1KZYA

Crystal structure of the 53bp1 brct region complexed to tumor suppressor p53
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
195
structure length
195
Chain Sequence
SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 53BP1 BRCT region bound to p53 and its comparison to the Brca1 BRCT structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein, protein binding
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 41
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kzyA00
2J1ZA 3EXLA 3Q05A 5ECGA 4AGMA 2BIQA 2MEJB 4AGNA 1GZHA 3QYMA 3TS8A 4IBZA 2X0VA 2BINA 3US1A 2X0WA 2ADYA 4IBTA 4AGPA 3WTUA 4IBVA 5LGYA 2ATAA 4LO9A 2J21A 5AOJA 1KZYA 2H1LM 3WTXA 5AOIA 3Q06A 5G4NA 4IBYA 5ABAA 3D06A 2RMNA 5G4OA 1HU8A 4IJTA 2PCXA 3Q01A 2J20A 2BIMA 5LAPA 2J1XA 4LOFA 2AHIA 5A7BA 2AC0A 5AB9A 3WTVA 1T4WA 4IBSA 5AOMA 3D0AA 2BIOA 4XR8C 1GZHC 2X0UA 3D05A 2FEJA 4AGLA 3D09A 3WTSA 1YCSA 4IBWA 2IOMA 2J1YA 3EXJA 1HJBC 3D08A 3VD0A 4IBUA 1EAOA 3WTTA 2GEQA 4GUQA 4MZIA 1LJMA 4QO1B 1EANA 5AOKA 5AOLA 3QYNA 1TSRA 4AGOA 3WTYA 2P52A 4IBQA 3WTWA 3VD2A 3IGLA 1EAQA 3VD1A 3KZ8A 4L0YA 4LOEA 2YBGA 1IO4C 4A63A 4HJEA 1HJCA 2J6WA 2WGXA 3US0A 2BIPA 1H9DA 3KMDA 5BUAA 1CO1A 2XWRA 3WU1A 4GUOA 2J1WA 3D07A 2XWCA 4G82A 2IOIA 1TUPA 4KVPA 5KBDA 1E50A 4G83A 3ZMEA 4L18A 4MZRA 1CMOA 1UOLA 5G4MA 2IOOA 4AGQA 3IGKA 2OCJA 4L0ZA 2VUKA
chains in the Genus database with same CATH superfamily
1HHJA 4UT9H 4R6UA 4V2CB 5CJOL 5BW7C 3TBVB 5CN1A 4AUJA 5KYYA 3C5JB 3PABA 3QZWB 4IKLA 4IRJC 4WJKB 1WS7A 4PJDA 1RZKC 5F89B 2CDGA 2WSDA 1BPLB 4YDNA 5C0DA 2EXYD 2AQQA 4DESA 2VUOA 4F27A 1NAMA 4GNKB 2OQJB 4OZIE 4X6EA 3RWFB 2GJ6B 4RDBA 4RNRB 1Y1DA 1CE6B 1U8CB 1KYOK 1W72A 2R51A 1BMZA 4LCIL 2EUXA 2DQEL 3FTSA 2NLJB 1OK8A 3QI9C 2HRLA 5J12B 3V55A 3E0GA 1Z3RA 4LSQH 3K4DA 4OLYH 4TOYL 4AQ1C 3PWVB 4A7GF 2CSPA 2Y2TA 3M86A 3WIAA 4JGJA 1AQDB 3ML9A 5JNYA 5IW1B 1IUZA 5DC2A 3T77B 5KYXB 1QI4A 2VM3A 2BNQB 1I3GH 1T4WA 3D39B 5I0VA 2BFVH 1XMWA 4LU5L 5IMKA 3QCVL 4PIRF 4RGMB 5CZRA 1UM5L 4TVPL 4GW5B 5C6TH 1MW2A 4XNYL 3EGDB 2YZ1A 5E08L 2ILLA 1VDGA 4FABH 3UABA 4PJXB 2CDFA 2FWUA 1TTRA 3ZKMD 3KJ4B 2A9DA 1ZT1B 3RE0A 2GK0B 1EO5A 1DN0B 3FRPA 2WXFA 3FU9A 4FQPA 1R24B 3NJGA 3OAWA 3T3MB 1OGTB 2H32A 4X8JB 2NTFA 2YEZA 3V6ZA 3X13A 2ZXBA 2WVUA 4XOAA 2HVBA 2X40A 2EUZA 3DV6B 5C08E 3C6LD 2YRBA 3LYRA 1WEJL 3LRSA 4NQXA 4P5TA 3UTQB 3VD2A 2XN9B 3PFQA 3U4KA 1KGUA 5E1QA 2OMBA 2XZCH 2AK1L 2VXUL 5C0ND 1QLEH 2DMHA 3CFEA 1HXYB 3QSKB 4NKMA 2Z0UA 4X6DE 2EDNA 5DEGA 4NQDA 3T65A 2NZ9D 5I5JA 1Z9LA 4LPVA 3QIBB 2WP3T 4MCNA 5E03A 2NUTA 2WWOA 4RWYL 1Z32X 1E43A 5D1QD 3SOBL 4M48H 2X2JA 4RFNB 2D9CA 4ELMF 3I3EA 5GGRB 3GSOB 1IBZA 3GXNA 1ZVSA 1A7OH 1ZV2A 3Q44A 5KSUB 3NZSA 4K5NA 4UYPA 3ZSTA 3VW3H 2D3VA 4AC2A 3DX8B 3QUYA 3X1NA 2Q3ZA 4DCQB 4L48A 3HMXH 1BYPA 1OTUD 3MNWB 3KWWA 3DROA 1Z3GL 1SJMA 2ZUVA 5EMYA 2C4FT 3OJDA 2C3WA 3U7AA 5K9JL 3KLSA 1T5WA 4XCNB 4QXGH 2Y3AA 4NNYA 1O9VA 3WS3A 1WCQA 2MEJB 3HG4A 1OLLA 2ZG3A 5KSAC 1M1SA 3TZVA 3GMLB 2BP8B 5DYFA 4WRLA 3LQAH 4BK8A 4CVZA 3OL2A 4D8PA 1JZ4A 2HPOA 4Z7NF 4O9HH 3OG6B 4WLCA 2JKRM 4MQ7A 4NBZB 2XWBA 3HNVL 1B0IA 3NIGF 3W37A 2J2ZA 2X28A 4UM9D 4AJVA 1F6LL 3OF6D 4NO5B 1AO7B 2EH7H 3GS7A 3BRGC 3R0MA 4YXKL 3MPCA 2XWXA 1BCIA 3T0EE 3IFOA 3MRLA 1ZANH 1F3DH 3HB3D 3OKNB 2XWJA 1BFSA 3UTQA 1DZBA 4HUVB 3FKUS 3UAJD 4ZFOL 3AS0A 4R4BA 3MKKA 4X9GA 3SE3C 4ZX3A 4N0YL 2DWDB 5CU5A 4ZUVB 1LO0H 2DKSA 4S1SL 5F9WC 1OGTA 1FGVH 3KPRB 3V4VL 1G9NC 4JQVC 3VQ1C 2BSTB 4N2OA 3FFCA 1NGZB 2D3NA 1DUZA 3R7QA 3GF8A 2HWZH 3NSCA 5GRYA 4U7MA 5INCB 1T0NA 4AE0A 4FAAB 4QNPF 4TSAH 4NAJA 4DF9A 5EH1A 5KSBE 4N0UB 4HWEH 4DVRH 3HNVH 4U1GC 5TDNB 1JUFA 4HQQH 2UZYA 2BNQA 2FX7L 4A7VA 3M8OH 4NUQA 1EHKB 3BKMH 3F58H 3QG6B 3VTAA 2JKXA 3KPOA 2R69H 4TTDD 2E27L 5BZDB 4WV1A 4PG9A 3MAWA 4QXGL 1T0MB 2AF2A 2QHRL 1B6UA 1I9IH 3GJFB 4FI6A 5DFTA 3V4VB 4AQEA 3HR6A 4PPTA 5CEYA 4ABVA 1X5FA 4JQXA 4RMVA 3VXQB 2Z93A 1QKZH 3MV8E 1W72B 3NFPA 4LEEA 4TPRL 4PN6A 1U8CA 3G5WA 5JIHA 2D2OA 1KBWA 4ANXA 3EG9B 5CZKA 4KUZL 4GRLB 2VDLB 5CGMA 2YMXL 3Q9PA 4X6EB 2YAMA 3HPJA 4KHXH 5T3XH 1MJUH 3O4LD 2NX5E 3U30C 3O6KL 5DMGD 1XIWB 2C1OB 4LDOB 4XBPA 3RU8L 4XMKL 4J6RH 1JDCA 4CL7A 1NC4D 1CICD 4LRIA 5I73B 3FF8A 4KJYB 3MLUL 2PO6B 3P9WB 2A38A 1MZZA 3FW6A 2YPVA 4D2NA 2HAZA 5CEZD 4KY1L 1U21A 1FGNL 4P2QD 3NIDB 4PTTB 4PS7A 4WI2A 3SPGA 4JFUA 4NKIL 1CLYL 1I7TB 3QFDB 4QY8A 5E94B 4N5ED 1RUAH 1NQBA 3KR3H 4M00A 5TGBB 5FOBA 3ISRA 2CK0H 2KLTA 1H19A 5AZEL 1FVEB 4K7PX 4HJJH 3T2NH 4JREC 3T0VA 1BQLH 3IU4H 3A0OA 2A6JB 4DP1X 1S7VB 4YHKH 4DQOH 3QO0A 1NJ9A 3F8UB 4G7YH 2IADA 1XR9A 2EYSB 3L9EA 4DKFL 2WZPA 3IF1B 5E2VH 5TE7L 3ZL2A 4DERA 4YQXL 3BXNA 3CN2A 3X2QB 3PJSB 4L4TE 4ZAKB 2DQJL 3QEQE 4WU7B 4FXTA 3PWJB 1LL1A 4NXSA 4PV9B 3ZPDA 4BINA 5IBLD 3S36H 4LCVA 3QORC 1DBKL 4CN1A 1CTMA 3PPEA 1ZWIB 3TWYA 2VIRB 4N0CC 4HWZA 1EO8L 3ZLQC 4AGLA 5L7XH 5I8KH 4J3VA 4KX7A 3VFTB 2BOCB 4XT1C 4Y1AB 4MJIA 4NN5B 3LQZB 4HWUA 5CLZA 5GGVL 3CFBB 1YEKL 4JY5L 1T1WA 1UKQA 4LK4A 3WFBL 2OXHA 5GGQH 5DD6B 3B1UA 3N1QC 1BIIA 1UWEL 4B96A 4YHNB 2YWYA 1R3LB 1M53A 1QSFD 1W0VA 2NUPB 2DBLL 4I2XE 1F3JA 43CAB 4BFJA 1SFHA 4LZKA 3A67H 2YLKA 1F4YH 3HVNA 5F7BA 1H6UA 2H4EA 2GBAA 2KPNA 4Y9BA 3GKWH 1DQDL 1TCRB 1TEGA 1X5JA 3Q8FA 4JMXA 1M6UA 3SQBB 5MHSE 2HKHH 1N6VA 2XWZA 3O3DA 4UU9A 3T3ME 1PLGL 3FTZA 4NFBA 2FHFA 4M1CC 2EDOA 4X9BA 1U8IB 4EJ1C 3AREC 4ZFZA 1OAXH 3RZCB 1NCUA 2I9TA 5GGVY 3PYCA 4U1NB 4FRWA 3QXTA 3SKOA 2OMTA 2YLHA 1NPNA 3ARXA 3NPSC 3VRLF 2CJTA 3OSVA 4PSPA 3DDFA 1L3WA 1SQ2N 4F57H 5HDWA 5EC1B 2A99A 1IFHH 1MFEH 1P7BA 4DNLA 3FTGB 4YXHL 4OVUA 2G2RA 5BV7H 4Q2ZA 2QFRA 2V9UA 1CXEA 1L9OA 4PH8A 1E4XH 4FNTA 3EJZC 3L4YA 1BJ8A 4QXUH 2NY7L 3N6YA 1URIA 3QEUA 4YSOA 2AANA 3WY1A 3MCLH 3VWKA 4RRPM 1BAFL 1GGUA 3L6FA 3OZ9H 5I0ZA 2XPZA 1RI8A 3KG5A 1ONQB 4EOWH 1EEZB 1PQZA 1VSCA 1YNTF 3HAEB 3L3JB 5ACZA 1AIFA 4QRRE 1USZA 2JNZA 3MBXL 4OZHB 5ANME 5KS9F 4H0LC 2VN5A 4X9HA 5GZOC 3MRJB 1KGCE 2FH8A 3MNMA 2VE6B 3LCYA 1AYRA 2WP3O 5ID0B 1BVZA 3VXPB 3GLEA 3L4ZA 4U1MA 3S8FB 1OAUL 4H8HA 4PLJD 5DJ8A 5E5RB 2R39A 5EZLA 3U6XS 3HC4L 2R9HC 4FNSA 4HUMB 3FFDB 5DVPA 4RGND 1RZ7H 4B9JA 4Y9FA 4OGXL 3MRIA 4UIKL 4UF7C 1C5DB 5ICXB 2AV7B 2XN2A 4MKTA 2WLNA 3VB8A 5CFAA 1B90A 4KH9A 4QTIL 3P4MB 1CTOA 3AJ7A 1EFQA 4GFTB 3DLQR 2OYPA 5C2BH 1Q0YH 3MQIA 4Q6YA 4U1LB 5E6ZA 3PNRB 5TK4A 5K1NA 1CBVH 1ACYH 3I6GB 2ENJA 3MOBL 3SD5A 4QDGA 3CZLA 4TNVK 5FV2A 4W4NA 1GAFH 5AKRA 5DHEA 3GK8L 3ISYA 3IGLA 2ITEA 3MRRB 5I1LB 4CC0A 2GEEA 2DIAA 1AIFB 4JFYB 3HAEA 1LYQA 4Z95H 5IESH 3RUGE 1HWGB 2Z65C 2OTWB 1CBVL 1RH8A 2KS0A 3C5ZB 3QIBD 1QX1A 3AREB 3MBWA 3PP4H 4XB3A 3PQYD 3EYQC 3OR7A 2WXNA 1CJYA 4Y2DB 2H3NB 4CJ1A 1BZ7A 3CZFB 3HZYA 5I66A 1EEYB 2WZ0A 3RWJA 5I26A 2GI0A 3B2UD 5C0FB 4JW3A 4ODUB 5B1AB 1S9VA 5C07B 2JJSA 4HBCL 5KSAA 1JK9A 3TZVC 3KPSA 1A65A 1NBYB 4FADA 1FFNA 1UM4H 1F4YL 5CWSA 3VXUA 4KZCA 2ZE0A 3ULUL 2DBLH 1F00I 3GXIA 4KKRA 5I1AA 2NXYB 3QUYC 4OV5B 4JFVA 3KPMA 4MVBD 4JPVL 1LP9F 4WUUD 1M3IA 5GGVH 5E24E 2WLIB 2OKMA 2WQSA 2OW6A 4EBQL 2OI9B 1NGXA 4Y2DC 3QHFH 5DZPA 5DURD 3U9PL 3ILPB 3NP3A 1NMCB 5I18L 1JZFA 4UDTA 4K7FB 1SBSH 1UQSA 3I2CH 4NLAA 1GA2A 3MV9B 1L9QA 1R3LA 3IT8D 1EAPA 4JO1L 3WD5H 4DP6X 4AT6A 1HWHB 5HBBA 2AV1B 3WEMA 3HG5A 2WLLA 5DRWA 3FO0L 1F11A 2X87A 3TONA 1RCYA 2PW1A 5LN4A 4PQXA 3L2MA 1KXQA 4ZW6A 1JK8B 1WSST 4F8OA 4JE4B 2FJGA 3TPUA 1FRGH 3DRTA 2BCMA 3O4LA 4FQ1L 4YQXH 2Z1PA 5I1CL 4L8BB 3AQZA 5D72L 4W9EC 2X6CA 2ZZUT 3BP6B 3K2KA 1OAXL 3P4LA 2H32H 3P2BA 5HYJA 5T1LA 3WFEH 1JHLL 4XZUB 4Y1TA 4ZK8A 4OW6A 5E8NB 2A9NL 1H3TA 1A6VL 12E8H 5FA4A 3HKFA 3OR6B 2AAAA 1IJNA 2H5UA 3L48A 1N3NA 5D4HA 1XV8A 1ICTA 1Z9PA 1ZHBA 4HDIA 3VU1A 5F7NC 3ZZLA 3EO0B 5IFHH 1SY6L 2IAMA 3R1GH 5I2IB 2CJ3A 1LQBC 1IAOA 1D5MA 2NXZB 4TQHA 4XO4A 4U31A 5D6DA 1MJJB 4AQZA 5JOPD 4KKQA 2F08A 5DD1H 1MFBH 1SLUA 1RURL 4WTXA 4W9IC 5CEXB 2AEOA 2X05A 1E8WA 4CAGA 2R2BA 3QZPA 1NCTA 5I8KL 1QTSA 4X6DB 1JI1A 1MW3A 4C58B 5I15H 5F88B 2X3AA 3EH3B 5CJQH 2J5LC 5CKGA 1HL9A 2COVD 1FLRL 4L1BA 3WFCL 4FXGB 3MC0A 4ERSL 3VXSE 4J3XA 1VESA 4OF8A 4N20A 2ED8A 4HJUA 1OF0A 3QDMB 3K6SA 3CFNA 1I9RL 3BP6A 4Q52A 4XPHL 4G8EA 4K0OA 5E8DH 4GI9A 2Z4QB 1VFAA 2Q9OA 2ICCA 1VEMA 2YOAA 4FFYA 1NCCL 3FO1A 3BWAB 3O4LB 3JBG7 3HPJB 4BCYA 5GRUH 2ENSA 3D5OF 4WFFE 2PPEA 2FJSA 1DANT 2AI0L 4XP4L 3AU1A 3TN0B 3W9DA 1G0DA 3FN0H 3BMWA 3V6FA 5D55A 4KK8D 1F11B 3DIVA 2HN7A 5DRWB 4OY9A 2PO6D 4AYEC 1RERA 5GSRB 4EF3A 3QUMB 3E3QE 4ZG1A 4PD4K 4QAMB 3BLPX 4XXWC 3CXHK 5TH2B 1N59A 3SPIA 4LLDA 3W57A 1D5BA 4QRSB 5E4EC 1MFDH 3CTTA 3FT0A 3HLAB 2HT2C 1G7IB 1XL6A 4RESB 1HHHA 5C97A 3QG6A 4JAMA 1AJ7L 3LEVL 4PLJC 1EXGA 2J12B 4KY1H 3ULVL 2LAGB 2N7BA 5E9AA 1A6ZB 4JN2B 5EBWB 3T0EB 2Y7LA 4GBXD 3FRUA 4OLVH 2J1KA 2QHLA 4HPYL 2K7QA 3B3IB 1NGZA 3GSQA 3QC5X 5FC9A 1PL3A 4YZWA 3QUHA 2F18A 4FKEA 4N2BA 5GHWL 3VXUB 5FGBA 1J05B 5H35B 3FC8A 1AAJA 1BFVH 3MBEC 2PWHA 3G08A 3ARGC 2E6QA 1VACB 4MAUL 3I9PA 5D7JC 3F7RA 3BPNB 5AOKA 5IBTH 4GS7C 1BPVA 3UP1A 1KBGL 4NXKA 5G5DA 5KSBB 2QSQA 2Y7MA 2Y1YA 3B8SA 1J5IA 3AREA 2RR3A 1N19A 3AUVA 1GTFA 1FCGA 4R8WH 2GJRA 2A9CA 3QEHB 1IO4C 5KJRH 3STZB 1J0IA 4MAUH 4PGBB 3TASA 4DAGL 3EJYD 3E38A 1FG2A 3FCTB 5ERWA 3LZQA 1HKLH 4NX0A 5C09B 3OAUH 1BFVL 2JELL 2BNRA 3KPNB 4TSAL 1A4BA 2E75C 2V7HA 1DQVA 2CJUH 3UG3A 5AL0A 4LP8A 4Y1SA 4BK5C 1M2VA 4M48L 3QGVA 5E6ID 5JMOC 4ODSL 4N8CL 3RI5F 3CVCA 2GABA 4F2EA 1FNLA 1NUFA 5D2LA 1B4JL 5LXGH 4A04A 4JX0A 3LHAA 3WEXA 2DJ4A 2NCEA 3U48A 2N7AA 2A7BA 3RB5A 2VXUH 2AK1H 3UGUA 4OU3A 1FG2B 3FCTA 5DFAA 5ERWB 5C09A 4H8UA 3S0PA 3ZO9A 1RJCA 5JHLA 1TO5A 2DWEA 3M1BB 5HPOA 2OCCB 4KK6D 3EADA 5FA3B 3F3HA 2WW8A 3NIDE 4KJQC 2FQGA 1ND0A 4F5CE 5B1CA 4NQDB 3TEYA 1VZIA 3S48A 4XC1H 3BPNC 3WN6A 1A9EB 2CA4A 2AI0H 3MRJA 5C6TL 2E9WA 1AC6A 3QCVH 2P80A 1PEWA 2H0PA 2V17L 3VD4A 3V6OE 3UTTA 3B5GA 4YDKL 1L0PA 2HT2D 3DX0A 4JKPL 4ALAH 2EE3A 2IO5A 1IC4L 3G9AB 4IW4C 2MOVA 1AHWC 3VXOA 1QRNE 3EGDA 3HRZB 1R1CA 1DJYA 4X4XA 3OG4B 5D6DC 2KZKA 4QIRA 5A1AA 1J8HB 4QHUA 3KHOA 4UILL 1CLCA 1F58H 3G7TA 3NEOA 5HHPB 4DKTA 4ZW8A 3GNML 3CSPA 2R4SH 4KGJA 5JNYB 4LFHG 1KN2H 3EBGA 3H9SE 3O11A 2PXYB 3E2HB 3G5XA 2VZOA 4XN5A 2E0PA 1NC2D 4U1NA 5F9WB 5DMYA 3S3JA 3PWLA 2B9BA 1LE9B 2Y23A 5GSRA 4ZMNA 5C0CD 3SPCA 3QI9A 4PJEF 4YN3A 4Z3JA 4N2GA 2CKBB 2YGQA 4AYDC 4POUB 5JIPA 1RQ5A 1EGJH 1AR2A 2NNCA 1FBIL 2LFEA 5GS0L 3LY6A 5L6YH 4ZOCA 2R1WA 4JPIB 3UGEA 4MB4A 4KQ0A 1DBJH 1UASA 3K7UA 3CPUA 1X9UA 4YDIH 2WXGA 2MCAA 4F5CA 2XTLA 2DQFA 3AY4A 1MRCL 2GVYA 1ZLUK 3Q5YA 3PAZA 3NCCB 4ZZKA 1C12B 4MASA 1SMAA 2R0WH 3LQZA 4FKKA 3DVGB 1PGRB 1GGIL 4KPHL 5JW3H 1RZ8B 4NO2B 4YDVA 4BBWA 4JM4H 3KH4A 3PWUA 4PW3A 3QQ3B 4JPSA 4YBQC 3WI9A 3Q6GH 3FO0H 1QQDB 8CGTA 3NFSH 2FQEA 3RWIA 1FH5H 1ULVA 5ECGA 3CPLB 4WKXA 1PKQA 2BSRB 4Y9GA 2Q6WB 4JVWA 4N2NA 3L9YA 5GS0D 4IBZA 3VRJB 3WAJA 2DIBA 1IAOB 4OT1L 1MFAL 5FDWA 5DRZA 1K3ZA 3NCFB 1GZPB 4HOXA 3VTTA 2ATAA 4WUUB 3IRCA 2F54B 1YO4A 4WW1B 4XP5L 1FO0L 1FC2D 3NIFF 4GY4A 1PG7W 2CLRB 3LKNA 1GZPA 4Z7NE 1PJ9A 1QASA 2P26A 3OR6A 4LAQH 3LH9A 4YH6A 1BZOA 3L3OA 1N67A 3VQ2C 2NW2B 2XA8L 2P5EB 4QYAA 1TYRA 2MTPA 3VI4E 2CPCA 3MLXL 2LU7A 5HPMA 1R9FA 5AAWC 1QVOA 3A6BL 4U1IA 5D7JA 3ARRA 3ET9F 4RA3A 4L8BA 4Y19B 1RULH 1A7NH 1NOLA 1NCBL 3VGGA 3SGDH 4DZBA 3RWEB 5IT2H 2FJGB 3TPUB 4U6VL 2YD0A 3NA4A 4OJDH 1N6QL 3FQRB 4LKXA 1DBAH 3KPSD 1HHGB 3U4AA 3VH8G 2N4IA 4ZQKA 2B5IB 2BHUA 3FZUD 4HIEA 3U6XA 2OSXA 1BBDH 4MJ4A 2QGBA 3VWJA 4B6ZA 3Q8CA 4UNIA 4KNSA 3C6LA 3GSXA 4DWHA 2EYRB 4NQQA 4I5BA 4L3ED 3CUPB 3TEXA 4ZNEA 3W5NA 4GRMB 2GHZA 3B2VH 4LLAA 1AKJA 4XO3A 4NS0A 1M57B 4JPIA 2HFFB 1AYOA 2IH1B 4P06A 4C83A 3ILPA 5DU7A 1XX9C 1NDMB 4FYQA 1XGZA 1UD5A 4QHMB 4MD5A 1GAFL 3U0TB 4HPOL 3FSOA 4FXGC 1XMEB 2NXYC 5JW5B 1IQWL 2WKGA 3DUUA 4Z3HA 3CN0A 3SE3A 4ETYA 4ODHH 1OW0A 4I1PA 4LSPH 4O2CA 3QHTC 5DMKB 3V4VA 1FJ1A 4JR9H 1KIPA 4H20L 4AQEB 1QR1A 1PW3A 3T6XA 2NR6D 3OQ3B 3HG0A 1KCSH 2OBGA 2UZYB 5ALBH 5E2WL 5C07A 4J3SA 3P0YL 5LCVH 2H0FA 4WO4A 1DQQB 4AENB 5J8OA 3HC4H 1T0NB 1KENL 1TJIL 1WPCA 4OIIH 5INCA 4G6FB 3D69A 4GRWH 1QLFA 2XZAH 1JHTB 4WSJA 2CD0A 4ANVA 4NZDA 1M05A 2BSTA 2E4TA 1U6AH 1RIUH 5IEKA 1G1KA 2ED6A 2NOYA 3HUJB 4NM4H 4OCSH 3ZHKA 1YEHH 2O6FA 5C0GB 5SWQB 1CFVH 1ZA6B 3II3A 4ONHB 1A9EA 4DKEL 3WXWL 5JORB 5T5FA 5FHAL 3PY9A 4JRYA 1WQVT 4X6BA 4ELMA 4XXCA 2Y6TE 5FCSH 2JXMA 4X4YA 5F9JB 3BZDA 3CXHJ 4HS3A 1B4TA 4YL9A 4FG2A 5JPNA 2BOBB 3SDXF 5G4NA 4BM7A 3ZE2F 3IEAA 5HXMA 4IQHA 5KBNC 5DUJA 2IFGA 2X4UB 5KVGE 3MV9E 1AD0A 5E9DB 5K33A 5BVJB 3D87B 3LKPB 3GMLA 2PNDA 3C75A 2BJMH 1UXSA 4JY6B 2OZ4L 4WEMB 5TDPA 3MV7B 1YEWA 5EWIL 5IHBA 4K5LA 3EDFA 3QDJE 1E9OA 2IC2A 4HIHB 4OD1L 4H26A 2PETA 3MNWA 3RY6C 1G4MA 3HEIB 3OXSA 1IT9L 5FM5O 3DX8A 3QUYB 4OTXH 1P7QA 3QIUC 1MCSA 1OD7A 1IFGA 3QUYD 3N1GC 1WAAA 1ZVSB 4Y4KA 3K6DA 2PUQT 3WNOA 4PUBH 4O02L 4D9LL 1MRDH 4P48A 4E5XG 3SDDB 1E42A 4Q0XH 3K8KA 3R0NA 1YJDL 5E2TH 5T3XE 2IQ9H 3L6FB 3WTWA 3HC0B 3OB0K 3V6BR 3DSNB 3H1ZA 4HIIB 3DUSA 4PJCE 3NIFE 2H3XC 2EILB 4ORGB 4ZMOA 4OI7A 1QSFA 4K8RL 3UTSB 3S88L 1HXYA 4MAYA 4ZO9A 5AAMA 4MHHI 4XPAH 2ZX9A 3HC3H 4M8QB 2VDQL 1H9DA 2ZUYA 4GLRI 1I4FA 3TNNB 5F70A 5JZ7C 4GW1A 4Y0GA 1CYXA 1JGLH 4QT5B 4WI0B 5DD5H 2GIMA 2HT3D 1EJ8A 5EF3A 4UM9A 2DS4A 2CDFB 4Z7OE 1JWSA 3HCVB 4ZDHB 2OCJA 3ZTEA 1PNDA 4ANWA 3EJJX 3TJHD 1J5DA 1RUQH 2IJ0C 1PCXA 1JAEA 4JFHE 1CG9A 1CGXA 2D7TH 2KDYA 4NP4H 3IJ9A 2NY1B 1HHHB 3GYRA 1GMEA 1K6QL 1PKQE 4IS6B 1NIEA 1FV1A 3PWVA 1XFPA 5GZNC 1W0VB 4JQIL 2X9ZA 4IRSD 1QNZH 4DUWA 3MRGA 1J8SA 1XR8A 5D8JH 4RISH 4Z0BL 4C57C 1J0HA 2HN7B 3L08A 3I9IA 3FU0A 4O51A 4LHUD 4NN5C 3BE1L 3WEBA 4X5WA 1ZAGA 3RVXC 1F4HA 2B1AL 3UG5A 4GUPB 4KTDH 1ET7A 1YN7B 4ONGL 3BKYH 1ADWA 2R15A 4HIJA 1QPKA 2Q8BH 4JG1H 2NNXA 4N2KA 5F1NA 1BW8A 1CD1B 2Z9TA 4IMLB 4ONGH 4KTEL 4X5QA 2CDGB 2VWEC 4R3SB 3UEQA 4WO4C 2B1AH 4PJDB 3US9A 4BKTC 3R8BB 1GKEA 1HX0A 2WSKA 2V2TA 3C5JA 4YMPA 3BE1H 4NERA 5E95B 3TBVA 3ALXA 2J3SA 1RIHH 4UOW1 1ZHKA 1G7MB 4YSDA 4KHXL 1FO0A 4FERA 1INDH 3D09A 3IJYB 1ZCRA 3FQXB 1E7UA 3GLDA 1KBBA 4KWUA 4RISL 3VWKC 4P2RA 3T6QC 1F6AA 1CR9H 1Z5HA 3EYOA 4X6DA 3QWOB 5ABZA 2D03L 3QPXL 4D3CL 3T09A 1T20A 4Y8AA 1BREA 2PPAA 3N1PC 3CCHB 2EZ0C 3WJJC 4A1RA 3CAFA 5DDHA 3QNZA 4NAQA 1T0OA 1KY6A 4X80L 2ZAGA 3RLSA 5FO2A 2NY6B 1KOAA 3BKML 3F58L 3NPSB 1KIRB 4LLUB 4H44C 4CNIA 3DPDA 2VMFA 5E94A 5I6PA 1KWGA 5D7LA 3QFJD 3V95A 5I1IL 2DTMH 5KVFL 4AZ8A 4HG4J 2X4NB 4FFYL 1H0DA 3AXHA 4XX1E 4Y4HB 7FABL 3FUIA 2IWGA 3WU1A 4F7TB 1J8RA 4GUOA 1NFIA 3T8MA 4YWGL 5I74B 1TMQA 3ORJA 3U4BL 3QRBA 1CK0L 3SGEH 3TH2T 2CH8A 4XMZA 3V4VH 4QTHB 4PVLA 2ZOUA 4MNQD 4ODBD 1RZJH 1HE8A 3FMGH 3IE4A 4APXA 1UA7A 3SE4A 4Z7IA 1VZHA 1WZMA 4ZXBB 3S96A 3UC2A 4GG6A 1MCIA 4FZ8L 4AIXA 2HRHA 1CVRA 3QUZA 5EZOL 3VXQA 3ZRSA 2YUZA 2G5UA 3B4NA 3T0BA 2EDDA 4AT6B 2CLVB 4ZSOA 2OZNA 3BN9C 2FX8H 2QV2A 5FO8B 3DBXB 5HDBF 3LKSB 1VADB 4X7EC 5TQ2L 3MRHA 2VRAA 1XF3A 4PJXF 1S7QA 4UZGA 5GRJL 3MMEB 2P47B 4M7ZB 4G59C 4P9HC 4EDWH 3QG7L 3U0WL 4YSEA 5DZJA 5I1DB 3SJVE 1VFMA 4EPSA 3GUTA 3FTYA 3MODH 1G7HB 5F9OH 3I6KB 3KPMB 4MQXD 4B5ZA 3OPZL 4OV5A 1JF1B 2YPLE 3F85A 3QIUA 2QDVA 1R3IH 3O2WL 4FHKA 4PMEA 3UERA 2J20A 2W94A 3V5KB 5EU6A 3WLBB 5B1BB 3KPRA 3GTTA 2YQ3A 4WTQA 2Q10A 3AABA 4ZUVA 3EIFA 5L8LB 1UWGH 3SBQA 5BRZB 1UZ6E 1G6RH 3POCA 1OP5K 1J5CA 3TIEB 3VFSB 4M9OA 1K5NA 1UJ3C 3QNYB 1BDYA 5CM1A 3FHEA 4G1EB 3VWJD 4L3CB 3RWJB 5IM7A 2XTSA 2GBVA 1BVLA 4DP2X 2DQGH 4LSRH 1N5YL 1R5IB 2PMZA 4JFZH 3NCBB 3SKJH 1DVXA 1G0YR 1SHXA 1QLEL 1ASOA 1E4WL 1FL3A 2J8UB 1INEH 4X0KB 4X6CA 1ODUA 2HXAA 3MLWH 2VM9A 2V5RA 5IJKC 4JFYA 4F33A 5D7JD 1WEJH 4ZD3H 4N87A 5DJ0A 4GG6E 2IG2H 1HDMA 2IMNA 4EO5A 4LLQA 2V5MA 2VC2H 3MNVB 3QPQD 1PZ5A 4KXZI 3VSUA 3Q2VA 4L3FA 3WS3B 2H8PB 1L0QA 4ZMQA 1FF5A 2FQFA 2DIEA 3ZE0B 2W81C 3V4UH 4NCDA 5FYLE 3TA3B 4G7QB 1CC3A 4N26A 5AW2B 3B5HA 4E41B 2YAFA 5E5MA 1TVBA 4TVPH 3FO9B 4LT7A 2QADC 5AW9B 2E8YA 4JO8A 1EK3A 2DAVA 3UCRA 2PCFB 4AITA 1EEUA 5F0MB 5HYSA 1BZ9A 3F04A 3RTLA 2Z31A 1V3KA 2C34A 4ODHL 4UQCA 1J9RA 3VYPA 3PAVA 2GT9B 3FFDA 2ICEA 1R3JB 3WKPA 1AXTL 4Z7VF 1YPZB 3GBNL 2WWMC 3SPVB 4YEFA 4BUHA 2GYSA 2YKKA 1GZQB 1JPFA 1YMMD 4X8XA 3P73A 3X17A 3TJEH 2P5ED 2ARJA 3CSTA 1NKGA 3U1SL 3G9VA 1QEWA 4FEIA 2XN9A 3J2PA 3OHXC 3QJTB 4F7MB 4AEIH 4AYBA 5E4EB 1BMGA 5JHLH 2Q76B 2SODB 4QHKI 1EEZA 1BBDL 1PQZB 3B37A 3ESNA 4FCAA 4LHQB 4UQ2A 4I18C 1J0JA 5CLTA 2YAOA 5SWZB 3I02B 3I3DA 2RBLA 3L3KA 4P2YA 4WFHE 2E46A 1MREL 2GK0A 2CRIA 2Q0ZX 3FRPB 4P4RA 4WHYH 4CDGC 3CSFA 4BCXA 5FYJE 3ARFD 3REWA 3K6FA 3ZKXC 1DQQA 4JHAH 4RGMC 3QI9D 3DIDA 1CI5A 1QTPA 1I1AD 3MGTA 3MRPB 4J2XA 2OR7A 1IIIA 3HNTH 4IBSA 5I6KA 1QFWI 4IM8A 3VXMA 4EN3C 4AY0A 5IW1A 3C09C 3AS3A 1JGVL 1WZLA 5C0BA 5J13B 5HGHB 4OZIF 2JIXB 2BY0A 3QK0A 2NSQA 4HS6B 4OFPA 2ALWA 3BW9B 3KCPB 1PNCA 4K23L 1KEGH 2GTWB 1MLBA 3V4PB 3A5VA 2IOMA 4DGVL 4ZFZB 2NLJA 3NDZE 5F9AC 4AVHA 3VM7A 1HCYA 1RUML 1UD8A 2XBDA 1U4EA 5E9NA 2BVYA 1P5VB 1DVTA 4CVUA 3T4YB 3BKCL 1HWWA 1C1EL 1MF2L 2FO1A 5HGBB 3LJ3A 5AB0A 4BZ1A 4C83B 43CAA 3K80A 4PJHF 4HJGA 1AZNA 3SYAA 5B38G 1G9NH 2L7JA 2XI9A 3HS0A 1UM6L 4PCSA 5GGTH 4ETQB 1TEYA 1X7SA 4YAQB 2UVEA 2HH0L 3IJHA 1CU4L 2I24N 5F8RC 4QRPB 2FK9A 3CK0H 3QC6X 1XB3A 4TRPL 5EU5B 1WFMA 4YGVB 1P4BL 2DZEA 1JF5A 3CN4A 2AQTA 3CFBA 4ZQKB 2PP8A 1HHJB 4HK3J 2VABB 2VDRH 4DZ8B 3NJJA 4AEHL 3LSOB 4R97B 2IDFA 2ZOKB 1P9MC 3LNIA 4KK5C 4ZXBC 2OJZL 1F2XK 3BIBX 1RFDL 1GY1A 5A43C 4M5SA 3V0DA 1M71B 5GGSB 2ADFL 3PL6A 1YQVL 4ISVA 5IK3A 5E23A 2E74C 2GAZB 2EDTA 3WUWG 4JHAL 5E2JA 5C09D 2AZAA 5IHHA 1FORL 4PRHA 1WBZA 3WUWA 5A2BA 4F93B 2BSBA 5M7QA 4ZAKA 3BP5B 3MCKB 1NAKL 3P0GB 4HEME 4NT6B 1UYWL 2YQGA 3RPIA 4PJ9D 2VXSL 3A6CH 5F1OB 5EOQH 1TPXC 3EFOA 5KZCD 2ZX5A 1Q0EA 2FLBT 4NKDB 1FYTD 1L9TA 4F2MA 4G6KL 3I50L 2NNAA 2G60H 3SYCA 5IW6B 2CUMA 3BP5A 1TETL 3MCKA 1OGAE 1TVHB 3HZVA 3WUWB 2A6JA 4WWOA 1RZJC 4TUOA 2C9VA 3P9MB 3O9WC 3CX5J 3UDWA 4IHOA 3TJEL 1FWXA 4XPGH 4BKSC 5CINL 2VISB 1U3HC 1QQDA 4PJFE 3WL9A 2YBRA 3THMH 1X5HA 3GSUA 3MN8A 4JO4L 3MJ9H 4L9LA 3PQYA 2GHWB 1RZGA 3D0LB 3UC0L 3S5LA 2W5PA 5F93C 4OCXL 3DVGA 4Z7QB 4YE4H 1KTDA 2YA1A 3L7FA 1N70A 4HZ1A 4QOKE 2UZXA 5EU5A 1HCVA 4F8PA 4H8WH 4PGZA 3LPWA 3HE6A 2W9LA 4N5UA 5B8CA 5A16A 3DJ9A 3INUL 4S1RL 5AW0B 5D1XB 3IAGC 4KXZH 1CLZL 1WAAE 2D7MA 4G3YL 4PREB 1N7MH 1K8DB 1XZ0B 4JJ5A 4KJWC 3V4UL 2J1YA 1FP5A 5DD0H 3AWEA 4QKTA 1SF3A 3HBGA 1WFNA 4G8IB 4N2DA 5E1AB 2AK4E 4CSZA 5I1JL 4XP1L 5DUPH 3VD9A 3MV01 4LASH 3O0RH 4PCTA 4BEIA 3ETBF 2QSCL 4M62H 2BVUA 3NA9L 4UTAA 4D8OA 3F62A 2ERJC 1NEZG 4J3UA 4LF3B 3SGDI 1Q0XL 2ZCZA 1IEBA 3PQYE 3O6ML 1FFQA 2QFPA 3DI2B 2CUAA 4MLSA 1FYHB 4X4KA 4JKKA 1KZQA 2KKQA 2VDOH 5DHYB 5JO5B 4DGUA 5BQDA 5C0BB 3S34H 3KPOB 2FZ3B 3S37L 3JUZA 4AK1A 4NRZA 3ZYZA 1BQSA 4Z7UF 4PBXA 5CZVL 2KDGA 1F41A 5EZIL 2WPGA 4MB3A 2VOTA 4YVNA 2APXA 1OARL 3FCUB 4DVBA 3QAZB 2F19H 1N8ZB 1IM3B 1HXKA 3BO8B 1GOHA 2F1EA 4AMWA 2XN9D 1O6VA 1IVTA 5GSVA 3LB6D 4J3OG 3CVBA 2GTQA 1FL5A 1YYCA 1S9YA 1UD4A 3CFCL 3MLSL 1ZLDA 4MNQB 4PGCA 5EO0A 4WI8A 5HDRA 3U1PA 2MOQA 1WA0X 3BJ91 1RP9A 2EH8H 1XGPB 2XQYK 4P2CG 1NGYA 4PBDA 4MNHB 1E2WA 4G9DA 4RAUA 4XHJD 4YDMA 5AVUB 4MCZB 4RIRA 2FCBA 2F58H 1MW0A 4ORZC 3MODL 3NJNA 2R2CA 4IMKC 1F1AA 2YPLA 4U05A 3UPCA 1TITA 3OZKA 5HGDA 2JKSA 1FHNA 3TVMB 1T7YA 3IWVA 2VGLM 1ZJAA 2XTJD 5IVOA 3ASWA 2VO5A 2X4QB 3QUZC 2X7LB 4OJFH 1XCQA 1R3JA 2GT9A 1IGMH 5AWNH 5JUEL 3B43A 5KS9E 4RGNB 1O7DE 1UD2A 4MQ7B 1UC6A 3POHA 2ZUQC 3QJHA 4FJ6A 2Z31B 1P5UA 3I85A 4XO9A 3IJSA 3KPLB 5KWYC 1GOGA 3NJMA 4HPYH 3TZVB 2FEEI 5L0QC 3L3HA 4HIXL 2CBTA 4NNYB 4XRCA 1IM9D 1QACA 3QWNA 5DC0A 3VFWA 4M7JL 1EFXB 1N0XL 2GI7A 4AG4L 4TQEH 4NJAH 2DB8A 3L45A 2Y6SC 3QAZC 4B97A 1WT5A 4R84A 3RG1C 3TYFA 2H8PA 2ZXAA 3ARDD 3QXVA 3DETD 4Z0XA 3RVWD 5C0CB 5BS0B 1WBYB 3BVUA 3WIHA 4I48B 2V7HB 3VI3F 3TT1L 1F8TH 2BNRB 1A6TA 2OMWB 3FS9A 5LAXB 3VFMA 7FABH 5HVHB 4UQ3A 2DYSB 4F37F 4YLQT 3BHBA 1NEUA 1VPOL 5EOTB 2VQ4A 1T80A 3II1A 4UUJB 5C3TA 3RNKA 5D93C 2ID5A 1FL3B 2J8UA 4FC3E 4JFWA 3OLGA 2D31A 1KJMA 5ISZE 1A6WH 4UDUA 1IGFL 2YD6A 4UT6L 5JXAH 1R5IA 3VDAA 3BUTA 4QRBA 2JTDA 4IBQA 5F6IB 3CFEB 2OYLA 3KLHD 1RSYA 1HT6A 1SNRA 3OLIA 4HSQA 1D5ZA 3ECBB 5BUGA 4HZLB 2V7NB 1MHHA 4RVBA 3VFNA 2E4FA 3L16A 5A2AA 1YDPA 3EJCA 4KDVA 3H3BC 4MXWL 4K9EC 3QPXH 2H32B 4X8JA 4C4KO 5AAPA 5J6SA 1FLRH 1OD9A 3QZNA 3VMPA 1E3ZA 3KBEA 4PJ9A 3ETTA 4J3TA 3IAPA 3K3QA 1QRNA 2R1YA 3W0WB 5CJQL 4PJXA 5HHMB 1KJVB 2GJZB 3UBXA 2E7CA 5CR1A 2X70B 3NZHL 3SCMD 3QIUB 1KNOB 2B1HL 4X5PA 4F1ZA 2CJSA 2DQDL 1A6ZA 4JN2A 1LDPH 1TYJA 4J8RB 2B2XH 5EBWA 3GUTB 3DJRA 2BMKB 5F6IC 4KNQA 3FB6B 4PJEA 4Y4FD 3BKYL 5FV1L 5KYXA 1HNGA 3F12B 3L1EA 5SX4H 3CHXA 1NCHA 1Q8MA 2ED7A 3MJWA 5FS5A 3OZLA 1VEOA 1BZDA 1WFUA 2QQKL 3NP4A 2PPCA 3JXAA 3MRBA 2J44A 4URKA 1S78D 3JVGC 3NYKA 1PBYA 3Q6FA 1ZT4A 3ATBA 1ZLWK 4GRWE 2DM3A 2F5AH 1M42A 2CIKB 3Q3GA 4XNDA 2FQDA 4ZI8A 3WE6A 4P23A 4HC1H 4BGDA 4EN3B 3E9UA 4WW2F 1JRHI 3R8QA 3WMSA 2OA9A 2YXWA 3VFRB 4I0CC 4IEFB 3HN3A 1PZAA 1ETB1 1QLRA 2VC2B 4JFPA 1FRGL 4X6CF 1E65A 2BNQE 1PZCA 3PABB 5KYYB 3IDYB 4J27A 4JHWH 2AMUA 2FBJH 1T5XB 4R7DA 15C8H 3GJEA 4OGQC 3KAAA 3GFUA 3L5IA 3CQQA 5EPMA 2AQ1A 1H3WM 4WCYL 5KOMC 1ZVNA 2W0FA 3DO7A 1ZEAL 5CEXA 3MLZH 4EIUA 2IGTA 5T5FL 3DRQA 1OWWA 3HC3L 3RGHA 1LEIB 1DEDA 1ZVHA 4RAVB 4BZ1H 2IGFH 2VN7A 1BQUA 4NO0A 1MNUL 4XC3L 3N0AA 2YGNA 3HZMA 3SHSA 3SYPA 4AW4A 4B9YA 3O81A 3BWUF 3FU8A 3KPPA 4XMLL 2W0FB 1MCDA 2VKXA 3LHPL 3C8HA 1CS6A 4YFDB 5TF0A 2A9BA 3MV8D 3U2SA 4G80A 4YSPA 3ROOA 1NLBL 2X4PA 3F5WA 4MRBA 3BEVB 3UYPB 4DJMA 2KZWA 3FQXA 1KIUB 1ZLVH 4UTCA 3KWTA 4OQTH 4R96A 1XF4A 4PJ5B 3Q9QA 4Q9QL 1B88A 3F05A 5IHLB 1D7DA 3LB6C 5D2LE 3SDCA 2F7QA 5IMOB 4ATWA 1RD6A 3KWUA 5FIEA 2QELA 1G7JB 3VFGH 1EZLA 1IGJB 4IMLA 2HRPH 4EZMA 5EBMA 1MCWM 1MCPH 5F1NB 4PRIB 3VFRA 1M7IB 5I1HH 3HNSL 4HV8B 4H1LG 4GKLA 1YN7A 4OFYD 3LRHA 5C7XH 2R0LH 4E2OA 3T2OA 4AUYA 2MCG1 2HX7A 3LMJL 4J3BA 5KS9A 4DGIH 1FDLH 1QD0A 4LLYB 5CD3B 1AD9B 1MIEH 4N4YB 1OP4A 2KZBA 4Z95L 2VUKA 5IESL 4Z5RB 3MACH 3KLAB 3NABH 4N85A 1EAPB 4KI5F 3TBBA 4C56E 4WO0A 3W82A 3MV9A 1JXJA 1J9TA 5FK9B 3IFLH 4DTGL 1WD8A 3SPHA 4ZOAA 5E6IB 4HEPA 3BZFB 4HFUL 5DS1A 2H1PH 3U7WL 3P11L 1YPZE 3I84A 4V2BA 4P04A 4BZ2H 1HESA 1MCPL 3MVSA 3GS0A 4J8RA 4JFHD 2BY3A 5D1XC 3WXWH 1BYNA 4LPXA 1ZLVK 3MJ9A 2IH3B 4FZEH 3GMRB 3WNPA 2DQUL 1JMZA 4A66A 1JWSB 3HCVA 2C26A 1A4AA 3TV3H 3MV7D 4OLUH 4OQTL 2AEQL 2XNAA 4F80A 4IBYA 1QRND 4C4BA 1BVNP 2B4CH 1YEIL 4UMSA 3WHXB 3O9WA 2DKUA 3UDWC 2WY3B 3ECBA 1I4FB 4ODUA 2AEIT 2CO7B 5DXWA 4DN3L 5I71C 1LE5A 1WWAX 1WS8A 3DYMA 3SDDD 4F91B 2TSBA 4ANUA 1PJWA 3CHRA 4ZNEE 3LEXB 4M7ZC 5F7MC 3ZRFC 2EIEA 2P48B 1KJMB 2IDSA 3C5ZA 3LIZA 3TA4D 1T5KA 3WG7B 3HC0A 4BWTA 3PHOA 3EDEA 1ROWA 4HX1A 1AR1D 5EOTA 3B9VA 1BAFH 5C0NC 1W8NA 3MNZB 5I1LA 1UH2A 1TEFA 3IS1X 4HUCA 4IJ3B 4MJID 4Y4KB 2Y69B 4LLWA 5GPRA 4A7QA 5DJAB 2FSDA 1UKSA 1ZD6A 4QYOB 2X1QA 5I19H 5BQ7B 4L2LA 4P5MA 5E51A 3T2QA 4R0LB 3L7EB 3GXFA 2IWKA 4HIHA 4HK0B 5DTFA 5IVXF 3ULVC 1BQHG 5J1SC 2QQLH 5TDPB 1CXKA 4W4OC 2Y7QA 1EFXA 1TTAA 3P4MA 5SWSA 5HHNA 4YDLC 3HI5H 5KAQF 3BP7B 4XO5A 3FT4B 3H7BB 1S5HB 1XD1A 3E6FB 1F4WH 1MVUA 2DEWX 5IKCA 4P9HH 5E9DA 2VDPL 2CAKA 3FH8A 4P2RE 5BVJA 2PWEA 1NUDA 3D07A 3QFJE 1EZSA 2BVPB 1BZ8A 1JTOA 2XSKA 3BOVA 3B7UX 4HS3B 4IMKA 4MCMA 3TN0C 2YJLA 1FN4B 4E9YA 2HTLC 3A67L 4N25A 4PEEA 4UIMB 4ZMTA 1DJSA 4I2XB 5F3BA 4RDQG 5CP3A 2EE6A 4Y4KC 3BWSA 4ONHA 4OZHA 1KB3A 5B7MA 3LN5B 4Y5XA 1JNHB 2O6EA 3L3JA 5L2KB 4KJWD 4H2AA 1KB9K 1J0ZA 2XV2A 4MKMA 5FHBH 2YPKB 4Q9BA 2B08A 4X7TB 2ZXDA 3BIAX 3FUJA 4G6JL 1FL5B 5EU7C 3VWKB 3UJTH 1OQOA 3R18A 4PJ8D 1QLFB 4UTAL 5B39B 5D7IE 3D69B 3BSZA 4IIQB 3BO8A 4ZPVA 1S7XA 1IAKA 4W6XB 3GI9H 2WNGA 4JGUA 2BP3A 4WO4B 2VDNB 4Q2ZB 4U1GB 4GAAA 4IU3B 4G7VL 5H4YA 3T0EC 1TJGL 2HSIA 1U2YA 2EIZB 4PJGF 3B83A 4QRRD 3VD7A 4N9GA 5ILTH 4PM1A 3H2PA 4UT6H 2BPBA 3SBRA 3LQAC 2V3DA 4B60A 2RQEA 3NJFA 3T0DA 1P1ZB 3APDA 4ENEC 4XXDA 1M56B 1OT4A 2CLZB 3LKQA 4M6NL 4WI7A 4YUEL 3P40A 4O2CB 3UBXG 3WLWC 5B38A 4XR8C 1P7KB 3RZCA 4NZJA 4OZGA 1RIVH 3H9SD 2VT0A 1U8NB 3MXWL 3MLRH 3OHXB 1ZS8B 5EFIB 4LLVA 4RWHA 1GL4B 5E99L 1ZDSA 4HMDA 5BXFA 4BQ9A 4DK3A 4HKXB 2WLYA 3WJLC 3BUPA 4RFEA 5CR8A 3OMAB 5HYJE 1XZ0A 3CDCA 3ASNB 3PHQB 4Y19D 3WTTA 3L4VA 3GIVB 4P3DA 5CILH 1DUYB 4TTGA 1N0XH 1ZE3C 3CUPA 4YHNA 5FWRA 5I1EH 1JVLA 4L29B 4U0RC 4U1JA 5F7DB 5HI3D 1QWHA 2W80C 1A1MB 3SGJA 2Z0BA 3CIQA 3MR9A 5D6CB 2G5RA 3RA7L 1JWUB 1D5IL 1QFOA 1MWAL 1NPJA 4LKXB 3BX7C 1SYSB 2QADB 4KK5D 3F7LA 2LHAA 4ZXBD 4HZAA 3S5LB 1ORSB 2CHXA 4NQCB 4HWZB 2C9UA 3PWPB 3QJRB 4TF4A 2R7EB 5JZ7D 4ZFOB 3QUKB 1KC5H 5C0EA 1S7WA 5DR5L 5C0BE 3O6KH 4DO5A 3TNMA 5HTSA 2VXTL 4MS8D 3C5SA 3UTPD 1G6VK 4KVPA 4XE5B 4BCZA 2Q2EB 3L4CA 2NXZD 4EE2A 5AG9A 4ODTL 2NY0D 4GSRA 3FL7A 5E4IA 2WAQA 4DO6A 2JV6A 3PWNA 4I4WB 4JKPH 1DO5A 3DGGB 4KU1A 4NC1E 4FHJA 3BXNB 5IW6A 4XTRD 3TFBA 3H4HA 1OE3A 1R34A 3E8UH 4PJHE 4QXTA 3PNWA 4UB0H 5J7CC 4F8NA 2EYSA 2CWRA 2J6EA 1KCVH 1UENA 3MHZA 1RMFH 4MNQE 1R5WB 2E27H 3E6HB 4XGZB 4DEWA 5DQJB 5LO7A 5GS1A 1TLKA 2CR3A 1EHNA 3OMIB 3KLKA 1JXGA 1M6OA 1FVEA 2FSEA 3CSYB 1VGEH 3ULSB 1ITBB 1JYXA 3LQMA 4G70B 3VXRA 4LAJH 2FNBA 3H2QA 5TGBA 5D96B 3RWIB 2O5YL 1XAUA 3P2DA 5JDSB 1XEDA 4J3WA 1YLBB 1SYSA 3SKUD 1PZUB 2KBGA 2VABA 4DZ8A 4A7UA 3O6MH 2G4GA 2EE9A 3CJJA 3MR9B 2VDLL 5LBSH 1C12A 1XO8A 2X4TB 1CGWA 4HHAA 4YGVA 4L29A 2F68X 3U7YL 1IGCL 4NWTL 2NY6C 3DHJA 3NGBC 4KJYA 1E28B 4WKZA 5HJ3A 4CVWA 2YSSA 5ESVB 1OM3L 1XB6A 3BZ4B 1B4JH 5JLZB 2C1OA 4XBPB 4A6YB 4GSDL 2KC0A 3PHQA 1G84A 4OZ4B 3ZYIA 2X0UA 5DHMC 3FYIB 2AJVL 3GSWA 3T4YA 4YXKH 3HG1A 4QRTA 3UBGA 4D0CA 3VX0A 3FXIC 2HA1A 2HFGH 3OHXA 4F8LA 1KJ3H 3ZZ1A 5DMJB 1OGPA 2NT0A 1U3JA 4KAQL 3EYFA 2ZWKA 4OZFG 5F6HJ 5GS0C 4DAGH 4IBUA 1TZGH 2OX5A 4L9DA 2MQ0A 3B5TA 3MRQA 5BO1L 1JYVA 3NSJA 3SY6A 4MZIA 4XXDB 1X5GA 4N0FB 5JOPE 2Z8WC 3VVWA 1EERB 2DQ6A 3ZQWA 1TKWB 4JO4H 1J8HA 1IAIH 2VR4A 4QHUB 3QUXB 2PP9A 1PVHA 1CFTA 1XF1A 3NH7H 1PFCA 2WANA 2G5BB 5GGUB 1OGAA 4IU3A 4XVJL 5DR5H 4JLRA 1WHPA 3CZNA 4LGSB 3TH4T 4DP4X 2CZNA 1LEKB 1PU0A 2BS8A 5DJYB 1S7XB 3MFFA 4NGHL 3WIIH 3HHSA 4QHPA 1I1FB 4GI6A 4H5SB 1XCWA 2QVFB 4PS4H 4EEEA 5CEZE 3FQTA 3GZOA 4FYRA 5CGBA 1FI8C 3UTTB 2VXSH 1QFWL 3ME0B 4MB1A 3FB7B 4P9ML 2PYEB 3DK0A 5FYLD 1CBJA 4CC1A 3C08L 4F7MA 1FORH 2MFNA 3QB7C 4GQPH 4Z3TA 3MTRA 1FL6B 5F3BB 1E8XA 3ULVH 1FFTB 2NX5D 3OKNA 4FLOA 3MRDA 2YRZA 3QXDA 4OGYH 1XGRB 5EO1B 3MU3A 3AT9A 5JA8B 4R26L 1OXYA 5JOFB 1C08A 1IMHC 2XG5A 3QH3B 3QR2A 5AVSB 4TKWA 4HAGA 2Y9RT 3CDZA 1F90H 2BP0A 4AXWB 5GS2D 5AZ2L 4M1GH 4JY4B 5H8DA 3S97C 5C9KA 1OAYH 3SGJC 1RUKL 3M46A 1ROCA 4D8PB 5HYSB 4CVZB 1BVKB 2YN3A 2PCFA 2ZUQB 3KYOB 1CIDA 4GB9A 3BP7A 4Z6AT 1COBA 4WFFD 3SE9H 3WEXB 2WQWA 1NCOA 4XCNA 3GMNA 3EYVB 2HYMA 3V0IA 2JIXD 4H7VA 2QPUA 3EHBB 1NZRA 1AG6A 4M6OL 3UL4A 2BHYA 5D71L 2WINA 1CFSB 4GAYB 1AKPA 3O6FD 3BKCH 3IJ8A 2J8OA 4DFIA 1TVDA 2UZPA 5C2UB 5CBAA 2FHBA 1MHPL 2ZWZA 4LLWB 3KPNA 3CN1A 5JTWA 3H7LA 2Z31C 3UJTL 3ETBJ 1KTLA 1J1PL 1O6SB 2XT1B 5J1AB 3VCLA 2WJ7A 3IDNB 4NB7A 3EYSH 3X14B 1SJEA 3HI1A 1AP2B 4LHUB 4R4FH 3VH8B 3TO4A 1A4JA 4NCC2 2P42B 1YY8A 2VZ1A 1ZLSL 4Q58C 3VD3A 5DEGB 3KNBA 2C1PB 2LABA 4AYFB 4YPGA 5DYOA 4EIZC 3V0JA 2H26B 1YNTB 3KYNB 5IBLC 3WNLA 3QJVB 2B14A 2WYZA 3UP6A 3G04A 3QEQA 1O7VA 1W8OA 1CDBA 4OV6F 4ZUWB 4W9FC 3SDAA 5J0BA 1MELA 4GAGL 4CMMB 1S9KC 1ZT1A 4B50A 5C9JA 3QCUH 4JHUA 3V5KA 4S0TD 5DJXA 1Z9MA 2QQQA 1A6VH 1H3XA 1IAMA 2QLYA 3COOA 2FATL 2FDBP 3L1GA 2R1XA 2VSMB 3M07A 4JFED 5KANG 1JHLH 1UEYA 1G7HA 1UWXH 3CLFL 1XF2B 3ZDXF 2VLJD 4G6MH 2PR4L 3S3BB 4R5VA 4NQSA 3U0PB 5I19L 1FA4A 1TF4A 3BH9A 3IPBA 1OAZH 5C86A 4UCFA 5TD4A 5KANI 2PW2B 3F7KA 2AABH 3TTYA 1FZKA 3Q2CA 4LCWB 4S11A 1VFUA 4QLWA 3K8LA 4ONOA 4YXLL 2VZTA 3O2VH 3TC9A 1A3LL 1UB6A 3OX8A 1UWFA 4NCC1 3RWFA 4F9LA 2YAHA 4NPYA 4IBTA 5KJ7E 4C56B 3KW8A 2BZDA 3QHFL 3MRNB 4PRPA 2WZ5A 3KPQB 2UY7B 1TZHA 2J21A 5B21A 2NX5A 2Q7NA 4YX2L 1MEXH 4CN4A 5DWUH 1SVZA 4BZ2A 1B4RA 2DDQH 1CFQB 5ICYA 1SYVB 1E4KC 5MEPB 1I53A 2G75A 2AEQH 3J8F7 4MMYA 4OZHE 3MGOB 3LKRA 1SN0A 5IQLA 2DQUH 3CDGB 5JXED 2EVGA 4JEGB 2D3JA 4FMFA 2X4OB 2GQHA 4XN9A 3PLYA 1GPOH 3HZMB 3IBEA 4CSPA 2WNKA 3D4YA 4JM2C 5LBSA 5DZVA 1OPGL 3LPFA 1JVKA 2G9KA 5CMAB 3T6WA 4YVUA 1MCQA 3V5DB 3IXAB 4J28A 3CXDL 1WFOA 1SFDA 1U42A 4L1SA 2H1PL 2R0KL 3IFPB 4G43B 1MHEB 2FR4B 4ZAKC 3RILA 4ZUTA 5SWSD 4GKNA 1LO5A 2JCCF 2WYIA 4H8QA 4N2MA 4GSXA 1XGUB 3HG1D 2ESVA 1XCTA 3ARVA 1CCZA 1B3IA 5D7EA 1BEXA 4TUJB 4Y16A 2CO6B 4E5XB 2FIKB 2C9SA 5I1KL 1EDHA 2A1WL 2DYPA 5EBGA 1KYUA 4AM0B 1INQA 2Z3FA 3HG1E 5IOKA 3BPCA 4G1MA 4S10A 2Y0SA 5IB3A 4KKAD 1DFBH 1LMKA 1CD1A 1NLDH 4HCGA 3V0AC 2V33A 4CVXA 1K4DB 2IWFA 1IC7L 3PFUA 1MNNA 1KPUB 1NBCA 2PABA 2I26N 2QMJA 2HRPL 2X5PA 3C5ZD 4GI8A 5EB9A 3U0WH 3V0FA 2MH4A 4PWHA 5IMMB 3WMQA 1PZ3A 4LOVA 5HGGS 1GVIA 1HILB 3H9ZA 3ZGHA 3VA2C 3RUGB 1A1NA 4B5EA 2P28B 4HWBA 4I9WE 5A2LH 4RRPA 5L88H 4LCWA 2FE0A 1VKXA 4U6YA 3Q6FB 2H6PA 5EZOH 5B22A 1AGFB 4JPWH 2ZJSL 3MRBB 1BM3H 4AKQA 1CMOA 2NY0B 3DX7A 1DN2A 1H5BB 1QMUA 4BSJA 3AC0A 4IBWA 1Z1WA 2DWSA 4K3EL 1DL7L 3VXRE 5KTEH 2XIBA 3M17A 1WJ3A 3AW5A 2AK4A 3TCLA 1UT1A 2ZKHH 4N2IA 1HHKA 5H94B 3HPLB 2ITCA 4JFDD 5I8OL 5MEOB 1XF2A 1FVDA 5T5FH 4ABWA 4NP9A 2E86A 1SXCA 1I1AA 5J6HB 4G6AC 3SJVD 3WGUB 3ZDZF 1ZGLB 1OKEA 1X5YA 1S7SA 2AJYH 3RL2B 4FFYH 3MYJB 2NNRA 1MJ7L 5K59F 3TEWA 4NC1C 3CIAA 3FCBA 3MV9D 1I1RA 3MUGA 3QIBC 5E00B 4XCEB 3QZOA 4PB0L 4OJYA 1MHHB 2J55A 3SD2A 4MRCA 4P59L 2KERA 1BWWA 1CLOH 1IX2A 2I9LB 4D7BA 3U1QA 3RDTB 1KYFA 4KJPC 4AL8H 3B56A 4L3EB 1UJ3B 2BW5A 2H3NA 5IR1A 4DN4H 5I17A 4QXWA 2EEFA 4MA8L 1W0WB 1AC0A 3WTVA 2D03H 5AOMA 5AYQA 4D3CH 2F5AL 1LK3H 5EUOB 1A4JB 4Y5VA 5SWZD 2ZD0A 4BSVB 2ZAIA 4D0BA 5EV7A 3Q1EA 4UUJA 3WY3A 3SDDA 3U2IA 4GXVH 4MLIA 3LRMA 4H8VA 4NQED 1OCCB 3L3GB 1HQRB 3GRWA 5CUSL 1DBML 4N8PA 4IGBA 2IFFH 5DWPA 4E9RA 3RL1B 3U30B 3VSQA 4PG2C 2ZQKA 1J1OH 1DQDH 3CQFA 1N9PA 3WUZA 3WNIA 4ZFFA 2XPGB 4N9OB 1KB9J 2WTRB 1IBGH 3LIZH 4QRAA 3RVUC 4U1LA 3T0AA 4KTDL 3ECUA 2VR6A 4N90D 2B1HH 3VG9B 1G9MH 1KGXA 4XAKE 3S35L 2AV7A 3CC5B 1UADC 4F7PB 4NKOB 1A64A 3QDAA 3WFBH 2WUCH 1BZQK 2WJ5A 3A23A 5E7BA 2EUVA 3NCJL 4JY4A 3G6AB 4JPKH 4G5ZL 3VXNA 1EDQA 3C09B 1NC2A 1SHMA 1SMDA 3T6VA 3AGVA 3D4ZA 1DSFL 5T1KA 2J8HA 3APCA 4UTBH 2WIIA 3LKOB 1DBKH 3QZWG 3MXVH 4FFVD 1QFPA 2OYMA 2NY4B 4NP4L 2BRRL 3PWPE 1MDAA 3CFKA 4QHKJ 1UJTA 5JR1H 3FONA 4W9KC 2RJMA 1FL6A 5AFAA 3C87A 3FO2A 1A6WL 3N91A 4MCZA 1RLWA 1A21A 1V8HA 4RAUB 5ACZB 3Q05A 1ONQA 2LVEA 1J86A 3V9FA 1EUTA 3B7YA 3AACA 2CGRH 4CSSA 4GP5B 1W0WA 1WRFA 4U6TA 4PJHB 2F54E 3RAJL 3TM6A 3F6JA 4PJIB 2X1OA 3VGAB 3LVEA 2DJUA 4P5KA 4AENA 4X98B 5ICZB 1QBML 4I7ZC 3HC2A 4L4TD 3ZR5A 3OKOB 3NCJH 2FYVA 5M95B 4N6RA 2A6IA 1FUNA 1NCJA 4PY7A 4JKLA 3QFJA 1FNSL 4NUGH 4N0FA 2IQ9L 5KBMA 5E2TL 4BFIB 4XP6H 3VFVB 5DK0A 3C6EA 5F3FA 2Z8SA 3WKQA 3RIAF 5AVWB 4W9JC 5EZPA 3P3TA 4GBXB 3JTTB 5J6HA 5F0JB 5A7BA 3L4UA 2O5XL 4PLNC 3DXAB 4XMPH 2IDUA 4MX7A 4R5TA 5IGXH 3ES6B 3ECWA 3GSWB 2VDKH 4GPVA 4XWGL 1AGBA 1L7TL 1K8DA 1OAJA 4KVCL 4X4ZA 2G2NA 4AQ1B 2ZP0T 8FABB 2ZUWA 4GRMA 2FO4B 1ACXA 1YCSA 3O8XA 5D1XA 1D6VL 3SO3C 1SN5A 2RIKA 2VITA 5EZJA 3CG8A 3RNQA 2FUTA 1I8MB 4BA8A 2EYRA 2H6PB 2KQMA 1ORQA 4PJCA 3ZRCC 3MRKA 3NSXA 4I88A 4GUQA 2LU4A 3AAZB 4AL8L 3NRPA 5FF6B 1X6LA 2P5WE 2QHRH 2AQ2A 3FQRA 2R69L 4HGKC 2X1PA 4BFBD 1HK6A 2YBRB 2KL6A 3T4AC 4I87A 4MMZA 1T66C 1OARH 4JO3L 2Q8AL 3GTNA 5HPMB 4HISA 3OKKA 4LEXL 2IDTA 5E6IC 4HFWB 4PJEE 4LPCA 1ES0A 4I3SL 2W8CA 3REVA 3ZHFA 4DKEH 3U6RB 1M6OB 4Z7AA 4KQ4H 3WXVL 2L8AA 3K1DA 2WVTA 4UOZA 5DQJA 1TVHA 4E5XA 1DJIA 3LNEA 4X6DF 5F3HA 3HR5B 3UO1L 5JIIA 1MQKL 3C5ZC 1WIPA 3H0TB 3KJ4C 5F96L 4Y8DC 5FM4A 2E3VA 5KBDA 1XCTB 2Y24A 2E7LA 4H4NA 2ZCHH 1RIUL 1E8YA 1M1XA 2Q1EA 2J5WA 4AV5A 1XR9B 2XXCB 4OLWH 5MENA 4BWUA 4A6YH 3HR5A 5HVHC 4P2RD 4WAFA 5L2JB 1WBZB 2AXGA 3N40F 1BXXA 2QVMA 5DF0A 5I71B 3VXSD 4FMVA 4IOFD 5E2WH 3CPLA 1PX4A 1WVZA 3WELA 5FOBB 5MERA 2X4OA 4ZFOA 1NICA 2Y5TA 1U8LB 3QZMA 1KGCD 1VIWA 4H8WL 4N3UA 2V6HA 2IANA 1M7DA 3RPBA 3S5YA 3RFZC 4K5PA 1S7RA 3SDCC 1NMAH 3WS6C 1JOIA 2XC8A 1X5IA 2JTYA 4HG4K 4HKJA 2Z1KA 2B39A 3OTTA 3WN5B 1QUNA 4JZNA 3GIVA 4P3DB 2A1WH 8FABA 1MCRA 3FN9A 5E1IA 4UOJA 5IJDC 2FB4H 5LAPA 4RMWA 3B2VL 4HKXA 1RY7B 3HMXL 4Z23A 2XTJB 4GMTH 5E0QA 5CSZA 2G3MA 3K71B 1USQA 5EFIA 4E9LA 2Z93B 1QWUA 3IDGA 4JUSA 3D39D 1IGTA 4RWYH 1MXGA 5D7LE 4NWUL 4QHNA 1KTJA 3VFVA 4LBEA 1IL1A 2FJUB 5ETUB 3BIKA 4GG8A 3SBWC 4JQIA 4QOKD 5I2IA 1JZEA 2AGJH 3ATEA 1GGCL 1Y18A 2UWEE 4V1DD 3UZVA 3VXMB 1TJMA 1CD0A 1RJLB 2ADIB 1X5ZA 4K2UL 1KF9B 3KJ6H 5ACMA 1EXUA 1YJDC 1IM3D 4JANA 3N2JA 3L2NA 3SQOH 4ZPVB 1TR7A 3ZZSA 1W80A 4PJIA 4IIQA 3BDXA 1JZHA 3N0PB 4KZ0A 5C9JB 3H53A 1PD0A 2QDWA 2CCLA 4G9FD 4ZUWA 3TJPA 1LDSA 3DX9B 1G7PA 1PLAA 3NACL 4OUUA 5I6OA 2ORBL 1NDTA 4WWPA 1CU4H 1NFDB 2IANE 5FO9B 1KTRL 1YEDA 5C6PB 1D5XA 5GRVL 1KCUL 3KL5A 5ACLA 1G9NL 4GQZA 4Q6KA 4LU5H 2BFVL 4B41A 3U36A 1O6TA 4YXLH 3WJLA 3CZGA 1MRFL 4N68A 5I6MA 4E68A 3IGKA 2IDQA 4O4YL 5FA3A 1F86A 4LRNL 3TO4B 1PIGA 1RUMH 2VAJA 2E76C 2QR0B 3IDXL 4AIZB 4AJYV 5B3NA 4JFEA 1TNMA 4MJ6B 4GAJH 4G6ML 2P44B 3TVMD 4BK4A 4K94C 3CC5A 2AEPH 2HX9A 4ZUUB 4MHHG 4LCWE 4BE5A 3CFJA 3VDBA 1TO4A 2JCCB 1DBJL 4KK6C 3GSNH 3ZMNA 2YUXA 4WI9A 5DTFB 3D85A 1UB5A 2YXFA 2LAAA 1MI5A 5EO9A 1HCZA 2CKBH 3WIHL 4R0LA 5AOJA 3UCQA 4NI6A 4J7RA 3S3SA 5I76A 5KSUA 4HU2A 5EG6C 4LHUG 4L2YA 3MNVA 3GSOA 1MREH 4Z7VA 3LZLA 4BFGA 1O7SA 2XIIA 5DJ0B 4WNQA 2EXWD 5K9QI 1ET5A 1IBFA 3FCSB 1DP0A 1LWJA 4D0BB 2AHIA 3P9LB 4XOBA 5K9OB 2FIRT 3ATAA 3ZHDA 3AROA 3QXAB 4DKDC 3T1WA 3LEXA 1IB5A 2E7HA 3QXDB 2AXHA 1IC1A 2B0SL 1I31A 5HI4C 5MEQB 1RSFA 4M5YL 4AC4A 1V54B 2Z7WA 3S2CA 3BEWA 1JCKA 4PMFA 2G3ZA 3QDGA 5IZ7A 5I6XB 5J89A 3DJTA 3L95A 4XCEA 3D39E 5DEFB 5IB2B 4K5MA 2I07B 4NRXB 1MHPH 2FO8A 3ARDC 3FQTB 1HEJC 5EDSA 1PAMA 2FB4L 2A9AA 2ZG1A 4JB9L 1I1FA 4TLKA 5ELIA 3GM8A 4NIYE 4M6OH 2ZOTA 4EUPH 4POYA 3MFGB 3NUKA 2BY2A 3O45B 4C8XA 2EIBA 1NFKA 1GGTA 2EDRA 2YMTA 2ZUSA 3CX5K 3D3VE 2WHVA 3QHZL 4KKLD 5FYJU 2J6WA 1VERA 3L5WA 1WC7B 2D0HA 4LDLB 3Q7JA 5KG9B 1XIWC 5MEOA 3QUXA 3TCLB 2WYHA 4JM0A 1SEQH 1AQDA 4M1GL 4TXVB 4BV1A 2VMEA 3NMEA 5DK3A 5DQ9A 3DO3A 2OL3L 4BXSV 1N59B 4LMQI 3MRQB 3MI6A 3DURA 3LD8C 3T1FA 4LP5A 4GQQA 1D9KD 1I8IB 3T04D 5IEHB 3B9DA 4L18A 3GI8L 1VKXB 2OMUA 4PGDA 1JV5B 4ZTPH 4OD2B 4P2AA 2EDWA 1RLBA 3K71A 2YAQA 2A4EA 4TTDC 1HILA 1FQ9C 4XVTL 1MCEA 2GJ6A 3C08H 4PP2B 2VLRE 5T33H 1KYAA 4GG6B 1HZKA 2P8LB 4OLWL 3Q2WA 2B4CC 1HEHC 5CP7A 1NAMB 1OT1A 2YMOA 4L23A 4A6YA 4QCIA 1R4XA 2E9BA 1C8QA 1PIFA 4N8CH 1DVZA 3ARYA 3A4DA 1IBYA 5B1KA 1EMTL 3BPCB 5ADPH 3WXVH 4AYMC 3PAYA 4HHAB 1PSKH 1S7RB 4I3SH 2YQBA 2YA0A 4JG5A 4J8QA 5IVNA 3RZCC 3TP4A 4CSTA 3QIWC 2Q8AH 4Z1PA 3V52L 3OAYH 1J8KA 4M61A 1EJ6A 3H42H 2G0KA 1AY1L 5D4QA 4OGAC 4XNXL 5EIIB 4C55A 3EHBD 5MERB 3PL6C 3ULSA 2JKTM 5DRNA 5JPMC 2FSEB 4YLCA 4FQCL 5C0JB 3HB3C 4LVOC 5CHNB 4S1QH 1LP9B 5EN3A 3D4GA 3T0ED 5L2JA 1HIML 3ZDZB 5FCUH 3X3GL 1DVSA 1JWMA 2Y06L 3Q8AA 4BFFA 3MJ7B 4NQUA 1KJ3L 5EBLA 1HHIA 3C9NB 5D7IA 2EVHA 5LWYL 3H0TA 1IU1A 3R19A 1K9TA 1FH2A 4NHCH 1QLEB 4KXAA 2VDKL 1EUUA 3DGGA 5F3HB 1PG7L 4MVBC 5T3XD 1SZNA 1U95B 2V8MA 2ITDA 4GSDH 3RX9A 3WDJA 5DZNA 4L4VE 3NJXA 4ZOBA 3QDJA 4J1UB 5E8OB 4XPFL 4IEFA 5E4OA 5JW4R 5F7HA 1U8JA 2CNZA 1TZHB 2CBPA 2UY7A 1AJ7H 1DVFD 2VDLH 3MRNA 1FNSH 4RETB 4JFEE 3DRTB 3OF6A 5IQOA 3FT9A 5IQMA 4ZJ9A 1JK8A 1VGKA 3P30L 4NM8L 5D6CA 1EJFA 3LIUA 5I1GL 3US0A 1KWKA 2OMVA 4WI3A 4LDCA 2OL3B 5A2KH 1ORQB 4PJCB 5I1IH 1YY9D 1CO1A 5DT1L 5IQ9B 2R29H 3D2UD 43C9A 1YAZA 5D2NB 2FO4A 3O8XB 4KRMB 4JREB 4NHUA 5D96C 4FQIH 3PRZA 1AGBB 1DR9A 1E5BA 3FQ4A 4WHDA 3C60A 1BF8A 3EDJA 2IXQB 1GC1L 2DI7A 2V5TA 2MIZA 3IMUA 3UIYA 1AXSB 1U9KA 4UB0L 3SDXA 1A6UH 1UURA 4RLDA 1ZA3B 2QZQA 4U6HA 2JB6A 4R0LC 2AJ3B 2OR9H 1TYEB 4GSQA 3QYCA 5DC9B 4FDWA 1OV8A 2QGEA 1P7KA 4ZDHA 3EH5B 1J5OL 2GJZA 3IRZA 4WSGA 4WWNA 3PHSA 2ZUTA 3W5MA 2CUIA 2WTPA 3L1OH 5ALCH 3W0WA 3EJUA 4IRZL 4MTMA 4UTBL 5KZCB 1U8OB 4UAOB 2NDGA 4ZAKD 5CNHA 3NFNA 4JPQA 4G7RB 3OKOA 4KRPB 3ZE1F 2PTVA 1RURH 1KJ2A 2V7NA 4JM2F 3VFNB 2ZYIA 1S3KL 5D5MA 4M8QA 4A67A 2P80D 4GRLC 4GS7B 5HHVL 4NENB 4FLQA 3IPFA 4E9VA 2DOCA 5ESAB 5B39A 4PJBE 3OR7B 4JRFA 4PS8A 3KYKL 2AERT 1A8JH 4F7CB 2D31B 4X99A 2PCXA 5BMFL 3RFZA 3P77B 4MDJB 1KLGB 3X14A 5D7LD 3H3PL 1E6JL 1W2KT 3BHBB 3U46A 1O6SA 3MRRA 1CFMA 2DF3A 3C2AH 1X7QA 2MOGA 2NZIA 2ATPB 2WAHA 4QAWA 2FJFB 1TTGA 5BNXD 4F9LC 3F65A 4WJG3 1RHHB 1AOHA 4S0HA 2PTTA 2R4RL 3PXJA 1V10A 1LMIA 3B9EA 2WBJA 3D18B 2JI3A 1VHPA 5T1KB 4DP0X 4M6NH 1F1DA 3RP1A 3LS4H 2GEQA 5GGTA 4DN4L 4ZMLA 3GS4A 5EU7E 2Q7YA 3KGSA 1MQ8A 4PBVC 1I3RB 2XBTA 4TLUA 4CW1B 5BJTA 1HQ4A 2D0FA 4RAHA 4KKBC 2CR0A 2W92A 3TYGH 1J48A 4BFOA 4RBPK 2BP0B 4HD9A 4N8VG 1H6EA 4TUKL 4TQ8A 4TNEA 1FIGL 2X7LA 5GISL 4XOEA 1CPUA 2JSFA 2F9BT 2R29L 5JPNB 5DJ8B 1Q1JL 2XPGA 2ICWJ 4FGMA 3PG2A 3ATDA 3FU7B 3D3VA 1HXMA 1NDGA 1TOXA 3QUGA 5B39G 1SEBA 1KULA 3E1F1 4HJIA 2B16A 5FHBL 2XHNA 2YWZA 1AHWB 3HBPA 4JPVH 5LNGA 2GW5A 2Y7OA 2XA3A 4U1HB 5IB4A 3CMOL 3TF7C 5DHDA 4GAFB 2PYEA 2VLRA 5L2KD 1A0QH 4JJHA 4KQ3L 3U46B 1CI3M 4E9QA 3LOWA 1HINH 3NCYS 2ZKHL 2WZ6A 4QNPE 1YMMA 1A6AB 2FJHA 4KFMA 4Q0XL 1NFDF 3PHOB 4NJ9H 5EUOA 3DC0A 4OM0H 1F18A 4NZUL 2DL9A 5T8IA 4F7CA 5FFLA 3AY2A 2QEJA 4EDXA 3BDYH 2RCSH 2XN9E 1E9PA 4WSKA 1TFPA 1NPUA 4FI7A 1ZLWH 4XVUD 2KHAA 1N8ZA 4TULL 1LEKA 4KZEH 5F9DC 3QT2A 2K4WA 1KCRL 1OGAB 3KVQA 4FD0A 2CO7A 2TSAA 2DMBA 4KRPC 4WEBH 5EWIH 3MBEB 1MFVA 2H0EA 1BD2D 2WV3A 5KJ4A 4H8WC 1NUNB 3IDUA 5JO5A 5CZXC 5H2BB 2A77H 2AJSL 1JGUH 1M7XA 3DWTA 1RAMA 3ZTNH 5IQ7L 2Z31D 5CJBA 2O1AA 2WWNA 4LEOA 2IH3A 2BZ7A 2VDML 3RVTC 1GIGL 2EO9A 2X3BA 3S4SA 3O6FC 2O5ZH 2Z34A 4PB0H 4V1DA 4ODVH 1FVDB 2DKMA 3KPSE 4QOKB 1GY2A 5I1KH 2ITCB 5CJXC 3RQ3A 2J4WH 3KLHC 1AHKA 2Y2YA 3STBA 3MUHL 3BZFA 3VXMD 5EC2B 1FZMB 5DRXA 5IBUB 3ISWA 3N40P 1H5BA 2IVFC 4UINL 5D2NA 3DX7B 43C9B 4IJ3C 2CBMA 3MA7A 1BIIB 1ADQH 3KLAA 3DOHA 5HDQH 3AY4C 4H88L 4UM8B 1VJSA 5KYWB 4HIEB 4GYBA 1AD9A 5AKSA 3RDTD 3CH1A 1CN4A 3DX1A 3T3MF 1EBPA 3F2LA 1BGXH 3GBML 5EN2A 3PQYB 4OIIL 1OLZA 3A4AA 5HJDA 4ATTA 3VQLA 4YHOH 3DDGA 1E4XI 3KPRD 1OAUH 5D1QB 4PRIA 1QVOB 4CVXB 4GIOA 3GBEA 3LXBA 5F2FA 2JB5L 5HD8D 3VRLE 4BELD 2ISDA 4PV9A 4GG6F 2NY3B 5FYKH 2HUEA 2OSLB 3ARQA 3BGMB 3HMWH 4P5TD 4CILA 2WLHA 3GXTA 1R5WA 3E6HA 3KPRE 5J6GB 5C0CE 1KIUA 4FNUA 5CCHE 3B2XA 3CVIH 4EN2A 1P69B 1SBBA 2BSEA 1NH6A 2ESVB 5DA4A 4JFDB 1BQ5A 1XGUA 2IADB 2NYYC 3AUWB 3GTVA 3IXTB 1DFBL 1HI6B 3G5YB 3RTQD 3U7WH 4D7PA 3HI6L 5AVZB 3L5XH 4MJ5B 1ZE3H 1KBPA 4LL1A 3ZE0E 4NRYA 1ZV9A 1TTCA 3C2SA 4AQAA 1MAMH 4G83A 4LLMB 4OD3L 4W81A 3SJVA 5C0JA 5DZOA 4WFED 1P53A 1KYOJ 1V27A 3DIFA 5DRNB 2GAZA 2BSSB 4PYGA 4JB9H 1BYOA 1JZ5A 1R6VA 3PL6B 5FDYA 2NY1C 3JWOL 5DURB 2FGWH 1JXKA 4OJCA 5EIIA 4F57L 4OM1H 3RGVC 5EPMB 1SXAA 1Q9KB 4WFEE 2MCMA 4AGNA 4G8GB 3S8WA 1T21A 1U58A 5JHDE 2XICA 2FX9H 4IDLA 1CFQA 3ZKMC 1H3PH 5IFAH 2XRAL 1UD3A 1MCOL 2WXHA 4U1JB 4HW6A 4O2EA 2J6EH 4WFHD 3JT0A 5F7DA 1OPGH 5LGYA 3ZMRA 1PLGH 4PGJA 3RB7A 2OLDA 1JHKH 1RULL 3PHAA 2NX5B 4U7SA 5KUMA 3WSQH 2QGDA 1ILSA 3NEXA 4W6WB 2RALA 2GC7C 2Y6SD 1FZJA 1KB5H 4RZCB 4MD4A 3TBWA 4EI5B 5SV3A 2VERA 3VGDA 5BXFB 4EI5D 1UB6B 1O9WA 3LS5H 2R0ZL 4XH2A 2CKBA 2JVUA 5E9DD 3QI9B 4OJAA 1P7QD 3I9GL 3WIHH 4F7KA 1FZKB 5JIDA 5KAQG 2WTOA 5AD0A 4CGTA 1DJZA 5AB1A 2AMGA 3FYEB 5ITBL 3ESMA 1NWOA 2WKOF 3HVDA 5IVXA 5FWQA 2MWCA 3T3PB 4QRQB 5BZDA 5HGHA 5AG8A 2AJXL 3BVNA 4U1SA 3ESUF 5D5ME 1F5WA 2E8ZA 2AAVA 2Q5BA 2EEXA 3TXAA 1Z6JT 3B9KA 3EYSL 3MUUA 3O2VL 4IOSA 1JHKL 3IAQA 3WSQL 3P02A 5TDNA 3S36L 1TJHL 4X4XB 4WI4A 2WVSA 5SV4A 1JYWA 4YR6B 1QA9A 2R1XB 4TSCH 3VA6A 4B7IA 1TCMA 5IROD 2BS71 4P4RB 3QA3B 4S2SA 2LW3A 5LUMA 3MLVL 3FFCD 3SDAB 4NNXA 4UV4L 2WGNB 5FM8A 1MWAA 4PJAE 4PJ5D 4ODWA 3IDYC 4ICXA 2QPEB 1AIZA 3D9AH 3QEQB 4LVEA 1EAJA 2AJUH 3BYYA 5M94B 4HZLA 2OSYA 4YDIL 5J5EA 2ORBH 5BV7C 3NVQA 5CD5C 1BQLL 2ZNWA 3G6JF 3IU4L 5HHME 4DPBX 2HMIC 1KV3A 1RHFA 2NT1A 4YSRA 4UIMA 5B7FA 1GGBL 1KPRA 2W59A 5HHOE 4XVSL 4GAGH 1ND0B 3WKMH 2VH5L 1OEZW 3ETSA 3SQOL 4NO5A 4Z7UE 1MI5D 3UAJC 1NBZA 3CVIL 1XH1A 2M26A 5T1MB 5FYJH 4U2YA 4PJ7A 5I75C 1FGNH 5BZWB 3UTSD 1N8OE 4LCUB 3RX8A 4IRSA 4PJGA 2VXQL 1LO2H 2QJDA 2B2XL 2CO1A 4Z0XB 1NOAA 2JB5H 5D7HA 2FAUA 2JH2A 1SM3H 3VI4A 3TYFB 4XMKH 3VXSB 5HYIA 1IGIH 5F71A 3T4AA 3US1A 4UQBA 1T2QL 5DMIL 2HZHA 5JQ6H 3KWWB 4BD4A 1IFRA 4F1SA 1UZ8A 3RY6A 4BH8B 3AG4B 1WGOA 5ID1A 1XDTT 4AEFA 1J12A 3KYOA 2OP4L 2L7EA 3T3PF 3U2JA 3ZO0A 2F8IA 5DJAA 1GJUA 4IRSB 4M43L 2W91A 4PJGB 4MXWH 3GPSA 2ZKMX 4YDKH 2X6MA 3SDDC 2GIXA 4AIZA 3MNZA 3QRGH 4HEMA 2A4ZA 1DBBL 2NUTB 1VA9A 1JCVA 4NLHA 1U2CA 4M7LT 3TFKC 4YLBA 5FO7B 2VDOB 1MZYA 3OGCB 4M4RB 5IIEB 4KUCD 1F4AA 2K45A 1OL0A 2VSDA 2VLLA 3SE9L 5G5DB 3P2TA 5KSBA 3MRDB 1NMBL 3OMNB 2FX7H 2OW7A 3I3BA 1TZGL 3DX4A 3IYLW 4NKMB 2GJ6D 4PJFB 2O5ZL 2EICA 5IROC 3VFSA 1UH3A 4XCYB 7CGTA 4TVPD 5PCYA 4RIRB 3H54A 4KMQA 1RZQA 5ISZD 5J11C 5IFJA 1XGPA 1CGYA 1JNLL 2LLNA 4NNXB 4QRRB 1GW6A 4LPUA 1A4KB 2C7UA 3INOA 1DN0A 4NZRH 4W9HC 4S2SB 1Z9NA 3JWDC 1EXHA 4N0YH 3MFFB 2IPUG 1IM3A 1ZXKA 4WEEA 1BBJA 1EVTC 1U92B 4M7JH 1QSZA 3RJOA 1V7NH 2F53B 2BVQA 4DVBB 3T0EA 5GGUA 1OT2A 1S7UB 2HTLD