1KZJA

Crystal structure of ects w80g/dump/cb3717 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIGDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan 80 and leucine 143 are critical for the hydride transfer step of thymidylate synthase by controlling active site access.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Escherichia coli
total genus 80
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1kzjA00
3I3RA 1B02A 3IJZA 4DP3A 2G8XA 3UM8A 2A9WA 1FWMA 1B5DA 1BO8A 4O1UA 5H39A 4EB4A 1AN5A 3EGYX 1TLCA 3N5EB 1J3KC 1HVYA 1JUJA 1VZAA 1KCEA 1SYNA 2TSCA 1BPJA 1VZBA 1BSPA 1BIDA 4XSDA 1EVGA 3NRRA 1F4EA 1BQ2A 4Q0EA 3BHRA 3KGBA 2KCEA 3QGTA 1TISA 4IRRA 4KY4A 1ZPRA 1NJDA 4EILA 4E5OA 1FFLA 3KJRA 2FTOX 1BDUA 1F4GA 1TSLA 1TSZA 2G89A 3IX6A 3BZ0A 4H0UA 1BP0A 5J7WA 2H2QA 4IQQA 3V8HA 1JMHA 1TVWA 1TSNA 3UWLB 1JTQA 1AIQA 3DG8C 1BKOA 1NJAA 1TSMA 4XSEA 4PSGA 4UP1A 3EJLA 2OIPA 1RTSA 3H9KA 3N5GA 3GH0A 3KJSA 1J3IC 5HS3A 5BY6A 3CL9A 5FCTA 1F4DA 1AXWA 1NJBA 2RD8B 1VZDA 1QQQA 1HW4A 3TMSA 3EF9A 3EDWX 3HB8A 1TJSA 4IQBA 1DNAA 4LRRA 3BHLA 1F28A 3BFIA 1AJMA 2VF0A 2ONBA 3DL5A 4DQ1A 3ED7A 1VZCA 1THYA 2BBQA 4FOGA 2TDMA 1TRGA 3EHIX 3DGAC 1TSXA 1F4CA 1J3JC 5WRNA 4FGTA 2FTNA 4G2OX 4G6WX 1LCAA 4H0RA 3B9HA 3DL6A 5H3AA 3BYXA 4Q0DA 2AAZA 3IK0A 3CLBA 1BKPA 3IHIA 1BP6A 3K2HA 4F2VA 4GD7A 1B49A 4EZ8A 4TMSA 1HZWA 3UM6A 4ISWA 1VZEA 3QG2A 1JUTA 1EV8A 1LCBA 4EINA 3C0AA 2FTQA 3EAWX 4DPDA 3EBUA 1TVVA 4FOAA 4KYAA 2RDAA 3BNZA 4O1XA 5H38A 3IRNA 3HBBA 3INVA 1I00A 1TDUA 1JTUA 1TSWA 1TVUA 1JMGA 1TYSA 2G8DA 1DDUA 1F4FA 1KZIA 3JSUA 1TDBA 1HW3A 1EV5A 3IK1A 3IRMA 3N5EA 1BQ1A 1KZJA 1TDAA 1YPVA 1B5EA 2RD8A 4DPHA 2TDDA 3GH2X 1JG0A 1SEJA 4O1XD 3QJ7A 3B5BA 4XSCA 3HJ3A 4E28A 3GG5A 1BO7A 1NJEA 4KY8A 3UM5A 4KPWA 2G86A 1JMFA 1NCEA 1AOBA 3BGXA 2TSRA 1TSYA 4ECKA 3OB7A 1JMIA 2G8AA 4KNZA 1QZFA 4GEVA 1CI7A 1LCEA 1TSVA 3C06A 4ISKA 1EVFA 1BJGA 4FQSA 3UWLA 4FOXA 2VETA 1F4BA 1TSDA 3IROA 1TDCA 1NJCA 4JEFA 1JU6A 1BSFA 4H1IA 4GYHA 1TLSA 4O7UA
chains in the Genus database with same CATH superfamily
3I3RA 1B02A 3IJZA 4DP3A 2G8XA 3UM8A 2A9WA 1FWMA 1B5DA 1BO8A 4O1UA 5H39A 4EB4A 1AN5A 3EGYX 1TLCA 3N5EB 1J3KC 1HVYA 1JUJA 1VZAA 1KCEA 1SYNA 2TSCA 1BPJA 1VZBA 1BSPA 1BIDA 4XSDA 1EVGA 3NRRA 1F4EA 1BQ2A 4Q0EA 3BHRA 3KGBA 2KCEA 3QGTA 1TISA 4IRRA 4KY4A 1ZPRA 1NJDA 4EILA 4E5OA 1FFLA 3KJRA 2FTOX 1BDUA 1F4GA 1TSLA 1TSZA 2G89A 3IX6A 3BZ0A 4H0UA 1BP0A 5J7WA 2H2QA 4IQQA 3V8HA 1JMHA 1TVWA 1TSNA 3UWLB 1JTQA 1AIQA 3DG8C 1BKOA 1NJAA 1TSMA 4XSEA 4PSGA 4UP1A 3EJLA 2OIPA 1RTSA 3H9KA 3N5GA 3GH0A 3KJSA 1J3IC 5HS3A 5BY6A 3CL9A 5FCTA 1F4DA 1AXWA 1NJBA 2RD8B 1VZDA 1QQQA 1HW4A 3TMSA 3EF9A 3EDWX 3HB8A 1TJSA 4IQBA 1DNAA 4LRRA 3BHLA 1F28A 3BFIA 1AJMA 2VF0A 2ONBA 3DL5A 4DQ1A 3ED7A 1VZCA 1THYA 2BBQA 4FOGA 2TDMA 1TRGA 3EHIX 3DGAC 1TSXA 1F4CA 1J3JC 5WRNA 4FGTA 2FTNA 4G2OX 4G6WX 1LCAA 4H0RA 3B9HA 3DL6A 5H3AA 3BYXA 4Q0DA 2AAZA 3IK0A 3CLBA 1BKPA 3IHIA 1BP6A 3K2HA 4F2VA 4GD7A 1B49A 4EZ8A 4TMSA 1HZWA 3UM6A 4ISWA 1VZEA 3QG2A 1JUTA 1EV8A 1LCBA 4EINA 3C0AA 2FTQA 3EAWX 4DPDA 3EBUA 1TVVA 4FOAA 4KYAA 2RDAA 3BNZA 4O1XA 5H38A 3IRNA 3HBBA 3INVA 1I00A 1TDUA 1JTUA 1TSWA 1TVUA 1JMGA 1TYSA 2G8DA 1DDUA 1F4FA 1KZIA 3JSUA 1TDBA 1HW3A 1EV5A 3IK1A 3IRMA 3N5EA 1BQ1A 1KZJA 1TDAA 1YPVA 1B5EA 2RD8A 4DPHA 2TDDA 3GH2X 1JG0A 1SEJA 4O1XD 3QJ7A 3B5BA 4XSCA 3HJ3A 4E28A 3GG5A 1BO7A 1NJEA 4KY8A 3UM5A 4KPWA 2G86A 1JMFA 1NCEA 1AOBA 3BGXA 2TSRA 1TSYA 4ECKA 3OB7A 1JMIA 2G8AA 4KNZA 1QZFA 4GEVA 1CI7A 1LCEA 1TSVA 3C06A 4ISKA 1EVFA 1BJGA 4FQSA 3UWLA 4FOXA 2VETA 1F4BA 1TSDA 3IROA 1TDCA 1NJCA 4JEFA 1JU6A 1BSFA 4H1IA 4GYHA 1TLSA 4O7UA
chains in the Genus database with same CATH topology
3I3RA 1B02A 3IJZA 4DP3A 2G8XA 3UM8A 2A9WA 1FWMA 1B5DA 1BO8A 4O1UA 5H39A 4EB4A 1AN5A 3EGYX 1TLCA 3N5EB 1J3KC 1HVYA 1JUJA 1VZAA 1KCEA 1SYNA 2TSCA 1BPJA 1VZBA 1BSPA 1BIDA 4XSDA 1EVGA 3NRRA 1F4EA 1BQ2A 4Q0EA 3BHRA 3KGBA 2KCEA 3QGTA 1TISA 4IRRA 4KY4A 1ZPRA 1NJDA 4EILA 4E5OA 1FFLA 3KJRA 2FTOX 1BDUA 1F4GA 1TSLA 1TSZA 2G89A 3IX6A 3BZ0A 4H0UA 1BP0A 5J7WA 2H2QA 4IQQA 3V8HA 1JMHA 1TVWA 1TSNA 3UWLB 1JTQA 1AIQA 3DG8C 1BKOA 1NJAA 1TSMA 4XSEA 4PSGA 4UP1A 3EJLA 2OIPA 1RTSA 3H9KA 3N5GA 3GH0A 3KJSA 1J3IC 5HS3A 5BY6A 3CL9A 5FCTA 1F4DA 1AXWA 1NJBA 2RD8B 1VZDA 1QQQA 1HW4A 3TMSA 3EF9A 3EDWX 3HB8A 1TJSA 4IQBA 1DNAA 4LRRA 3BHLA 1F28A 3BFIA 1AJMA 2VF0A 2ONBA 3DL5A 4DQ1A 3ED7A 1VZCA 1THYA 2BBQA 4FOGA 2TDMA 1TRGA 3EHIX 3DGAC 1TSXA 1F4CA 1J3JC 5WRNA 4FGTA 2FTNA 4G2OX 4G6WX 1LCAA 4H0RA 3B9HA 3DL6A 5H3AA 3BYXA 4Q0DA 2AAZA 3IK0A 3CLBA 1BKPA 3IHIA 1BP6A 3K2HA 4F2VA 4GD7A 1B49A 4EZ8A 4TMSA 1HZWA 3UM6A 4ISWA 1VZEA 3QG2A 1JUTA 1EV8A 1LCBA 4EINA 3C0AA 2FTQA 3EAWX 4DPDA 3EBUA 1TVVA 4FOAA 4KYAA 2RDAA 3BNZA 4O1XA 5H38A 3IRNA 3HBBA 3INVA 1I00A 1TDUA 1JTUA 1TSWA 1TVUA 1JMGA 1TYSA 2G8DA 1DDUA 1F4FA 1KZIA 3JSUA 1TDBA 1HW3A 1EV5A 3IK1A 3IRMA 3N5EA 1BQ1A 1KZJA 1TDAA 1YPVA 1B5EA 2RD8A 4DPHA 2TDDA 3GH2X 1JG0A 1SEJA 4O1XD 3QJ7A 3B5BA 4XSCA 3HJ3A 4E28A 3GG5A 1BO7A 1NJEA 4KY8A 3UM5A 4KPWA 2G86A 1JMFA 1NCEA 1AOBA 3BGXA 2TSRA 1TSYA 4ECKA 3OB7A 1JMIA 2G8AA 4KNZA 1QZFA 4GEVA 1CI7A 1LCEA 1TSVA 3C06A 4ISKA 1EVFA 1BJGA 4FQSA 3UWLA 4FOXA 2VETA 1F4BA 1TSDA 3IROA 1TDCA 1NJCA 4JEFA 1JU6A 1BSFA 4H1IA 4GYHA 1TLSA 4O7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3R A;  1B02 A;  3IJZ A;  4DP3 A;  2G8X A;  3UM8 A;  2A9W A;  1FWM A;  1B5D A;  1BO8 A;  4O1U A;  5H39 A;  4EB4 A;  1AN5 A;  3EGY X;  1TLC A;  3N5E B;  1J3K C;  1HVY A;  1JUJ A;  1VZA A;  1KCE A;  1SYN A;  2TSC A;  1BPJ A;  1VZB A;  1BSP A;  1BID A;  4XSD A;  1EVG A;  3NRR A;  1F4E A;  1BQ2 A;  4Q0E A;  3BHR A;  3KGB A;  2KCE A;  3QGT A;  1TIS A;  4IRR A;  4KY4 A;  1ZPR A;  1NJD A;  4EIL A;  4E5O A;  1FFL A;  3KJR A;  2FTO X;  1BDU A;  1F4G A;  1TSL A;  1TSZ A;  2G89 A;  3IX6 A;  3BZ0 A;  4H0U A;  1BP0 A;  5J7W A;  2H2Q A;  4IQQ A;  3V8H A;  1JMH A;  1TVW A;  1TSN A;  3UWL B;  1JTQ A;  1AIQ A;  3DG8 C;  1BKO A;  1NJA A;  1TSM A;  4XSE A;  4PSG A;  4UP1 A;  3EJL A;  2OIP A;  1RTS A;  3H9K A;  3N5G A;  3GH0 A;  3KJS A;  1J3I C;  5HS3 A;  5BY6 A;  3CL9 A;  5FCT A;  1F4D A;  1AXW A;  1NJB A;  2RD8 B;  1VZD A;  1QQQ A;  1HW4 A;  3TMS A;  3EF9 A;  3EDW X;  3HB8 A;  1TJS A;  4IQB A;  1DNA A;  4LRR A;  3BHL A;  1F28 A;  3BFI A;  1AJM A;  2VF0 A;  2ONB A;  3DL5 A;  4DQ1 A;  3ED7 A;  1VZC A;  1THY A;  2BBQ A;  4FOG A;  2TDM A;  1TRG A;  3EHI X;  3DGA C;  1TSX A;  1F4C A;  1J3J C;  5WRN A;  4FGT A;  2FTN A;  4G2O X;  4G6W X;  1LCA A;  4H0R A;  3B9H A;  3DL6 A;  5H3A A;  3BYX A;  4Q0D A;  2AAZ A;  3IK0 A;  3CLB A;  1BKP A;  3IHI A;  1BP6 A;  3K2H A;  4F2V A;  4GD7 A;  1B49 A;  4EZ8 A;  4TMS A;  1HZW A;  3UM6 A;  4ISW A;  1VZE A;  3QG2 A;  1JUT A;  1EV8 A;  1LCB A;  4EIN A;  3C0A A;  2FTQ A;  3EAW X;  4DPD A;  3EBU A;  1TVV A;  4FOA A;  4KYA A;  2RDA A;  3BNZ A;  4O1X A;  5H38 A;  3IRN A;  3HBB A;  3INV A;  1I00 A;  1TDU A;  1JTU A;  1TSW A;  1TVU A;  1JMG A;  1TYS A;  2G8D A;  1DDU A;  1F4F A;  1KZI A;  3JSU A;  1TDB A;  1HW3 A;  1EV5 A;  3IK1 A;  3IRM A;  3N5E A;  1BQ1 A;  1KZJ A;  1TDA A;  1YPV A;  1B5E A;  2RD8 A;  4DPH A;  2TDD A;  3GH2 X;  1JG0 A;  1SEJ A;  4O1X D;  3QJ7 A;  3B5B A;  4XSC A;  3HJ3 A;  4E28 A;  3GG5 A;  1BO7 A;  1NJE A;  4KY8 A;  3UM5 A;  4KPW A;  2G86 A;  1JMF A;  1NCE A;  1AOB A;  3BGX A;  2TSR A;  1TSY A;  4ECK A;  3OB7 A;  1JMI A;  2G8A A;  4KNZ A;  1QZF A;  4GEV A;  1CI7 A;  1LCE A;  1TSV A;  3C06 A;  4ISK A;  1EVF A;  1BJG A;  4FQS A;  3UWL A;  4FOX A;  2VET A;  1F4B A;  1TSD A;  3IRO A;  1TDC A;  1NJC A;  4JEF A;  1JU6 A;  1BSF A;  4H1I A;  4GYH A;  1TLS A;  4O7U A; 
#chains in the Genus database with same CATH topology
 3I3R A;  1B02 A;  3IJZ A;  4DP3 A;  2G8X A;  3UM8 A;  2A9W A;  1FWM A;  1B5D A;  1BO8 A;  4O1U A;  5H39 A;  4EB4 A;  1AN5 A;  3EGY X;  1TLC A;  3N5E B;  1J3K C;  1HVY A;  1JUJ A;  1VZA A;  1KCE A;  1SYN A;  2TSC A;  1BPJ A;  1VZB A;  1BSP A;  1BID A;  4XSD A;  1EVG A;  3NRR A;  1F4E A;  1BQ2 A;  4Q0E A;  3BHR A;  3KGB A;  2KCE A;  3QGT A;  1TIS A;  4IRR A;  4KY4 A;  1ZPR A;  1NJD A;  4EIL A;  4E5O A;  1FFL A;  3KJR A;  2FTO X;  1BDU A;  1F4G A;  1TSL A;  1TSZ A;  2G89 A;  3IX6 A;  3BZ0 A;  4H0U A;  1BP0 A;  5J7W A;  2H2Q A;  4IQQ A;  3V8H A;  1JMH A;  1TVW A;  1TSN A;  3UWL B;  1JTQ A;  1AIQ A;  3DG8 C;  1BKO A;  1NJA A;  1TSM A;  4XSE A;  4PSG A;  4UP1 A;  3EJL A;  2OIP A;  1RTS A;  3H9K A;  3N5G A;  3GH0 A;  3KJS A;  1J3I C;  5HS3 A;  5BY6 A;  3CL9 A;  5FCT A;  1F4D A;  1AXW A;  1NJB A;  2RD8 B;  1VZD A;  1QQQ A;  1HW4 A;  3TMS A;  3EF9 A;  3EDW X;  3HB8 A;  1TJS A;  4IQB A;  1DNA A;  4LRR A;  3BHL A;  1F28 A;  3BFI A;  1AJM A;  2VF0 A;  2ONB A;  3DL5 A;  4DQ1 A;  3ED7 A;  1VZC A;  1THY A;  2BBQ A;  4FOG A;  2TDM A;  1TRG A;  3EHI X;  3DGA C;  1TSX A;  1F4C A;  1J3J C;  5WRN A;  4FGT A;  2FTN A;  4G2O X;  4G6W X;  1LCA A;  4H0R A;  3B9H A;  3DL6 A;  5H3A A;  3BYX A;  4Q0D A;  2AAZ A;  3IK0 A;  3CLB A;  1BKP A;  3IHI A;  1BP6 A;  3K2H A;  4F2V A;  4GD7 A;  1B49 A;  4EZ8 A;  4TMS A;  1HZW A;  3UM6 A;  4ISW A;  1VZE A;  3QG2 A;  1JUT A;  1EV8 A;  1LCB A;  4EIN A;  3C0A A;  2FTQ A;  3EAW X;  4DPD A;  3EBU A;  1TVV A;  4FOA A;  4KYA A;  2RDA A;  3BNZ A;  4O1X A;  5H38 A;  3IRN A;  3HBB A;  3INV A;  1I00 A;  1TDU A;  1JTU A;  1TSW A;  1TVU A;  1JMG A;  1TYS A;  2G8D A;  1DDU A;  1F4F A;  1KZI A;  3JSU A;  1TDB A;  1HW3 A;  1EV5 A;  3IK1 A;  3IRM A;  3N5E A;  1BQ1 A;  1KZJ A;  1TDA A;  1YPV A;  1B5E A;  2RD8 A;  4DPH A;  2TDD A;  3GH2 X;  1JG0 A;  1SEJ A;  4O1X D;  3QJ7 A;  3B5B A;  4XSC A;  3HJ3 A;  4E28 A;  3GG5 A;  1BO7 A;  1NJE A;  4KY8 A;  3UM5 A;  4KPW A;  2G86 A;  1JMF A;  1NCE A;  1AOB A;  3BGX A;  2TSR A;  1TSY A;  4ECK A;  3OB7 A;  1JMI A;  2G8A A;  4KNZ A;  1QZF A;  4GEV A;  1CI7 A;  1LCE A;  1TSV A;  3C06 A;  4ISK A;  1EVF A;  1BJG A;  4FQS A;  3UWL A;  4FOX A;  2VET A;  1F4B A;  1TSD A;  3IRO A;  1TDC A;  1NJC A;  4JEF A;  1JU6 A;  1BSF A;  4H1I A;  4GYH A;  1TLS A;  4O7U A; 
#chains in the Genus database with same CATH homology
 3I3R A;  1B02 A;  3IJZ A;  4DP3 A;  2G8X A;  3UM8 A;  2A9W A;  1FWM A;  1B5D A;  1BO8 A;  4O1U A;  5H39 A;  4EB4 A;  1AN5 A;  3EGY X;  1TLC A;  3N5E B;  1J3K C;  1HVY A;  1JUJ A;  1VZA A;  1KCE A;  1SYN A;  2TSC A;  1BPJ A;  1VZB A;  1BSP A;  1BID A;  4XSD A;  1EVG A;  3NRR A;  1F4E A;  1BQ2 A;  4Q0E A;  3BHR A;  3KGB A;  2KCE A;  3QGT A;  1TIS A;  4IRR A;  4KY4 A;  1ZPR A;  1NJD A;  4EIL A;  4E5O A;  1FFL A;  3KJR A;  2FTO X;  1BDU A;  1F4G A;  1TSL A;  1TSZ A;  2G89 A;  3IX6 A;  3BZ0 A;  4H0U A;  1BP0 A;  5J7W A;  2H2Q A;  4IQQ A;  3V8H A;  1JMH A;  1TVW A;  1TSN A;  3UWL B;  1JTQ A;  1AIQ A;  3DG8 C;  1BKO A;  1NJA A;  1TSM A;  4XSE A;  4PSG A;  4UP1 A;  3EJL A;  2OIP A;  1RTS A;  3H9K A;  3N5G A;  3GH0 A;  3KJS A;  1J3I C;  5HS3 A;  5BY6 A;  3CL9 A;  5FCT A;  1F4D A;  1AXW A;  1NJB A;  2RD8 B;  1VZD A;  1QQQ A;  1HW4 A;  3TMS A;  3EF9 A;  3EDW X;  3HB8 A;  1TJS A;  4IQB A;  1DNA A;  4LRR A;  3BHL A;  1F28 A;  3BFI A;  1AJM A;  2VF0 A;  2ONB A;  3DL5 A;  4DQ1 A;  3ED7 A;  1VZC A;  1THY A;  2BBQ A;  4FOG A;  2TDM A;  1TRG A;  3EHI X;  3DGA C;  1TSX A;  1F4C A;  1J3J C;  5WRN A;  4FGT A;  2FTN A;  4G2O X;  4G6W X;  1LCA A;  4H0R A;  3B9H A;  3DL6 A;  5H3A A;  3BYX A;  4Q0D A;  2AAZ A;  3IK0 A;  3CLB A;  1BKP A;  3IHI A;  1BP6 A;  3K2H A;  4F2V A;  4GD7 A;  1B49 A;  4EZ8 A;  4TMS A;  1HZW A;  3UM6 A;  4ISW A;  1VZE A;  3QG2 A;  1JUT A;  1EV8 A;  1LCB A;  4EIN A;  3C0A A;  2FTQ A;  3EAW X;  4DPD A;  3EBU A;  1TVV A;  4FOA A;  4KYA A;  2RDA A;  3BNZ A;  4O1X A;  5H38 A;  3IRN A;  3HBB A;  3INV A;  1I00 A;  1TDU A;  1JTU A;  1TSW A;  1TVU A;  1JMG A;  1TYS A;  2G8D A;  1DDU A;  1F4F A;  1KZI A;  3JSU A;  1TDB A;  1HW3 A;  1EV5 A;  3IK1 A;  3IRM A;  3N5E A;  1BQ1 A;  1KZJ A;  1TDA A;  1YPV A;  1B5E A;  2RD8 A;  4DPH A;  2TDD A;  3GH2 X;  1JG0 A;  1SEJ A;  4O1X D;  3QJ7 A;  3B5B A;  4XSC A;  3HJ3 A;  4E28 A;  3GG5 A;  1BO7 A;  1NJE A;  4KY8 A;  3UM5 A;  4KPW A;  2G86 A;  1JMF A;  1NCE A;  1AOB A;  3BGX A;  2TSR A;  1TSY A;  4ECK A;  3OB7 A;  1JMI A;  2G8A A;  4KNZ A;  1QZF A;  4GEV A;  1CI7 A;  1LCE A;  1TSV A;  3C06 A;  4ISK A;  1EVF A;  1BJG A;  4FQS A;  3UWL A;  4FOX A;  2VET A;  1F4B A;  1TSD A;  3IRO A;  1TDC A;  1NJC A;  4JEF A;  1JU6 A;  1BSF A;  4H1I A;  4GYH A;  1TLS A;  4O7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...