1KZYA

Crystal structure of the 53bp1 brct region complexed to tumor suppressor p53
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
195
structure length
195
Chain Sequence
b'SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Dna binding protein, protein binding
source organism Homo sapiens
publication title Structure of the 53BP1 BRCT region bound to p53 and its comparison to the Brca1 BRCT structure.
pubmed doi rcsb
total genus 41
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kzyA00
2BINA 2BIOA 3VD2A 4AGOA 4IBYA 1HU8A 2XWCA 2IOOA 4GUQA 5AOLA 4IBQA 4MZIA 2P52A 4G83A 4HJEA 2J1ZA 3VD1A 4GUOA 4QO1B 3ZMEA 4AGPA 1UOLA 4AGNA 4AGQA 3WTTA 3D05A 4LOEA 3WTXA 3US1A 4L0YA 3D0AA 2IOIA 1KZYA 2RMNA 3WU1A 2J1YA 3D09A 2X0UA 4IBSA 3EXJA 4AGLA 1T4WA 2VUKA 1EAOA 2IOMA 1GZHA 1H9DA 3QYMA 2AHIA 3Q05A 1IO4C 2X0VA 5AOMA 1TUPA 4IBWA 5AOJA 3VD0A 1GZHC 5ABAA 3US0A 2J1XA 2XWRA 5KBDA 4IJTA 3Q06A 5G4OA 4L0ZA 2BIMA 5ECGA 3IGLA 2X0WA 3WTWA 1LJMA 3WTSA 3D07A 2ADYA 2J1WA 1E50A 2J6WA 3TS8A 5LGYA 3WTVA 4KVPA 1HJCA 1CO1A 4IBUA 5AOIA 4LO9A 2J20A 1EAQA 2WGXA 4G82A 4XR8C 5AB9A 3EXLA 2PCXA 4L18A 4MZRA 3KZ8A 3IGKA 3WTYA 2AC0A 2OCJA 1HJBC 2ATAA 3KMDA 4IBZA 2H1LM 5G4NA 4A63A 1TSRA 2YBGA 2BIQA 3D08A 2BIPA 3WTUA 2FEJA 5A7BA 2J21A 1YCSA 4IBTA 4AGMA 2GEQA 4LOFA 5LAPA 1EANA 4IBVA 5G4MA 3QYNA 2MEJB 1CMOA 5AOKA 3D06A 3Q01A 5BUAA
chains in the Genus database with same CATH superfamily
1TQVA 4I8DA 1PL3A 3KBHE 2MTPA 1MIEH 1HSAB 5JPNC 3MLRL 5EU3A 5FWQA 5I18H 5K59F 3GSVA 1OF0A 2JKNA 2JE8A 3ZPDA 4ADGA 1F4YL 2W0LA 1MFNA 3MOAH 4FFYL 4W9JC 2QZ5A 3DROA 1NFIB 2OMXA 2VDKH 3SDAC 5I76B 1QFUL 3K81A 5BRZB 2VH5H 1OF2A 4WU7B 1X5IA 2H3KA 3OMZA 4M00A 5DD1L 1UKSA 2AK1H 1SLWA 5EZLA 3HNSL 5AVSB 1RUML 4L2LA 1AC0A 4KTYA 4PUBL 5TF1H 1EERB 5SWQB 4ZT1A 3CX5K 3HNSH 4BCXA 3OAZH 4FKKA 1GMIA 1U8OB 1A7OL 1AOZA 3ABZA 1IBBA 1TZGL 4FQIH 3S5LA 1DVFD 4F7PA 4A6YL 5HHOB 5TK2A 3QZWB 3E8VA 1T0NB 1T4WA 3TNMB 3S3JA 4DKDC 3CXFA 2ZXWB 1MCOH 2CK0L 4UQ2A 3VDBA 4ZNEE 1QO3A 3GSQB 2MCAA 3QO1B 4IBWA 1S9XA 2XX0A 2DWTA 3VXQB 3PP3H 3BQUC 4GBXD 2XWBB 4Y19A 4JPQA 3CIQA 1USQA 3TF7C 2YA0A 4QRRB 2KZKA 1URZA 4DFHA 5E4AA 1GY1A 3QH3B 4LL4A 5I1LA 1UB6A 5AW5B 1ETB1 1A8ZA 1URLA 2JXMB 3MUY1 4L8BB 3MGOB 1BWWA 3X17A 4MCZA 2VNCA 3I6LE 1M05B 5I6NA 2AP2A 2ZXBA 3MI6A 4P3WA 1AANA 1S7UA 5I82A 4ZDHA 5JHDE 4P9HL 5F7NC 2P5EB 5FYLD 3H4FA 3ZVVA 4M62L 1USZA 4NO3A 5H8DA 1G7HA 4L4VE 4PCSA 1WRFA 3BQUD 1LP9F 2HT3C 3N44F 2OJZL 4GBXC 4W9LC 3RFRA 5LGJA 3QJTB 3N0AA 3MNZB 2CDEB 4WI7A 4NFBA 2YSTA 3CWGA 5T1KB 4K9EL 1S3KL 2G2RA 1HHHA 3CSBA 2VLJE 3I2CH 4WFFD 1K2DA 3IKCA 4XC1H 5IM7B 5TPWH 1GGIH 1UVQA 3S8WA 2JNZA 4NN5B 4R7NB 4OLWH 2WVVA 4HWUA 4GKNB 5IB3A 5CEZL 2QEJA 4NJ9L 5F6HJ 5LNGA 1VJSA 1XR9B 2J4WL 2NX5A 5KVFE 3CDFA 3WFDL 4K94H 1QI4A 4OZGA 4OCMC 3ZYOA 4G8EA 1OGAD 2H3NB 4BSWB 1A5FH 3P3YA 4MNQE 1BIIA 1X5XA 5GZNA 5GRUH 4DPRA 4ENEC 3EGDA 2ETWA 5MEQB 2YK1H 5DWUL 4C59B 5FLVA 1IKNC 4ESKA 3MODL 2AJYL 3F6JA 3SPIA 4MSWA 3N41F 2P43B 1NAKH 4M4PA 1PW3A 4G5AA 2R29A 3ZTJG 3EBIA 1GRWA 3EUDA 3BVUA 1T21B 1XDTT 1EDHA 1OP9A 3ZZSA 3UG3A 4L9LC 1FIEA 3TBWB 1FV1A 3M1BB 4JQXC 3FOLA 3GJEB 3E9TA 2VJ8A 4G70B 2I60H 1E6JH 2J2ZB 4GAYA 1JFQL 2I07A 1BAWA 1HI6B 4TUKH 3FTXA 2GPZA 4N2BA 3TC9A 4XAWL 5HDWA 3BE1L 5K9JH 4TXVB 3P73A 2OYKA 3OB8A 4NAQA 3BVXA 1J9SA 4HBCL 4ELKB 5CJXA 4JPKH 4FFYA 3AT8A 1YEFL 1YMME 4MDJB 3NIFB 5F88A 3TZVB 4QF1A 3CU1A 3HI1A 3V4VH 4WJ5B 2PYEB 5HHQA 1YY8A 1FFOA 2HKHL 5HHOE 2CGRH 3KYNA 2MCMA 1BZQK 5IFAH 4J2XA 5E8DL 3MCLL 4AKPA 3MJ8A 5H35B 3DUUA 3IRCA 4P23B 4CSZA 2HTLD 4PJGF 4DO4A 4R96A 1VFOA 2KDGA 3C09B 3MJ9L 2YUXA 4N2GA 2LAAA 5AKRA 3U4EB 1BXXA 2W07A 1F3RB 2YC1A 3EH1A 2FVNA 3MRQA 4AWJC 4M03A 2D9QB 4UT7H 4HHGA 2X9YA 2HFFB 2Q6WA 3SBQA 4F2EA 3FC8A 1L0YA 2Y2WA 1S9VA 5DI8B 4CDHA 3GFUA 2AJSH 2MQGA 5EBMB 1F41A 3DMMD 1RULH 2ARJQ 2ZONA 2OCJA 5CHNA 2BY0A 2VR3A 2VN4A 4IKIA 3L4YA 4PJBB 4XN1A 3LD8B 1BQ5A 5FW6A 2ATAA 5GGSA 2DRUA 5EC1B 1CGWA 1EEUA 3K1KC 1ZHLA 1N4XH 1SMOA 4FS0A 1TZOA 3F58H 5F3FA 5C09E 3VFMA 1DQMH 4DGIH 1B90A 1DYZA 1JMZA 3QJUB 5F0PB 1YPZB 1TXKA 3FPXA 4EAEA 4ZX4A 4UI2A 3LS4H 4DETA 3HUJF 4IRSA 3WIAA 5GGRY 4ZTEA 4OZGF 4QJ4B 3GSNH 2PTVA 3X2QB 1P5VB 4AYFA 3H7LA 1P5UA 3G3LA 4G2AA 1XH2A 1BLIA 3PWLA 3RHWK 3SPHA 3K2MC 4BK5A 5IEKA 2K78A 3PWVA 5EZPA 4HH9B 4TVPE 4PJ8D 1V54B 5A16A 3LKQB 4RZCA 1YEIH 3CQPA 1PF3A 3V6FB 3RTQD 1AKJD 2J8UF 2NCEA 2EYRA 5HBBA 3SYOA 3ESPA 2DTML 4I3SL 4H0HB 4UF7C 4OD1H 5FKPA 3F58L 1DUZA 1YNLL 2R0KL 1WS8A 3GEFA 1KFAH 2OMWA 3KPMB 3QDAA 5HHXH 3ZT7A 5E00B 4AM0A 3QUXD 2YMOA 4TTGA 3MRDB 1MCPH 4R5TA 3Q1SH 2GI0A 1H6EA 3GO1L 2VL5A 2F7OA 3PP4H 1XCQA 3Q9QA 3RWCB 3O6FD 4RX4D 1OAQL 2ITDA 3GEWB 4RIRB 3PHOB 2IQAB 4QRPB 3LRMA 2AQ2A 5DHXB 1HL9A 3AS0A 4AM0Q 4FABH 3NYKA 4J1UB 4NNXA 4ZO8A 1ONQB 4V2BA 1HIML 2Y7SA 4BK8A 4EQ3A 1N64L 4G1EA 2PWDA 3V6ZA 2X4RB 4FNUA 4KFMA 3GSXB 3JWOL 4M5ZL 5DS8B 4Y1AD 4ABQA 3L9BA 2NYYD 4ZUVB 5AOJA 4PW9A 5DO2C 3QDHA 5GGVY 1U4EA 1XGUA 5CEZH 4Y5XC 2WBJA 4DUXA 4DN4L 4HPOH 2BIMA 1UZ8A 1TCRB 2ERJC 4G6ML 2NQ3A 4J3VA 1MJ8L 1FNSH 2P44B 3VACA 3QHFH 2WLKA 4GEJA 4J3UA 4ABWA 2YEVB 1OM3L 5KAQF 4KDTC 4G9DA 3KW8A 3OMNB 4N2KA 1BZ7A 3TCLA 1Q0XH 3BDYL 1KN4H 4RFEB 4WFED 1A64A 1XHHA 2JJTA 2O1AA 3BP4B 4ETQA 5AAWA 3OC8A 4DN4H 2PPDA 2IO5A 4Z8FL 2Y25A 1OGTB 4WK0B 1EGJH 2AF2A 4DCQB 2IDSA 1DJXA 1OSZB 1YEGH 2NY5L 5JDJA 4PJIE 3NFSL 3WO3B 1IGIL 1VHPA 2GHWB 3FCSA 3LPPA 3QCVH 3QJOA 3IFPA 1U8CA 4FLQA 4LHUD 1FNGA 5FYKL 1T0PB 3LIUA 1T1ZB 4UIKH 3W5MA 4MMXC 1K6QH 2XV2A 4KC3B 4XPGL 5EBWA 3QQXA 2BIQA 4P2CG 2GVYA 5DZPA 3ULVL 4BKLA 2OXGA 1NGYB 1C1EL 2X44D 3DX9B 4OB5H 4ZYKA 3I74A 4CN4A 3UFIA 1DEEA 3VSQA 4BM7A 4X7TB 5D7HA 3EJJX 3K46A 2P8PB 1X5FA 3IN0A 5G4MA 3FQNB 3ARWA 1ZGLM 3HTLX 3HFMH 3HKFA 4Y2OA 4YLCA 3UG4A 1KDJA 2VW6A 1WJ3A 5CNHA 4C56B 4N1CA 1XF4B 3ZT6A 2LHAA 2IXQA 1OAXL 3RVUD 4D94A 2D0FA 4WK2B 5BNXD 4J27A 3QDGB 1CXIA 4G59C 1B9ZA 4OCWL 3MV8E 25C8H 2X70B 1HXYA 3C6SA 5E7BA 3SDCB 4ELMB 3Q6FA 3L9RA 2ZSWB 1PY0A 1NMAL 5J3HC 1WVZA 2VH5L 5DD1H 2CCVA 1SFHA 1DUYA 5JQHC 2D0HA 1KIPA 3DGCR 5ESVB 4ZW3A 1MH5B 1NDGA 2R1WA 1JWSA 2V3EA 2VERN 1U33A 2DWDB 2QELA 2WZAA 4KXZI 1Y1DA 3WL9B 5J1TC 4N1EA 4QTHA 2WLYA 1KJ2H 1T22A 1O5PA 4ACTA 1S46A 2XFXB 1RURL 2WWMC 4RMSA 2X0UA 1JF1B 4ODVH 1HOEA 1U8HA 2DJSA 3OJVC 1K85A 4A39A 3QG6B 3P0VH 3SJVE 1OO2A 3ARDB 5HDLA 1U3HB 4M9PA 3VFWB 2UXVA 2VXQL 1FF5A 3H0TB 2A1WL 3LPWA 4XCCH 4PIRF 5SWSD 1FC1A 2HFTA 1Z0NA 3EJQA 2NSMA 1JTTA 2EDNA 3IDYB 4K9EC 1S78C 5HPMA 3V0AC 1IFGA 2RCSL 1FZJA 3MRLA 4HIEA 1GJIA 3GSNB 3BFOA 1P7KB 1E4HA 4IGBA 4IRZH 4A6YH 5EU6E 2X2UA 3E0GA 2OTWB 5IQ9B 1JWUA 5JIMA 2QZQA 1GS7A 3SQOL 5J9PB 2FX7L 1I7TA 3TT1L 3VW3H 1KMGA 1JPEA 3SE4C 4N25A 2Q86A 1RZGA 3H3BC 5C1MB 4XNXH 1RZJL 3LIZH 1EAQA 2XWJA 5FUCC 4W6XB 5GGSY 4LGRB 5B1JC 4MGXA 5GGTL 3PWJA 3MXWL 3L5WB 4FTDA 1F4XL 2D3NA 3B2VL 3BKCH 2VZOA 3ZQ9A 1ZWIB 3B43A 4U1JA 4N9GB 1OGAA 1HILA 5E5MB 4I18C 1PKQE 1P4LB 1IGYA 3OHMB 3HC0A 2OR9H 3CDCA 4MX7A 2HMID 5JIPA 1I9JL 1WZKA 2GIXA 1L5GA 1DJIA 4ZFOA 4Q9CA 3E3QE 1XT5A 3DWTA 3NDYE 4PWIA 3BGMB 2NCMA 3EH2A 1EXGA 2XUWA 5CP7B 4B3EA 2BNQA 2BJMH 1WC7A 5F1IA 1K5NA 1U21A 2NY1D 2QLYA 1MI5A 2MEJB 3ARFA 4LLWA 5AOKA 1RSFA 1AXSB 1CLCA 3JBG7 4OTXH 2AXWA 1XCTB 4G5ZH 4LPYA 4NC1E 1C16A 3U1PA 4FG2A 4PRIE 1SY6H 1DBAL 1LO3L 3NSCA 2YQBA 3HZ3A 4P46D 3H9ZA 5J13C 3W81A 4CVZA 4IOIA 4JG1H 3V0VA 1QFWH 4UQAA 4UQEA 4P99A 3C8HA 3IBEA 1NSNL 2VLLB 4D7PA 1SLVA 3EO0B 4KHXH 1A14H 4OSUL 5GZOD 2YD6A 4DT2A 4NIYE 4K07A 4XZ4A 5EPMA 3OJDB 3B1TA 3QAZC 4APQD 5LDUA 3NCXA 2XPGA 3MSPA 4YNYB 4YWGL 1XTMA 4DP9X 3UBFA 1FC2D 1FORL 1RZQA 3ETSA 4H40A 2HRPL 3K91A 1IFRA 3U83A 4FJ6A 4U1IB 2CZNA 3BAIA 3BPNB 1OGAE 4U05A 4ZUSB 2WZPD 4Z77B 2BP5M 3W0WA 4N28A 3ESUF 1T89A 3CFQA 4ANVA 5AL8A 4KJWC 3HBQA 4XMWA 2VLRB 2HP4A 3T8XB 4DZ8A 4M29A 2I5YL 4UYQA 2DL2A 1Q0YH 3IT8D 1FFPA 1T5WB 4XOAA 4JFFA 4L9LB 5IBLC 5FF6A 3KJ6L 1MAMH 4D0DA 4M56A 1M7IA 1SVZA 2MCPH 3VD3A 2CGZA 3TYFA 1DSFL 2JKLA 4GB9A 1JN6B 2HVJA 3M17B 3PG2A 3QNZA 1MXGA 4KNUA 1D7DA 3TFKC 4UOW1 3VFRA 3BZEB 2VMFA 1XH0A 4DP8X 1NCDH 2D2OA 4LCWE 5C0CA 1Z9OA 1PY4A 3Q6GH 1N3NA 5EO0B 3ELAT 2YXMA 5AWNH 4HS6A 4BXSV 5SWSB 5DMGD 5L6YL 5CGBA 1UJTA 1TSHA 4BCYA 2AQ1A 4BKSC 2ZPKL 3OAWA 1BD2D 3V5HB 3CDZB 4PGBB 2WVUA 4GRLC 1QBML 3S48A 3B2VH 1QSFA 2B5IB 1JDAA 4QHPA 2C9VA 1L0QA 5DJZA 1AKJA 2ENJA 3OWEA 1KYOJ 4LSPH 2JMRA 2WBJC 3GSOB 3LQAH 4PPTA 5DT1L 3S3PA 2CR3A 1H3UA 2OMZB 1KTKE 5EIQA 2ZIDA 1ZGLB 3HPLA 3UC0L 3QUXA 5D2NB 3S36X 1JERA 2VJXA 3NIGE 4W9DC 4XNXL 5HHNA 3TBSB 1J0ZA 4E36A 4F8PA 1RUMH 5IFJA 5DJ6A 2XQYK 3ZYZA 1MY7A 3EOAA 4RFOH 1DL7H 4B41A 4B9ZA 1BM3H 1CBVL 3OAZK 1B4LA 2X4TA 2XVBA 3BPCA 1CBVH 4LEOA 3ULUH 3KLDA 2EO1A 3WS3A 1OIOA 3EAKA 2NY4B 2YLHA 4OJAA 1Y0LA 3BOVA 5CSBA 4NQEA 2FQDA 4R0LA 4NQSB 2WY3B 2IQ9H 2ICEC 4M7JH 1VGKA 1GGTA 3Q2LA 3IJYB 2IQ9L 3L81A 5C0AA 2AW2A 3B9DA 1PX8A 3X1NA 5SX5K 4E68A 4GJTB 1RURH 4FG6C 4NUPA 2I25N 2WBJD 3NH7L 3VMOA 2F15A 4U1NB 4ZQKA 5ALBL 4X8JA 4WWNA 5EH1A 3ZN6A 4MNHA 4JE0A 4UCFA 4YPGA 1QZ1A 5D93B 1XF2A 2CA3A 2CCWA 4LMQI 4YE4L 3ULAB 1AH1A 3T08A 1L9OA 1KGUA 3UBHA 4BK5C 2CWRA 3V4VB 4HJJH 4Y1TA 1UT2A 2IV8A 3M1CA 4MQ7B 3SD2A 3MUUA 1SXNA 1F6LL 3PWPD 2FCBA 4F93B 1H3PH 4Y4KB 4B96A 3ZDXB 4Z7NE 3CFUA 5G4OA 4JREC 1E4KC 4I89A 4LGSB 1NGWA 5L4IA 2XWTB 1FDLL 4UT9A 3LZNA 1SBBA 4LCIH 1ZJBA 5C0IA 2AXFB 4LL1A 2HX8A 3DGGA 4M6OH 5ANME 1VFUA 5KYWA 3P2TA 2FH6A 3PQYB 3UZQB 1TTFA 1J0KA 4W9KC 5CJ8A 5FUOH 3V0WH 4WK4B 4Z95H 4EN2A 5CLYA 4XCNB 4YIQB 1A7PL 2VLKD 1NDTA 5B38A 3F6IA 4JLRA 1M53A 2BM3A 3ARTA 1DBJL 1Q72H 4JFQA 4OFDA 4N68A 4E42A 2UUDH 3NJLA 5AWNL 2OMTB 2MIZA 3POHA 4QHNA 2KL6A 1X5KA 2YXVA 3MR9B 1H6FA 4FTVA 4UIKL 3K8MA 3UABA 1WCBA 4DERA 3MV8D 5E2TH 1IGIH 3LYRA 1TQCC 2DLEA 4M4RA 1DSFH 5IESH 4WKZB 1KN4L 3PGCB 5DJAA 1KTDB 3BP7B 1C12B 3HUJB 1BQHA 5F96H 4ZAKC 3CPUA 3LKNB 1ZLWH 3MBEB 5D7SH 3VYPA 3ESNA 4NWUH 4QRRE 5FK9B 2K0RA 4OFIA 4ZOAA 1IM9B 3D39E 1QPKA 5IK3A 5E51A 2Y7QB 3GBNL 1QFOA 3CNKA 2XA3A 4J3OC 4UTAH 4FXGA 5IZ7A 4Z76A 3BYTA 3T0VA 5IMLB 1GS8A 2VDML 1NUNB 4F7EA 1G4RA 3P77B 4OLUL 3S4SB 4FKEA 1ZVHA 2EEBA 2ZXGA 2J1ZA 5D6DA 3O3EA 4OIIL 1BQLH 3RPIA 4OCYH 1WT5C 4AJYV 4YHOL 4O02B 3OKKB 2YUVA 2NY3D 4F20A 1KJ2L 4NZ8A 1SHXA 5KBMA 3RUGE 1GL4B 3FSWA 5FA3B 4HFWA 2BSCA 1O9VA 4NC1C 1OAKH 2OM5A 3V0FA 4G3YL 4G8GE 2XV0A 2IBGA 1T3FB 4FNPA 4U6VH 2ERJB 4JY4B 3O9WA 1BVKB 1JK9A 4Z7VF 2CUMA 3SDYL 3A4AA 5MERB 2IAMC 35C8H 2H32A 5LHDA 3NA9L 2YD0A 3C6LD 4HSQA 1MCPL 3N43B 5CGTA 2GABA 1MRDH 5F71A 1VADA 3EGXB 2XN9B 3HC3H 3U2SA 2A77L 2AQPA 4A37A 2PTTB 4OZGE 2C9UA 3DETC 4L5FE 2VM3A 4LASL 3GMNA 5KWYC 3FTYA 4UOZA 4KUZH 4Q4IA 5K9OB 2NR6A 2VZ3A 1U92B 4KOBA 5I73B 1BXUA 5F9DC 4B9CA 4V1DB 3D18A 5I30H 3NFNB 1T6BX 3N0PB 2Y7MA 5F7DB 4BZ1H 1R6VA 3UBGA 4YDVA 3EFOA 3PNWB 4PJHA 3BEVB 4XB8A 5C0NC 4LSRH 3LKPB 1YQVL 5JYMA 4DF9A 4F92B 2P8LB 1FNHA 2Y1ZA 3F65A 4LSQL 3TA3B 4PY8I 4CILA 2Z1KA 5FHAL 3ROOB 1JHKH 2ZX6A 4RA3A 1M7DB 4BUHA 2LT9A 1GY2A 3H9HB 2BIHA 4FXTA 4JN1H 5F44A 5FM8A 2NQDA 1YEGL 3DDGA 3D9AL 1TVDA 1QRKA 4PS8A 4YFLI 1FL5A 2HSIA 2H2SC 1LNUB 1FLRL 1KELH 3ELQA 2ATKA 3BWUF 4DPCX 3UDWA 1TQSA 2E7DA 1ID2A 2J21A 2X6UA 1V7MH 3GDBA 1IE5A 1U8NB 2HT3D 2WVSA 1Z5LB 4XCEB 5ADOH 1G5GA 1XGZA 2CBQA 1E8ZA 4QD2E 3P69A 4U0RC 3DA0A 1PLBA 5G5DB 2K8MA 5INDA 1KPUB 4PRDB 3V8OA 4NPYB 4L2YA 1UWXK 1QQDA 2Y1AA 4HP5A 2GB2A 3CQQA 3D12B 3OZ9H 2CKBL 2YBRB 4NUJB 4ODTL 2LOEA 3QP3A 3CGTA 4LXFA 4APQA 3EH5B 5EZOH 1BF5A 5F89A 2YHGA 4GKSA 4DVRL 2W88A 3HCVA 2C3VA 5BRZE 3QZNA 1OY3B 2GFBA 4YHML 4JFOA 3DX6A 3KYOB 3W0WD 5IHZA 3IMVA 3THML 3BKJL 1HEZA 3GT6A 1CK0L 2P5ED 2V5SA 2IH1A 5KVEL 4LCWB 3RWHB 3R06A 4XH2B 4RAVB 4HJEA 1M1XA 1D6VH 5CSZA 5I75C 1PAZA 4OQTA 1JGEA 3BRDA 1MLCB 1JGLL 3TONA 2WC7A 5CBAB 3WU1A 2W9DH 2UYLB 4YFDB 1G6RA 2JLPA 2Z93A 4DN3H 3CLEH 5EUOE 3IDYC 1A22B 4XX5A 1JFQH 3QPKA 1VFBA 4YHYC 3GLDA 3GJFK 5GRVL 2BY1A 3WGUB 4AIZB 3CXHK 5H37A 4NKDB 3MJ7B 5A7EA 4P2OD 1QMUA 4ADJA 4EEEA 1LEGB 4JEGB 5E2TL 1SYVA 2O5NA 2VW4A 3N55A 1MCWM 1S2EA 2R2EA 1NGPL 2HFEA 1I7ZB 2B15A 4TUJA 2XZAH 2IAMB 4KGJA 4L3CB 1OCZB 1G1YA 1MDTA 1T89C 3MLWL 3FU7A 5DTFA 2JVUA 3WTSA 4MCMA 1RQ5A 1B2WH 2ZUQB 3K72B 1K4CB 3FF7A 3FQTB 3LXAA 3MUGA 4Y4HA 3ZE1B 4L8CB 3CSGA 1QSFD 1EHXA 2A6IA 5FLUA 5IB5B 3RPBA 4RGOL 3ATBA 4NNYB 1EFQA 3LVTA 3M46A 3TH3T 3FRUB 2IWKA 3O3AB 3PL6B 1G7QA 3BH8B 1MCDA 3ARYA 4G82A 5DVLA 1XTLA 3WY2A 5AB9A 1ZLWK 2E7HA 4DZBB 5CFHA 4Q56A 5JDSA 1IZKA 2ESVB 4GW4A 4UB0H 4TRPL 3AC0A 2BP0A 3L3GB 1GOHA 5BUGA 4UM9D 5HGDA 4XMXA 3GPSA 2YAOA 3QR0A 4M9OA 1NKGA 2CU9A 3K5RA 4FQHB 1QVOB 3L1EA 2OSLA 4KO6A 2WNWA 3KH3A 3IFLH 4EZJA 1FG2A 3HC2A 1TVBA 2QL1A 5AW3B 2JKTM 1U6AH 2GSMB 2FH8A 4AJVA 1S7TA 3MRPB 5C0AD 3HE6C 4PRBB 4BBWA 3P1VA 4JO1L 1LEKB 2DTMH 1HCZA 1G87A 2ZWZA 5D1ZD 5J7CC 1BOGA 2NUTB 3CFKB 3EFFA 1C8PA 2HT4D 1A1MB 4PJXF 1T6WA 2D7PA 3L7EA 2EADA 1KWGA 5EEVA 2I26N 1IC1A 3UADA 1VERA 1HU8A 1HL4A 1S7WB 4X4YA 5L2JB 4GQPH 4PJFE 3RVWD 4XP9L 2UXFA 3QI9A 1FLRH 1KELL 2ZT9C 3RGBA 2IDTA 4MYWB 4G83A 2AV1A 4WNQB 5ESAB 4OT1H 3MCKB 4FQCL 4HGMA 2F18A 5I0ZA 4LCVA 3QO0B 4HUWA 3FOMA 1R4XA 4LASH 2Y5EA 5EORL 5AG9A 4IRSC 5B1KA 1TZGH 5I1KL 5E9DA 1HQRB 2WIIA 2Y6TE 3ETTA 1PNCA 4GLRI 5IREA 1XV8A 5EA0L 1NEZB 4XE5B 3H6AA 2VDMH 2I60L 5DJCA 3IXAA 1SJEB 3CFNA 4I3SH 5E7FA 4LOUD 3REVB 2IWEA 3T3PE 2VWEC 1J9TA 2O6FA 3ZKXC 1U58B 5BQDA 4MDIA 4JRYB 3RB7A 2IOMA 2KLSA 4S1RH 1IIIA 3A6BH 3ZZ1A 4XPBH 4BQ6A 4S1QH 4LLDB 4GI8A 2A9MH 3QC5X 3ZE2B 4WTWA 5A3IC 3CFTA 4N6RB 5HY9A 5BV7B 3OD3A 3MRBB 3ECUA 2DQ6A 3FFOA 3H7BA 1A6TA 4XPFL 4PYGA 2MKWA 3U6RB 1NCBH 4O02H 1W72B 3OSKA 2KERA 1E9OB 2JIXA 4BHUA 1A3LH 5D7IB 3QUZD 4ONGH 3EJYC 3M45A 3WO4C 2ESVD 3LSOB 1L6PA 4LIQL 4P4RA 4BQCA 4HIPA 3SKNB 3CFEA 1RI8A 1XR8A 3O4LD 3O9WC 4RMWA 3B5GA 4HOXA 3DO7A 1J8RA 3CSTA 5B3SB 5C0EA 1JYXA 1ETJA 5AFAA 3NIDB 2CBTA 2DM7A 4XXWA 1FJ1A 3W9EB 2FL5B 5DMYA 2IWGA 2W0FB 2DQFA 3RJDA 1E5UI 3A67H 3WFBL 2CA4A 3S8FB 1E4XL 3EJRA 5ERWA 4QXUL 4NO0D 1KTCA 2OJZH 4F9PC 3FHEA 5BJTA 1MIML 1RZIA 3I3EA 5E08H 3WIHA 4APXB 2EE9A 4NT6A 2NY6D 4Y7MA 2QQKH 4OJCA 3APMA 3HAEA 1Q1PA 2ZYSA 3QWRA 1G5AA 1PEZA 4FXGC 4PJEF 4HW6A 3ATAA 4LAJH 1RIHH 1W0WB 1UA6L 3DJ9A 4XPAL 3TJHD 4B0MM 3UTTA 3KPPB 4KV5E 2O5YH 2DDQL 5ADPL 5BOZG 4ERSH 1CDUA 5C0AE 3HLAB 2N56A 1NAMB 3DHPA 3O8XD 5CLTA 2IGFH 1QLFB 4CC4A 1AO7A 2XWCA 3ZDWA 3QHTC 1BZOA 4KAQH 3KLAB 2X4OB 3WFDH 1BBDH 3FUFA 4QYAA 2ARJA 3M8OL 1B6DA 1KXHA 2QVMA 5AZEH 1BW8A 1KGYE 1N12A 5C7XH 4NO5B 1CLOL 3PJSB 3L4WA 4RX4A 1Z1WA 1BYOA 3HPJA 3OR7A 2W59A 3WKML 3WE6B 3W82A 1TCMA 3RURA 4F3FA 2AXJA 4X5WA 2LLLA 2IAAC 3L2MA 5IBLD 2SEBA 4TQPA 3RVTD 2NUPA 2IC2A 4FI6A 3S5YA 4HIXH 5AEAA 4YXHH 3G7TA 4A7UA 1XGRA 1QFUH 5KJRL 1LK2B 4KTEH 1MVUB 4DQOH 3MKKA 1WK0A 4XMLL 3LN5A 5F1NB 2ZOTA 4U1LB 3BIAX 3T3PB 2EDMA 3HKZA 1S9YA 1P7QA 2YLKA 4AEHL 2ZYRA 1IGCH 3KGSA 5EU6D 1BVOA 3QJVB 3DJZA 2Q7NA 4XNQB 3NP4A 4FYTA 4F57L 1XH1A 4G43B 1A9BB 2Y2TA 3E6FB 3GHEL 1JXKA 4H20L 5C2UB 5L8JB 2LGNA 4ZO7A 1ZHBA 1NCWH 1W8OA 1MELA 5AW1B 1S7VB 3HMXA 4YE4H 3UTOA 4WDIB 4DGWC 3V2AR 1XGQB 4HOZA 3DBXA 1ZY9A 3TEYA 1J0IA 2JQAA 1IAIM 1JOIA 3Q0HA 2Z92A 1OD9A 4NC0B 1WGVA 4OUOA 3UAEA 4HUXB 4Z78B 1GGUA 1N6QH 2ZUXA 1OL0A 1JYNA 4HPYH 1RUPL 1BZ8A 1QW8A 3MREA 3LTVA 4MMXA 4LP5A 4MA8H 3MBXH 4ONOA 3UERA 4DK5A 3OKDA 1HDMA 1LWRA 5D5MA 4ZBJA 5FYLL 1F8TH 3TH4T 2E7MA 1KCVH 1YECH 3KWXA 3IWUA 3V4PB 3LDBC 4Z7QB 3E1F1 3VI3E 3QUML 5JIDA 1H3WM 2B9BA 4NQCD 3IJ7A 4JFSA 3RP1A 5M94B 4FFWD 2DLHA 3B9EA 2Y5TA 2VQUA 4X7FC 3WIFA 5IVOA 1TZIB 3N85L 4Y8AA 1JV2A 4GAJL 1L3WA 5AVYB 4B9FA 1I82A 3A6BL 4AZUA 5I8KL 1EWHA 2R27A 2P9RA 4KROC 2B59B 4XMPH 3QUMH 5T1MA 2ENSA 4XGZA 4OVVA 1MF2L 4IBYA 4IMLB 4P5TC 3SDDC 2ZCKH 1HESA 3ZYJA 3CUPA 1KIQA 3Q43A 2JB5L 2F7RA 4XPHL 2XA8H 3ZU8A 4ZTOL 1CDIA 3ATDA 4JQVC 4XMKH 1EFXA 1JPFB 5FO8A 4AGQA 4YLQT 2P5WB 4F7TB 1XWVA 3TJPA 2VDOL 4PI0A 3TEXA 4OZIB 1IAII 3OMIB 1WHPA 1ETZB 4JQIA 2FT8A 3ARDD 5CUSH 5AD0B 4N24A 5D5ME 3MRJA 3ARFC 1LO0L 1ZA3B 2XZZA 4N0CC 1HQ4B 1NCAL 4GAGL 5KVFH 3QUYB 2H2PC 5D9SA 4MNQD 2IIJA 3G5WA 1F56A 1KNOA 4FYRA 4YWGH 3G5XB 3KR3H 3MV7E 4LSTL 2IGLA 4WUKL 3REWB 5C8JB 5EF2A 1KGXA 2R4SH 4HOWA 1E5BA 2HRPH 2PP9A 3I50L 1YDPB 4UUJB 4XPFH 1KXQE 4GQ9H 3QQ4A 4U49A 3UTQB 1JZJA 2APTA 3D07A 4D0CB 3GXMA 1E2WA 4I7ZC 4DNLA 1E3XA 1U4FA 1H9VA 2DQHL 4ZS7H 1KPVB 3EGSB 3UIYA 1LTXA 4WW2C 1H5BB 4I5BB 4Y1AE 1IBYA 1VGEL 1VCBC 5BXFA 4CNIB 3BP6A 3HE7D 3SE8L 3DNKA 3AROA 3IJEB 3OG6B 4CW1B 4TLKA 1MLBA 1X5MA 3HA0A 3VG9C 2C1OA 3C5ZB 1OSYA 5I26A 2XKSA 1KIUA 3ARZA 3UYRH 1X6NA 4ZFZB 2R23B 5BUPA 3US9A 2ENQA 3EBGA 1TMCB 4LLMA 1H0DA 2EVGA 1IGMH 1JZ6A 1D5XA 1BVLB 3DRTB 3QR1A 4MD0A 3VYOA 4LNRA 2R8SH 1V7NL 4EE2A 3ARBB 3WLBA 4AMXA 4JRWA 1AYOA 4MTMA 3ZRSA 4Y5YC 1XGPB 5T3XD 4UYPA 2GSGB 2ICCA 3KAAA 3ZKXB 3JQOB 2BNQD 2DJUA 2DEXX 2XWXA 3E8UH 4NZUH 3FCTB 1YEHL 1IX2A 5HGAB 1SOQA 5GGTH 1XMEB 4PS7A 1ZRUA 2JI1A 3D87B 4HBQA 3VWJD 4RLDA 2CRMA 1VRSA 1EXUB 3CD4A 3CQFA 4G42B 2VLME 5E9DD 4KX8A 1KG0A 1TMQA 2B3IA 3U1SL 1BQHG 5T1LA 3UTPE 4Y16A 4HUVA 1P4BH 5MP6L 5E2UL 4G80A 1I7RB 1IV8A 5SWQA 1KXQA 2P42B 5C71A 3QA3A 5C0ND 1QLRB 2NT1A 2FX7H 2NW2A 2D0GA 3ARVA 1MNUH 3GNMH 1MCQA 1WGOA 2VSDA 1N9PA 1ZOXA 3RZCA 1EHLL 1CFMA 3GJFB 1R46A 4WV1B 3US1A 3QZWA 1QD0A 2XXCB 3G6DH 1KGCD 1UUSA 4I1PA 2DMBA 1UADC 4OF6A 2I9TA 3KXFE 4FOMA 5DD3H 3QUYD 3I02A 4NKMA 5FGCB 3V52L 3P0VL 1WHOA 1Z9SA 1CZ8H 1MFAL 4HAFA 4DVRH 3WN5B 1PQZA 3C12A 4NN6B 5DURD 4GQRA 3T2PA 5HYJA 2QVIA 4MRCA 2WUBL 2Y2YA 2WLHA 2ADGA 4Z5RA 3RWJB 1NFDF 2NZ9C 5E8PB 1ZGLP 4RAUA 4K71B 1UT1A 2H0JA 3IYLW 3DUSB 1E4XI 1L9QA 4E41E 4K7FA 3P54A 3QHZH 3OX8B 1F86A 2DAVA 2Q0ZX 1QSEA 4OFYD 5DA4A 2EDDA 3KL0A 4ZDHB 1UXLA 1MHCB 3QEUA 1I31A 4MA3A 2YJLA 4TQEH 2YN3A 5D7JB 1OB1A 3V4LA 3AAZB 4G9FA 1WISA 5IR1A 5D2NE 3TASA 5EUOA 2VXQH 2YAEA 3WIIH 1MQ8A 2BS9A 4PP2B 3C2AH 4Z18A 2HFGH 2NY7H 3CVHH 4Y88A 5F1KC 2G2RB 5DMIL 1BD2B 1HZKA 1ZT7B 1QEWA 1NBVH 1H6TA 2APWA 2AXGB 4PS4L 1JP5A 2FJHA 3FFCA 5HI4C 1EEYA 2HPTA 4U4BA 3VGGA 1S7RB 1UOWA 4LVNC 4YBHA 4NHUA 1T0OA 1G7PB 4PY8J 3B6SB 2WLLA 3KXFB 5FGCE 4FHBD 3TYGH 2DQTH 4G72B 4ZUWA 1E8YA 1K8DB 1LK3L 3APFA 5C08D 3HE6B 3MDJA 5IW3A 1KJMB 3O8XA 3BE1H 3D08A 2HLAA 2FO4B 3BHBA 3ARED 4TUOA 4ZAKB 2AJXH 2DM4A 3MQIA 4N2LA 3PFUA 1HSBB 4BSVA 1XCWA 3TA4D 5IB2A 32C2B 3ZKQD 1MCIA 2UUDK 3IFLL 1UENA 4HKBB 2VWEE 4HGWA 1CD1B 2XVGA 2VCOA 1NGQH 4LEXL 3VSTA 1E0OB 3VGFA 5E5LA 5HDOA 4LSSH 3SDXF 2BINA 4E41A 4O5LH 1DLHA 4AGOA 4J3XA 5CMAB 4IRJB 3ZHNA 5HDQH 4NUQA 3VAEA 4I2XB 3WYRA 3G04A 1ZS2A 1FV1B 1X9QA 2EKSA 3K0WA 3GJEA 3M1BA 4QRTA 4N0RA 1I8IB 5E6RB 5DK2B 1S7SA 2I07B 2V5TA 4QRAA 3VD1A 5FECA 1Q1JL 5CZRA 1BSIA 4QO1B 4QRSB 2ITEA 4S11A 1BFVL 4OLVH 5ETUB 1UHVA 2N7SA 3P73B 5CU5A 3ULSB 4F58L 2FDBP 4NQXB 3K4DA 4N0UB 4Z7WE 2F74B 3S7GA 2XN1A 4DPAX 3GK8H 5T1KD 2YPKA 3VI4F 5EZIH 5EULV 1Q9LA 3EIFA 3VXRB 1DCLA 4JJ5A 4LFHD 3EYUH 1CFBA 1SN2A 5AYUH 5L4MA 4QXTA 1T03L 4KKLD 1VGEH 2XZCH 3KPSB 1NLDH 1F02I 5H35A 4H1LG 4U3XA 5ANMA 5C0JA 4HLJA 4NN6C 2B14A 2JH2A 4IOFD 1P7BA 4P9HC 1TFHA 4JFPB 1I8AA 4F2ME 3FB8B 4G1MB 3PWPA 1DE4B 4GFTB 3J8F7 1DCEA 2AAAA 1FPTH 3MRQB 4W68A 2DMHA 1IRAY 1Q9KA 4Q9RL 1R5WA 4N8UA 4KNQA 1P6AB 2L04A 1WBXA 2J88L 2VMCA 2DLFL 1AFVH 3J27A 4N87A 5KANG 4ABVA 1G43A 5CEXB 5FYJU 4JKMA 1A6AA 2R7EB 1T7ZA 2Z4QA 3FZUC 3MLVL 4LPVA 4KOCA 3HBZA 1F6AB 1MHPL 4B9YA 5J57B 1HZHL 5I9QB 5E6UB 2G3ZA 2J20A 5C3LD 4JRYD 4XR8C 3ZGIA 2O93L 1TLKA 3EXLA 1HYSD 3ASOB 5DJ0A 3MMEA 3D34A 5CZXD 4D9QD 4G8FB 2VDNH 5D1QD 4WKXA 3SY0B 1BLNA 4BYHA 3QS3A 1NLBH 2P7TA 3NZSA 1BM7A 3EZJB 4LCIL 5I6XB 2D9CA 2J73A 4HT1H 2O5ZL 3C2AL 1VEPA 2B3RA 2B0SL 4QHUA 5DO2D 4IOSA 4M6AA 4KKCC 5TE7L 1CD8A 2VKWA 1CDYA 2C1PA 3HG1E 3S3DB 4ANUA 4JFXB 3T3PF 1JZ2A 4MHHG 2A83B 4OQ1A 5TH2A 4FQLH 2VR9A 5E2WL 4AM0B 1B4JL 3ZE0B 4BFBD 5DD5H 3MRDA 1HEHC 1FFNA 4KI5E 1XB3A 4AVJA 2ATPB 2VL5B 4YSDA 3CJJA 3M7FB 3QVAA 1JCKA 2FGWL 3BAXA 43CAB 1CFSB 2IOOA 5DHYB 1O7VA 2ITDB 3BUTA 3O3UN 2X3CA 2ZOLA 2CJSA 3RWIA 1MCWW 1NGZB 4TUKL 1ZS8B 1S7XA 2CBPA 1AYRA 1WIPA 2XBDA 3C60A 4GNKB 5HYEA 4KO9A 4ZMPA 4YAQB 2ADIA 1P4IL 3N42F 1ET8A 1ONQA 1IBDA 3CHPA 4K5NA 3ZSSA 4DW2H 3GLAA 2X4RA 1CGXA 1IBGL 4XN4A 4KVNL 1AGFB 3SSGA 4C56E 1XD0A 3MV11 3ES6B 4FZEL 4TNVK 2Y06L 3TT3L 1D9KD 1IC7H 4X6FB 3PGFL 4FXKB 3LRHA 2F5AH 4CL7A 1EJOL 1KLGA 3D69B 4YPJA 1QRND 3CSYB 1HHIB 3D25B 3O9WD 1JXJA 1JPST 3OKLB 1ACYL 3R1GL 2MOVA 4NAJA 4GRWH 4P2QB 3EOBB 1F58L 2OSYA 5D4JA 2NYZA 5EUKB 4NP9A 5CN3A 5JW5A 3H2PA 2J8UB 4JHWL 4G8GD 1WA0X 1Y18A 1RJYA 4M5SA 4UBDC 3LX9A 3H85A 3IU4L 4G9DB 3W2DH 1R3JA 1KGCE 4Q6IC 3IGLA 1BZ7B 3DI3B 4GRMB 4LLYA 1ND0A 1IAOA 3MYZA 3ZL4L 2ICES 2WJ5A 2CO3A 5K93A 3F6LA 4JNXA 4OF0A 2WSPA 2SODB 2COVD 1S5HB 2IFGA 2MCG1 2BCMA 3RNKA 2NY6B 1ACZA 3W37A 4TL5A 3T3MB 3BSZH 4FFVC 3O0LA 1NKOA 1S7QA 1A6ZA 1ZLVH 3W39A 1JUFB 2LVEA 2QPDB 1FNGB 3D7PA 2HJFB 1AACA 3KZ8A 3WTYA 5E9DE 1R9FA 2AJ3A 3WNMA 4BWWA 4QHMA 1NAMH 2AQRA 2NTFA 1MFDL 5H94A 6PCYA 1ZE3H 1FAKT 1QATA 1IT9L 2AAVA 3KLQA 2EDYA 2K3TA 2F1BA 2OV0A 2UZYA 3I9GL 3NZHH 2HTLC 3PIQA 4OZHB 3O41B 5D55A 4I3GA 1THAA 3SGEH 4F7MA 3M8OH 5T1LD 1MOEA 1J9QA 4AE1A 3OF6D 3KGUA 1HCYA 3VG0L 2VDQH 2H0EA 3MACH 5C6TH 5EOTA 4C56A 1SF3A 3BGAA 4ODXB 2C3WA 4AG4L 5FYJH 3ARGD 2IXQB 2DN7A 4CJ0A 4ZSOE 3MLUH 3T9WA 3PLYA 4IRZA 2YPVA 1UM6L 3CX2A 5DJ8B 4F8TA 4L8SC 3APNA 3HBPA 3FAWA 3LEXA 1BM3L 4RDQG 4U1MA 4U6TA 2XG4A 3WI9A 5I66B 4L37B 1OAUH 5K1JA 4S0TD 5DEGA 3TBYB 1KYFA 4HPHA 4L29B 1KCBA 1AE6H 3ATEA 3VXOA 1BBJA 4FXLA 2QQNH 2PMZA 5E99H 5I16A 3T4YB 4QLRA 4F37F 3SDAB 5IIEB 1NMBL 3FQRB 2BO0A 4MVBD 2XY2A 4UDUA 3NDZE 2FZ3A 4F9LA 3W9DB 1I4FA 4X4XB 4MXQD 1ET5A 4XT1C 5E6ZA 1JVKA 1QSED 2FWLB 4HV8B 3KDMB 3T1WA 3DRQB 2Z91A 5KBNC 1M6OB 4TLUA 3QG7L 2CO1A 1VLXA 5TD4A 2PABA 4LQFL 4MB4A 3MOQA 4HJSA 1SY6L 3ZOAA 2V17L 4JRFA 4Y4KD 1TJIL 4FNRA 4G8AC 4B9PA 2QDVA 1RJCA 4P2OA 5IF0B 3QEGL 4UTAA 4ZX6A 2IDQA 2BNUB 2Q2LA 5CD3B 3SJVB 1TUPA 4XPHH 3A22A 2CLRA 4JJOA 1IFHL 4MS6A 5DC2A 3VTMA 4A2LA 5IGXH 1TYJA 2EUZA 4K8RH 4JFYA 3V0IA 4AENB 3FFCD 4MA8L 2P47B 3FUJA 3TM6A 4KJYB 1YAIA 5LVEA 1IJNA 1HNGA 4K2UL 4NB7A 4XBGB 3DC0A 5B1BB 1J8KA 4URTB 4FERA 4KXAA 2EDWA 3UPRA 2GIMA 3C5ZC 4WWKA 2BP3A 3AQYA 4ZX5A 2LTQC 3O2DL 5LGYA 5EN3A 5KVMC 2EECA 5C08A 2W0PA 3OG4B 4W93A 5CEYB 3MKGA 5FFLA 5E8NB 4DP2X 2UZIH 1N59A 1WQVT 4GXVH 3AREA 4FQJL 4MMZA 4ZPTA 5TQ2H 4NBXB 2YN5A 3FTGA 1QSFE 4G6JL 2DQMA 4P04A 5F6IB 3BWAB 4Y5YB 4TKWA 2F54B 1AMYA 5IB1B 2DQEL 3QQ3A 3DVNA 2BCKB 1JNNL 1CQYA 4ZFFA 5BS0B 1KT2A 1FORH 2NY3B 4CADB 3GMOB 4IGBC 3ZYIA 3QEHA 2AK4B 4M6ML 4S2SA 4E41D 2QPSA 4NRXB 2RR3A 2O6PA 3FO1A 4A63A 4DGYL 4LPWA 2EO7A 4UM9A 5E1QA 2TSBA 4UQ9A 1G9NC 1ITBB 4N2AA 1GZPA 4L1TA 5DUBA 3C6LB 1XCTA 4OM1L 3KYAA 1IAIL 3CVIH 4R26H 1NFDB 2MFNA 3K6IA 4G6KH 4JM2A 1NSNH 4FCHA 4PJDF 3AGWA 4P9MH 3QFJA 2GUOB 3MACL 2NY4D 5GHWH 1LHZA 3QJXA 1YEKH 2D31B 2VDPH 4GUPA 2XWZA 3O3DB 3SBPA 5IHLB 3FPYA 3EO0A 2B1AL 3VCLA 8FABB 4D9RE 4G7RB 2B1OA 2P80A 4BUQA 3OHXA 2E9WA 3I9PA 1FH5L 1F2XK 2X41A 4X7CC 3CVHA 4RMUA 4CVWA 4QJ5B 3QUZB 1MEXL 3ZUCA 2H7WA 1FI8C 1CURA 1XAKA 4FQPA 1BAGA 4TULL 3L7FB 5KYYA 3KPTA 2D03H 2B08A 2OL3L 4E2OA 1R3KA 1PJWA 5ACMA 1ZV5A 1EO8L 2DKUA 3LHAA 2VZUA 1UA6H 4UQIM 4XPAH 1BFOB 1SXAA 2WO3B 2P49B 1LE5A 1TKWA 1ILSA 3ECBA 3P4NB 3TIEB 1NBYA 1WUNT 2R69H 3P3RA 4L9LA 3WSQH 5DR5L 5C7ZA 5MEND 4GMSH 4BELD 4D0DB 1JZ5A 4EIBA 5I71C 4UDTA 2W65B 3MGTA 3KLLA 3L4UA 1I3GL 1YEEL 1DQLH 1E40A 2E0PA 3GDCA 4M6NL 3IDIB 3VD9A 2O6CA 4IJTA 2YMTA 3SDAD 4K23L 3NABH 2V8MA 3U46A 5CJXC 1MI5E 5EC2B 5D1XA 1TG8A 4X5XB 3SE9H 5D1QA 4HS6B 3RX5A 2J3SA 2WINA 1CE6A 1R34A 2YSSB 2FSEA 4W6YB 5I0WA 2R0ZH 4Y4HC 2V9TA 1IAKA 1OB0A 4RMRA 4WENB 2X9WA 3LZFH 2A74A 3PU7A 7PCYA 1CN4A 3DROB 5E24E 1O6SA 4OLEA 5TE6L 3QJZA 2WZ0A 3NSFA 2QJDA 4J3OD 5EV7A 1EBAA 5F7BA 1I8KA 3KGTA 2PCFB 2BHYA 2H8PB 5EOCH 3HR5A 5A1AA 3S37X 4W9ZA 3P0YL 1ED3A 5IMKA 1YEWA 1QBAA 4WHTB 4YXLL 2EDBA 3MXVL 3DX8B 5DJXA 5TDNB 2LFGA 4HU8A 3EJSA 4JB9H 5B4MD 5HHPA 5HHOA 3EDJA 1Z9PA 3RLSA 4LQ1A 1YUHB 4BQBA 1FYTB 1AP2B 4Z7VB 5BVJB 2RCSH 5CSGA 3GMMA 3QEQA 5JORB 5D2LE 1S9XB 3CBJB 2H26B 1EANA 4MA7H 4O9HL 3VXQA 2IMNA 4MCYB 4DVBB 5C0DA 4P8QA 2Z0UA 2ZJSL 3NSXA 4PCTA 3U7YL 5I1DA 5I6KA 4YHZH 5FYJE 3T0EB 4ZO9A 2HX7A 3U6XS 3BVNB 1CUOA 4WEBL 3AACA 1NFDE 5I1LB 4Y9GA 4JANA 5J6GA 3BO8B 4BH7B 5BO1L 4AITA 1VGKB 2PPCA 4ZPVB 4X50A 1TJIH 2J8HA 2P5WE 4DEPB 3IJYA 3HS0B 4Z7NF 5I6XC 2EVIA 1AO7D 2QFRA 1T2QL 3HVNA 4ORGA 1OAQH 1X3DA 4UV4L 4BFKA 4Z1PA 4OI7A 2BERA 4HKXA 4Y5VB 1A9EB 1T5XB 1IEBB 1UOLA 2R56L 5C70A 3MNZA 4MXWL 3VD5A 3UO1H 5C92A 5ITBH 4OM0L 3CFBB 2NZ9D 4G8GA 3D39D 1TU2B 4GLRH 3SKMB 2PPEA 1YN6A 1QHQA 4PRNB 1N8ZA 4HG4K 5FV1L 4BFGA 2V6HA 3IKCB 1EGJL 2DWSA 2JKWA 2OL3B 4NKQB 4DJMA 4HOMA 2WVVB 4BKTC 3O0RH 4LARL 2CRIA 3OKOA 2QR0A 3L3DB 4EI6B 1RJZB 5CILL 2BP8A 4GKOA 3AREC 3N50A 4MMZC 2DB8A 1MHEB 1F1GA 3DGGB 1P2CB 4KY1L 1TNNA 2OK0H 1U3HC 4DKAA 1Z0MA 3AG1B 4U1SA 3P2DA 4S1DD 2X4NA 1UD8A 3I9IA 2JQZA 4XCNA 2FTAA 5GS1C 3RU8L 4Y5XB 1HCFX 2OW7A 3VB8A 2AEOA 1D9KC 1YN7A 4LSUL 1VEMA 1J9RA 5EU6A 2YD9A 4KO5A 1JAEA 1DVTA 3JTBA 1W16A 2AQSA 1RPUA 3ATFA 1RY7B 5E95B 3CN0A 5FO9A 5M95B 4PV8A 5AB1A 3LZOA 2WYZA 3B8YA 4IS6B 4KWUA 3VX1A 3SDXE 1XH3B 3OJ2C 3O4OC 4XI5C 4E9WA 1JV5B 4XVSH 4Y2DC 4YVUA 1UCBH 4X7DC 1HHKB 1UB5A 1B2WL 2X4SB 2DMCA 3MLYL 4QWWD 2PR4L 2F8OA 2H47C 3BP7A 3KPRE 4UV7H 3RDJA 2E56A 5CBEB 2GK0B 1GW0A 4OCYL 4HLEA 4BFOA 4UV7L 4U6YB 2VN3A 3L5XL 1WF5A 3OZKA 4F2MA 4JPVH 3H1ZA 4I18B 2YWYA 5FGBA 2GTZA 2WBKA 1BQKA 2XKUA 3GC3A 2A0LC 3FQUA 3SE6A 4PJ8B 4KKAD 4EZLA 3VXUE 4Z7WF 4X0KB 5IFAL 4X9BA 3RUGF 3K6OA 3TZVA 4PTUB 2G4GA 1S5IH 3VI4E 3HI1B 2EYTA 4WEEA 2HKHH 1LDSA 4I3RL 4F58H 5I0YA 3S9DB 2XJLA 3MNVA 4XC3L 3ZZLA 5CP3H 4A6YA 1MCJA 3B2XA 1ACCA 4QLWA 1U8IA 5K1VA 2NTSP 1I9RH 3QFGA 3QXTA 4PJ7B 3K2UL 3RWEB 4MAUH 3NRFA 1A1OA 5CXPA 1P1ZB 1SOKA 3G9AB 4PJEB 4HLZG 2GY5A 5T5FL 12E8L 1T20A 4MMYA 3GS4A 1XMWA 5J89A 1VESA 1RLWA 2YQ3A 4Z0XA 1AO7E 2YUWA 1RU9L 1RP8A 1R3HB 4S0SD 3WXVL 5EBMA 5A2CA 1XVSA 3D05A 2WWNA 2GJ6D 4OCSH 3ZKSD 1L9RA 2HWZH 1YNLH 1G4MA 5A3ID 2R51A 3F7KA 4J23A 1WTGT 4X6BA 3W0WE 4NQDE 1IQWH 2XN9A 4R6UA 1MJ8H 3EG9B 5AW7B 2BY3A 4Y19B 4YHPA 4WY7H 5IY5B 2OS7A 3PYCA 2JJTC 5AAWC 3RY6C 3QWOB 3UAJA 1U9KA 3QHZL 2IGTA 5FW8A 3PY9A 2V2XA 4UANA 1ZD6A 4QY8A 3UTSE 3GSWB 1UASA 4ZFOL 3PWPE 3SKJL 1W80A 3U9UB 4YDKL 3DYOA 4X99B 4XN9A 3P30H 4IKNA 1DFXA 3LV3B 4W9IC 4EUPA 1IL1A 5C3IA 3BN9D 3P30L 5I6OA 2EH7L 4YQXH 2D7TH 2ODHA 1YMHA 5JHMA 1TR7A 4LCCA 3M7OA 1IKOP 3ZZQA 2RBLA 3HS9A 5J06A 4QRUB 1D9KB 1GOGA 1UZ6F 2CDEA 3LXCA 4RGNB 3KD4A 3WNNA 1CJYA 1RV6X 3RTQC 4PVLA 3ROOA 1DZ0A 2A2QT 2OI9B 2WQUA 2XKNB 3ILDA 1SYSB 1HHHB 5FOBA 3PRZA 2ED7A 4MA1C 1HTYA 1J5HA 5ISZB 3TVMB 4K3HA 4FRWA 5A40E 5IM7A 2FEDD 4JM2D 3ARUA 4Y9BA 1NEZG 3E3QC 3ZTCC 3Q5OA 2OYLA 5C2BH 4QOKE 2DQUH 3AB0C 1HZHH 3L2LA 1KB5B 4OBRA 2DM2A 5A2BA 4ODWB 2WWKT 2KT6A 3C8KA 1F3DH 2N4IA 2YPLE 3MRRB 5F1SA 1PKQA 4LSRL 4MLSA 3U7WL 3EYFB 2JTDA 4AGMA 5DO8A 1E4WH 2UXGA 3B9KA 2UY6B 3WFCH 5IVXB 2ZSVB 3FQ4A 3QRGL 4FYQA 4FI8A 5IJKA 1YNKL 2NDGA 1T1WA 2EVHA 2FSDA 3A0OA 4FQXA 2Q8AL 1UZ8B 2OMBA 4X4MA 5GSRB 1HZLA 2NY3C 3IAGC 4RBPH 1Z66A 3FB6A 4K3JH 2BNQE 4MXVF 4E9QA 3IWVA 3B3BA 1JGEB 4BZ2L 2BS8A 4Y16D 5DMKB 2AEPL 4JDTH 3UACA 3WUZA 3MA7B 3TBBA 2GJZA 5DZVA 4MXWH 5ITBL 3I9AA 4HK0A 2H6OA 1T4KA 3KH4A 1DBKL 3P4MA 4WFHE 4Y0GA 4G11A 5I23A 1D7CA 1R24B 4ZUUB 2FT7A 4E9XA 3LNDA 2V7HB 1AGEA 4URKA 1QHPA 1CGTA 2NLJB 5MENB 1CDBA 3BEWB 2R2EB 3BZDA 3QIWB 4EO5A 3RWDA 5K5YA 2FNWA 4WTQA 4RMVA 5HDBF 4IIQA 3L3JA 2WLZA 4KTDL 2OSXA 3KYNB 3IDMA 5HDQL 4ZW6A 4ZAKD 2OXGB 4X9GA 4AK1A 2R4SL 3ARXA 4O2EB 4OLUH 1K4CA 5CCKL 1U91B 3QIBA 4OCLC 4OBSA 3GLEA 2YC1B 2J56A 4YSOA 3QXAB 2A74C 3ROLA 3SPVA 3VRJA 1M56B 4WSKA 2XWEA 2F53A 3PL6A 1ADQA 1ID5I 2BXZA 3TIDB 2WXJA 1WWWX 4JPWL 1S9VB 4WI9A 1EHNA 1NC2B 5DRNA 3SE3A 4HKZA 2I5YH 4G9FD 5KYNA 4CAGA 1L7TH 2WQSA 3C6SB 1CTOA 3CLWA 3IDJB 4KY1H 3RKPA 4POZD 2FX8L 4NZFA 3IM1A 3HB3B 3LB6D 4GQ9L 3VXNA 3MRGA 4Y2LA 4Q9QH 3KPLA 4MKTA 4ZD3H 3VA6A 3C6LC 1AGDA 4FA6A 1S9KC 1HJBC 1SJMA 3QIWD 4GIAA 4ATWA 5GS0L 1A3QA 2F8XC 1C8QA 5IBUG 2VLKB 2P3YA 5E8OA 1ETA1 5ELIA 1MAKA 4I9WD 1BPLB 3QPXL 4F7CA 3SDDB 4J3WA 5I2IB 1Y7VA 1SQMA 3KPRB 3LKQA 4NJAL 1BX2A 4G7VH 4JFDB 2VDKL 1UEYA 3FU0A 3K8KA 2FUTA 4NRZA 5T1JA 3H0TA 3QXDB 4XXCA 2OMVB 1UWFA 3A21A 4IQHA 4XCYA 2KPNA 4EUPH 1FNLA 4GAJH 4YMPA 3A3YB 3IMSA 4JW3A 3RWGA 3ARBC 4YL4A 5J8OA 3UJIH 4OLWL 2CR0A 1QX1A 3T1FA 2OR7A 5JA8B 1U3ZA 5JOEA 3LRSA 5FYLH 2WZ5A 2ZCKL 3MLSL 2ISDA 1JXFA 1NCTA 4GEIA 3B56A 3IEAA 5T3XE 3X3GL 3WEOA 1QI5A 4AQ8A 2C9QA 1N6QL 4UT9L 1Q9WB 2VT0A 1SLXA 4N6QA 4NQCB 2X89D 2WXQA 4P4KC 2VUYA 2G3MA 3MO1A 1QG3A 4PFEA 4GXUM 4PLNC 1TT6A 3S3SA 3T2NL 1WFMA 1EHAA 3C9NB 3QXWA 3PWUA 3DSNA 1IGYB 3D09A 1GCYA 5I19H 1E43A 5DHMC 5ABDE 5H2BA 4DAGH 1A66A 2V2TA 1MZYA 1OSEA 4OD2B 4MJID 1ORSB 3U7AA 1A3ZA 1TCRA 3BQUB 2WJ7A 1HFUA 3GTTA 2MKLC 2EZ0C 4OD3L 5AOMA 4MBRA 5K9KB 1P1VA 4Y5VC 2BDNL 2YA2A 4JQIH 3VH8G 3LPFA 3N43F 3ZHDA 4P23C 3UOAB 4LHUB 1JVLA 3CZFA 5ECGA 5FYLE 1RUAH 2CMRL 3ULUF 1AY1H 1QABA 3IPFA 1RK0A 2AEQL 4OQTH 3L3IA 1HYRC 1O0VA 4KRNA 4LU5L 1AHKA 1CFNA 5IOPA 5AW6B 4HGKC 3DO7B 1ZVSB 3OLGA 1KOAA 5C07B 4DCQA 4BCZA 5D7JD 3BUYB 1P84J 2CLVB 2FL5A 5IQLA 4D0BA 1KIRA 1FZMA 2IANE 4U3HA 3BW9A 4JPSA 2XFGB 4P57B 3K74B 4BFIA 4F27A 4Y9EA 1T1ZA 1KY7A 2IADB 3QI9C 1BAFH 4WFHD 3RFZC 4JO2L 3D4GA 1F6FB 4KU1A 5ACZA 2G2PA 2XPGB 3ZQXA 3V0JA 3D0VA 3T5WA 3BUQA 5HD8C 1NGYA 4ZYKB 4ZZKA 5C0GB 1KCRL 3HI5L 2WHVA 3GXDA 5T5NG 2ZUYA 4KDVA 2BH0A 1R3IH 4NHCL 2N7BA 2APXA 2ZKWA 2X05A 4Y9CA 4ERSL 3VXTB 2VOTA 4M43L 3OKEA 1W0WA 2OZNA 2EXWD 4GMTL 3W1ZA 2R29L 4H8WC 2VLRA 3T8XA 1CICD 4UAOB 3VH8B 4NI3A 4F91B 3BSZL 5EIIA 3NJVA 2RHEA 4LHUG 3T4AB 4DPBX 2GEQA 2B4CC 1XZ0A 3QDME 4NI6A 4IBVA 3NCYP 3VD7A 1NANH 1A6WL 1AO7B 3IXTB 3WHE1 4B3VA 1CDGA 4NSKA 2JKXA 2J5LC 4JO3H 3WCYA 4QXUH 5D4IA 3OAYK 3V4UH 3VXPA 3M17A 4BDVB 1IGFL 4MWFA 4X6CB 2XN9D 5FYJL 1OGPA 1F11A 3X12B 1N3NB 5C6TL 1G9MH 1VFAA 1HVXA 3II3A 2XFXA 4TNWK 5EWIL 3WKPA 5L2KB 2WKOA 1MUJA 3GUTB 3WEBA 1AR1D 4JCMA 4QKXB 2BSTA 1RUQL 5BZWA 5I1HH 3PUUA 3O6LL 4NO2B 2R2HA 5CINH 4Q9QL 5KSUA 3HE6D 3VQ1C 4K4KA 3L95B 3GINA 4WQOA 2EDLA 4RFNC 3UTZB 5HPMB 3QDMD 2FX8H 5FM4A 4YHYB 5BPPA 4KI1A 4RZKA 1BF8A 1P7KA 2AJUL 5KS9A 3QUXB 1M2VA 2CDFA 2HZHA 1R75A 2WN3A 5DJDA 5FCSH 2OTWA 4GP5B 5IQ9A 4BFNA 1ZSDA 5IV2A 3S88L 1A25A 1UJ3A 2F0CA 1CFTA 3BPOB 3GKZA 1JZIA 1AC6A 2GAZA 4Q6KA 2CKBA 5GGUB 1XXDC 4M3HA 2AEIT 1ZHBB 4IDLA 4CMHC 5B7FA 1CF1A 3BKCL 5B7MA 3CCHA 4R5XA 1W9XA 5DVOA 3FKUS 3FH7A 1JHTB 4IU2B 2Z92B 3N41B 4JHUA 4M61B 2RALA 3VWJC 2FATL 4EBQH 2FQEA 3DV4A 3QDJA 2F1EA 2Q76A 1PAMA 2UY7A 3U4BL 3PE9A 3P11L 1Z3GL 1L0XA 5TDPA 1BGXL 4D2NA 4EI5B 1CBJA 1EEQA 5B39A 2VABA 1HKFA 1RUPH 4HWEH 1AS8A 4XRCB 4JKNA 2X6CA 3CC5B 2VZTA 4I48B 5A43C 1ASPA 4MJ4A 1NLBL 2UVEA 3IJHA 3NCCB 3GIZH 3KMDA 2BOLA 1G7IA 1BHGA 2XIIA 4M7ZC 5DFVD 5AYTA 3UYPB 2J57A 1WC7B 5I8EB 2QPFA 1TVHA 4NWTL 1RSYA 1MI5B 4LLWB 3VDCA 1D5IH 2HCZX 2YA1A 1AQDA 3GIVB 3RUGA 4CA4A 1CYWA 3ZDZF 3CHXA 1AVAA 1LDPH 4LOFA 2XYCA 1XAUA 3HS8A 2XHNA 5JYLA 1NGXB 3G08A 3GZKA 5JHDA 1KCUH 3C5ZD 4YO0A 5D2LB 4OV5A 2VR7A 4ONHB 3FU5A 2HG0A 4MJIB 4FFZH 3U0TB 1FYTE 1CLZH 4I77H 2MOGA 1JNHA 2FIKA 4UINL 1XBDA 5EPMB 4FNSA 1JYWA 1PTZA 5TE7H 4S10A 4TNWF 3OKYA 4NCDA 4YNYA 2FHBA 3TCXA 4NUGH 3AJ7A 2R69A 1V27A 1LQSR 4NKIH 4MAYA 1P69B 2VN5A 1W15A 1XEUA 4XPTH 5E6SB 1KCWA 4X8GA 2GEEA 5CJQH 4B5ZA 2F1AA 1ZTXL 1A7BA 3ISYA 5GIRA 4FTVB 1EHKB 2W91A 4TV3A 3X13A 3QT2A 2XTJE 1WIOA 1MJ7L 2C7UB 4P5MB 2ZG3A 2J25A 3NN8B 5LAXA 1XCXA 2BSSB 3F12A 1WD8A 4GP8B 3IETB 3DPBA 3QJQB 3ARDC 3X14B 2EVJA 2Z8VC 5FF6B 1FCCA 1C1EH 4PBWD 5B3JE 2OCFD 2BOCB 3U25A 2RFXB 2DMKA 3G5ZB 3UTQA 3GSRB 2KDYA 4YUEH 4KJWD 2NXZC 2R0WL 1PU0A 3FT2A 5D96B 3LKNA 4KMTH 4YSUA 1KEGH 2VDLL 3IMRA 4YDMA 3MC0A 3ULUC 1MG2C 3II2A 4CU8A 3ME0A 3HFML 2FYYB 3MUHL 5C3TA 5KSVA 1SEQH 1KBGL 4ACPA 3GRBA 4OH2A 3RG1C 1A4CA 3QIWC 3FCGA 2HN7A 2WWKO 2H1PL 1A1NA 3T2LA 1E27A 5IQNA 4C83A 1TZAA 3BIKA 1QW9A 4X9FA 5CLZA 3AT0A 2CO2A 5IMLA 2X3AA 1I9IL 2ZAIA 3S5LG 4WW1A 2YFNA 4PWHA 2CIKA 1SHSA 3RDTC 2R23A 1DFBH 2PR4H 2QKSA 4QUOA 3DIFA 4L18A 1BG1A 1ZIBA 3GSOA 2WQWA 2CE6A 3WO4B 3EHBB 2QV4A 4LNRB 3QULA 4E9SA 1AS6A 2HJLA 4BH8A 2FK9A 2YAHA 5LGHL 1KB5H 3G6JB 4PGDB 2O61B 3FQWB 1YYMH 3RRQA 4CVXA 2AJZA 3OAYH 3GLZA 4MD5A 5I5JA 5AB0A 5FB8B 2ZAHA 3L4TA 3CFJB 3X1EA 3MGAA 3MRFB 1UXSB 1YY9C 3G5VA 5AUMB 5E6IA 4PJFA 5EZOL 5HGAA 1NWPA 3MV7B 1BVKA 2XTJB 4O02L 1T0MA 2L4OA 4WHYH 2XNAB 1MDAA 3FUHA 5HDBB 2AJYH 1VIWA 2X1WL 4XCFL 3TN0D 5T1LB 2OX5A 4B27A 3VGDA 1X4ZA 3DURA 1I9RL 2X89A 2OW6A 3HZYA 3WXWL 1FO0B 3ERXA 3Q8CA 4NXSA 4KO7A 5EBGA 5ANHA 3VQLA 1UB6B 3GRWA 4CVUA 1QLRA 2A9NH 5F3BA 5F1OB 4FDWA 4MCZB 2APVA 5GZNC 2DH2A 4P2RB 1GR7A 4C4KT 4KFZC 2G3XA 4GPVA 5J6HA 3RKDC 4QXGL 1N0LA 4I13B 5AAMA 3D85B 3TESA 4NZTH 1DVZA 1OXYA 1IC4H 5I74C 4U1NA 3L6FA 1AG6A 3N40P 3OZ9L 4ODTH 2O26U 4FQQA 4YZFE 5HJ3A 4YPGB 3W38A 4H4NA 3UBXG 2F53E 2BW4A 3LKSA 4NM4H 3V4VA 5E4EB 4PRIB 5BQ7B 5EHFA 5GRJL 4K94C 1DVFA 1NC4B 1MJUH 1UVQB 4R83A 3LS5H 1MQKL 4N1HB 5CN1A 4P9HH 1ZHNB 5CILH 5DD0L 4YBQC 4DEUA 1BGXH 2X6VA 2LAGB 3O0RL 5C0BB 3HG5A 3EO9H 5D7JA 1ZT4A 3GF8A 1N6VA 4R90H 3WDHA 5D1XE 3B2DC 1EIBA 1G7LA 1QBLH 3L4VA 3LH2H 3UZQA 5FOJA 4PJ9D 3BKMH 5C9JB 3FONB 1NINA 1QSEE 1WFIA 1U8JA 1A21A 2YPVH 2K1MA 5JR1L 4FJZA 5B1CA 1IBHA 3DJTA 3ZMNA 1WUZA 2YXFA 5ID0B 4WFFE 5DC4B 3NACL 3TYGL 2WKLA 1QPXA 2X40A 3FTVA 3G6AA 4ELMF 3QQDA 1KSRA 1E42A 4Z0BL 3RE0A 4PWEA 5CCHE 3JV6A 1AQKL 1P5UC 1CI3M 5TGBB 4XN8A 1QHOA 4I0PC 4R7VA 4AE0A 1LE9B 2Y24A 1SBSH 1YYCA 1QRNB 5I17A 1MLCA 1MNNA 1N26A 2E7BA 4N26A 4P5TA 4PUBH 5TF1L 4Y9FA 1V5JA 4LMQE 3OLIA 1ASOA 1H8OA 1VFBB 2PO6C 3GBNH 3CFDA 2QDWA 3TPUB 1KEMH 3O6KH 4NQDB 5F8RC 1N5AB 4PJ5D 4YSQA 1S9WA 1NCCL 2QGEA 3CN4A 5FK9A 3SJVD 4HWZA 4QWWC 3KYKH 3T0ED 3WGVB 4HEPG 4YBLB 3OBAA 3NGBB 4JAMA 4QF1B 5JQ6H 4WO4C 4YDJA 1YY8B 4EDWH 2DY2A 3GGWA 4HJ1A 5C07D 4RRPG 4E9YA 1KLUA 3FU7B 4XNMB 5B3NA 1YC7A 4QTIH 1I1FA 5KSAD 3SCMD 3LN4A 3V4UL 3A24A 4DP4X 4WUUB 4FN0A 1I8IA 3FQTA 2FWUA 4BA0A 4L8CA 5DQJB 4IMKA 5I76A 1CXEA 3U4EA 3KPOB 3LIZA 1GS6X 4GUQA 2QSCL 1N0XH 2IPTH 3LJ3A 3KM2A 3VGBA 5H4YA 1SEBA 2F5BH 5LCVA 4PW3A 4ZMWA 3HG1D 2BNRA 4CUCA 3WFHA 4IIQC 3TNMA 3RIAF 1A6VH 1JK9B 1QOKA 5EOCL 4E0RA 1EV2E 2DH3A 4F37K 1HINH 1OCWL 1DBMH 3QEQE 3D39A 2BP0B 3L3GA 1P4BL 1OK0A 1QO3B 1ZHLB 2X3BA 3GSQA 2VXTL 4MLIA 1KDIA 1I1YA 1TYRA 1RAMA 1JYVA 5TDOA 5LN8A 2DS4A 2JLLA 5IVXF 5I1EH 4QRRA 4HX1B 1CT8B 3QCTL 4XO8A 3KVQA 1IU1A 3Q05A 1KJ2A 5K1NA 2ZTBA 2JB5H 3E8UL 2E59A 4HH9A 2LE9A 2Y23A 4JREB 3V9FA 5K9OA 3MRPA 5IVNA 5F6IC 4A04A 3QUMA 4IHOA 2GJPA 4ZW7A 4JHAL 4V1DA 2E4TA 3TO2B 2QKIC 1LJMA 4P2QE 2EYRB 2J5WA 1MWAL 1WWCA 1H8LA 1NCGA 4AMKH 4PM1A 5E1IA 3FB5B 1E28A 2DQDH 5ALBH 1JXDA 4YHIB 2L7UA 1AIFB 2DD8H 2CALA 2C9XA 5J1AA 5D1QE 3B2UC 2QGDA 5KVDL 1EAPB 1QACA 4NJ9H 1ZHKB 3QUXC 3NAAH 3D50A 1UGNA 2ZOKA 1H5BC 4GFXA 1RK1A 3RDTA 3KL3A 4R7NA 1LNUA 4YSAA 2AC0A 4G6JH 1F8TL 3NCYS 3FN0H 4PRHB 1INDH 3VI4A 2ZKHH 4F8QA 3RI5F 3GKWH 1TQCB 2TAAA 2X4PA 4K8RC 4NYLA 2PYFB 3VXUA 2BWIA 2E74C 5HYQA 2DLIA 3S0PA 4Q74A 3SGKC 3HC4L 2CH8A 1TSRA 4DOHE 1L6ZA 4JFXA 3O2DH 4OZGB 2K3HA 4M6MH 1OW0A 4PCKA 1QQDB 3LDBB 3UROR 3CSPA 4Z7WA 1HOCA 1QAWA 2XG5A 4ZTOH 3UEQA 3VQ2C 2ZCHH 4Z3IA 5EF3A 2Q8BH 3U9PH 4K2UH 1EAJA 1J05A 5E8EB 4GBXB 5AW8B 4FEIA 3TZVD 2BLFA 2VR8A 2VLJA 4XWGH 4PJAA 4JMXA 4GRWB 4PRID 3D06A 3RTQA 3WENA 4J4PA 4KHTL 5EO1A 1PCSA 5LCVL 1G0DA 2VO5A 1D5IL 1KXTB 2GSIB 1W72A 4KROD 4NHCH 2CLZA 3MNWB 1OLLA 5TF0A 2UWEB 3T77B 4QR7A 1W0VA 4GAYB 1F42A 4NQEE 1JMXA 3ES6A 2XXMB 3TFBA 3O6FA 1CICB 3G6JF 3HI6L 4YXHL 4AGPA 5AVRB 4JFFE 2X6BA 3KNBB 1O6VA 4H88H 1D6EB 2ARWA 4LLQB 3MJ7A 2DQEH 4HS3B 2MJWA 4XP6H 1M7XA 2V7NA 4H88L 2L7JA 5D93C 1SM3L 3C75A 3QQ9C 1NJ9A 1HEJC 3T0XA 2BMKB 4TTDD 1FFOB 1ORQA 1OP3H 5DLMH 3I75A 5DT1H 2ZCLL 4UNVA 1TTBA 5HHMB 5E94A 4LKCB 3HJ0A 2XDHA 4HXAL 4NT6B 2K6YA 1OE3A 4OLZL 3SOBH 2D7NA 1X5ZA 1IGTB 1K9TA 4OLYH 3MNMA 3PHAA 3RVTC 3BKYH 4AVIA 1UURA 4NQTA 3OB0H 4XVUC 4AG4H 4NQQA 3BH8A 4KPHH 3HNTH 1JUFA 4I4WB 3F7YB 1U8LA 3RVVD 3DLQR 2QKIB 4F1SA 4TYUA 4AV0A 3MYJB 1UUNA 1KJVA 4HDIA 5EEUA 4LSTH 5IMMA 3NZHL 1U95A 2ZYIA 3QNYB 3IMWA 4NRYB 2VIRA 1XF3A 1DDTA 5GGSB 5KJRH 2O72A 2DI7A 5KW9L 1JPTH 2NXZB 1ML0A 5D96C 4ANXA 3BH4A 3P2BA 2PCXA 4H5SB 4WU5A 4OKVB 4N8CL 3V55A 4JZOB 1KENH 1INEH 1DSWA 4WUUD 3EYVB 4QXVA 3ZE1E 2MQCA 2DEWX 3LNFA 1KN2H 1BWMA 1IILE 2RGSA 4CN6A 4H20H 4ZI8A 1MHHB 4EOWH 2OXHB 4PR5A 3FN0L 1JF1A 3CXDH 4JPWH 4OCXL 4PWFA 2FNBA 2KC0A 4XP1L 3QBTB 4TSCH 4PLOB 3STZA 2BFVL 3FCBA 1JPTL 1D7BA 5ICYA 3VGEA 4G6AC 1MVUA 3LEXB 1NAML 5KVDH 4JVUA 1AZZC 4K55A 4JDEB 1BDYA 1P7QB 4MASA 2CO7B 3GMRA 4GW5B 4L29A 4P46B 2OMWB 2ID5A 1OCWH 4NNPH 4OCNC 5SX4H 1BBJB 4NBZB 1EX0A 3CDYA 4LLAA 4RMQA 3UTSD 4N90E 4Z23A 5E5RB 4U7MA 4JHAH 3VJ6A 1XCQB 3SPCA 3QO0A 2R4RH 3IE9A 4HUWB 1HNFA 4UILL 4YGVB 1NUDA 3E2HB 4NDMB 4EDXA 4W4NA 4XP4L 4AQ1A 2WIIB 1XGQA 2ZUWA 5EMYA 1XF5B 3F05A 3KDMA 5GGQL 3IDGB 4FMFA 2YAFA 3AVEA 4Z78A 1J1XH 3EZ8A 3PJLA 4Z7OF 1RHHB 4HUUB 1F58H 3GSXA 2CBMA 3LNIA 2JSFA 5DS8A 3MBXL 1CFVL 4FG0A 2ZX7A 1IARB 1ZT1B 5TK4A 3SQOH 1UACL 1IKNA 5BCAA 5BVPH 4AQAB 1EJOH 3E6HA 2F5BL 4CGUB 3EXJA 1MRFH 5CZXC 3VVVA 2GBAA 4QOKD 4N6RA 5HY9B 4JFED 1I3UA 1UQSA 3RGVA 3H7BB 4JR9L 1W72H 3D3VB 2QTVA 4PTTA 2X4UA 3O3BB 3VWKB 3CZJA 3MBWB 1GJWA 3CDGB 4KRPC 3QE5A 4FE9A 5C08B 4IGBD 3F85A 4YLBA 4H7VA 2JJUA 5BZDB 5JOPD 4JMNA 1C16B 3TO4D 1JWMA 4P5TD 3CFMA 1CL7H 2F53D 3BP4A 3L1GA 3A67L 4PJDE 4IMLA 2WQAA 2H0FA 5F6HI 4PJXA 4JHBA 1OGTA 1E9QB 2ICWJ 4HF5L 4DKFH 2Z7ZA 2VUOA 3I85A 1NCCH 1AD0B 4LL9A 1JGVH 4L4VB 4FLOA 3QFDB 4DGVH 3IFNL 3GMQA 4O58L 5CWSA 3NJGA 2IALB 4KKRA 4LF3B 5K39A 4LBEA 4MHHI 1YPZF 2E46A 4U6XA 2VXSL 1UXWB 4HWNA 2VERA 4GSQA 4HC1H 3CK0H 4LVHC 3S3CB 1WWBX 2O6EA 4Y19E 3IU3A 3HN3A 3NCJH 3UP1A 1OPOA 3SCMA 1DEEB 1OT4A 1ANUA 3KHOA 3TWYA 5D1ZC 3GXIA 2AV7B 2F2HA 1RZFL 5FO7A 4AH2B 2QSQA 2VR6A 2XVLA 3EO1B 4OCRH 5EN2B 2OTPA 4Z7UB 4HCRL 4EF3A 4JKPL 4AVKA 1INQB 2YKKA 4PJIA 4K5LA 5DS2A 2CBOA 3CVDA 4ODUB 4I0PB 1NAMA 3ARFD 2E5EA 2NNRA 2R2CA 1T83A 1OPGH 1ESOA 1VACA 4JO4H 5EZJB 1QFWI 4UZSA 3SDCA 5B7EA 5FUZL 4KK8D 4AC2A 4JO1H 4MDRA 4LDLB 1E6OH 2N0MA 3MLVH 2HWZL 5D4QA 4N8PA 3Q3GA 2XT1B 2J88H 5GZOA 1I7UA 4HT1L 4U6HB 3ESVF 4HALA 4XBPB 5C0CB 3SEPA 2VQ4A 4P4KA 2CJTA 4QTHB 2X1QA 4NPJA 3KHQA 5HJDA 5AQ0A 1LQBC 1O7DE 3MAWA 4JZNA 5I1AB 1D5MB 2DYPA 4PVMA 3KCWA 3DJSA 3ZHFA 1T7YA 3IDNA 3MNDA 4L3EA 3BUIA 2B7DT 3KPQB 2C9PA 2KLTA 3V7AE 4PH8A 3SZ6A 2WZPA 1ULVA 5F7FA 4GAAA 2IANA 4KQ4L 2V3FA 1T1XB 5DJZB 3CAFA 4X7SH 1X44A 1IKFH 1HK6A 4N20A 4HWBL 3UBXI 2CAKA 4AGLA 5EIIG 1DVSA 3H42H 5KN5A 3QHFL 1IIKA 1OE2A 2Z35A 5D2NA 3TBSA 4X5XA 2JF1A 2HLEB 4JFFD 1JWUB 5IFJB 1OALA 1XB8A 4NX0A 3T8VA 3AXIA 3FJTA 4PG9A 5K9QG 3N9GH 4O51A 3OZLA 4HWBH 3OR6B 2XWJB 1XFPA 3FO9B 1PZ5B 3H42L 4W81A 3KJ4C 1X5GA 3QDGD 1E4KA 2B8OT 4LLVA 3HNVL 4HUXA 4KY2A 4K0OA 2BVQA 3MV9D 4HUNB 2NY0C 4MMXB 5DVNA 4OCSL 4GIOA 4K7PL 4R0LB 1NCNA 1MJJA 1OK8A 4PBDA 1T2JA 3ILPA 1PZBA 4XWOC 4MX7B 3MV01 2LABA 2KMWA 2F58H 2NY6C 5K33A 3SQRA 4LLUB 2WXMA 3BP5B 4XP5H 1YUHA 3MXWH 5FFGA 1LLAA 3IGAB 3OMAB 2AQ3A 3BISA 2YRPA 4WO4B 2ZCZA 4J3OH 4KX9A 5DUJA 3JWOH 3AU0A 5JOFB 3IF1A 3QDMB 1OKEA 2EJ1A 4ALAC 1FZKA 3NTCH 4QRFA 1B2YA 3EDKA 1IC5H 1W2KT 4FNLH 4TN9A 1NBZA 4QHLA 3IJ9A 3GXPA 4LAQL 5PCYA 1N5YH 5E8PA 2WQ8A 3QRGH 4H8HA 4XGZB 3VFPA 1DQVA 4E9LA 3VXSB 1MXDA 3EJYD 2Q8AH 4H1LB 5L88L 3ZKMD 4DGUA 1AQ8A 3ESOA 2PO6D 1P9MC 4KVNH 5EFIA 1T04B 2OMYB 1KIQB 1R3LB 2EYSA 4ORGB 1OB1B 1FAIL 1HXMA 3AAZA 1I9EA 4PI2A 2OTUB 1OP5K 4QTIL 1EFXB 1JPFA 4LRNL 2EP6A 4N9OB 2AJXL 2IH3B 3OJDA 4YIQA 2DV6A 2DZEA 3CVHL 1OWRM 4BK4A 4XVJH 4G7SB 3GBML 4XNYH 4YHLH 4S1DC 2AXGA 5C2BL 4O2FA 2ORBH 3KWWB 4U1KA 2YFOA 5DURB 3ZMEA 3QJHA 4U2ZA 1NDMA 2X4QA 5FM5M 4TL4A 2OL3A 1AR2A 3BZ4B 3MRJB 5E6YA 1IM3D 5ITFA 3IFOA 2C9SA 4JRYE 3F5WB 4X6DA 5CJQL 4EI6A 3UZVB 3THMH 2WLLB 3KXFA 1OCOB 5AW0B 4NXKA 4OFPA 1Z9MA 1K8DA 3EJUA 1TJGL 1XD1A 3HE6A 4AV4A 1U8QB 4AT6A 5B8CA 4U1SB 2VO8A 3CE1A 4HHAA 2HVBA 4QRPD 5JO5B 3ECWA 4PV9B 3VD0A 5JXED 5MEPB 2WGNB 1X7QB 1FSKC 5EDSA 4GRWE 3CZSA 1KPVA 1XO8A 2D3JA 3EGSA 2EXTA 1M4KA 3GHBL 3QJFA 2X0WA 3JUZA 2UZPA 1UT9A 3Q2CA 4ZK8A 5H4ZA 3OQ3B 1WO2A 3EUUA 4DH2A 3EYSH 4J12A 3IJSB 1AMXA 2OMUB 2Y3NA 4HVBA 5I6MA 1I3GH 1YEEH 3NIDE 5DK2A 1V10A 2CK2A 3QDJD 4OUUA 4TNGA 4UBDD 5EOQL 1RU9H 2NY5H 5F9OL 1BPVA 1O7SA 2EXWC 4Q9RH 1X4YA 2XQYG 3RX8A 4G3YH 2OMZA 5I6LA 1G7JA 3U30B 1FPTL 3F7LA 4CSPA 1ZGLA 2HTKD 4Z9KB 3F83A 1I1RA 4L5FL 3LD8C 4PTUA 3S37H 2HKFH 4H8UA 5E1AB 4RBPK 4FI7A 3T2QA 3UTSA 3E7JA 1E4JA 2XTJC 3FCTA 3L8QA 3RBSA 4WEBH 3AADB 5F9JA 2WNGA 1DQJB 2J55A 5K9QI 2VLRE 1YCSA 1BEYL 3EOYG 3JTSB 3QO1A 3V0DA 1QZNA 3BKJH 3IPBA 3UX9B 2B2XL 1UA3A 1JZDC 4TMPA 2AANA 2F58L 1ZLSH 3UBXA 2HXAA 1PG7W 1VAHA 4HCFA 4FMVA 2B5IC 4NQSA 4H0LC 5CEXA 3O2VH 3QWQB 1NPUA 1QA9A 2HUHA 2JCCB 2BC4B 3WY3A 1BZDA 5C0AB 5GRVK 3T0DA 2P28B 5GXBB 4WV1A 1JFHA 2LU4A 1HIMH 1QR4A 4WZ9A 1BFSA 1XSKA 5F7DA 3IDXH 3ET9F 4QOKA 5D7LD 3BH9A 3CH1A