1KZNA

Crystal structure of e. coli 24kda domain in complex with clorobiocin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
205
structure length
186
Chain Sequence
GLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIGVSAAEVIMTVLHAHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA gyrase interaction with coumarin-based inhibitors: the role of the hydroxybenzoate isopentenyl moiety and the 5'-methyl group of the noviose.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT B
total genus 55
structure length 186
sequence length 205
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2002-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1kznA00
3VADA 1YS3A 4U7NA 1THNA 1YT2A 2XHTA 5M4HA 5CF0A 1UYIA 4JAVA 4PL9A 3O6OA 1UYEA 4O07A 2VCJA 4EGIA 4P8OA 3B28A 4XITA 3RLPA 4CWSA 1UY9A 4V25A 3TTZA 4U93A 3A0RA 1Y8NA 4YKXA 3OMUA 3TUHA 3CRKA 5BOCA 2YE7A 5FNFA 5M4KA 4XDMA 3TZ2A 4O05A 1GKZA 4URNA 4CE1A 2GQPA 3R4OA 4YKWA 4P7AA 2YEAA 4LWIA 2AKPA 1I58A 2YEJA 4YKUA 4CWFA 2XX5A 3NMQA 3H80A 3ZKBA 4FCRA 5C93A 1UY7A 2IWXA 4XCJA 2YKIA 1QYEA 2YKCA 5M4NA 3ZXOA 4MBCA 3ZM7A 1EI1A 1Y4UA 3ZXQA 1L0OA 4KSHA 2WI2A 3A0YA 3PEJA 4GGLA 3HYYA 2WEQA 5GGZA 4EM7A 4GCZA 4MP7A 4YKQA 3QDDA 1BYQA 2YECA 4CWNA 4KQVA 3CGZA 2YE9A 4HZ5A 3T10A 3IEDA 4UROA 4YKRA 3R92A 4NH8A 4ASBA 1NHHA 1YT0A 2WI7A 4K4OA 2YI6A 3O0IA 4E01A 1EA6A 3TZ4A 4HZ0A 2XJGA 4W7TA 4KFGA 1I5BA 2XDLA 4XC0A 2WI1A 1UYGA 4QPKA 3OPDA 1YSZA 1YSRA 4CWPA 4L91A 1KZNA 3H4LA 2XDXA 4XCLA 2BYIA 3RLRA 4CWQA 1Z59A 4BQGA 3EKOA 2H8MA 4AWPA 3GIFA 1BKNA 2XJXA 3ZKDA 4KTNA 4AWOA 1AM1A 1R62A 1JM6A 4BIUA 1TBWA 4CWTA 4YKTA 4AWQA 3K60A 3D36A 1ID0A 2Q8FA 2Q2EB 3K99A 4XTJA 4CWRA 5FWKA 4NH9A 3SL2A 4MOTA 4FCQA 4DZYA 3Q5KA 4O09A 3MNRP 3HZ1A 1UYKA 4L94A 2ZDYA 3R4MA 3K97A 2Q8IA 4XE2A 3RKZA 2YE8A 5CPHA 1BXDA 4H81A 2Q8HA 3EHGA 4ZVIA 4L8ZA 1S16A 2WI4A 2JKIA 2YGEA 2E0AA 1BGQA 3A0TA 1Y4SA 4NH7A 4EGKA 2XX4A 4L93A 1TIDA 2ZKJA 1AMWA 2BU2A 2ESAA 4HYPA 3A0ZA 1I5CA 2YEIA 5CTWA 1A4HA 2YE2A 1B3QA 3GIGB 2BZ5A 1YT1A 5F3KA 5IDMA 2FWZA 4PRVA 3U67A 2JJCA 5D7RA 1UYCA 4PU9A 3CRLA 4EGHA 3VHCA 1NHIA 3WQ9A 4YKZA 1UY8A 4YKYA 3LPSA 3CWVA 1AH6A 2YGFA 3C11A 1U2OA 1UYMA 2YE3A 4LP0A 4PRXA 3TZ0A 2GFDA 2WI6A 3BMYA 2K5BA 4XIRA 2BU7A 2XHXA 3OWDA 2CGFA 2QG2A 3VHAA 3WHAA 2VW5A 4BIZA 5F5RA 2YGAA 4DUHA 3G7BA 1MX0A 1YC1A 2O1WA 3T2SA 1QZRA 4EFUA 1MU5A 1TC6A 2UWDA 2QG0A 4H85A 1Y8OA 1ZXMA 2XK2A 4AS9A 2PNRA 4KP4A 1YC3A 5L3JA 2BU6A 2IWSA 3D2RA 2HCHA 3EHHA 4FCPA 2YK9A 3T0HA 2ZBKB 4XD8A 3G75A 4LWHA 5J71A 5IN9A 1B63A 2YKEA 5IDJA 2FYPA 2IOPA 4GFNA 2YEDA 4GT8A 2YE4A 1OSFA 5M4EA 2BU8A 2YEFA 4MPNA 3FV5A 4KSGA 4JQLA 4MP2A 2IORA 5CTYA 1UYLA 4O04A 2YE5A 1H7UA 3FT5A 4E00A 1GKXA 1S14A 5M4MA 1B62A 2WI5A 3HZ5A 5D7DA 4ZKIA 4WUDA 1NHJA 3OWBA 4XKAA 4XIQA 4Q20A 4CE2A 4CE3A 2YI0A 3B26A 2FWYA 2YJWA 4LWGA 4QPJA 3K98A 4ASFA 3PEHA 3Q5JA 4EEHA 2XDUA 4ASGA 4FMTA 3BM9A 3GIEA 4LPBA 3RLQA 4HY6A 5FNDA 1AJ6A 1QY8A 3U2KA 1I59A 4GEEA 4H7QA 2YI5A 2BREA 4R1FA 3R91A 4B7PA 1YETA 3Q5LA 2CCUA 2IOQA 2C2AA 3EKRA 2ZDXA 5M4PA 2H55A 2YKJA 4FPPA 3HYZA 2XDSA 1PVGA 4HXWA 1GJVA 1ZW9A 2XJJA 3EHFA 1ZWHA 3LNUA 3A0WA 4WUBA 2HKJA 3CGYA 2XX2A 2FXSA 1TC0A 2XDKA 2BYHA 5D6PA 3VHDA 4JASA 2O1UA 3T0ZA 4JAUA 4XIPA 4MPEA 2BTZA 3GIGA 3B24A 1AH8A 3HHUA 3INXA 2BU5A 4HYMA 4CWOA 2YEHA 4BQJA 4MB9A 2BT0A 4URLA 2BRCA 2O1VA 4ASAA 2IWUA 1UYFA 4R3AA 1TILA 2CCSA 3U2DA 4MPCA 4XKKA 1TH8A 2XCMA 2YEGA 3G7EA 3JZ3A 2WI3A 4V26A 4L90A 5J6AA 2VCIA 4BXIA 3TZ5A 1US7A 2YJXA 5CTUA 1YERA 2EXLA 1YC4A 2YI7A 2CG9A 2WERA 4LWFA 4B6CA 2BSMA 4I5SA 1UYHA 4URMA 2QFOA 4XKOA 2QF6A 3OW6A 3HEKA 2YE6A 4R3MA 2YEBA 2XHRA 4GQTA 3B27A 4WUCA 1U0ZA 1YESA 2CH4A 3R4PA 1I5AA 4EMVA 3O2FA 2VWCA 3C0EA 2Q8GA 4U7OA 4HY1A 1ZXNA 4O0BA 1Z5AA 4BAEA 2WEPA 3B25A 4I3HA 4EFTA 3R4NA 4X9LA 1I5DA 1H7SA 4HXZA 5CTXA 3INWA 5D7CA 3D0BA 1Z5CA 3EHJA 1Y8PA 2XD6A 3FT8A 2YKBA 1UY6A 3DGEA 4LWEA 2YK2A 5FNCA 2CCTA 1Z5BA 2XABA 3A0XA 3T1KA 3KE6A 3QTFA 2YEEA 5D6QA 1KIJA 2HG1A 5BODA 1UYDA 4E02A
chains in the Genus database with same CATH superfamily
3VADA 1YS3A 4U7NA 1THNA 1YT2A 2XHTA 5M4HA 5CF0A 1UYIA 4JAVA 4PL9A 3O6OA 1UYEA 4O07A 2VCJA 4EGIA 4P8OA 3B28A 4XITA 3RLPA 4CWSA 1UY9A 4V25A 3TTZA 4U93A 3A0RA 1Y8NA 4YKXA 3OMUA 3TUHA 3CRKA 5BOCA 2YE7A 5FNFA 5M4KA 4XDMA 3TZ2A 4O05A 1GKZA 4URNA 4CE1A 2GQPA 3R4OA 4YKWA 4P7AA 2YEAA 4LWIA 2AKPA 1I58A 2YEJA 4YKUA 4CWFA 2XX5A 3NMQA 3H80A 3ZKBA 4FCRA 5C93A 1UY7A 2IWXA 4XCJA 1F51A 2YKIA 1QYEA 2YKCA 5M4NA 3ZXOA 4MBCA 3ZM7A 1EI1A 1Y4UA 3ZXQA 1L0OA 4KSHA 2WI2A 3A0YA 3PEJA 4GGLA 3HYYA 2WEQA 5GGZA 4EM7A 4GCZA 4MP7A 4YKQA 3QDDA 1BYQA 2YECA 4CWNA 4KQVA 3CGZA 2YE9A 4HZ5A 3T10A 3IEDA 4UROA 4YKRA 3R92A 4NH8A 4ASBA 1NHHA 1YT0A 2WI7A 4K4OA 2YI6A 3O0IA 4E01A 1EA6A 3TZ4A 4HZ0A 2XJGA 4W7TA 4KFGA 1I5BA 2XDLA 4XC0A 2WI1A 1UYGA 4QPKA 3OPDA 1YSZA 1YSRA 4CWPA 4L91A 1KZNA 3H4LA 2XDXA 4XCLA 2BYIA 3RLRA 4CWQA 1Z59A 4BQGA 3EKOA 2H8MA 4AWPA 3GIFA 1BKNA 2XJXA 3ZKDA 4KTNA 4AWOA 1AM1A 1R62A 1JM6A 4BIUA 1TBWA 4CWTA 4YKTA 4AWQA 3K60A 3D36A 1ID0A 2Q8FA 2Q2EB 3K99A 4XTJA 4CWRA 5FWKA 4NH9A 3SL2A 4MOTA 2C1IA 4FCQA 4DZYA 3Q5KA 4O09A 3MNRP 3HZ1A 1UYKA 4L94A 2ZDYA 3R4MA 3K97A 2Q8IA 4XE2A 3RKZA 2YE8A 5CPHA 1BXDA 4H81A 2Q8HA 3EHGA 4ZVIA 4L8ZA 1S16A 2WI4A 2JKIA 2YGEA 2E0AA 1BGQA 3A0TA 1Y4SA 4NH7A 4EGKA 2XX4A 4L93A 1TIDA 5JENA 2ZKJA 1AMWA 2BU2A 2ESAA 4HYPA 3A0ZA 1I5CA 2YEIA 5CTWA 1A4HA 2YE2A 1B3QA 3GIGB 2BZ5A 1YT1A 5F3KA 5IDMA 2FWZA 4PRVA 3U67A 2JJCA 5D7RA 1UYCA 4PU9A 3CRLA 4EGHA 3VHCA 1NHIA 3WQ9A 4YKZA 1UY8A 4YKYA 3LPSA 3CWVA 1AH6A 2YGFA 3C11A 3LMMA 1U2OA 1UYMA 2YE3A 4LP0A 4PRXA 3TZ0A 2GFDA 2WI6A 3BMYA 2K5BA 4XIRA 2BU7A 2XHXA 3OWDA 2CGFA 2QG2A 3VHAA 3WHAA 2VW5A 4BIZA 5F5RA 2YGAA 4DUHA 3G7BA 1MX0A 1YC1A 2O1WA 3T2SA 1QZRA 4EFUA 1MU5A 1TC6A 2UWDA 2QG0A 4H85A 1Y8OA 1ZXMA 2XK2A 4AS9A 2PNRA 4KP4A 1YC3A 5L3JA 2BU6A 2IWSA 3D2RA 2HCHA 3EHHA 4FCPA 2YK9A 3T0HA 2ZBKB 4XD8A 3G75A 4LWHA 5J71A 5IN9A 1B63A 2YKEA 5IDJA 2FYPA 2IOPA 4GFNA 2YEDA 4GT8A 2YE4A 1OSFA 5M4EA 2BU8A 2YEFA 4MPNA 3FV5A 4KSGA 4JQLA 4MP2A 2IORA 5CTYA 1UYLA 4O04A 2YE5A 1H7UA 3FT5A 4E00A 1GKXA 1S14A 5M4MA 1B62A 2WI5A 3HZ5A 5D7DA 4ZKIA 4WUDA 1NHJA 3OWBA 4XKAA 4XIQA 1IXMA 4Q20A 4CE2A 4CE3A 2YI0A 3B26A 2FWYA 2YJWA 4LWGA 4QPJA 3K98A 4ASFA 3PEHA 3Q5JA 4EEHA 3S5TA 2XDUA 4ASGA 4FMTA 3BM9A 3GIEA 4LPBA 3RLQA 4HY6A 5FNDA 1AJ6A 1QY8A 3U2KA 1I59A 4GEEA 4H7QA 2YI5A 2BREA 4R1FA 3R91A 4B7PA 1YETA 3Q5LA 2CCUA 2IOQA 2C2AA 3EKRA 2ZDXA 5M4PA 2H55A 2YKJA 4FPPA 3HYZA 2XDSA 1PVGA 4HXWA 1GJVA 1ZW9A 2XJJA 3EHFA 1ZWHA 3LNUA 3A0WA 4WUBA 2HKJA 3CGYA 2XX2A 2FXSA 1TC0A 2XDKA 2BYHA 5D6PA 3VHDA 4JASA 2O1UA 3T0ZA 4JAUA 4XIPA 4MPEA 2BTZA 3GIGA 2FTKA 3B24A 1AH8A 3HHUA 3INXA 2BU5A 4HYMA 4CWOA 2YEHA 4BQJA 4MB9A 2BT0A 4URLA 2BRCA 2O1VA 4ASAA 2IWUA 1UYFA 4R3AA 1TILA 2CCSA 3U2DA 4MPCA 2C1GA 4XKKA 1TH8A 2XCMA 2YEGA 3G7EA 3JZ3A 2WI3A 4V26A 4L90A 5J6AA 2VCIA 4BXIA 3TZ5A 1US7A 2YJXA 5CTUA 1YERA 2HHIA 2EXLA 1YC4A 2YI7A 4E72A 2CG9A 2WERA 4LWFA 4B6CA 2BSMA 4I5SA 1UYHA 4URMA 2QFOA 4XKOA 2QF6A 3OW6A 3HEKA 2YE6A 4R3MA 2YEBA 2XHRA 4GQTA 3B27A 4WUCA 1U0ZA 1YESA 2CH4A 3R4PA 1I5AA 4EMVA 3O2FA 2VWCA 3C0EA 2Q8GA 4U7OA 4HY1A 1ZXNA 4O0BA 1Z5AA 4BAEA 2WEPA 3B25A 4I3HA 4EFTA 3R4NA 4X9LA 1I5DA 1H7SA 4HXZA 5CTXA 3INWA 5D7CA 3D0BA 1Z5CA 3EHJA 1Y8PA 2XD6A 3FT8A 2YKBA 1UY6A 3DGEA 4LWEA 2YK2A 5FNCA 2CCTA 1Z5BA 2XABA 3CYGA 3A0XA 3T1KA 3KE6A 3QTFA 2YEEA 5D6QA 1KIJA 2HG1A 5BODA 1UYDA 4E02A
chains in the Genus database with same CATH topology
3VADA 1YS3A 4U7NA 1THNA 1YT2A 2XHTA 5M4HA 5CF0A 1UYIA 4JAVA 4PL9A 3O6OA 1UYEA 4O07A 2VCJA 4EGIA 4P8OA 3B28A 4XITA 3RLPA 4CWSA 1UY9A 4V25A 3TTZA 4U93A 3A0RA 1Y8NA 4YKXA 3OMUA 3TUHA 3CRKA 5BOCA 2YE7A 5FNFA 5M4KA 4XDMA 3TZ2A 4O05A 1GKZA 4URNA 4CE1A 2GQPA 3R4OA 4YKWA 4P7AA 2YEAA 4LWIA 2AKPA 1I58A 2YEJA 4YKUA 4CWFA 2XX5A 3NMQA 3H80A 3ZKBA 4FCRA 5C93A 1UY7A 2IWXA 4XCJA 2YKIA 1QYEA 2YKCA 5M4NA 3ZXOA 4MBCA 3ZM7A 1EI1A 1Y4UA 3ZXQA 1L0OA 4KSHA 2WI2A 3A0YA 3PEJA 4GGLA 3HYYA 2WEQA 5GGZA 4EM7A 4GCZA 4MP7A 4YKQA 3QDDA 1BYQA 2YECA 4CWNA 4KQVA 3CGZA 2YE9A 4HZ5A 3T10A 3IEDA 4UROA 4YKRA 3R92A 4NH8A 4ASBA 1NHHA 1YT0A 2WI7A 4K4OA 2YI6A 3O0IA 4E01A 1EA6A 3TZ4A 4HZ0A 2XJGA 4W7TA 4KFGA 1I5BA 2XDLA 4XC0A 2WI1A 1UYGA 4QPKA 3OPDA 1YSZA 1YSRA 4CWPA 4L91A 1KZNA 3H4LA 2XDXA 4XCLA 2BYIA 3RLRA 4CWQA 1Z59A 4BQGA 3EKOA 2H8MA 4AWPA 3GIFA 1BKNA 2XJXA 3ZKDA 4KTNA 4AWOA 1AM1A 1R62A 1JM6A 4BIUA 1TBWA 4CWTA 4YKTA 4AWQA 3K60A 3D36A 1ID0A 2Q8FA 2Q2EB 3K99A 4XTJA 4CWRA 5FWKA 4NH9A 3SL2A 4MOTA 4FCQA 4DZYA 3Q5KA 4O09A 3MNRP 3HZ1A 1UYKA 4L94A 2ZDYA 3R4MA 3K97A 2Q8IA 4XE2A 3RKZA 2YE8A 5CPHA 1BXDA 4H81A 2Q8HA 3EHGA 4ZVIA 4L8ZA 1S16A 2WI4A 2JKIA 2YGEA 2E0AA 1BGQA 3A0TA 1Y4SA 4NH7A 4EGKA 2XX4A 4L93A 1TIDA 2ZKJA 1AMWA 2BU2A 2ESAA 4HYPA 3A0ZA 1I5CA 2YEIA 5CTWA 1A4HA 2YE2A 1B3QA 3GIGB 2BZ5A 1YT1A 5F3KA 5IDMA 2FWZA 4PRVA 3U67A 2JJCA 5D7RA 1UYCA 4PU9A 3CRLA 4EGHA 3VHCA 1NHIA 3WQ9A 4YKZA 1UY8A 4YKYA 3LPSA 3CWVA 1AH6A 2YGFA 3C11A 1U2OA 1UYMA 2YE3A 4LP0A 4PRXA 3TZ0A 2GFDA 2WI6A 3BMYA 2K5BA 4XIRA 2BU7A 2XHXA 3OWDA 2CGFA 2QG2A 3VHAA 3WHAA 2VW5A 4BIZA 5F5RA 2YGAA 4DUHA 3G7BA 1MX0A 1YC1A 2O1WA 3T2SA 1QZRA 4EFUA 1MU5A 1TC6A 2UWDA 2QG0A 4H85A 1Y8OA 1ZXMA 2XK2A 4AS9A 2PNRA 4KP4A 1YC3A 5L3JA 2BU6A 2IWSA 3D2RA 2HCHA 3EHHA 4FCPA 2YK9A 3T0HA 2ZBKB 4XD8A 3G75A 4LWHA 5J71A 5IN9A 1B63A 2YKEA 5IDJA 2FYPA 2IOPA 4GFNA 2YEDA 4GT8A 2YE4A 1OSFA 5M4EA 2BU8A 2YEFA 4MPNA 3FV5A 4KSGA 4JQLA 4MP2A 2IORA 5CTYA 1UYLA 4O04A 2YE5A 1H7UA 3FT5A 4E00A 1GKXA 1S14A 5M4MA 1B62A 2WI5A 3HZ5A 5D7DA 4ZKIA 4WUDA 1NHJA 3OWBA 4XKAA 4XIQA 4Q20A 4CE2A 4CE3A 2YI0A 3B26A 2FWYA 2YJWA 4LWGA 4QPJA 3K98A 4ASFA 3PEHA 3Q5JA 4EEHA 2XDUA 4ASGA 4FMTA 3BM9A 3GIEA 4LPBA 3RLQA 4HY6A 5FNDA 1AJ6A 1QY8A 3U2KA 1I59A 4GEEA 4H7QA 2YI5A 2BREA 4R1FA 3R91A 4B7PA 1YETA 3Q5LA 2CCUA 2IOQA 2C2AA 3EKRA 2ZDXA 5M4PA 2H55A 2YKJA 4FPPA 3HYZA 2XDSA 1PVGA 4HXWA 1GJVA 1ZW9A 2XJJA 3EHFA 1ZWHA 3LNUA 3A0WA 4WUBA 2HKJA 3CGYA 2XX2A 2FXSA 1TC0A 2XDKA 2BYHA 5D6PA 3VHDA 4JASA 2O1UA 3T0ZA 4JAUA 4XIPA 4MPEA 2BTZA 3GIGA 3B24A 1AH8A 3HHUA 3INXA 2BU5A 4HYMA 4CWOA 2YEHA 4BQJA 4MB9A 2BT0A 4URLA 2BRCA 2O1VA 4ASAA 2IWUA 1UYFA 4R3AA 1TILA 2CCSA 3U2DA 4MPCA 4XKKA 1TH8A 2XCMA 2YEGA 3G7EA 3JZ3A 2WI3A 4V26A 4L90A 5J6AA 2VCIA 4BXIA 3TZ5A 1US7A 2YJXA 5CTUA 1YERA 2EXLA 1YC4A 2YI7A 2CG9A 2WERA 4LWFA 4B6CA 2BSMA 4I5SA 1UYHA 4URMA 2QFOA 4XKOA 2QF6A 3OW6A 3HEKA 2YE6A 4R3MA 2YEBA 2XHRA 4GQTA 3B27A 4WUCA 1U0ZA 1YESA 2CH4A 3R4PA 1I5AA 4EMVA 3O2FA 2VWCA 3C0EA 2Q8GA 4U7OA 4HY1A 1ZXNA 4O0BA 1Z5AA 4BAEA 2WEPA 3B25A 4I3HA 4EFTA 3R4NA 4X9LA 1I5DA 1H7SA 4HXZA 5CTXA 3INWA 5D7CA 3D0BA 1Z5CA 3EHJA 1Y8PA 2XD6A 3FT8A 2YKBA 1UY6A 3DGEA 4LWEA 2YK2A 5FNCA 2CCTA 1Z5BA 2XABA 3A0XA 3T1KA 3KE6A 3QTFA 2YEEA 5D6QA 1KIJA 2HG1A 5BODA 1UYDA 4E02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAD A;  1YS3 A;  4U7N A;  1THN A;  1YT2 A;  2XHT A;  5M4H A;  5CF0 A;  1UYI A;  4JAV A;  4PL9 A;  3O6O A;  1UYE A;  4O07 A;  2VCJ A;  4EGI A;  4P8O A;  3B28 A;  4XIT A;  3RLP A;  4CWS A;  1UY9 A;  4V25 A;  3TTZ A;  4U93 A;  3A0R A;  1Y8N A;  4YKX A;  3OMU A;  3TUH A;  3CRK A;  5BOC A;  2YE7 A;  5FNF A;  5M4K A;  4XDM A;  3TZ2 A;  4O05 A;  1GKZ A;  4URN A;  4CE1 A;  2GQP A;  3R4O A;  4YKW A;  4P7A A;  2YEA A;  4LWI A;  2AKP A;  1I58 A;  2YEJ A;  4YKU A;  4CWF A;  2XX5 A;  3NMQ A;  3H80 A;  3ZKB A;  4FCR A;  5C93 A;  1UY7 A;  2IWX A;  4XCJ A;  2YKI A;  1QYE A;  2YKC A;  5M4N A;  3ZXO A;  4MBC A;  3ZM7 A;  1EI1 A;  1Y4U A;  3ZXQ A;  1L0O A;  4KSH A;  2WI2 A;  3A0Y A;  3PEJ A;  4GGL A;  3HYY A;  2WEQ A;  5GGZ A;  4EM7 A;  4GCZ A;  4MP7 A;  4YKQ A;  3QDD A;  1BYQ A;  2YEC A;  4CWN A;  4KQV A;  3CGZ A;  2YE9 A;  4HZ5 A;  3T10 A;  3IED A;  4URO A;  4YKR A;  3R92 A;  4NH8 A;  4ASB A;  1NHH A;  1YT0 A;  2WI7 A;  4K4O A;  2YI6 A;  3O0I A;  4E01 A;  1EA6 A;  3TZ4 A;  4HZ0 A;  2XJG A;  4W7T A;  4KFG A;  1I5B A;  2XDL A;  4XC0 A;  2WI1 A;  1UYG A;  4QPK A;  3OPD A;  1YSZ A;  1YSR A;  4CWP A;  4L91 A;  1KZN A;  3H4L A;  2XDX A;  4XCL A;  2BYI A;  3RLR A;  4CWQ A;  1Z59 A;  4BQG A;  3EKO A;  2H8M A;  4AWP A;  3GIF A;  1BKN A;  2XJX A;  3ZKD A;  4KTN A;  4AWO A;  1AM1 A;  1R62 A;  1JM6 A;  4BIU A;  1TBW A;  4CWT A;  4YKT A;  4AWQ A;  3K60 A;  3D36 A;  1ID0 A;  2Q8F A;  2Q2E B;  3K99 A;  4XTJ A;  4CWR A;  5FWK A;  4NH9 A;  3SL2 A;  4MOT A;  4FCQ A;  4DZY A;  3Q5K A;  4O09 A;  3MNR P;  3HZ1 A;  1UYK A;  4L94 A;  2ZDY A;  3R4M A;  3K97 A;  2Q8I A;  4XE2 A;  3RKZ A;  2YE8 A;  5CPH A;  1BXD A;  4H81 A;  2Q8H A;  3EHG A;  4ZVI A;  4L8Z A;  1S16 A;  2WI4 A;  2JKI A;  2YGE A;  2E0A A;  1BGQ A;  3A0T A;  1Y4S A;  4NH7 A;  4EGK A;  2XX4 A;  4L93 A;  1TID A;  2ZKJ A;  1AMW A;  2BU2 A;  2ESA A;  4HYP A;  3A0Z A;  1I5C A;  2YEI A;  5CTW A;  1A4H A;  2YE2 A;  1B3Q A;  3GIG B;  2BZ5 A;  1YT1 A;  5F3K A;  5IDM A;  2FWZ A;  4PRV A;  3U67 A;  2JJC A;  5D7R A;  1UYC A;  4PU9 A;  3CRL A;  4EGH A;  3VHC A;  1NHI A;  3WQ9 A;  4YKZ A;  1UY8 A;  4YKY A;  3LPS A;  3CWV A;  1AH6 A;  2YGF A;  3C11 A;  1U2O A;  1UYM A;  2YE3 A;  4LP0 A;  4PRX A;  3TZ0 A;  2GFD A;  2WI6 A;  3BMY A;  2K5B A;  4XIR A;  2BU7 A;  2XHX A;  3OWD A;  2CGF A;  2QG2 A;  3VHA A;  3WHA A;  2VW5 A;  4BIZ A;  5F5R A;  2YGA A;  4DUH A;  3G7B A;  1MX0 A;  1YC1 A;  2O1W A;  3T2S A;  1QZR A;  4EFU A;  1MU5 A;  1TC6 A;  2UWD A;  2QG0 A;  4H85 A;  1Y8O A;  1ZXM A;  2XK2 A;  4AS9 A;  2PNR A;  4KP4 A;  1YC3 A;  5L3J A;  2BU6 A;  2IWS A;  3D2R A;  2HCH A;  3EHH A;  4FCP A;  2YK9 A;  3T0H A;  2ZBK B;  4XD8 A;  3G75 A;  4LWH A;  5J71 A;  5IN9 A;  1B63 A;  2YKE A;  5IDJ A;  2FYP A;  2IOP A;  4GFN A;  2YED A;  4GT8 A;  2YE4 A;  1OSF A;  5M4E A;  2BU8 A;  2YEF A;  4MPN A;  3FV5 A;  4KSG A;  4JQL A;  4MP2 A;  2IOR A;  5CTY A;  1UYL A;  4O04 A;  2YE5 A;  1H7U A;  3FT5 A;  4E00 A;  1GKX A;  1S14 A;  5M4M A;  1B62 A;  2WI5 A;  3HZ5 A;  5D7D A;  4ZKI A;  4WUD A;  1NHJ A;  3OWB A;  4XKA A;  4XIQ A;  4Q20 A;  4CE2 A;  4CE3 A;  2YI0 A;  3B26 A;  2FWY A;  2YJW A;  4LWG A;  4QPJ A;  3K98 A;  4ASF A;  3PEH A;  3Q5J A;  4EEH A;  2XDU A;  4ASG A;  4FMT A;  3BM9 A;  3GIE A;  4LPB A;  3RLQ A;  4HY6 A;  5FND A;  1AJ6 A;  1QY8 A;  3U2K A;  1I59 A;  4GEE A;  4H7Q A;  2YI5 A;  2BRE A;  4R1F A;  3R91 A;  4B7P A;  1YET A;  3Q5L A;  2CCU A;  2IOQ A;  2C2A A;  3EKR A;  2ZDX A;  5M4P A;  2H55 A;  2YKJ A;  4FPP A;  3HYZ A;  2XDS A;  1PVG A;  4HXW A;  1GJV A;  1ZW9 A;  2XJJ A;  3EHF A;  1ZWH A;  3LNU A;  3A0W A;  4WUB A;  2HKJ A;  3CGY A;  2XX2 A;  2FXS A;  1TC0 A;  2XDK A;  2BYH A;  5D6P A;  3VHD A;  4JAS A;  2O1U A;  3T0Z A;  4JAU A;  4XIP A;  4MPE A;  2BTZ A;  3GIG A;  3B24 A;  1AH8 A;  3HHU A;  3INX A;  2BU5 A;  4HYM A;  4CWO A;  2YEH A;  4BQJ A;  4MB9 A;  2BT0 A;  4URL A;  2BRC A;  2O1V A;  4ASA A;  2IWU A;  1UYF A;  4R3A A;  1TIL A;  2CCS A;  3U2D A;  4MPC A;  4XKK A;  1TH8 A;  2XCM A;  2YEG A;  3G7E A;  3JZ3 A;  2WI3 A;  4V26 A;  4L90 A;  5J6A A;  2VCI A;  4BXI A;  3TZ5 A;  1US7 A;  2YJX A;  5CTU A;  1YER A;  2EXL A;  1YC4 A;  2YI7 A;  2CG9 A;  2WER A;  4LWF A;  4B6C A;  2BSM A;  4I5S A;  1UYH A;  4URM A;  2QFO A;  4XKO A;  2QF6 A;  3OW6 A;  3HEK A;  2YE6 A;  4R3M A;  2YEB A;  2XHR A;  4GQT A;  3B27 A;  4WUC A;  1U0Z A;  1YES A;  2CH4 A;  3R4P A;  1I5A A;  4EMV A;  3O2F A;  2VWC A;  3C0E A;  2Q8G A;  4U7O A;  4HY1 A;  1ZXN A;  4O0B A;  1Z5A A;  4BAE A;  2WEP A;  3B25 A;  4I3H A;  4EFT A;  3R4N A;  4X9L A;  1I5D A;  1H7S A;  4HXZ A;  5CTX A;  3INW A;  5D7C A;  3D0B A;  1Z5C A;  3EHJ A;  1Y8P A;  2XD6 A;  3FT8 A;  2YKB A;  1UY6 A;  3DGE A;  4LWE A;  2YK2 A;  5FNC A;  2CCT A;  1Z5B A;  2XAB A;  3A0X A;  3T1K A;  3KE6 A;  3QTF A;  2YEE A;  5D6Q A;  1KIJ A;  2HG1 A;  5BOD A;  1UYD A;  4E02 A; 
#chains in the Genus database with same CATH topology
 3VAD A;  1YS3 A;  4U7N A;  1THN A;  1YT2 A;  2XHT A;  5M4H A;  5CF0 A;  1UYI A;  4JAV A;  4PL9 A;  3O6O A;  1UYE A;  4O07 A;  2VCJ A;  4EGI A;  4P8O A;  3B28 A;  4XIT A;  3RLP A;  4CWS A;  1UY9 A;  4V25 A;  3TTZ A;  4U93 A;  3A0R A;  1Y8N A;  4YKX A;  3OMU A;  3TUH A;  3CRK A;  5BOC A;  2YE7 A;  5FNF A;  5M4K A;  4XDM A;  3TZ2 A;  4O05 A;  1GKZ A;  4URN A;  4CE1 A;  2GQP A;  3R4O A;  4YKW A;  4P7A A;  2YEA A;  4LWI A;  2AKP A;  1I58 A;  2YEJ A;  4YKU A;  4CWF A;  2XX5 A;  3NMQ A;  3H80 A;  3ZKB A;  4FCR A;  5C93 A;  1UY7 A;  2IWX A;  4XCJ A;  1F51 A;  2YKI A;  1QYE A;  2YKC A;  5M4N A;  3ZXO A;  4MBC A;  3ZM7 A;  1EI1 A;  1Y4U A;  3ZXQ A;  1L0O A;  4KSH A;  2WI2 A;  3A0Y A;  3PEJ A;  4GGL A;  3HYY A;  2WEQ A;  5GGZ A;  4EM7 A;  4GCZ A;  4MP7 A;  4YKQ A;  3QDD A;  1BYQ A;  2YEC A;  4CWN A;  4KQV A;  3CGZ A;  2YE9 A;  4HZ5 A;  3T10 A;  3IED A;  4URO A;  4YKR A;  3R92 A;  4NH8 A;  4ASB A;  1NHH A;  1YT0 A;  2WI7 A;  4K4O A;  2YI6 A;  3O0I A;  4E01 A;  1EA6 A;  3TZ4 A;  4HZ0 A;  2XJG A;  4W7T A;  4KFG A;  1I5B A;  2XDL A;  4XC0 A;  2WI1 A;  1UYG A;  4QPK A;  3OPD A;  1YSZ A;  1YSR A;  4CWP A;  4L91 A;  1KZN A;  3H4L A;  2XDX A;  4XCL A;  2BYI A;  3RLR A;  4CWQ A;  1Z59 A;  4BQG A;  3EKO A;  2H8M A;  4AWP A;  3GIF A;  1BKN A;  2XJX A;  3ZKD A;  4KTN A;  4AWO A;  1AM1 A;  1R62 A;  1JM6 A;  4BIU A;  1TBW A;  4CWT A;  4YKT A;  4AWQ A;  3K60 A;  3D36 A;  1ID0 A;  2Q8F A;  2Q2E B;  3K99 A;  4XTJ A;  4CWR A;  5FWK A;  4NH9 A;  3SL2 A;  4MOT A;  2C1I A;  4FCQ A;  4DZY A;  3Q5K A;  4O09 A;  3MNR P;  3HZ1 A;  1UYK A;  4L94 A;  2ZDY A;  3R4M A;  3K97 A;  2Q8I A;  4XE2 A;  3RKZ A;  2YE8 A;  5CPH A;  1BXD A;  4H81 A;  2Q8H A;  3EHG A;  4ZVI A;  4L8Z A;  1S16 A;  2WI4 A;  2JKI A;  2YGE A;  2E0A A;  1BGQ A;  3A0T A;  1Y4S A;  4NH7 A;  4EGK A;  2XX4 A;  4L93 A;  1TID A;  5JEN A;  2ZKJ A;  1AMW A;  2BU2 A;  2ESA A;  4HYP A;  3A0Z A;  1I5C A;  2YEI A;  5CTW A;  1A4H A;  2YE2 A;  1B3Q A;  3GIG B;  2BZ5 A;  1YT1 A;  5F3K A;  5IDM A;  2FWZ A;  4PRV A;  3U67 A;  2JJC A;  5D7R A;  1UYC A;  4PU9 A;  3CRL A;  4EGH A;  3VHC A;  1NHI A;  3WQ9 A;  4YKZ A;  1UY8 A;  4YKY A;  3LPS A;  3CWV A;  1AH6 A;  2YGF A;  3C11 A;  3LMM A;  1U2O A;  1UYM A;  2YE3 A;  4LP0 A;  4PRX A;  3TZ0 A;  2GFD A;  2WI6 A;  3BMY A;  2K5B A;  4XIR A;  2BU7 A;  2XHX A;  3OWD A;  2CGF A;  2QG2 A;  3VHA A;  3WHA A;  2VW5 A;  4BIZ A;  5F5R A;  2YGA A;  4DUH A;  3G7B A;  1MX0 A;  1YC1 A;  2O1W A;  3T2S A;  1QZR A;  4EFU A;  1MU5 A;  1TC6 A;  2UWD A;  2QG0 A;  4H85 A;  1Y8O A;  1ZXM A;  2XK2 A;  4AS9 A;  2PNR A;  4KP4 A;  1YC3 A;  5L3J A;  2BU6 A;  2IWS A;  3D2R A;  2HCH A;  3EHH A;  4FCP A;  2YK9 A;  3T0H A;  2ZBK B;  4XD8 A;  3G75 A;  4LWH A;  5J71 A;  5IN9 A;  1B63 A;  2YKE A;  5IDJ A;  2FYP A;  2IOP A;  4GFN A;  2YED A;  4GT8 A;  2YE4 A;  1OSF A;  5M4E A;  2BU8 A;  2YEF A;  4MPN A;  3FV5 A;  4KSG A;  4JQL A;  4MP2 A;  2IOR A;  5CTY A;  1UYL A;  4O04 A;  2YE5 A;  1H7U A;  3FT5 A;  4E00 A;  1GKX A;  1S14 A;  5M4M A;  1B62 A;  2WI5 A;  3HZ5 A;  5D7D A;  4ZKI A;  4WUD A;  1NHJ A;  3OWB A;  4XKA A;  4XIQ A;  1IXM A;  4Q20 A;  4CE2 A;  4CE3 A;  2YI0 A;  3B26 A;  2FWY A;  2YJW A;  4LWG A;  4QPJ A;  3K98 A;  4ASF A;  3PEH A;  3Q5J A;  4EEH A;  3S5T A;  2XDU A;  4ASG A;  4FMT A;  3BM9 A;  3GIE A;  4LPB A;  3RLQ A;  4HY6 A;  5FND A;  1AJ6 A;  1QY8 A;  3U2K A;  1I59 A;  4GEE A;  4H7Q A;  2YI5 A;  2BRE A;  4R1F A;  3R91 A;  4B7P A;  1YET A;  3Q5L A;  2CCU A;  2IOQ A;  2C2A A;  3EKR A;  2ZDX A;  5M4P A;  2H55 A;  2YKJ A;  4FPP A;  3HYZ A;  2XDS A;  1PVG A;  4HXW A;  1GJV A;  1ZW9 A;  2XJJ A;  3EHF A;  1ZWH A;  3LNU A;  3A0W A;  4WUB A;  2HKJ A;  3CGY A;  2XX2 A;  2FXS A;  1TC0 A;  2XDK A;  2BYH A;  5D6P A;  3VHD A;  4JAS A;  2O1U A;  3T0Z A;  4JAU A;  4XIP A;  4MPE A;  2BTZ A;  3GIG A;  2FTK A;  3B24 A;  1AH8 A;  3HHU A;  3INX A;  2BU5 A;  4HYM A;  4CWO A;  2YEH A;  4BQJ A;  4MB9 A;  2BT0 A;  4URL A;  2BRC A;  2O1V A;  4ASA A;  2IWU A;  1UYF A;  4R3A A;  1TIL A;  2CCS A;  3U2D A;  4MPC A;  2C1G A;  4XKK A;  1TH8 A;  2XCM A;  2YEG A;  3G7E A;  3JZ3 A;  2WI3 A;  4V26 A;  4L90 A;  5J6A A;  2VCI A;  4BXI A;  3TZ5 A;  1US7 A;  2YJX A;  5CTU A;  1YER A;  2HHI A;  2EXL A;  1YC4 A;  2YI7 A;  4E72 A;  2CG9 A;  2WER A;  4LWF A;  4B6C A;  2BSM A;  4I5S A;  1UYH A;  4URM A;  2QFO A;  4XKO A;  2QF6 A;  3OW6 A;  3HEK A;  2YE6 A;  4R3M A;  2YEB A;  2XHR A;  4GQT A;  3B27 A;  4WUC A;  1U0Z A;  1YES A;  2CH4 A;  3R4P A;  1I5A A;  4EMV A;  3O2F A;  2VWC A;  3C0E A;  2Q8G A;  4U7O A;  4HY1 A;  1ZXN A;  4O0B A;  1Z5A A;  4BAE A;  2WEP A;  3B25 A;  4I3H A;  4EFT A;  3R4N A;  4X9L A;  1I5D A;  1H7S A;  4HXZ A;  5CTX A;  3INW A;  5D7C A;  3D0B A;  1Z5C A;  3EHJ A;  1Y8P A;  2XD6 A;  3FT8 A;  2YKB A;  1UY6 A;  3DGE A;  4LWE A;  2YK2 A;  5FNC A;  2CCT A;  1Z5B A;  2XAB A;  3CYG A;  3A0X A;  3T1K A;  3KE6 A;  3QTF A;  2YEE A;  5D6Q A;  1KIJ A;  2HG1 A;  5BOD A;  1UYD A;  4E02 A; 
#chains in the Genus database with same CATH homology
 3VAD A;  1YS3 A;  4U7N A;  1THN A;  1YT2 A;  2XHT A;  5M4H A;  5CF0 A;  1UYI A;  4JAV A;  4PL9 A;  3O6O A;  1UYE A;  4O07 A;  2VCJ A;  4EGI A;  4P8O A;  3B28 A;  4XIT A;  3RLP A;  4CWS A;  1UY9 A;  4V25 A;  3TTZ A;  4U93 A;  3A0R A;  1Y8N A;  4YKX A;  3OMU A;  3TUH A;  3CRK A;  5BOC A;  2YE7 A;  5FNF A;  5M4K A;  4XDM A;  3TZ2 A;  4O05 A;  1GKZ A;  4URN A;  4CE1 A;  2GQP A;  3R4O A;  4YKW A;  4P7A A;  2YEA A;  4LWI A;  2AKP A;  1I58 A;  2YEJ A;  4YKU A;  4CWF A;  2XX5 A;  3NMQ A;  3H80 A;  3ZKB A;  4FCR A;  5C93 A;  1UY7 A;  2IWX A;  4XCJ A;  2YKI A;  1QYE A;  2YKC A;  5M4N A;  3ZXO A;  4MBC A;  3ZM7 A;  1EI1 A;  1Y4U A;  3ZXQ A;  1L0O A;  4KSH A;  2WI2 A;  3A0Y A;  3PEJ A;  4GGL A;  3HYY A;  2WEQ A;  5GGZ A;  4EM7 A;  4GCZ A;  4MP7 A;  4YKQ A;  3QDD A;  1BYQ A;  2YEC A;  4CWN A;  4KQV A;  3CGZ A;  2YE9 A;  4HZ5 A;  3T10 A;  3IED A;  4URO A;  4YKR A;  3R92 A;  4NH8 A;  4ASB A;  1NHH A;  1YT0 A;  2WI7 A;  4K4O A;  2YI6 A;  3O0I A;  4E01 A;  1EA6 A;  3TZ4 A;  4HZ0 A;  2XJG A;  4W7T A;  4KFG A;  1I5B A;  2XDL A;  4XC0 A;  2WI1 A;  1UYG A;  4QPK A;  3OPD A;  1YSZ A;  1YSR A;  4CWP A;  4L91 A;  1KZN A;  3H4L A;  2XDX A;  4XCL A;  2BYI A;  3RLR A;  4CWQ A;  1Z59 A;  4BQG A;  3EKO A;  2H8M A;  4AWP A;  3GIF A;  1BKN A;  2XJX A;  3ZKD A;  4KTN A;  4AWO A;  1AM1 A;  1R62 A;  1JM6 A;  4BIU A;  1TBW A;  4CWT A;  4YKT A;  4AWQ A;  3K60 A;  3D36 A;  1ID0 A;  2Q8F A;  2Q2E B;  3K99 A;  4XTJ A;  4CWR A;  5FWK A;  4NH9 A;  3SL2 A;  4MOT A;  4FCQ A;  4DZY A;  3Q5K A;  4O09 A;  3MNR P;  3HZ1 A;  1UYK A;  4L94 A;  2ZDY A;  3R4M A;  3K97 A;  2Q8I A;  4XE2 A;  3RKZ A;  2YE8 A;  5CPH A;  1BXD A;  4H81 A;  2Q8H A;  3EHG A;  4ZVI A;  4L8Z A;  1S16 A;  2WI4 A;  2JKI A;  2YGE A;  2E0A A;  1BGQ A;  3A0T A;  1Y4S A;  4NH7 A;  4EGK A;  2XX4 A;  4L93 A;  1TID A;  2ZKJ A;  1AMW A;  2BU2 A;  2ESA A;  4HYP A;  3A0Z A;  1I5C A;  2YEI A;  5CTW A;  1A4H A;  2YE2 A;  1B3Q A;  3GIG B;  2BZ5 A;  1YT1 A;  5F3K A;  5IDM A;  2FWZ A;  4PRV A;  3U67 A;  2JJC A;  5D7R A;  1UYC A;  4PU9 A;  3CRL A;  4EGH A;  3VHC A;  1NHI A;  3WQ9 A;  4YKZ A;  1UY8 A;  4YKY A;  3LPS A;  3CWV A;  1AH6 A;  2YGF A;  3C11 A;  1U2O A;  1UYM A;  2YE3 A;  4LP0 A;  4PRX A;  3TZ0 A;  2GFD A;  2WI6 A;  3BMY A;  2K5B A;  4XIR A;  2BU7 A;  2XHX A;  3OWD A;  2CGF A;  2QG2 A;  3VHA A;  3WHA A;  2VW5 A;  4BIZ A;  5F5R A;  2YGA A;  4DUH A;  3G7B A;  1MX0 A;  1YC1 A;  2O1W A;  3T2S A;  1QZR A;  4EFU A;  1MU5 A;  1TC6 A;  2UWD A;  2QG0 A;  4H85 A;  1Y8O A;  1ZXM A;  2XK2 A;  4AS9 A;  2PNR A;  4KP4 A;  1YC3 A;  5L3J A;  2BU6 A;  2IWS A;  3D2R A;  2HCH A;  3EHH A;  4FCP A;  2YK9 A;  3T0H A;  2ZBK B;  4XD8 A;  3G75 A;  4LWH A;  5J71 A;  5IN9 A;  1B63 A;  2YKE A;  5IDJ A;  2FYP A;  2IOP A;  4GFN A;  2YED A;  4GT8 A;  2YE4 A;  1OSF A;  5M4E A;  2BU8 A;  2YEF A;  4MPN A;  3FV5 A;  4KSG A;  4JQL A;  4MP2 A;  2IOR A;  5CTY A;  1UYL A;  4O04 A;  2YE5 A;  1H7U A;  3FT5 A;  4E00 A;  1GKX A;  1S14 A;  5M4M A;  1B62 A;  2WI5 A;  3HZ5 A;  5D7D A;  4ZKI A;  4WUD A;  1NHJ A;  3OWB A;  4XKA A;  4XIQ A;  4Q20 A;  4CE2 A;  4CE3 A;  2YI0 A;  3B26 A;  2FWY A;  2YJW A;  4LWG A;  4QPJ A;  3K98 A;  4ASF A;  3PEH A;  3Q5J A;  4EEH A;  2XDU A;  4ASG A;  4FMT A;  3BM9 A;  3GIE A;  4LPB A;  3RLQ A;  4HY6 A;  5FND A;  1AJ6 A;  1QY8 A;  3U2K A;  1I59 A;  4GEE A;  4H7Q A;  2YI5 A;  2BRE A;  4R1F A;  3R91 A;  4B7P A;  1YET A;  3Q5L A;  2CCU A;  2IOQ A;  2C2A A;  3EKR A;  2ZDX A;  5M4P A;  2H55 A;  2YKJ A;  4FPP A;  3HYZ A;  2XDS A;  1PVG A;  4HXW A;  1GJV A;  1ZW9 A;  2XJJ A;  3EHF A;  1ZWH A;  3LNU A;  3A0W A;  4WUB A;  2HKJ A;  3CGY A;  2XX2 A;  2FXS A;  1TC0 A;  2XDK A;  2BYH A;  5D6P A;  3VHD A;  4JAS A;  2O1U A;  3T0Z A;  4JAU A;  4XIP A;  4MPE A;  2BTZ A;  3GIG A;  3B24 A;  1AH8 A;  3HHU A;  3INX A;  2BU5 A;  4HYM A;  4CWO A;  2YEH A;  4BQJ A;  4MB9 A;  2BT0 A;  4URL A;  2BRC A;  2O1V A;  4ASA A;  2IWU A;  1UYF A;  4R3A A;  1TIL A;  2CCS A;  3U2D A;  4MPC A;  4XKK A;  1TH8 A;  2XCM A;  2YEG A;  3G7E A;  3JZ3 A;  2WI3 A;  4V26 A;  4L90 A;  5J6A A;  2VCI A;  4BXI A;  3TZ5 A;  1US7 A;  2YJX A;  5CTU A;  1YER A;  2EXL A;  1YC4 A;  2YI7 A;  2CG9 A;  2WER A;  4LWF A;  4B6C A;  2BSM A;  4I5S A;  1UYH A;  4URM A;  2QFO A;  4XKO A;  2QF6 A;  3OW6 A;  3HEK A;  2YE6 A;  4R3M A;  2YEB A;  2XHR A;  4GQT A;  3B27 A;  4WUC A;  1U0Z A;  1YES A;  2CH4 A;  3R4P A;  1I5A A;  4EMV A;  3O2F A;  2VWC A;  3C0E A;  2Q8G A;  4U7O A;  4HY1 A;  1ZXN A;  4O0B A;  1Z5A A;  4BAE A;  2WEP A;  3B25 A;  4I3H A;  4EFT A;  3R4N A;  4X9L A;  1I5D A;  1H7S A;  4HXZ A;  5CTX A;  3INW A;  5D7C A;  3D0B A;  1Z5C A;  3EHJ A;  1Y8P A;  2XD6 A;  3FT8 A;  2YKB A;  1UY6 A;  3DGE A;  4LWE A;  2YK2 A;  5FNC A;  2CCT A;  1Z5B A;  2XAB A;  3A0X A;  3T1K A;  3KE6 A;  3QTF A;  2YEE A;  5D6Q A;  1KIJ A;  2HG1 A;  5BOD A;  1UYD A;  4E02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...