 4CHTA 1I5OA 4TKVB 5IM5A 3PDUA 4C9YA 3BICA 1C14A 1TC1A 1VP9A 1X70A 2WLTA 2FPMA 1ZJJA 2CBXA 4JKOA 1QLHA 1S3SA 4V2FA 2P0AA 1IEWA 1EFRD 1K7FB 3JCZA 2AC2A 3LCUA 4LDNA 1QVAA 2L9NA 1T9AA 1KAMA 2GCEA 2IITA 3BTCA 4IJAA 3LP8A 3O1JC 1JKXA 2OTLI 4P1WA 1R0RE 2HI0A 4A23A 5J2TA 4AVYA 1E6KA 2ZIFA 3NWSA 2FWJA 3CLOA 1OBFO 1QH0A 4Q24A 2VBGA 3A31A 5KQLA 1CIJA 3BR5A 2VBCA 3I9LA 3ND6A 3OQVA 4TXHA 3GO4A 3VM6A 5LXTA 3GYGA 1AQNA 4J7XA 3TL4X 2VXOA 3R7SA 2ESNA 3T7RA 1TLFA 1NNUA 4M0DA 4C7BA 1AQLA 1U8UA 4I0BA 3IPAA 1VDZA 2DT5A 2A9QA 2HLDA 2YVUA 2CC2A 1FYDA 3OE7A 4JJGA 4KMFA 1G8YA 1O7FA 4GS5A 4P81A 5CLQA 4WN3A 3M3DA 1MB4A 5F77A 3ROGA 3FB1A 4TKZA 2CSXA 4ISCA 3HBNA 5IN5A 1Q0SA 4YAEA 3VZBA 2YS9A 5JO9A 5FLMJ 2A0FA 1IG0A 2OXIA 3IQZA 1TIKA 2EZ9A 3D4IA 4G41A 4M0KA 3UTDA 1YRBA 4Q9LA 5K7FA 1U0RA 1N3LA 5LQAA 4J3JA 4EVRA 1LPMA 4ACBA 4NNPA 2IHYA 1LE8B 1OWOA 5AIPA 4YJGA 3MEXA 2P9BA 3BL8A 3WHIA 4CUKA 1DBPA 2AEEA 2R65A 5JSFA 1HDYA 2UUPA 4G01B 1FUYB 2O5VA 4N82A 3VPXA 1JR2A 4OBBA 5AHOA 2JZNA 2OCIA 2Q7DA 3WMFA 3C3CA 1UXJA 4NZ9A 2C2HA 1G7CA 1JSCA 2L82A 2XA9A 2JCYA 1L6RA 1J0XO 1G3WA 3R0VA 3G5MA 1ZSVA 5JDCC 3THXB 4RCYA 2RKBA 3KKOA 3UMYA 3JTHA 4ZCMA 4JX5A