1L0FA

X-ray crystal structure of ampc n152h mutant beta-lactamase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
353
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYAHSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSINKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases of stability-function tradeoffs in enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 115
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1l0fA00
1EWZA 4MBHA 4JXVA 1SCWA 1HVBA 4Y0UA 2Y2QA 4E3LA 1KDWA 3NIAA 3G31A 4Q8IA 2P9VB 3CJMA 5EVIB 1FCOA 4X69A 3ZFZA 1GHPA 3EQUA 2OV5A 2ZQDA 2ZC5B 4RX3A 4DF6A 1K38A 1K57A 3Q82A 1IYOA 1SDNA 3D4FA 4KZ5A 3TG9A 2OLUA 2ZC7A 5J8XA 3NDGA 3M2JA 2CC1A 3C7UA 3ZNYA 4DKIA 2WGVA 3BECA 1PWDA 4OPQA 4Y0OA 1TVFA 3PBOA 1ES3A 4GDBA 4ZJ2A 3VFHA 5FI7A 4KENB 3RJUA 4JKTA 3TOIA 4X6TA 4R0QA 5HX9A 4BQMA 4QJGA 4UA6A 4E3OA 1VM1A 1JTDA 4JPMA 3UDXA 1H8YA 4MEZA 2ZQ7A 1E25A 4DXBA 2J7VA 3PTEA 4ZBEA 2G2UA 5DVAA 5EECA 4WZ4A 2RL3A 3C4PA 4MBKA 4UHUA 5A93A 3E2KA 1ERMA 4PM6A 4R4SA 1GCEA 4WZ5A 3G2ZA 2VGKA 3OPPA 4HBUA 4DE3A 1BLPA 1LI9A 3ITBA 4PPRA 4R4RA 5EPHA 5FQQA 4DDYA 3LEZA 2XH9A 5FI6A 2Y2IA 1PZPA 3ZG8B 4LCLA 5FDHA 1K56D 1K54C 3PBNA 4BLMA 5GLAA 2WAFA 4OQGA 1EI5A 3LY3A 1YT4A 3SH7A 3IWIA 4N1HA 3QNBA 5CGSA 3NC8A 5GHZA 1MY8A 3GTCA 1K57C 1FOFA 2ZMAA 4ID4A 5FAOA 2EX2A 1PZOA 4RX2A 2V20A 3ZCZA 4BL3A 5HW3A 3G4PA 5EE8A 2ZQ8A 4DDSA 4DXCA 4OPYA 1FSYA 1AXBA 4S2NA 1TEMA 2FFYA 2BG1A 1K6RA 4PM8A 3UPNA 1XA7A 3VMAA 4C75A 2HDSA 4WEJA 2PU2A 4S2JA 4L0LA 1IYSA 4U3TA 3IHBA 3OPRA 1NY0A 4UA9A 2ZQCA 4GD6A 5FSRA 1JWZA 4F94A 2VGJA 4Y0TA 5EVIC 5TR7A 3VP3A 4OQHA 2EX8A 2J9OA 4PMAA 1FR6A 2Y2GA 3O88A 1PWGA 5FQIA 3VP0A 4S2PA 4QD4A 2EX9A 5FAPA 2X71A 2PU4A 3FKVA 4XUZA 3BEBA 4QY5A 4CPKA 3UY6A 4WZ5C 2DNSA 3SOIA 3PAEA 1YLYA 3HBRA 2QZ6A 5E2FA 3WS2A 2R9XA 4MNRA 4C6YA 1E3UD 4GNUA 1YM1A 4BL2A 3C7VA 1M40A 3AGEA 3RXXA 2HDRA 4PM9A 3HLGA 2XF3A 3ZNTA 1BLSA 1I5QA 3NCKA 4D2OA 2XEPA 3ZVWA 4LCMA 4HESA 2HP9A 1MPLA 3BYDA 2ZLYA 1SHVA 1FSWA 1O7EA 4KZAA 3Q7VA 4U0XA 1HZOA 4MLLA 2ZM0A 4DRTA 3IXHA 4DE2A 4IVIA 4N1XA 3S4XA 5CXWA 1FQGA 2FFFB 3DTMA 3HUOA 4OOYA 1IEMA 2ZM8A 4P85A 3UE1A 5HAPA 4UA7A 4A5RA 2WUQA 4X56A 5EVID 4OQ0A 4R23A 1SDEA 2DRWA 2PBYA 3G34A 2WKIA 2Y59A 5FAQA 2Q9NA 5BOHA 1YLTA 2WZXA 1PW8A 2XQZA 2XLNA 1GHMA 3NI9A 1ZG4A 3UN7A 1MBLA 2E8IA 3NDEA 2XGNA 3MXSA 1ES4A 3SS3A 2Y2HA 3WS1A 5GL9A 1IELA 2XD1A 2QPNA 5GLDA 2JE5A 5GLCA 4E3MA 3HLBA 4KG6A 3IXBA 1LLBA 3CZDA 5FI2A 3N7WA 3G30A 1K4FA 1PI4A 3A3EA 4OPRA 1OMEA 1L0GA 3Q1FA 4KZ4A 3SH9A 3UO9A 5JYPA 2EFUA 1L0EA 1ZG6A 2A49A 5GHYA 1J9MA 3M6HA 3ZG0A 3ZVTA 4YINA 4RVAA 1YLZA 3N4IA 1K55A 3ZDJA 3PBSA 5KSCA 1K25A 1K55C 3VOZA 3IHAA 2Y2NA 4JXSA 2RCXA 4QY6A 1MWUA 3QHYA 4R3BA 3RXWA 5IHVA 4E3KA 4E3IA 4MBFA 3BFDA 3MZFA 1IKIA 1Q2QA 3GR2A 4KZBA 5A92A 1Y54A 4KG5A 4BENA 2IWDA 1NRFA 1XGJA 3N6IA 5E2EA 3BFEA 5CERA 1YQSA 3S22A 4N9KA 3WS4A 2Y4AA 5AQBA 4KZ7A 1U60A 3GSGA 3A3DA 3ITAA 2IWCA 4X53A 4S2OA 5HARA 1CI9A 1K4EA 2ZJ9A 3DW0A 3PAGA 4EQIA 2XFTA 5HL1A 4N92A 5EOEA 2X02A 2Z2MB 4M3KA 1YMSA 4OQIA 1XPBA 3HLEA 3V50A 4IVKA 5F83A 2ZC4B 2GDNA 3N8SA 3IF6B 1MWTA 1XP4A 1H5XA 2Z2LB 4R3JA 4GZBA 4BD0A 2XFSA 5HAIA 4HBTA 2Y2PA 3ZHHA 2V2FF 1Q2PA 1ERQA 3M6BA 2Y55A 1YLJA 4U0TA 3WS5A 4E3JA 4K0XA 4KQQA 1XXMA 3W4QA 4YFMA 3G2YA 3LO7A 4GDNA 1NZUA 4WMCD 4FH2A 4Y7PA 2ZQ9A 4OLDA 3IF6A 4GOGA 2X01A 4ZJ3A 2BLSA 3P98A 3ZG5A 1BLCA 1L0DA 3CG5A 2Y2LA 3G35A 3A3JA 2EXBA 3BLSA 3P09A 3A3FA 4QU3A 3UPOA 1QMEA 3N8RA 2R9WA 1IYPA 3OC2A 3SS5A 4GKUA 5FQKA 4IBRA 1IKGA 4BJPA 3UE3A 5FQMA 1N4OA 2HP5A 4B4XA 3V3SA 5CECA 3GVBA 2WZZA 3W8KA 4GD8A 4KZ6A 2HPBA 1G6AA 2XK1A 4JF6A 2A3UA 4S2IA 3MXRA 3MBZA 1KDSA 3BFCA 4GB7A 4LV2A 4JF4A 5CHJA 1KGFA 4JXWA 4OP8A 5AQ9A 3SS4A 1LI0A 5JYOA 1GHIA 1W79A 1YMXA 2Y2KA 1RGYA 1KE0A 3OCLA 4OVDA 2WGWB 1W5DA 3Q7ZA 3GV9A 5DF7A 3GRJA 4GN2A 3IWQA 1BSGA 4B88A 5FASA 1I2SA 1O07A 3W4OA 1NJ4A 2H0TA 2OSUA 2ZM2A 1MWSA 1MWRA 1QMFA 2UWXA 3BM6A 4OH0A 2HP6A 5DTSA 3HLFA 2EXAA 5FQJA 5CEDA 5KSHA 4KZ9A 3O87A 4KQRA 1HTZA 2ZD8A 2JC7A 1XKZA 1C3BA 1FR1A 5EVIA 4EBLA 3S1YA 3N8LA 3WRZA 4P0MA 1XX2A 3HVFA 5CEBA 1PW1A 2WGWA 3HLCA 3JYIA 2EFXA 1W8YA 1GA9A 1BUEA 1GA0A 3VP2A 1LL9A 3FWLA 3LY4A 3VOYA 4S2MA 2WYXA 2P9VA 2WKHA 3EQVA 4Z9QA 4KG2A 4LV0A 4RA7A 1N9BA 4LENA 3UDFA 1Z6FA 1TDGA 3IF6C 1JWPA 1WYBA 3GMWA 2C6WB 4KZ3A 3W4PA 4EV4A 1CEGA 3O86A 3V3RA 1W8QA 3HREA 3V39A 4DE1A 1L2SA 1HD8A 2H5SA 1SKFA 3NY4A 5TGFA 2Y91A 3IT9A 3IWOA 5CTMA 5TFQA 4C3QA 4KZ8A 5CGWA 4DE0A 1ZKJA 3Q07A 4K91A 5F1GA 2QMIA 2Y2MA 2Y2OA 2WAEA 5L2FA 4OOLA 1KVLA 1MKIA 3LCEA 1ONGA 4FD8A 4E3NA 1KGEA 4IEDA 1BLHA 4HEFA 1RP5A 5GLBA 5GHXA 1ALQA 3IXDA 5CRFA 2WADA 3M2KA 3HUMA 4E6XA 2J9PA 1LL5A 3TSGA 3IH8A 5E2HA 1K6SA 1LHYA 3V5MA 4JBFA 5FQ9A 3IXGA 1BZAA 3HL9A 2XR0A 2XDMA 3UDIA 4E6WA 5U47A 4WYYA 1KVMA 1TDLA 1RCJA 4BD1A 4B4ZA 1KGGA 2J8YA 3E2LA 3GQZA 5HFOA 1FCMA 4OKPA 4PM5A 2I72A 1EROA 5EOOA 4EWFA 5KMWA 4ZDXA 4JLFA 2ZC3B 5AQAA 3MKFA 2Q9MA 5FA7A 3O3VA 1G68A 4OP5A 1K56A 3FYZA 1S0WA 3NBLA 3A3IA 3IF5A 1NZOA 3C5AA 3UE0A 4CJNA 2DCFA 4QB8A 4WBGA 4OOMA 5G18A 4ZJ1A 3VP1A 3CMZA 3AGFA 3SH8A 1DJCA 1WYCA 1BTLA 3BFGA 1PWCA 1ESIA 3ZG9B 3Q7VB 4S2NC 5AQ7A 1IYQA 3VP4A 4XUXA 3ZGAB 3BFFA 4FSFA 4S2KA 5D3OA 3AGDA 1VQQA 3IH9A 3MKEA 1WE4A 4NK3A 4WM9A 4H8RA 1NYYA 5CTNA 2HDQA 4NETA 1YLPA 1YLWA 4ZTKA 5CHMA 1PI5A 3G32A 3WWXA 1KE3A 5DF9A 1FCNA 1ZC2A 3UNWA 5HAQA 5M18A 5CHUA 5M1AA 4RYEA 4EBPA 3PBTA 1CEFA 4S2LA 3WS0A 2XD5A 3HUNA 2Y2JA 2HDUA 3MZEA 5DTKA 3WRTA 1M6KA 5EUAA 2IWBA 1L0FA 3MZDA 4X55A 4OLGA 1S6RA 1XA1A 2WGIA 3BRMA 3UPPA 5A91A 3DWKA 4QHCA 5F82A 4LV3A 1BT5A 3FKWA 3I7JA 3QNCA 2WK0A 1DJBA 2H0YA 4WMCA 4JF5A 5M19A 1DJAA 2OLVA 1CK3A 4JXGA 1KE4A 4R1GA 1ES2A 4EBNA 5A90A 4FH4A 3OZHA 5E2GA 1BULA 1DY6A 1E4DA 4X68A 4WEKA 1PYYA 2V1ZA 1ONHA 4O7DA 4UAAA 3OPLA 1NXYA 4LV1A 1H8ZA 2JBFA 1I2WA 1JVJA 3C4OA 2EX6A 3FZCA 2ZC6B 4WELA 4FCFA 4P6BA 4XXRA 5I94A 2P74A 1JWVA 3Q81A 4P87A 2B5RA 1NYMA 4N9LA 2WKEA 4ZAMA 3OPHA 4K0WA 5FATA 3VFFA 1ESUA 3OCNA 4OPZA 3DWZA 4OONA 3VSKA 4PM7A 5EVLA 3HLWA 1MXOA 3FV7A 1JTGA 2JCHA 3ZG7B 1CI8A 5E43A 1W7FA 5DTTA 3B3XA 5CGXA 1XGIA 1E3UA 3VSLA 4EUZA 3PBQA 3HLDA 2ZQAA 4KQOA 3BLMA 5DF8A 5KZHA 3IQAA 2G2WA 3PBRA 1PIOA 3ISGA 4IBXA 2C5WB 1RGZA 3MFDA 1ES5A 2H10A 5F1FA 1K54A
chains in the Genus database with same CATH superfamily
1F98A 4X25A 1HVBA 4ESPA 3NIAA 3G31A 2OOLA 3CJMA 4I5SA 5J3WA 2PYRA 4RX3A 4DF6A 3LGOA 1IYOA 1SDNA 3D4FA 4FTXA 3M2JA 4DMZA 3C7UA 3ZNYA 1P9RA 3MS6A 1YKDA 4ARZA 1OJ5A 1V9YA 1OTAA 1TVFA 1XFQA 4ZJ2A 3RJUA 3TOIA 4QJGA 4BQMA 1OTBA 2V0WA 3ZQ5A 1E25A 1PRQA 3IX3A 4WZ4A 4HY8A 3C4PA 4MBKA 4R4SA 1OT9A 4WZ5A 3G2ZA 4I3AA 1VETA 3IS2A 4CLCD 3ITBA 4DDYA 3LEZA 2XH9A 4LRXC 1P9WA 4OQGA 5HSQA 2W1TB 4LFUA 1YT4A 4N1HA 3NC8A 3VOLA 3GTCA 1K57C 3RH8B 4L9GA 3BY8A 4I3JA 1TS6A 4BL3A 3G4PA 4DDSA 1TEMA 2FFYA 1XA7A 4R3AA 1DP8A 2O9CA 3LIBA 4C75A 2ZQCA 1CJFA 4F94A 2CMNA 2HZ5A 4YNRA 3KSIA 1VETB 5TBMB 3VP3A 4OQHA 4NG2A 1NLYA 2EX8A 1FR6A 3VP0A 5HWWA 4FOFA 3T1XA 2PU4A 3EWKA 3FKVA 2OWJA 3BEBA 3LIDA 2GNXA 2QZ6A 5E2FA 2ZMVA 4Z1WA 4WUJA 3C7VA 3AGEA 2JKRM 2HDRA 4PM9A 3V67A 2XF3A 3ZNTA 1I5QA 3ZVWA 4LCMA 4HESA 1FILA 4U0XA 1MZUA 5IT5A 3IXHA 5HAPA 4X56A 4OQ0A 4R23A 1HLUP 2W3HA 2WKIA 1S4RA 1T19A 2XLNA 1MBLA 2J80A 3NDEA 4G3VA 2O9BA 1IELA 5GLDA 4R70A 2JE5A 1LLBA 3F1PB 3N7WA 4PAUA 3A3EA 4OPRA 1L0GA 3UO9A 5JYPA 2VV8A 3HJIA 1L0EA 1XJ4A 2A49A 3M6HA 1K25A 2RCXA 1MWUA 3LICA 3MZFA 1IKIA 5A92A 1Y54A 1NRFA 5C5KA 3TE8A 5E2EA 5DFXA 1YQSA 3S22A 3F1OB 4YWZA 2YKFA 2IWCA 4X53A 3QP1A 1CI9A 1K4EA 3DW0A 5HL1A 5EOEA 1VEUA 1MWTA 4BD0A 3IX4A 4GZBA 4HBTA 2Y2PA 3ZHHA 2QHKA 4IJGA 1Q2PA 1ERQA 3G6OA 4E3JA 1XFNA 5HPIA 1DRMA 3G2YA 1NZUA 4FH2A 1CQAA 4OLDA 5F69A 3IF6A 2K31A 4ZJ3A 2BLSA 3P98A 1BLCA 1L0DA 2PHYA 4HP9A 2VKSA 3T12B 2W0NA 2R9WA 1IYPA 4IBRA 3UE3A 4B4XA 4GD8A 4KZ6A 1G6AA 4S2IA 1KDSA 3SS4A 1KGFA 2ZL1B 4JXWA 1LI0A 1W79A 4HH3A 2Y2KA 3OCLA 3C30A 1BSGA 1O07A 2H0TA 1MWSA 3NOTC 5CEDA 3HLFA 4KZ9A 3O87A 1Y4OA 3UMDA 1C3BA 4EBLA 5HL6A 4DJ3A 1XX2A 3HVFA 5CEBA 1PW1A 3HLCA 2WKQA 2EFXA 3VOYA 1GA0A 3LR4A 3LY4A 4S2MA 3EQVA 4Z9QA 4RA7A 2VX8A 3UDFA 4PHTA 1Z6FA 1VEUB 1DP9A 3O86A 2QJ7A 3V39A 1SKFA 5TGFA 3IT9A 4DE0A 5TFQA 5CGWA 1P97A 1ZKJA 4NXGA 3LCEA 4B9OA 1RP5A 5GLBA 5CRFA 4E6XA 5E2HA 3HL9A 4WYYA 3E2LA 2P08A 2I72A 1EROA 4JLFA 3MKFA 2JKTM 3LIEA 3O3VA 1S0WA 4I38A 3C5AA 3UE0A 4BBTA 2LB9A 4EUVA 3EEAA 3AGFA 3H82B 3VE4A 3BFGA 3E0YA 3ZG9B 3Q7VB 5AQ7A 4XUXA 3BFFA 3B42A 1VQQA 2A2LA 2JKFA 2E8JA 1XJ6A 5K5BA 2HDQA 1YLWA 4Y2FA 3TW8A 1FCNA 1ZC2A 3UNWA 5HAQA 4MN7A 3PBTA 2HGVA 2Y2JA 3S7NA 3MZEA 3WRTA 5EUAA 2IWBA 2XRNA 1K0KA 4LRYC 2WGIA 3BRMA 4O01A 4LV3A 5HDCA 2WK0A 3E4PA 3E4OA 4WMCA 4JF5A 1DJAA 4JXGA 4B93A 3OZHA 4NKPA 4UAAA 4O7DA 3OPLA 5G4YA 1JVJA 2JHEA 2ZC6B 3CITA 2VV7A 4FCFA 2P74A 1J3WA 3QP5A 3Q81A 4N9LA 4KQDA 3VFFA 3W2ZA 5LBRA 3SZTA 3VSKA 1JTGA 2JCHA 1DP6A 5CGXA 1E3UA 4EUZA 3CUEC 4II7A 1PIOA 3ISGA 3R4KA 2C5WB 3FC7A 4E3LA 2Y2QA 4GS9A 4Q8IA 3D3OA 3ZFZA 1GHPA 3S7QA 3TG9A 2OLUA 5J8XA 1S67L 4DKIA 4HI4A 1PWDA 4OPQA 3UB9A 2KDKA 2V8CA 4XT2B 2OWHA 3PBOA 3MQQA 2VGLS 4X6TA 4GS9B 4E3OA 4HJ4A 1TS7A 4JGRA 1JTDA 2QKPA 2ZQ7A 1OJGA 2J7VA 2XSSA 4K08A 3MQ0A 5DVAA 5EECA 3T4QA 3TRCA 4UHUA 5EV0A 1F9IA 3KX0X 2VGKA 3OPPA 4Y13A 2KX6A 1ACFA 3H82A 4JGPA 1G5UA 1BLPA 4PPRA 5FI6A 2Y2IA 1PZPA 2UV0E 1K56D 4BBVA 4O0PA 2WAFA 1L3LA 1A0KA 3IWIA 5CGSA 5GHZA 4ID4A 1PZOA 2OAQ1 4DXCA 4OPYA 4S2NA 2BG1A 1K6RA 2PRFA 4PM8A 4GCZA 4WEJA 4UA9A 1PNEA 4GD6A 2VGJA 1X0OA 3CUEA 3CHWP 2O0YA 2B02A 1STZA 2INWA 2QJ5A 2X71A 5TJJA 4CLCC 1NLZA 3UY6A 4R38A 2DNSA 5HDDA 3VE3A 5EM1A 4P6ZS 3WS2A 4EEUA 4C6YA 1E3UD 3ULFA 1M40A 3RXXA 1BLSA 1TS8A 4HJ6A 1MPLA 3DTIA 1FSWA 1HZOA 2KOIA 4IVIA 3S4XA 1FQGA 2FFFB 3HUOA 2HJEA 4P85A 1GSVA 4UA7A 2WUQA 1SZVA 3MXQA 1SDEA 3G34A 4ETZA 1YLTA 2WZXA 3UN7A 3MXSA 1ES4A 3UE6A 3FPVA 2XD1A 1KOUA 4E3MA 3CZDA 3OOVA 5FI2A 1K4FA 3Q1FA 2GJ3A 4KZ4A 2EFUA 2HJ9C 3LIFA 1ZG6A 1H8MA 1YLZA 1K55A 3ZDJA 3PBSA 1PFLA 1TD5A 1K55C 3IHAA 4QY6A 3QHYA 5IU1A 3RXWA 3KYQA 1Q2QA 3GR2A 4KG5A 2NUPC 2W27A 3BFEA 4N9KA 2Y4AA 3GSGA 2I9VA 1XJ2A 3FPWA 5DJTA 3PAGA 3PXPA 2XFTA 4X1MA 4UQIM 2X02A 2Z2MB 2GDNA 4R3JA 5AJGA 5HAIA 4CQHA 4HHDA 1YLJA 4U0TA 4K0XA 1XXMA 4P6ZM 4YFMA 5HZHA 5F6AA 3LO7A 1OT6A 4LGWA 4GOGA 2X01A 3G35A 3A3JA 3L9KA 3P09A 4QU3A 3BQAA 1S4SA 5FQKA 3NJAA 1IKGA 5FQMA 2JKRI 1N4OA 5L09A 4L9EA 5CECA 2EWWA 2HPBA 4GB7A 4LV2A 5AQ9A 5CHJA 5TBMA 4DN0A 1LT0A 5FEGA 2WGWB 3Q7ZA 3GV9A 2PYPA 1SKOA 3EGDC 1NWZA 5FASA 2W3EA 4H6JA 2ZM2A 1MWRA 1QMFA 2HP6A 5FQJA 3T4JA 1HTZA 1OPXA 2JC7A 1XKZA 2ZD8A 2PD7A 1IFQA 3T50A 3N8LA 2OAP1 3IS2B 4NXEA 3JYIA 1W8YA 1GA9A 2XROA 2WYXA 2P9VA 2Y8HA 1N9BA 4Y3IA 3R7WA 3V3RA 3HREA 1HD8A 2H5SA 2VZWA 5CTMA 3CPTA 5F1GA 2QMIA 2Y2MA 4G3KA 4O8GA 3LEQA 1MKIA 4E3NA 4Q0IA 4IEDA 1BLHA 2ZL1A 4HEFA 2D01A 1K6SA 1LHYA 1OTEA 1P0ZA 1VB6A 3MJQA 1BZAA 2XR0A 4PM5A 3F1NA 5EOOA 4ZDXA 2Q9MA 4IUKA 1G68A 4OP5A 1LSXA 3MFXA 3VP1A 3SH8A 1WYCA 1BTLA 1PWCA 1ESIA 2B18A 4S2NC 4FSFA 2W3GA 3AGDA 4NK3A 4PKYA 4WM9A 3QP4A 3A0VA 1YLPA 3PR6A 4FUWA 5CHMA 5DF9A 5M1AA 4RYEA 1CEFA 4S2LA 2ZBBA 2HDUA 5DTKA 1LSVA 1M6KA 1L0FA 3MR0A 5A8BA 1S6RA 4QHCA 1UGUA 1BT5A 3MMHA 2H0YA 3LI9A 5M19A 1CK3A 4BMWA 2Z6DA 4R1GA 5A90A 1D7EA 4FH4A 1DY6A 1E4DA 3NOUC 1PYYA 4LV1A 1I2WA 5J7EA 2EX6A 3FZCA 4WELA 3ICYA 4XXRA 3E98A 2O9AA 4R6LA 2VGLM 1NYMA 3OPHA 4K0WA 3EOIA 3BWLA 4WN5A 1MXOA 3B3XA 1W63M 4Q0HA 2DMWA 4MDZA 2L1MA 3PBRA 4MN5A 2PAVP 2H10A 1YAXA 4MBHA 3SW1A 4JXVA 4MN6A 1KDWA 2GZAA 1LL8A 3EGXC 5EVIB 3UB8A 3GECA 3BW6A 3EQUA 2ZC5B 3IBJA 3Q82A 4KZ5A 2ZC7A 2CC1A 1YPRA 3BECA 4Y0OA 4GDBA 1ES3A 3VFHA 4KENB 4JKTA 5FEFA 4JPMA 1H8YA 2YKHA 4DXBA 3PTEA 3U4LP 4ZBEA 2G2UA 3K2NA 2ZOIA 3E2KA 1ERMA 3DTEA 1GCEA 3R7WB 4DE3A 2PD8A 1LI9A 2J3TD 5EPHA 5FQQA 5AVEA 2V1AA 4NXBA 5GLAA 4NEED 1EI5A 1SKOB 3F1NB 1FOFA 2ZMAA 5FAOA 2EX2A 4RX2A 2ZQ8A 3UPNA 2W3DA 2PU2A 4L0LA 1IYSA 1NY0A 5FSRA 1JWZA 1OTDA 4Y0TA 5EVIC 4PMAA 3BY9A 3O88A 3PHYA 3CI6A 4QD4A 3NECA 1T1AA 5FAPA 1TS0A 4QY5A 4WZ5C 3HBRA 1YM1A 2G7UA 3HLGA 3NCKA 4D2OA 3E4QA 2HP9A 2ZLYA 1O7EA 4KZAA 2ZM0A 4CLCE 4DE2A 4IHQA 4N1XA 3CAXA 3DTMA 4OOYA 1IEMA 4A5RA 5DJUA 1BYWA 2M7VA 2DRWA 2PBYA 5L07A 4UQIS 2Q9NA 5BOHA 3NI9A 1ZG4A 3LYXA 2E8IA 2Y2HA 5HDSA 3WS1A 5GL9A 3U2AA 5GLCA 3HLBA 4KG6A 3IXBA 3KSFA 5FL3A 2HF6A 1PI4A 3SH9A 3C38A 2WKRA 1J9MA 3ZG0A 3ZVTA 4YINA 5KSCA 2V8FA 4JXSA 2V9AA 5IHVA 2M7UA 3IX8A 4EESA 4MBFA 3QP2A 4HOIA 4BENA 1XGJA 3N6IA 5CERA 3WS4A 2ZMFA 5AQBA 4KZ7A 4GJ4A 3CWFA 2ZJ9A 5G4ZA 2AVXA 4N92A 4AFIA 4OQIA 4M3KA 1YMSA 2A24A 4IVKA 3N8SA 3B33A 1XP4A 3IF6B 3T4TA 2Z2LB 2XFSA 3D72A 2V2FF 3T1RA 3BJNA 3WS5A 1LSWA 4GDNA 2BTFP 3UB5P 3EEHA 2ZQ9A 4GW9A 3LFVA 3ZG5A 5HD5A 1D1JA 3LR0A 2Y2LA 2MJ6A 4I39A 3A3FA 1QMEA 3N8RA 3OC2A 4EXOA 1N9LA 4BJPA 1EW0A 3GVBA 5KIZA 2WZZA 3W8KA 2XK1A 3MXRA 3MBZA 4JGOA 4HQAA 4OP8A 1YMXA 1YSQA 1RGYA 1KE0A 4OVDA 5DF7A 4GN2A 1ODVA 4LRZE 2PR5A 3W4OA 1NJ4A 5EM0A 2UWXA 4OH0A 3UB6A 5KSHA 2EXAA 4HNBA 3KYEA 1FR1A 4WL9A 3S1YA 1NRJA 3WRZA 5CX7A 2WGWA 1BUEA 1OTIA 3KO6A 2WKHA 3H9WA 1G28A 4LV0A 1FIKA 4LENA 1TDGA 3IF6C 1JWPA 4EV4A 3GMWA 2BASA 2C6WB 4HP4A 4DE1A 2Y91A 5F68A 4C3QA 3Q07A 5L2FA 5DFYA 4OOLA 1ONGA 4FD8A 1N9NA 1KGEA 1ALQA 3IXDA 4EU0A 4EEPA 3C8CA 2J9PA 3TSGA 3C2WA 3IH8A 3V5MA 2WKPA 3F1OA 2EA9A 4JBFA 4QPRA 1KVMA 3NULA 4BD1A 4B4ZA 2J8YA 2K7SA 1Y28A 2V1BA 4EWFA 2KLIA 5AQAA 1H0MA 3K3CA 3FYZA 4PKYG 2JKTI 3A3IA 1NZOA 4BBUA 4CJNA 2L4RA 2DCFA 5G18A 1Z09A 1UWNX 2W1TA 1MC0A 3ZGAB 4S2KA 5D3OA 2A24B 3IH9A 1WE4A 4H8RA 3LR5A 1NYYA 1TF1A 1GSXA 4NETA 3WWXA 1PI5A 3G32A 3T1QB 4Y17A 5CHUA 4EBPA 4I3IA 2PR6A 2XD5A 3HUNA 1AWIA 4OLGA 1XA1A 5A91A 3JPUA 3FKWA 2J3WA 5DKLA 3KYZA 3NHQA 4HIAA 2P7JA 2OLVA 1KE4A 4EBNA 5E2GA 4JGQA 2V1ZA 1NXYA 2D02A 1H8ZA 2JBFA 3T4LA 1T1CA 5HWTA 5L10A 1JWVA 2B5RA 4ZAMA 5FATA 4UEYA 5L8MA 3DWZA 4OONA 5EVLA 4EETB 5HWVA 5EVEA 3KSHA 4EQ1A 5E43A 3JVVA 1G6OA 2IA2A 3HLDA 2ZQAA 5DF8A 3BLMA 1RGZA 1ES5A 3QP6A 5F1FA 1EWZA 1SCWA 4Y0UA 1H3QA 2P9VB 4KUKA 1FCOA 4X69A 2QWSA 3OBFA 2OV5A 2ZQDA 1K38A 1K57A 2HV1A 3NDGA 1V9ZA 1IOUA 5HPFA 2WGVA 4EERA 3TJZC 3RTYA 5FI7A 2NUTC 4RQ9A 5I5LA 4R0QA 5HX9A 1D06A 4UA6A 1VM1A 3RFBA 3UDXA 4MEZA 5A93A 2PDRA 2RL3A 4PM6A 3D9YA 3F1PA 2VLGA 4HBUA 2L0WA 1S1ZA 4R4RA 2R78A 3B47A 4Q0JA 3ZG8B 3DTKA 4LCLA 3LUQA 5FDHA 5F5YA 1K54C 3S7PA 3PBNA 4BLMA 1WA9A 4MCWA 4D60A 3LY3A 3NOPC 3SH7A 3CPTB 3QNBA 2LB5A 1MY8A 3L7HA 2V20A 3ZCZA 5HW3A 5EE8A 1FSYA 1AXBA 3VMAA 4G3WA 3DAVA 2HDSA 4S2JA 4U3TA 2JKGA 3IHBA 3OPRA 4X1LA 2VEAA 3LIAA 5TR7A 3T4KA 4QWOA 2J9OA 2J3TC 2Y2GA 1PWGA 5FQIA 3LR3A 4S2PA 4CLCA 2EX9A 4WLAA 1JNUA 4XUZA 4CPKA 3LI8A 3SOIA 3PAEA 1YLYA 3A0SA 2R9XA 4MNRA 4GNUA 4BL2A 3MSHA 3H7WB 5MC7A 2XEPA 3BYDA 1SHVA 4BWIA 3Q7VA 4MLLA 4DRTA 3DBAA 5CXWA 1ZHHB 4XT2A 3UE1A 2ZM8A 5EVID 2Y59A 5FAQA 4ZRRA 1PW8A 2XQZA 1GHMA 2XGNA 3SS3A 2QPNA 3G30A 3GDIA 4EW7A 1OMEA 4GHIA 4Y5FA 4HH2A 5IS1A 2FZ0A 4GLQA 5GHYA 4RVAA 1UWPX 2H28A 3N4IA 2PT7A 5EFWA 2XA7M 3VOZA 2Y2NA 2ACGA 1S66L 2B95A 4R3BA 4E3KA 4E3IA 1S1YA 3BFDA 4IUHA 4KZBA 2IWDA 4DJ2A 2JN7A 2PBDP 1U60A 3A3DA 3ITAA 5HD3A 4S2OA 5HARA 4E04A 4EQIA 3V50A 1XPBA 3HLEA 5F83A 2ZC4B 1H5XA 4Y15A 3M6BA 2Y55A 4KQQA 3W4QA 4L9FA 1CF0A 4WMCD 4Y7PA 3P01A 2ZOHA 3CG5A 1N9OA 2EXBA 2P04A 3BLSA 4F3LA 3UPOA 3SS5A 4KUOA 4GKUA 2HP5A 3V3SA 4JF6A 1T18A 2A3UA 3JVUA 3BFCA 4JF4A 5JYOA 1GHIA 4M4XA 1XJ3A 1W5DA 2Z6CA 3GRJA 3IWQA 5DKKA 4B88A 1I2SA 3VV4A 4HJ3A 2OSUA 3BM6A 5DTSA 4GHIB 2FH5A 4KQRA 1T1BA 5EVIA 3UMEA 4P0MA 3VP2A 1LL9A 3FWLA 5FDSA 4KG2A 3HJKA 3BQ8A 1WYBA 4KZ3A 3W4PA 1CEGA 2VA0A 3PYPA 1W8QA 1L2SA 3NY4A 1GSWA 3T4OA 1W63Q 3IWOA 4KZ8A 4K91A 2M1CA 2EWVA 2Y2OA 2WAEA 1KVLA 4MMNA 4YOFA 4NXFA 5GHXA 2W1RA 2VK3A 2WADA 3M2KA 3HCYA 3HUMA 1LL5A 3P7NA 3T4SA 4ARZB 5J4EA 5FQ9A 3IXGA 3T1SA 2XDMA 3UDIA 4E6WA 5U47A 1TDLA 1RCJA 3MQOA 1KGGA 3GQZA 5HFOA 1FCMA 4OKPA 5KMWA 2ZC3B 4F3LB 5FA7A 4WF0A 1K56A 3NBLA 1YSPA 3IF5A 4QB8A 4WBGA 4OOMA 1F5MA 4ZJ1A 3MF0A 3CMZA 2W3FA 1DJCA 3S7OA 4ETXA 2V0UA 1IYQA 3VP4A 2O99A 1F2KA 3MKEA 5CTNA 2Y79A 4ZTKA 2VJWA 1KE3A 3A0RA 3IBRA 1MKMA 5M18A 2K2NA 3H7WA 3WS0A 1ZTUA 3MZDA 4X55A 3OLOA 4LPZA 2VV6A 5AVFA 3UPPA 3DWKA 5F82A 3CLOA 3QNCA 3I7JA 1DJBA 3UB7A 3K3DA 3KSGA 3O5YA 1ES2A 1BULA 4X68A 4WEKA 1ONHA 2Q0OA 4CLCB 1VHMA 3C4OA 4P6BA 3QP8A 5I94A 3FG8A 4P87A 2WKEA 1ESUA 3OCNA 4OPZA 4PM7A 3HLWA 3FV7A 3ZG7B 1CI8A 1W7FA 5DTTA 1XGIA 3ZYTA 4LLOB 3VSLA 3PBQA 2GX5A 4KQOA 5KZHA 3IQAA 2G2WA 4ME4A 4IBXA 2QYBA 3MFDA 4H6JB 2XA7S 1K54A
chains in the Genus database with same CATH topology
1EWZA 4MBHA 4JXVA 1SCWA 1HVBA 4Y0UA 2Y2QA 4E3LA 1KDWA 3NIAA 3G31A 4Q8IA 2P9VB 3CJMA 5EVIB 1FCOA 4X69A 3ZFZA 1GHPA 3EQUA 2OV5A 2ZQDA 2ZC5B 4RX3A 4DF6A 1K38A 1K57A 3Q82A 1IYOA 1SDNA 3D4FA 4KZ5A 3TG9A 2OLUA 2ZC7A 5J8XA 3NDGA 3M2JA 2CC1A 3C7UA 3ZNYA 4DKIA 2WGVA 3BECA 1PWDA 4OPQA 4Y0OA 1TVFA 3PBOA 1ES3A 4GDBA 4ZJ2A 3VFHA 5FI7A 4KENB 3RJUA 4JKTA 3TOIA 4X6TA 4R0QA 5HX9A 4BQMA 4QJGA 4UA6A 4E3OA 1VM1A 1JTDA 4JPMA 3UDXA 1H8YA 4MEZA 2ZQ7A 1E25A 4DXBA 2J7VA 3PTEA 4ZBEA 2G2UA 5DVAA 5EECA 4WZ4A 2RL3A 3C4PA 4MBKA 4UHUA 5A93A 3E2KA 1ERMA 4PM6A 4R4SA 1GCEA 4WZ5A 3G2ZA 2VGKA 3OPPA 4HBUA 4DE3A 1BLPA 1LI9A 3ITBA 4PPRA 4R4RA 5EPHA 5FQQA 4DDYA 3LEZA 2XH9A 5FI6A 2Y2IA 1PZPA 3ZG8B 4LCLA 5FDHA 1K56D 1K54C 3PBNA 4BLMA 5GLAA 2WAFA 4OQGA 1EI5A 3LY3A 1YT4A 3SH7A 3IWIA 4N1HA 3QNBA 5CGSA 3NC8A 5GHZA 1MY8A 3GTCA 1K57C 1FOFA 2ZMAA 4ID4A 5FAOA 2EX2A 1PZOA 4RX2A 2V20A 3ZCZA 4BL3A 5HW3A 3G4PA 5EE8A 2ZQ8A 4DDSA 4DXCA 4OPYA 1FSYA 1AXBA 4S2NA 1TEMA 2FFYA 2BG1A 1K6RA 4PM8A 3UPNA 1XA7A 3VMAA 4C75A 2HDSA 4WEJA 2PU2A 4S2JA 4L0LA 1IYSA 4U3TA 3IHBA 3OPRA 1NY0A 4UA9A 2ZQCA 4GD6A 5FSRA 1JWZA 4F94A 2VGJA 4Y0TA 5EVIC 5TR7A 3VP3A 4OQHA 2EX8A 2J9OA 4PMAA 1FR6A 2Y2GA 3O88A 1PWGA 5FQIA 3VP0A 4S2PA 4QD4A 2EX9A 5FAPA 2X71A 2PU4A 3FKVA 4XUZA 3BEBA 4QY5A 4CPKA 3UY6A 4WZ5C 2DNSA 3SOIA 3PAEA 1YLYA 3HBRA 2QZ6A 5E2FA 3WS2A 2R9XA 4MNRA 4C6YA 1E3UD 4GNUA 1YM1A 4BL2A 3C7VA 1M40A 3AGEA 3RXXA 2HDRA 4PM9A 3HLGA 2XF3A 3ZNTA 1BLSA 1I5QA 3NCKA 4D2OA 2XEPA 3ZVWA 4LCMA 4HESA 2HP9A 1MPLA 3BYDA 2ZLYA 1SHVA 1FSWA 1O7EA 4KZAA 3Q7VA 4U0XA 1HZOA 4MLLA 2ZM0A 4DRTA 3IXHA 4DE2A 4IVIA 4N1XA 3S4XA 5CXWA 1FQGA 2FFFB 3DTMA 3HUOA 4OOYA 1IEMA 2ZM8A 4P85A 3UE1A 5HAPA 4UA7A 4A5RA 2WUQA 4X56A 5EVID 4OQ0A 4R23A 1SDEA 2DRWA 2PBYA 3G34A 2WKIA 2Y59A 5FAQA 2Q9NA 5BOHA 1YLTA 2WZXA 1PW8A 2XQZA 2XLNA 1GHMA 3NI9A 1ZG4A 3UN7A 1MBLA 2E8IA 3NDEA 2XGNA 3MXSA 1ES4A 3SS3A 2Y2HA 3WS1A 5GL9A 1IELA 2XD1A 2QPNA 5GLDA 2JE5A 5GLCA 4E3MA 3HLBA 4KG6A 3IXBA 1LLBA 3CZDA 5FI2A 3N7WA 3G30A 1K4FA 1PI4A 3A3EA 4OPRA 1OMEA 1L0GA 3Q1FA 4KZ4A 3SH9A 3UO9A 5JYPA 2EFUA 1L0EA 1ZG6A 2A49A 5GHYA 1J9MA 3M6HA 3ZG0A 3ZVTA 4YINA 4RVAA 1YLZA 3N4IA 1K55A 3ZDJA 3PBSA 5KSCA 1K25A 1K55C 3VOZA 3IHAA 2Y2NA 4JXSA 2RCXA 4QY6A 1MWUA 3QHYA 4R3BA 3RXWA 5IHVA 4E3KA 4E3IA 4MBFA 3BFDA 3MZFA 1IKIA 1Q2QA 3GR2A 4KZBA 5A92A 1Y54A 4KG5A 4BENA 2IWDA 1NRFA 1XGJA 3N6IA 5E2EA 3BFEA 5CERA 1YQSA 3S22A 4N9KA 3WS4A 2Y4AA 5AQBA 4KZ7A 1U60A 3GSGA 3A3DA 3ITAA 2IWCA 4X53A 4S2OA 5HARA 1CI9A 1K4EA 2ZJ9A 3DW0A 3PAGA 4EQIA 2XFTA 5HL1A 4N92A 5EOEA 2X02A 2Z2MB 4M3KA 1YMSA 4OQIA 1XPBA 3HLEA 3V50A 4IVKA 5F83A 2ZC4B 2GDNA 3N8SA 3IF6B 1MWTA 1XP4A 1H5XA 2Z2LB 4R3JA 4GZBA 4BD0A 2XFSA 5HAIA 4HBTA 2Y2PA 3ZHHA 2V2FF 1Q2PA 1ERQA 3M6BA 2Y55A 1YLJA 4U0TA 3WS5A 4E3JA 4K0XA 4KQQA 1XXMA 3W4QA 4YFMA 3G2YA 3LO7A 4GDNA 1NZUA 4WMCD 4FH2A 4Y7PA 2ZQ9A 4OLDA 3IF6A 4GOGA 2X01A 4ZJ3A 2BLSA 3P98A 3ZG5A 1BLCA 1L0DA 3CG5A 2Y2LA 3G35A 3A3JA 2EXBA 3BLSA 3P09A 3A3FA 4QU3A 3UPOA 1QMEA 3N8RA 2R9WA 1IYPA 3OC2A 3SS5A 4GKUA 5FQKA 4IBRA 1IKGA 4BJPA 3UE3A 5FQMA 1N4OA 2HP5A 4B4XA 3V3SA 5CECA 3GVBA 2WZZA 3W8KA 4GD8A 4KZ6A 2HPBA 1G6AA 2XK1A 4JF6A 2A3UA 4S2IA 3MXRA 3MBZA 1KDSA 3BFCA 4GB7A 4LV2A 4JF4A 5CHJA 1KGFA 4JXWA 4OP8A 5AQ9A 3SS4A 1LI0A 5JYOA 1GHIA 1W79A 1YMXA 2Y2KA 1RGYA 1KE0A 3OCLA 4OVDA 2WGWB 1W5DA 3Q7ZA 3GV9A 5DF7A 3GRJA 4GN2A 3IWQA 1BSGA 4B88A 5FASA 1I2SA 1O07A 3W4OA 1NJ4A 2H0TA 2OSUA 2ZM2A 1MWSA 1MWRA 1QMFA 2UWXA 3BM6A 4OH0A 2HP6A 5DTSA 3HLFA 2EXAA 5FQJA 5CEDA 5KSHA 4KZ9A 3O87A 4KQRA 1HTZA 2ZD8A 2JC7A 1XKZA 1C3BA 1FR1A 5EVIA 4EBLA 3S1YA 3N8LA 3WRZA 4P0MA 1XX2A 3HVFA 5CEBA 1PW1A 2WGWA 3HLCA 3JYIA 2EFXA 1W8YA 1GA9A 1BUEA 1GA0A 3VP2A 1LL9A 3FWLA 3LY4A 3VOYA 4S2MA 2WYXA 2P9VA 2WKHA 3EQVA 4Z9QA 4KG2A 4LV0A 4RA7A 1N9BA 4LENA 3UDFA 1Z6FA 1TDGA 3IF6C 1JWPA 1WYBA 3GMWA 2C6WB 4KZ3A 3W4PA 4EV4A 1CEGA 3O86A 3V3RA 1W8QA 3HREA 3V39A 4DE1A 1L2SA 1HD8A 2H5SA 1SKFA 3NY4A 5TGFA 2Y91A 3IT9A 3IWOA 5CTMA 5TFQA 4C3QA 4KZ8A 5CGWA 4DE0A 1ZKJA 3Q07A 4K91A 5F1GA 2QMIA 2Y2MA 2Y2OA 2WAEA 5L2FA 4OOLA 1KVLA 1MKIA 3LCEA 1ONGA 4FD8A 4E3NA 1KGEA 4IEDA 1BLHA 4HEFA 1RP5A 5GLBA 5GHXA 1ALQA 3IXDA 5CRFA 2WADA 3M2KA 3HUMA 4E6XA 2J9PA 1LL5A 3TSGA 3IH8A 5E2HA 1K6SA 1LHYA 3V5MA 4JBFA 5FQ9A 3IXGA 1BZAA 3HL9A 2XR0A 2XDMA 3UDIA 4E6WA 5U47A 4WYYA 1KVMA 1TDLA 1RCJA 4BD1A 4B4ZA 1KGGA 2J8YA 3E2LA 3GQZA 5HFOA 1FCMA 4OKPA 4PM5A 2I72A 1EROA 5EOOA 4EWFA 5KMWA 4ZDXA 4JLFA 2ZC3B 5AQAA 3MKFA 2Q9MA 5FA7A 3O3VA 1G68A 4OP5A 1K56A 3FYZA 1S0WA 3NBLA 3A3IA 3IF5A 1NZOA 3C5AA 3UE0A 4CJNA 2DCFA 4QB8A 4WBGA 4OOMA 5G18A 4ZJ1A 3VP1A 3CMZA 3AGFA 3SH8A 1DJCA 1WYCA 1BTLA 3BFGA 1PWCA 1ESIA 3ZG9B 3Q7VB 4S2NC 5AQ7A 1IYQA 3VP4A 4XUXA 3ZGAB 3BFFA 4FSFA 4S2KA 5D3OA 3AGDA 1VQQA 3IH9A 3MKEA 1WE4A 4NK3A 4WM9A 4H8RA 1NYYA 5CTNA 2HDQA 4NETA 1YLPA 1YLWA 4ZTKA 5CHMA 1PI5A 3G32A 3WWXA 1KE3A 5DF9A 1FCNA 1ZC2A 3UNWA 5HAQA 5M18A 5CHUA 5M1AA 4RYEA 4EBPA 3PBTA 1CEFA 4S2LA 3WS0A 2XD5A 3HUNA 2Y2JA 2HDUA 3MZEA 5DTKA 3WRTA 1M6KA 5EUAA 2IWBA 1L0FA 3MZDA 4X55A 4OLGA 1S6RA 1XA1A 2WGIA 3BRMA 3UPPA 5A91A 3DWKA 4QHCA 5F82A 4LV3A 1BT5A 3FKWA 3I7JA 3QNCA 2WK0A 1DJBA 2H0YA 4WMCA 4JF5A 5M19A 1DJAA 2OLVA 1CK3A 4JXGA 1KE4A 4R1GA 1ES2A 4EBNA 5A90A 4FH4A 3OZHA 5E2GA 1BULA 1DY6A 1E4DA 4X68A 4WEKA 1PYYA 2V1ZA 1ONHA 4O7DA 4UAAA 3OPLA 1NXYA 4LV1A 1H8ZA 2JBFA 1I2WA 1JVJA 3C4OA 2EX6A 3FZCA 2ZC6B 4WELA 4FCFA 4P6BA 4XXRA 5I94A 2P74A 1JWVA 3Q81A 4P87A 2B5RA 1NYMA 4N9LA 2WKEA 4ZAMA 3OPHA 4K0WA 5FATA 3VFFA 1ESUA 3OCNA 4OPZA 3DWZA 4OONA 3VSKA 4PM7A 5EVLA 3HLWA 1MXOA 3FV7A 1JTGA 2JCHA 3ZG7B 1CI8A 5E43A 1W7FA 5DTTA 3B3XA 5CGXA 1XGIA 1E3UA 3VSLA 4EUZA 3PBQA 3HLDA 2ZQAA 4KQOA 3BLMA 5DF8A 5KZHA 3IQAA 2G2WA 3PBRA 1PIOA 3ISGA 4IBXA 2C5WB 1RGZA 3MFDA 1ES5A 2H10A 5F1FA 1K54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWZ A;  4MBH A;  4JXV A;  1SCW A;  1HVB A;  4Y0U A;  2Y2Q A;  4E3L A;  1KDW A;  3NIA A;  3G31 A;  4Q8I A;  2P9V B;  3CJM A;  5EVI B;  1FCO A;  4X69 A;  3ZFZ A;  1GHP A;  3EQU A;  2OV5 A;  2ZQD A;  2ZC5 B;  4RX3 A;  4DF6 A;  1K38 A;  1K57 A;  3Q82 A;  1IYO A;  1SDN A;  3D4F A;  4KZ5 A;  3TG9 A;  2OLU A;  2ZC7 A;  5J8X A;  3NDG A;  3M2J A;  2CC1 A;  3C7U A;  3ZNY A;  4DKI A;  2WGV A;  3BEC A;  1PWD A;  4OPQ A;  4Y0O A;  1TVF A;  3PBO A;  1ES3 A;  4GDB A;  4ZJ2 A;  3VFH A;  5FI7 A;  4KEN B;  3RJU A;  4JKT A;  3TOI A;  4X6T A;  4R0Q A;  5HX9 A;  4BQM A;  4QJG A;  4UA6 A;  4E3O A;  1VM1 A;  1JTD A;  4JPM A;  3UDX A;  1H8Y A;  4MEZ A;  2ZQ7 A;  1E25 A;  4DXB A;  2J7V A;  3PTE A;  4ZBE A;  2G2U A;  5DVA A;  5EEC A;  4WZ4 A;  2RL3 A;  3C4P A;  4MBK A;  4UHU A;  5A93 A;  3E2K A;  1ERM A;  4PM6 A;  4R4S A;  1GCE A;  4WZ5 A;  3G2Z A;  2VGK A;  3OPP A;  4HBU A;  4DE3 A;  1BLP A;  1LI9 A;  3ITB A;  4PPR A;  4R4R A;  5EPH A;  5FQQ A;  4DDY A;  3LEZ A;  2XH9 A;  5FI6 A;  2Y2I A;  1PZP A;  3ZG8 B;  4LCL A;  5FDH A;  1K56 D;  1K54 C;  3PBN A;  4BLM A;  5GLA A;  2WAF A;  4OQG A;  1EI5 A;  3LY3 A;  1YT4 A;  3SH7 A;  3IWI A;  4N1H A;  3QNB A;  5CGS A;  3NC8 A;  5GHZ A;  1MY8 A;  3GTC A;  1K57 C;  1FOF A;  2ZMA A;  4ID4 A;  5FAO A;  2EX2 A;  1PZO A;  4RX2 A;  2V20 A;  3ZCZ A;  4BL3 A;  5HW3 A;  3G4P A;  5EE8 A;  2ZQ8 A;  4DDS A;  4DXC A;  4OPY A;  1FSY A;  1AXB A;  4S2N A;  1TEM A;  2FFY A;  2BG1 A;  1K6R A;  4PM8 A;  3UPN A;  1XA7 A;  3VMA A;  4C75 A;  2HDS A;  4WEJ A;  2PU2 A;  4S2J A;  4L0L A;  1IYS A;  4U3T A;  3IHB A;  3OPR A;  1NY0 A;  4UA9 A;  2ZQC A;  4GD6 A;  5FSR A;  1JWZ A;  4F94 A;  2VGJ A;  4Y0T A;  5EVI C;  5TR7 A;  3VP3 A;  4OQH A;  2EX8 A;  2J9O A;  4PMA A;  1FR6 A;  2Y2G A;  3O88 A;  1PWG A;  5FQI A;  3VP0 A;  4S2P A;  4QD4 A;  2EX9 A;  5FAP A;  2X71 A;  2PU4 A;  3FKV A;  4XUZ A;  3BEB A;  4QY5 A;  4CPK A;  3UY6 A;  4WZ5 C;  2DNS A;  3SOI A;  3PAE A;  1YLY A;  3HBR A;  2QZ6 A;  5E2F A;  3WS2 A;  2R9X A;  4MNR A;  4C6Y A;  1E3U D;  4GNU A;  1YM1 A;  4BL2 A;  3C7V A;  1M40 A;  3AGE A;  3RXX A;  2HDR A;  4PM9 A;  3HLG A;  2XF3 A;  3ZNT A;  1BLS A;  1I5Q A;  3NCK A;  4D2O A;  2XEP A;  3ZVW A;  4LCM A;  4HES A;  2HP9 A;  1MPL A;  3BYD A;  2ZLY A;  1SHV A;  1FSW A;  1O7E A;  4KZA A;  3Q7V A;  4U0X A;  1HZO A;  4MLL A;  2ZM0 A;  4DRT A;  3IXH A;  4DE2 A;  4IVI A;  4N1X A;  3S4X A;  5CXW A;  1FQG A;  2FFF B;  3DTM A;  3HUO A;  4OOY A;  1IEM A;  2ZM8 A;  4P85 A;  3UE1 A;  5HAP A;  4UA7 A;  4A5R A;  2WUQ A;  4X56 A;  5EVI D;  4OQ0 A;  4R23 A;  1SDE A;  2DRW A;  2PBY A;  3G34 A;  2WKI A;  2Y59 A;  5FAQ A;  2Q9N A;  5BOH A;  1YLT A;  2WZX A;  1PW8 A;  2XQZ A;  2XLN A;  1GHM A;  3NI9 A;  1ZG4 A;  3UN7 A;  1MBL A;  2E8I A;  3NDE A;  2XGN A;  3MXS A;  1ES4 A;  3SS3 A;  2Y2H A;  3WS1 A;  5GL9 A;  1IEL A;  2XD1 A;  2QPN A;  5GLD A;  2JE5 A;  5GLC A;  4E3M A;  3HLB A;  4KG6 A;  3IXB A;  1LLB A;  3CZD A;  5FI2 A;  3N7W A;  3G30 A;  1K4F A;  1PI4 A;  3A3E A;  4OPR A;  1OME A;  1L0G A;  3Q1F A;  4KZ4 A;  3SH9 A;  3UO9 A;  5JYP A;  2EFU A;  1L0E A;  1ZG6 A;  2A49 A;  5GHY A;  1J9M A;  3M6H A;  3ZG0 A;  3ZVT A;  4YIN A;  4RVA A;  1YLZ A;  3N4I A;  1K55 A;  3ZDJ A;  3PBS A;  5KSC A;  1K25 A;  1K55 C;  3VOZ A;  3IHA A;  2Y2N A;  4JXS A;  2RCX A;  4QY6 A;  1MWU A;  3QHY A;  4R3B A;  3RXW A;  5IHV A;  4E3K A;  4E3I A;  4MBF A;  3BFD A;  3MZF A;  1IKI A;  1Q2Q A;  3GR2 A;  4KZB A;  5A92 A;  1Y54 A;  4KG5 A;  4BEN A;  2IWD A;  1NRF A;  1XGJ A;  3N6I A;  5E2E A;  3BFE A;  5CER A;  1YQS A;  3S22 A;  4N9K A;  3WS4 A;  2Y4A A;  5AQB A;  4KZ7 A;  1U60 A;  3GSG A;  3A3D A;  3ITA A;  2IWC A;  4X53 A;  4S2O A;  5HAR A;  1CI9 A;  1K4E A;  2ZJ9 A;  3DW0 A;  3PAG A;  4EQI A;  2XFT A;  5HL1 A;  4N92 A;  5EOE A;  2X02 A;  2Z2M B;  4M3K A;  1YMS A;  4OQI A;  1XPB A;  3HLE A;  3V50 A;  4IVK A;  5F83 A;  2ZC4 B;  2GDN A;  3N8S A;  3IF6 B;  1MWT A;  1XP4 A;  1H5X A;  2Z2L B;  4R3J A;  4GZB A;  4BD0 A;  2XFS A;  5HAI A;  4HBT A;  2Y2P A;  3ZHH A;  2V2F F;  1Q2P A;  1ERQ A;  3M6B A;  2Y55 A;  1YLJ A;  4U0T A;  3WS5 A;  4E3J A;  4K0X A;  4KQQ A;  1XXM A;  3W4Q A;  4YFM A;  3G2Y A;  3LO7 A;  4GDN A;  1NZU A;  4WMC D;  4FH2 A;  4Y7P A;  2ZQ9 A;  4OLD A;  3IF6 A;  4GOG A;  2X01 A;  4ZJ3 A;  2BLS A;  3P98 A;  3ZG5 A;  1BLC A;  1L0D A;  3CG5 A;  2Y2L A;  3G35 A;  3A3J A;  2EXB A;  3BLS A;  3P09 A;  3A3F A;  4QU3 A;  3UPO A;  1QME A;  3N8R A;  2R9W A;  1IYP A;  3OC2 A;  3SS5 A;  4GKU A;  5FQK A;  4IBR A;  1IKG A;  4BJP A;  3UE3 A;  5FQM A;  1N4O A;  2HP5 A;  4B4X A;  3V3S A;  5CEC A;  3GVB A;  2WZZ A;  3W8K A;  4GD8 A;  4KZ6 A;  2HPB A;  1G6A A;  2XK1 A;  4JF6 A;  2A3U A;  4S2I A;  3MXR A;  3MBZ A;  1KDS A;  3BFC A;  4GB7 A;  4LV2 A;  4JF4 A;  5CHJ A;  1KGF A;  4JXW A;  4OP8 A;  5AQ9 A;  3SS4 A;  1LI0 A;  5JYO A;  1GHI A;  1W79 A;  1YMX A;  2Y2K A;  1RGY A;  1KE0 A;  3OCL A;  4OVD A;  2WGW B;  1W5D A;  3Q7Z A;  3GV9 A;  5DF7 A;  3GRJ A;  4GN2 A;  3IWQ A;  1BSG A;  4B88 A;  5FAS A;  1I2S A;  1O07 A;  3W4O A;  1NJ4 A;  2H0T A;  2OSU A;  2ZM2 A;  1MWS A;  1MWR A;  1QMF A;  2UWX A;  3BM6 A;  4OH0 A;  2HP6 A;  5DTS A;  3HLF A;  2EXA A;  5FQJ A;  5CED A;  5KSH A;  4KZ9 A;  3O87 A;  4KQR A;  1HTZ A;  2ZD8 A;  2JC7 A;  1XKZ A;  1C3B A;  1FR1 A;  5EVI A;  4EBL A;  3S1Y A;  3N8L A;  3WRZ A;  4P0M A;  1XX2 A;  3HVF A;  5CEB A;  1PW1 A;  2WGW A;  3HLC A;  3JYI A;  2EFX A;  1W8Y A;  1GA9 A;  1BUE A;  1GA0 A;  3VP2 A;  1LL9 A;  3FWL A;  3LY4 A;  3VOY A;  4S2M A;  2WYX A;  2P9V A;  2WKH A;  3EQV A;  4Z9Q A;  4KG2 A;  4LV0 A;  4RA7 A;  1N9B A;  4LEN A;  3UDF A;  1Z6F A;  1TDG A;  3IF6 C;  1JWP A;  1WYB A;  3GMW A;  2C6W B;  4KZ3 A;  3W4P A;  4EV4 A;  1CEG A;  3O86 A;  3V3R A;  1W8Q A;  3HRE A;  3V39 A;  4DE1 A;  1L2S A;  1HD8 A;  2H5S A;  1SKF A;  3NY4 A;  5TGF A;  2Y91 A;  3IT9 A;  3IWO A;  5CTM A;  5TFQ A;  4C3Q A;  4KZ8 A;  5CGW A;  4DE0 A;  1ZKJ A;  3Q07 A;  4K91 A;  5F1G A;  2QMI A;  2Y2M A;  2Y2O A;  2WAE A;  5L2F A;  4OOL A;  1KVL A;  1MKI A;  3LCE A;  1ONG A;  4FD8 A;  4E3N A;  1KGE A;  4IED A;  1BLH A;  4HEF A;  1RP5 A;  5GLB A;  5GHX A;  1ALQ A;  3IXD A;  5CRF A;  2WAD A;  3M2K A;  3HUM A;  4E6X A;  2J9P A;  1LL5 A;  3TSG A;  3IH8 A;  5E2H A;  1K6S A;  1LHY A;  3V5M A;  4JBF A;  5FQ9 A;  3IXG A;  1BZA A;  3HL9 A;  2XR0 A;  2XDM A;  3UDI A;  4E6W A;  5U47 A;  4WYY A;  1KVM A;  1TDL A;  1RCJ A;  4BD1 A;  4B4Z A;  1KGG A;  2J8Y A;  3E2L A;  3GQZ A;  5HFO A;  1FCM A;  4OKP A;  4PM5 A;  2I72 A;  1ERO A;  5EOO A;  4EWF A;  5KMW A;  4ZDX A;  4JLF A;  2ZC3 B;  5AQA A;  3MKF A;  2Q9M A;  5FA7 A;  3O3V A;  1G68 A;  4OP5 A;  1K56 A;  3FYZ A;  1S0W A;  3NBL A;  3A3I A;  3IF5 A;  1NZO A;  3C5A A;  3UE0 A;  4CJN A;  2DCF A;  4QB8 A;  4WBG A;  4OOM A;  5G18 A;  4ZJ1 A;  3VP1 A;  3CMZ A;  3AGF A;  3SH8 A;  1DJC A;  1WYC A;  1BTL A;  3BFG A;  1PWC A;  1ESI A;  3ZG9 B;  3Q7V B;  4S2N C;  5AQ7 A;  1IYQ A;  3VP4 A;  4XUX A;  3ZGA B;  3BFF A;  4FSF A;  4S2K A;  5D3O A;  3AGD A;  1VQQ A;  3IH9 A;  3MKE A;  1WE4 A;  4NK3 A;  4WM9 A;  4H8R A;  1NYY A;  5CTN A;  2HDQ A;  4NET A;  1YLP A;  1YLW A;  4ZTK A;  5CHM A;  1PI5 A;  3G32 A;  3WWX A;  1KE3 A;  5DF9 A;  1FCN A;  1ZC2 A;  3UNW A;  5HAQ A;  5M18 A;  5CHU A;  5M1A A;  4RYE A;  4EBP A;  3PBT A;  1CEF A;  4S2L A;  3WS0 A;  2XD5 A;  3HUN A;  2Y2J A;  2HDU A;  3MZE A;  5DTK A;  3WRT A;  1M6K A;  5EUA A;  2IWB A;  1L0F A;  3MZD A;  4X55 A;  4OLG A;  1S6R A;  1XA1 A;  2WGI A;  3BRM A;  3UPP A;  5A91 A;  3DWK A;  4QHC A;  5F82 A;  4LV3 A;  1BT5 A;  3FKW A;  3I7J A;  3QNC A;  2WK0 A;  1DJB A;  2H0Y A;  4WMC A;  4JF5 A;  5M19 A;  1DJA A;  2OLV A;  1CK3 A;  4JXG A;  1KE4 A;  4R1G A;  1ES2 A;  4EBN A;  5A90 A;  4FH4 A;  3OZH A;  5E2G A;  1BUL A;  1DY6 A;  1E4D A;  4X68 A;  4WEK A;  1PYY A;  2V1Z A;  1ONH A;  4O7D A;  4UAA A;  3OPL A;  1NXY A;  4LV1 A;  1H8Z A;  2JBF A;  1I2W A;  1JVJ A;  3C4O A;  2EX6 A;  3FZC A;  2ZC6 B;  4WEL A;  4FCF A;  4P6B A;  4XXR A;  5I94 A;  2P74 A;  1JWV A;  3Q81 A;  4P87 A;  2B5R A;  1NYM A;  4N9L A;  2WKE A;  4ZAM A;  3OPH A;  4K0W A;  5FAT A;  3VFF A;  1ESU A;  3OCN A;  4OPZ A;  3DWZ A;  4OON A;  3VSK A;  4PM7 A;  5EVL A;  3HLW A;  1MXO A;  3FV7 A;  1JTG A;  2JCH A;  3ZG7 B;  1CI8 A;  5E43 A;  1W7F A;  5DTT A;  3B3X A;  5CGX A;  1XGI A;  1E3U A;  3VSL A;  4EUZ A;  3PBQ A;  3HLD A;  2ZQA A;  4KQO A;  3BLM A;  5DF8 A;  5KZH A;  3IQA A;  2G2W A;  3PBR A;  1PIO A;  3ISG A;  4IBX A;  2C5W B;  1RGZ A;  3MFD A;  1ES5 A;  2H10 A;  5F1F A;  1K54 A; 
#chains in the Genus database with same CATH topology
 1F98 A;  4X25 A;  1HVB A;  4ESP A;  3NIA A;  3G31 A;  2OOL A;  3CJM A;  4I5S A;  5J3W A;  2PYR A;  4RX3 A;  4DF6 A;  3LGO A;  1IYO A;  1SDN A;  3D4F A;  4FTX A;  3M2J A;  4DMZ A;  3C7U A;  3ZNY A;  1P9R A;  3MS6 A;  1YKD A;  4ARZ A;  1OJ5 A;  1V9Y A;  1OTA A;  1TVF A;  1XFQ A;  4ZJ2 A;  3RJU A;  3TOI A;  4QJG A;  4BQM A;  1OTB A;  2V0W A;  3ZQ5 A;  1E25 A;  1PRQ A;  3IX3 A;  4WZ4 A;  4HY8 A;  3C4P A;  4MBK A;  4R4S A;  1OT9 A;  4WZ5 A;  3G2Z A;  4I3A A;  1VET A;  3IS2 A;  4CLC D;  3ITB A;  4DDY A;  3LEZ A;  2XH9 A;  4LRX C;  1P9W A;  4OQG A;  5HSQ A;  2W1T B;  4LFU A;  1YT4 A;  4N1H A;  3NC8 A;  3VOL A;  3GTC A;  1K57 C;  3RH8 B;  4L9G A;  3BY8 A;  4I3J A;  1TS6 A;  4BL3 A;  3G4P A;  4DDS A;  1TEM A;  2FFY A;  1XA7 A;  4R3A A;  1DP8 A;  2O9C A;  3LIB A;  4C75 A;  2ZQC A;  1CJF A;  4F94 A;  2CMN A;  2HZ5 A;  4YNR A;  3KSI A;  1VET B;  5TBM B;  3VP3 A;  4OQH A;  4NG2 A;  1NLY A;  2EX8 A;  1FR6 A;  3VP0 A;  5HWW A;  4FOF A;  3T1X A;  2PU4 A;  3EWK A;  3FKV A;  2OWJ A;  3BEB A;  3LID A;  2GNX A;  2QZ6 A;  5E2F A;  2ZMV A;  4Z1W A;  4WUJ A;  3C7V A;  3AGE A;  2JKR M;  2HDR A;  4PM9 A;  3V67 A;  2XF3 A;  3ZNT A;  1I5Q A;  3ZVW A;  4LCM A;  4HES A;  1FIL A;  4U0X A;  1MZU A;  5IT5 A;  3IXH A;  5HAP A;  4X56 A;  4OQ0 A;  4R23 A;  1HLU P;  2W3H A;  2WKI A;  1S4R A;  1T19 A;  2XLN A;  1MBL A;  2J80 A;  3NDE A;  4G3V A;  2O9B A;  1IEL A;  5GLD A;  4R70 A;  2JE5 A;  1LLB A;  3F1P B;  3N7W A;  4PAU A;  3A3E A;  4OPR A;  1L0G A;  3UO9 A;  5JYP A;  2VV8 A;  3HJI A;  1L0E A;  1XJ4 A;  2A49 A;  3M6H A;  1K25 A;  2RCX A;  1MWU A;  3LIC A;  3MZF A;  1IKI A;  5A92 A;  1Y54 A;  1NRF A;  5C5K A;  3TE8 A;  5E2E A;  5DFX A;  1YQS A;  3S22 A;  3F1O B;  4YWZ A;  2YKF A;  2IWC A;  4X53 A;  3QP1 A;  1CI9 A;  1K4E A;  3DW0 A;  5HL1 A;  5EOE A;  1VEU A;  1MWT A;  4BD0 A;  3IX4 A;  4GZB A;  4HBT A;  2Y2P A;  3ZHH A;  2QHK A;  4IJG A;  1Q2P A;  1ERQ A;  3G6O A;  4E3J A;  1XFN A;  5HPI A;  1DRM A;  3G2Y A;  1NZU A;  4FH2 A;  1CQA A;  4OLD A;  5F69 A;  3IF6 A;  2K31 A;  4ZJ3 A;  2BLS A;  3P98 A;  1BLC A;  1L0D A;  2PHY A;  4HP9 A;  2VKS A;  3T12 B;  2W0N A;  2R9W A;  1IYP A;  4IBR A;  3UE3 A;  4B4X A;  4GD8 A;  4KZ6 A;  1G6A A;  4S2I A;  1KDS A;  3SS4 A;  1KGF A;  2ZL1 B;  4JXW A;  1LI0 A;  1W79 A;  4HH3 A;  2Y2K A;  3OCL A;  3C30 A;  1BSG A;  1O07 A;  2H0T A;  1MWS A;  3NOT C;  5CED A;  3HLF A;  4KZ9 A;  3O87 A;  1Y4O A;  3UMD A;  1C3B A;  4EBL A;  5HL6 A;  4DJ3 A;  1XX2 A;  3HVF A;  5CEB A;  1PW1 A;  3HLC A;  2WKQ A;  2EFX A;  3VOY A;  1GA0 A;  3LR4 A;  3LY4 A;  4S2M A;  3EQV A;  4Z9Q A;  4RA7 A;  2VX8 A;  3UDF A;  4PHT A;  1Z6F A;  1VEU B;  1DP9 A;  3O86 A;  2QJ7 A;  3V39 A;  1SKF A;  5TGF A;  3IT9 A;  4DE0 A;  5TFQ A;  5CGW A;  1P97 A;  1ZKJ A;  4NXG A;  3LCE A;  4B9O A;  1RP5 A;  5GLB A;  5CRF A;  4E6X A;  5E2H A;  3HL9 A;  4WYY A;  3E2L A;  2P08 A;  2I72 A;  1ERO A;  4JLF A;  3MKF A;  2JKT M;  3LIE A;  3O3V A;  1S0W A;  4I38 A;  3C5A A;  3UE0 A;  4BBT A;  2LB9 A;  4EUV A;  3EEA A;  3AGF A;  3H82 B;  3VE4 A;  3BFG A;  3E0Y A;  3ZG9 B;  3Q7V B;  5AQ7 A;  4XUX A;  3BFF A;  3B42 A;  1VQQ A;  2A2L A;  2JKF A;  2E8J A;  1XJ6 A;  5K5B A;  2HDQ A;  1YLW A;  4Y2F A;  3TW8 A;  1FCN A;  1ZC2 A;  3UNW A;  5HAQ A;  4MN7 A;  3PBT A;  2HGV A;  2Y2J A;  3S7N A;  3MZE A;  3WRT A;  5EUA A;  2IWB A;  2XRN A;  1K0K A;  4LRY C;  2WGI A;  3BRM A;  4O01 A;  4LV3 A;  5HDC A;  2WK0 A;  3E4P A;  3E4O A;  4WMC A;  4JF5 A;  1DJA A;  4JXG A;  4B93 A;  3OZH A;  4NKP A;  4UAA A;  4O7D A;  3OPL A;  5G4Y A;  1JVJ A;  2JHE A;  2ZC6 B;  3CIT A;  2VV7 A;  4FCF A;  2P74 A;  1J3W A;  3QP5 A;  3Q81 A;  4N9L A;  4KQD A;  3VFF A;  3W2Z A;  5LBR A;  3SZT A;  3VSK A;  1JTG A;  2JCH A;  1DP6 A;  5CGX A;  1E3U A;  4EUZ A;  3CUE C;  4II7 A;  1PIO A;  3ISG A;  3R4K A;  2C5W B;  3FC7 A;  4E3L A;  2Y2Q A;  4GS9 A;  4Q8I A;  3D3O A;  3ZFZ A;  1GHP A;  3S7Q A;  3TG9 A;  2OLU A;  5J8X A;  1S67 L;  4DKI A;  4HI4 A;  1PWD A;  4OPQ A;  3UB9 A;  2KDK A;  2V8C A;  4XT2 B;  2OWH A;  3PBO A;  3MQQ A;  2VGL S;  4X6T A;  4GS9 B;  4E3O A;  4HJ4 A;  1TS7 A;  4JGR A;  1JTD A;  2QKP A;  2ZQ7 A;  1OJG A;  2J7V A;  2XSS A;  4K08 A;  3MQ0 A;  5DVA A;  5EEC A;  3T4Q A;  3TRC A;  4UHU A;  5EV0 A;  1F9I A;  3KX0 X;  2VGK A;  3OPP A;  4Y13 A;  2KX6 A;  1ACF A;  3H82 A;  4JGP A;  1G5U A;  1BLP A;  4PPR A;  5FI6 A;  2Y2I A;  1PZP A;  2UV0 E;  1K56 D;  4BBV A;  4O0P A;  2WAF A;  1L3L A;  1A0K A;  3IWI A;  5CGS A;  5GHZ A;  4ID4 A;  1PZO A;  2OAQ 1;  4DXC A;  4OPY A;  4S2N A;  2BG1 A;  1K6R A;  2PRF A;  4PM8 A;  4GCZ A;  4WEJ A;  4UA9 A;  1PNE A;  4GD6 A;  2VGJ A;  1X0O A;  3CUE A;  3CHW P;  2O0Y A;  2B02 A;  1STZ A;  2INW A;  2QJ5 A;  2X71 A;  5TJJ A;  4CLC C;  1NLZ A;  3UY6 A;  4R38 A;  2DNS A;  5HDD A;  3VE3 A;  5EM1 A;  4P6Z S;  3WS2 A;  4EEU A;  4C6Y A;  1E3U D;  3ULF A;  1M40 A;  3RXX A;  1BLS A;  1TS8 A;  4HJ6 A;  1MPL A;  3DTI A;  1FSW A;  1HZO A;  2KOI A;  4IVI A;  3S4X A;  1FQG A;  2FFF B;  3HUO A;  2HJE A;  4P85 A;  1GSV A;  4UA7 A;  2WUQ A;  1SZV A;  3MXQ A;  1SDE A;  3G34 A;  4ETZ A;  1YLT A;  2WZX A;  3UN7 A;  3MXS A;  1ES4 A;  3UE6 A;  3FPV A;  2XD1 A;  1KOU A;  4E3M A;  3CZD A;  3OOV A;  5FI2 A;  1K4F A;  3Q1F A;  2GJ3 A;  4KZ4 A;  2EFU A;  2HJ9 C;  3LIF A;  1ZG6 A;  1H8M A;  1YLZ A;  1K55 A;  3ZDJ A;  3PBS A;  1PFL A;  1TD5 A;  1K55 C;  3IHA A;  4QY6 A;  3QHY A;  5IU1 A;  3RXW A;  3KYQ A;  1Q2Q A;  3GR2 A;  4KG5 A;  2NUP C;  2W27 A;  3BFE A;  4N9K A;  2Y4A A;  3GSG A;  2I9V A;  1XJ2 A;  3FPW A;  5DJT A;  3PAG A;  3PXP A;  2XFT A;  4X1M A;  4UQI M;  2X02 A;  2Z2M B;  2GDN A;  4R3J A;  5AJG A;  5HAI A;  4CQH A;  4HHD A;  1YLJ A;  4U0T A;  4K0X A;  1XXM A;  4P6Z M;  4YFM A;  5HZH A;  5F6A A;  3LO7 A;  1OT6 A;  4LGW A;  4GOG A;  2X01 A;  3G35 A;  3A3J A;  3L9K A;  3P09 A;  4QU3 A;  3BQA A;  1S4S A;  5FQK A;  3NJA A;  1IKG A;  5FQM A;  2JKR I;  1N4O A;  5L09 A;  4L9E A;  5CEC A;  2EWW A;  2HPB A;  4GB7 A;  4LV2 A;  5AQ9 A;  5CHJ A;  5TBM A;  4DN0 A;  1LT0 A;  5FEG A;  2WGW B;  3Q7Z A;  3GV9 A;  2PYP A;  1SKO A;  3EGD C;  1NWZ A;  5FAS A;  2W3E A;  4H6J A;  2ZM2 A;  1MWR A;  1QMF A;  2HP6 A;  5FQJ A;  3T4J A;  1HTZ A;  1OPX A;  2JC7 A;  1XKZ A;  2ZD8 A;  2PD7 A;  1IFQ A;  3T50 A;  3N8L A;  2OAP 1;  3IS2 B;  4NXE A;  3JYI A;  1W8Y A;  1GA9 A;  2XRO A;  2WYX A;  2P9V A;  2Y8H A;  1N9B A;  4Y3I A;  3R7W A;  3V3R A;  3HRE A;  1HD8 A;  2H5S A;  2VZW A;  5CTM A;  3CPT A;  5F1G A;  2QMI A;  2Y2M A;  4G3K A;  4O8G A;  3LEQ A;  1MKI A;  4E3N A;  4Q0I A;  4IED A;  1BLH A;  2ZL1 A;  4HEF A;  2D01 A;  1K6S A;  1LHY A;  1OTE A;  1P0Z A;  1VB6 A;  3MJQ A;  1BZA A;  2XR0 A;  4PM5 A;  3F1N A;  5EOO A;  4ZDX A;  2Q9M A;  4IUK A;  1G68 A;  4OP5 A;  1LSX A;  3MFX A;  3VP1 A;  3SH8 A;  1WYC A;  1BTL A;  1PWC A;  1ESI A;  2B18 A;  4S2N C;  4FSF A;  2W3G A;  3AGD A;  4NK3 A;  4PKY A;  4WM9 A;  3QP4 A;  3A0V A;  1YLP A;  3PR6 A;  4FUW A;  5CHM A;  5DF9 A;  5M1A A;  4RYE A;  1CEF A;  4S2L A;  2ZBB A;  2HDU A;  5DTK A;  1LSV A;  1M6K A;  1L0F A;  3MR0 A;  5A8B A;  1S6R A;  4QHC A;  1UGU A;  1BT5 A;  3MMH A;  2H0Y A;  3LI9 A;  5M19 A;  1CK3 A;  4BMW A;  2Z6D A;  4R1G A;  5A90 A;  1D7E A;  4FH4 A;  1DY6 A;  1E4D A;  3NOU C;  1PYY A;  4LV1 A;  1I2W A;  5J7E A;  2EX6 A;  3FZC A;  4WEL A;  3ICY A;  4XXR A;  3E98 A;  2O9A A;  4R6L A;  2VGL M;  1NYM A;  3OPH A;  4K0W A;  3EOI A;  3BWL A;  4WN5 A;  1MXO A;  3B3X A;  1W63 M;  4Q0H A;  2DMW A;  4MDZ A;  2L1M A;  3PBR A;  4MN5 A;  2PAV P;  2H10 A;  1YAX A;  4MBH A;  3SW1 A;  4JXV A;  4MN6 A;  1KDW A;  2GZA A;  1LL8 A;  3EGX C;  5EVI B;  3UB8 A;  3GEC A;  3BW6 A;  3EQU A;  2ZC5 B;  3IBJ A;  3Q82 A;  4KZ5 A;  2ZC7 A;  2CC1 A;  1YPR A;  3BEC A;  4Y0O A;  4GDB A;  1ES3 A;  3VFH A;  4KEN B;  4JKT A;  5FEF A;  4JPM A;  1H8Y A;  2YKH A;  4DXB A;  3PTE A;  3U4L P;  4ZBE A;  2G2U A;  3K2N A;  2ZOI A;  3E2K A;  1ERM A;  3DTE A;  1GCE A;  3R7W B;  4DE3 A;  2PD8 A;  1LI9 A;  2J3T D;  5EPH A;  5FQQ A;  5AVE A;  2V1A A;  4NXB A;  5GLA A;  4NEE D;  1EI5 A;  1SKO B;  3F1N B;  1FOF A;  2ZMA A;  5FAO A;  2EX2 A;  4RX2 A;  2ZQ8 A;  3UPN A;  2W3D A;  2PU2 A;  4L0L A;  1IYS A;  1NY0 A;  5FSR A;  1JWZ A;  1OTD A;  4Y0T A;  5EVI C;  4PMA A;  3BY9 A;  3O88 A;  3PHY A;  3CI6 A;  4QD4 A;  3NEC A;  1T1A A;  5FAP A;  1TS0 A;  4QY5 A;  4WZ5 C;  3HBR A;  1YM1 A;  2G7U A;  3HLG A;  3NCK A;  4D2O A;  3E4Q A;  2HP9 A;  2ZLY A;  1O7E A;  4KZA A;  2ZM0 A;  4CLC E;  4DE2 A;  4IHQ A;  4N1X A;  3CAX A;  3DTM A;  4OOY A;  1IEM A;  4A5R A;  5DJU A;  1BYW A;  2M7V A;  2DRW A;  2PBY A;  5L07 A;  4UQI S;  2Q9N A;  5BOH A;  3NI9 A;  1ZG4 A;  3LYX A;  2E8I A;  2Y2H A;  5HDS A;  3WS1 A;  5GL9 A;  3U2A A;  5GLC A;  3HLB A;  4KG6 A;  3IXB A;  3KSF A;  5FL3 A;  2HF6 A;  1PI4 A;  3SH9 A;  3C38 A;  2WKR A;  1J9M A;  3ZG0 A;  3ZVT A;  4YIN A;  5KSC A;  2V8F A;  4JXS A;  2V9A A;  5IHV A;  2M7U A;  3IX8 A;  4EES A;  4MBF A;  3QP2 A;  4HOI A;  4BEN A;  1XGJ A;  3N6I A;  5CER A;  3WS4 A;  2ZMF A;  5AQB A;  4KZ7 A;  4GJ4 A;  3CWF A;  2ZJ9 A;  5G4Z A;  2AVX A;  4N92 A;  4AFI A;  4OQI A;  4M3K A;  1YMS A;  2A24 A;  4IVK A;  3N8S A;  3B33 A;  1XP4 A;  3IF6 B;  3T4T A;  2Z2L B;  2XFS A;  3D72 A;  2V2F F;  3T1R A;  3BJN A;  3WS5 A;  1LSW A;  4GDN A;  2BTF P;  3UB5 P;  3EEH A;  2ZQ9 A;  4GW9 A;  3LFV A;  3ZG5 A;  5HD5 A;  1D1J A;  3LR0 A;  2Y2L A;  2MJ6 A;  4I39 A;  3A3F A;  1QME A;  3N8R A;  3OC2 A;  4EXO A;  1N9L A;  4BJP A;  1EW0 A;  3GVB A;  5KIZ A;  2WZZ A;  3W8K A;  2XK1 A;  3MXR A;  3MBZ A;  4JGO A;  4HQA A;  4OP8 A;  1YMX A;  1YSQ A;  1RGY A;  1KE0 A;  4OVD A;  5DF7 A;  4GN2 A;  1ODV A;  4LRZ E;  2PR5 A;  3W4O A;  1NJ4 A;  5EM0 A;  2UWX A;  4OH0 A;  3UB6 A;  5KSH A;  2EXA A;  4HNB A;  3KYE A;  1FR1 A;  4WL9 A;  3S1Y A;  1NRJ A;  3WRZ A;  5CX7 A;  2WGW A;  1BUE A;  1OTI A;  3KO6 A;  2WKH A;  3H9W A;  1G28 A;  4LV0 A;  1FIK A;  4LEN A;  1TDG A;  3IF6 C;  1JWP A;  4EV4 A;  3GMW A;  2BAS A;  2C6W B;  4HP4 A;  4DE1 A;  2Y91 A;  5F68 A;  4C3Q A;  3Q07 A;  5L2F A;  5DFY A;  4OOL A;  1ONG A;  4FD8 A;  1N9N A;  1KGE A;  1ALQ A;  3IXD A;  4EU0 A;  4EEP A;  3C8C A;  2J9P A;  3TSG A;  3C2W A;  3IH8 A;  3V5M A;  2WKP A;  3F1O A;  2EA9 A;  4JBF A;  4QPR A;  1KVM A;  3NUL A;  4BD1 A;  4B4Z A;  2J8Y A;  2K7S A;  1Y28 A;  2V1B A;  4EWF A;  2KLI A;  5AQA A;  1H0M A;  3K3C A;  3FYZ A;  4PKY G;  2JKT I;  3A3I A;  1NZO A;  4BBU A;  4CJN A;  2L4R A;  2DCF A;  5G18 A;  1Z09 A;  1UWN X;  2W1T A;  1MC0 A;  3ZGA B;  4S2K A;  5D3O A;  2A24 B;  3IH9 A;  1WE4 A;  4H8R A;  3LR5 A;  1NYY A;  1TF1 A;  1GSX A;  4NET A;  3WWX A;  1PI5 A;  3G32 A;  3T1Q B;  4Y17 A;  5CHU A;  4EBP A;  4I3I A;  2PR6 A;  2XD5 A;  3HUN A;  1AWI A;  4OLG A;  1XA1 A;  5A91 A;  3JPU A;  3FKW A;  2J3W A;  5DKL A;  3KYZ A;  3NHQ A;  4HIA A;  2P7J A;  2OLV A;  1KE4 A;  4EBN A;  5E2G A;  4JGQ A;  2V1Z A;  1NXY A;  2D02 A;  1H8Z A;  2JBF A;  3T4L A;  1T1C A;  5HWT A;  5L10 A;  1JWV A;  2B5R A;  4ZAM A;  5FAT A;  4UEY A;  5L8M A;  3DWZ A;  4OON A;  5EVL A;  4EET B;  5HWV A;  5EVE A;  3KSH A;  4EQ1 A;  5E43 A;  3JVV A;  1G6O A;  2IA2 A;  3HLD A;  2ZQA A;  5DF8 A;  3BLM A;  1RGZ A;  1ES5 A;  3QP6 A;  5F1F A;  1EWZ A;  1SCW A;  4Y0U A;  1H3Q A;  2P9V B;  4KUK A;  1FCO A;  4X69 A;  2QWS A;  3OBF A;  2OV5 A;  2ZQD A;  1K38 A;  1K57 A;  2HV1 A;  3NDG A;  1V9Z A;  1IOU A;  5HPF A;  2WGV A;  4EER A;  3TJZ C;  3RTY A;  5FI7 A;  2NUT C;  4RQ9 A;  5I5L A;  4R0Q A;  5HX9 A;  1D06 A;  4UA6 A;  1VM1 A;  3RFB A;  3UDX A;  4MEZ A;  5A93 A;  2PDR A;  2RL3 A;  4PM6 A;  3D9Y A;  3F1P A;  2VLG A;  4HBU A;  2L0W A;  1S1Z A;  4R4R A;  2R78 A;  3B47 A;  4Q0J A;  3ZG8 B;  3DTK A;  4LCL A;  3LUQ A;  5FDH A;  5F5Y A;  1K54 C;  3S7P A;  3PBN A;  4BLM A;  1WA9 A;  4MCW A;  4D60 A;  3LY3 A;  3NOP C;  3SH7 A;  3CPT B;  3QNB A;  2LB5 A;  1MY8 A;  3L7H A;  2V20 A;  3ZCZ A;  5HW3 A;  5EE8 A;  1FSY A;  1AXB A;  3VMA A;  4G3W A;  3DAV A;  2HDS A;  4S2J A;  4U3T A;  2JKG A;  3IHB A;  3OPR A;  4X1L A;  2VEA A;  3LIA A;  5TR7 A;  3T4K A;  4QWO A;  2J9O A;  2J3T C;  2Y2G A;  1PWG A;  5FQI A;  3LR3 A;  4S2P A;  4CLC A;  2EX9 A;  4WLA A;  1JNU A;  4XUZ A;  4CPK A;  3LI8 A;  3SOI A;  3PAE A;  1YLY A;  3A0S A;  2R9X A;  4MNR A;  4GNU A;  4BL2 A;  3MSH A;  3H7W B;  5MC7 A;  2XEP A;  3BYD A;  1SHV A;  4BWI A;  3Q7V A;  4MLL A;  4DRT A;  3DBA A;  5CXW A;  1ZHH B;  4XT2 A;  3UE1 A;  2ZM8 A;  5EVI D;  2Y59 A;  5FAQ A;  4ZRR A;  1PW8 A;  2XQZ A;  1GHM A;  2XGN A;  3SS3 A;  2QPN A;  3G30 A;  3GDI A;  4EW7 A;  1OME A;  4GHI A;  4Y5F A;  4HH2 A;  5IS1 A;  2FZ0 A;  4GLQ A;  5GHY A;  4RVA A;  1UWP X;  2H28 A;  3N4I A;  2PT7 A;  5EFW A;  2XA7 M;  3VOZ A;  2Y2N A;  2ACG A;  1S66 L;  2B95 A;  4R3B A;  4E3K A;  4E3I A;  1S1Y A;  3BFD A;  4IUH A;  4KZB A;  2IWD A;  4DJ2 A;  2JN7 A;  2PBD P;  1U60 A;  3A3D A;  3ITA A;  5HD3 A;  4S2O A;  5HAR A;  4E04 A;  4EQI A;  3V50 A;  1XPB A;  3HLE A;  5F83 A;  2ZC4 B;  1H5X A;  4Y15 A;  3M6B A;  2Y55 A;  4KQQ A;  3W4Q A;  4L9F A;  1CF0 A;  4WMC D;  4Y7P A;  3P01 A;  2ZOH A;  3CG5 A;  1N9O A;  2EXB A;  2P04 A;  3BLS A;  4F3L A;  3UPO A;  3SS5 A;  4KUO A;  4GKU A;  2HP5 A;  3V3S A;  4JF6 A;  1T18 A;  2A3U A;  3JVU A;  3BFC A;  4JF4 A;  5JYO A;  1GHI A;  4M4X A;  1XJ3 A;  1W5D A;  2Z6C A;  3GRJ A;  3IWQ A;  5DKK A;  4B88 A;  1I2S A;  3VV4 A;  4HJ3 A;  2OSU A;  3BM6 A;  5DTS A;  4GHI B;  2FH5 A;  4KQR A;  1T1B A;  5EVI A;  3UME A;  4P0M A;  3VP2 A;  1LL9 A;  3FWL A;  5FDS A;  4KG2 A;  3HJK A;  3BQ8 A;  1WYB A;  4KZ3 A;  3W4P A;  1CEG A;  2VA0 A;  3PYP A;  1W8Q A;  1L2S A;  3NY4 A;  1GSW A;  3T4O A;  1W63 Q;  3IWO A;  4KZ8 A;  4K91 A;  2M1C A;  2EWV A;  2Y2O A;  2WAE A;  1KVL A;  4MMN A;  4YOF A;  4NXF A;  5GHX A;  2W1R A;  2VK3 A;  2WAD A;  3M2K A;  3HCY A;  3HUM A;  1LL5 A;  3P7N A;  3T4S A;  4ARZ B;  5J4E A;  5FQ9 A;  3IXG A;  3T1S A;  2XDM A;  3UDI A;  4E6W A;  5U47 A;  1TDL A;  1RCJ A;  3MQO A;  1KGG A;  3GQZ A;  5HFO A;  1FCM A;  4OKP A;  5KMW A;  2ZC3 B;  4F3L B;  5FA7 A;  4WF0 A;  1K56 A;  3NBL A;  1YSP A;  3IF5 A;  4QB8 A;  4WBG A;  4OOM A;  1F5M A;  4ZJ1 A;  3MF0 A;  3CMZ A;  2W3F A;  1DJC A;  3S7O A;  4ETX A;  2V0U A;  1IYQ A;  3VP4 A;  2O99 A;  1F2K A;  3MKE A;  5CTN A;  2Y79 A;  4ZTK A;  2VJW A;  1KE3 A;  3A0R A;  3IBR A;  1MKM A;  5M18 A;  2K2N A;  3H7W A;  3WS0 A;  1ZTU A;  3MZD A;  4X55 A;  3OLO A;  4LPZ A;  2VV6 A;  5AVF A;  3UPP A;  3DWK A;  5F82 A;  3CLO A;  3QNC A;  3I7J A;  1DJB A;  3UB7 A;  3K3D A;  3KSG A;  3O5Y A;  1ES2 A;  1BUL A;  4X68 A;  4WEK A;  1ONH A;  2Q0O A;  4CLC B;  1VHM A;  3C4O A;  4P6B A;  3QP8 A;  5I94 A;  3FG8 A;  4P87 A;  2WKE A;  1ESU A;  3OCN A;  4OPZ A;  4PM7 A;  3HLW A;  3FV7 A;  3ZG7 B;  1CI8 A;  1W7F A;  5DTT A;  1XGI A;  3ZYT A;  4LLO B;  3VSL A;  3PBQ A;  2GX5 A;  4KQO A;  5KZH A;  3IQA A;  2G2W A;  4ME4 A;  4IBX A;  2QYB A;  3MFD A;  4H6J B;  2XA7 S;  1K54 A; 
#chains in the Genus database with same CATH homology
 1EWZ A;  4MBH A;  4JXV A;  1SCW A;  1HVB A;  4Y0U A;  2Y2Q A;  4E3L A;  1KDW A;  3NIA A;  3G31 A;  4Q8I A;  2P9V B;  3CJM A;  5EVI B;  1FCO A;  4X69 A;  3ZFZ A;  1GHP A;  3EQU A;  2OV5 A;  2ZQD A;  2ZC5 B;  4RX3 A;  4DF6 A;  1K38 A;  1K57 A;  3Q82 A;  1IYO A;  1SDN A;  3D4F A;  4KZ5 A;  3TG9 A;  2OLU A;  2ZC7 A;  5J8X A;  3NDG A;  3M2J A;  2CC1 A;  3C7U A;  3ZNY A;  4DKI A;  2WGV A;  3BEC A;  1PWD A;  4OPQ A;  4Y0O A;  1TVF A;  3PBO A;  1ES3 A;  4GDB A;  4ZJ2 A;  3VFH A;  5FI7 A;  4KEN B;  3RJU A;  4JKT A;  3TOI A;  4X6T A;  4R0Q A;  5HX9 A;  4BQM A;  4QJG A;  4UA6 A;  4E3O A;  1VM1 A;  1JTD A;  4JPM A;  3UDX A;  1H8Y A;  4MEZ A;  2ZQ7 A;  1E25 A;  4DXB A;  2J7V A;  3PTE A;  4ZBE A;  2G2U A;  5DVA A;  5EEC A;  4WZ4 A;  2RL3 A;  3C4P A;  4MBK A;  4UHU A;  5A93 A;  3E2K A;  1ERM A;  4PM6 A;  4R4S A;  1GCE A;  4WZ5 A;  3G2Z A;  2VGK A;  3OPP A;  4HBU A;  4DE3 A;  1BLP A;  1LI9 A;  3ITB A;  4PPR A;  4R4R A;  5EPH A;  5FQQ A;  4DDY A;  3LEZ A;  2XH9 A;  5FI6 A;  2Y2I A;  1PZP A;  3ZG8 B;  4LCL A;  5FDH A;  1K56 D;  1K54 C;  3PBN A;  4BLM A;  5GLA A;  2WAF A;  4OQG A;  1EI5 A;  3LY3 A;  1YT4 A;  3SH7 A;  3IWI A;  4N1H A;  3QNB A;  5CGS A;  3NC8 A;  5GHZ A;  1MY8 A;  3GTC A;  1K57 C;  1FOF A;  2ZMA A;  4ID4 A;  5FAO A;  2EX2 A;  1PZO A;  4RX2 A;  2V20 A;  3ZCZ A;  4BL3 A;  5HW3 A;  3G4P A;  5EE8 A;  2ZQ8 A;  4DDS A;  4DXC A;  4OPY A;  1FSY A;  1AXB A;  4S2N A;  1TEM A;  2FFY A;  2BG1 A;  1K6R A;  4PM8 A;  3UPN A;  1XA7 A;  3VMA A;  4C75 A;  2HDS A;  4WEJ A;  2PU2 A;  4S2J A;  4L0L A;  1IYS A;  4U3T A;  3IHB A;  3OPR A;  1NY0 A;  4UA9 A;  2ZQC A;  4GD6 A;  5FSR A;  1JWZ A;  4F94 A;  2VGJ A;  4Y0T A;  5EVI C;  5TR7 A;  3VP3 A;  4OQH A;  2EX8 A;  2J9O A;  4PMA A;  1FR6 A;  2Y2G A;  3O88 A;  1PWG A;  5FQI A;  3VP0 A;  4S2P A;  4QD4 A;  2EX9 A;  5FAP A;  2X71 A;  2PU4 A;  3FKV A;  4XUZ A;  3BEB A;  4QY5 A;  4CPK A;  3UY6 A;  4WZ5 C;  2DNS A;  3SOI A;  3PAE A;  1YLY A;  3HBR A;  2QZ6 A;  5E2F A;  3WS2 A;  2R9X A;  4MNR A;  4C6Y A;  1E3U D;  4GNU A;  1YM1 A;  4BL2 A;  3C7V A;  1M40 A;  3AGE A;  3RXX A;  2HDR A;  4PM9 A;  3HLG A;  2XF3 A;  3ZNT A;  1BLS A;  1I5Q A;  3NCK A;  4D2O A;  2XEP A;  3ZVW A;  4LCM A;  4HES A;  2HP9 A;  1MPL A;  3BYD A;  2ZLY A;  1SHV A;  1FSW A;  1O7E A;  4KZA A;  3Q7V A;  4U0X A;  1HZO A;  4MLL A;  2ZM0 A;  4DRT A;  3IXH A;  4DE2 A;  4IVI A;  4N1X A;  3S4X A;  5CXW A;  1FQG A;  2FFF B;  3DTM A;  3HUO A;  4OOY A;  1IEM A;  2ZM8 A;  4P85 A;  3UE1 A;  5HAP A;  4UA7 A;  4A5R A;  2WUQ A;  4X56 A;  5EVI D;  4OQ0 A;  4R23 A;  1SDE A;  2DRW A;  2PBY A;  3G34 A;  2WKI A;  2Y59 A;  5FAQ A;  2Q9N A;  5BOH A;  1YLT A;  2WZX A;  1PW8 A;  2XQZ A;  2XLN A;  1GHM A;  3NI9 A;  1ZG4 A;  3UN7 A;  1MBL A;  2E8I A;  3NDE A;  2XGN A;  3MXS A;  1ES4 A;  3SS3 A;  2Y2H A;  3WS1 A;  5GL9 A;  1IEL A;  2XD1 A;  2QPN A;  5GLD A;  2JE5 A;  5GLC A;  4E3M A;  3HLB A;  4KG6 A;  3IXB A;  1LLB A;  3CZD A;  5FI2 A;  3N7W A;  3G30 A;  1K4F A;  1PI4 A;  3A3E A;  4OPR A;  1OME A;  1L0G A;  3Q1F A;  4KZ4 A;  3SH9 A;  3UO9 A;  5JYP A;  2EFU A;  1L0E A;  1ZG6 A;  2A49 A;  5GHY A;  1J9M A;  3M6H A;  3ZG0 A;  3ZVT A;  4YIN A;  4RVA A;  1YLZ A;  3N4I A;  1K55 A;  3ZDJ A;  3PBS A;  5KSC A;  1K25 A;  1K55 C;  3VOZ A;  3IHA A;  2Y2N A;  4JXS A;  2RCX A;  4QY6 A;  1MWU A;  3QHY A;  4R3B A;  3RXW A;  5IHV A;  4E3K A;  4E3I A;  4MBF A;  3BFD A;  3MZF A;  1IKI A;  1Q2Q A;  3GR2 A;  4KZB A;  5A92 A;  1Y54 A;  4KG5 A;  4BEN A;  2IWD A;  1NRF A;  1XGJ A;  3N6I A;  5E2E A;  3BFE A;  5CER A;  1YQS A;  3S22 A;  4N9K A;  3WS4 A;  2Y4A A;  5AQB A;  4KZ7 A;  1U60 A;  3GSG A;  3A3D A;  3ITA A;  2IWC A;  4X53 A;  4S2O A;  5HAR A;  1CI9 A;  1K4E A;  2ZJ9 A;  3DW0 A;  3PAG A;  4EQI A;  2XFT A;  5HL1 A;  4N92 A;  5EOE A;  2X02 A;  2Z2M B;  4M3K A;  1YMS A;  4OQI A;  1XPB A;  3HLE A;  3V50 A;  4IVK A;  5F83 A;  2ZC4 B;  2GDN A;  3N8S A;  3IF6 B;  1MWT A;  1XP4 A;  1H5X A;  2Z2L B;  4R3J A;  4GZB A;  4BD0 A;  2XFS A;  5HAI A;  4HBT A;  2Y2P A;  3ZHH A;  2V2F F;  1Q2P A;  1ERQ A;  3M6B A;  2Y55 A;  1YLJ A;  4U0T A;  3WS5 A;  4E3J A;  4K0X A;  4KQQ A;  1XXM A;  3W4Q A;  4YFM A;  3G2Y A;  3LO7 A;  4GDN A;  1NZU A;  4WMC D;  4FH2 A;  4Y7P A;  2ZQ9 A;  4OLD A;  3IF6 A;  4GOG A;  2X01 A;  4ZJ3 A;  2BLS A;  3P98 A;  3ZG5 A;  1BLC A;  1L0D A;  3CG5 A;  2Y2L A;  3G35 A;  3A3J A;  2EXB A;  3BLS A;  3P09 A;  3A3F A;  4QU3 A;  3UPO A;  1QME A;  3N8R A;  2R9W A;  1IYP A;  3OC2 A;  3SS5 A;  4GKU A;  5FQK A;  4IBR A;  1IKG A;  4BJP A;  3UE3 A;  5FQM A;  1N4O A;  2HP5 A;  4B4X A;  3V3S A;  5CEC A;  3GVB A;  2WZZ A;  3W8K A;  4GD8 A;  4KZ6 A;  2HPB A;  1G6A A;  2XK1 A;  4JF6 A;  2A3U A;  4S2I A;  3MXR A;  3MBZ A;  1KDS A;  3BFC A;  4GB7 A;  4LV2 A;  4JF4 A;  5CHJ A;  1KGF A;  4JXW A;  4OP8 A;  5AQ9 A;  3SS4 A;  1LI0 A;  5JYO A;  1GHI A;  1W79 A;  1YMX A;  2Y2K A;  1RGY A;  1KE0 A;  3OCL A;  4OVD A;  2WGW B;  1W5D A;  3Q7Z A;  3GV9 A;  5DF7 A;  3GRJ A;  4GN2 A;  3IWQ A;  1BSG A;  4B88 A;  5FAS A;  1I2S A;  1O07 A;  3W4O A;  1NJ4 A;  2H0T A;  2OSU A;  2ZM2 A;  1MWS A;  1MWR A;  1QMF A;  2UWX A;  3BM6 A;  4OH0 A;  2HP6 A;  5DTS A;  3HLF A;  2EXA A;  5FQJ A;  5CED A;  5KSH A;  4KZ9 A;  3O87 A;  4KQR A;  1HTZ A;  2ZD8 A;  2JC7 A;  1XKZ A;  1C3B A;  1FR1 A;  5EVI A;  4EBL A;  3S1Y A;  3N8L A;  3WRZ A;  4P0M A;  1XX2 A;  3HVF A;  5CEB A;  1PW1 A;  2WGW A;  3HLC A;  3JYI A;  2EFX A;  1W8Y A;  1GA9 A;  1BUE A;  1GA0 A;  3VP2 A;  1LL9 A;  3FWL A;  3LY4 A;  3VOY A;  4S2M A;  2WYX A;  2P9V A;  2WKH A;  3EQV A;  4Z9Q A;  4KG2 A;  4LV0 A;  4RA7 A;  1N9B A;  4LEN A;  3UDF A;  1Z6F A;  1TDG A;  3IF6 C;  1JWP A;  1WYB A;  3GMW A;  2C6W B;  4KZ3 A;  3W4P A;  4EV4 A;  1CEG A;  3O86 A;  3V3R A;  1W8Q A;  3HRE A;  3V39 A;  4DE1 A;  1L2S A;  1HD8 A;  2H5S A;  1SKF A;  3NY4 A;  5TGF A;  2Y91 A;  3IT9 A;  3IWO A;  5CTM A;  5TFQ A;  4C3Q A;  4KZ8 A;  5CGW A;  4DE0 A;  1ZKJ A;  3Q07 A;  4K91 A;  5F1G A;  2QMI A;  2Y2M A;  2Y2O A;  2WAE A;  5L2F A;  4OOL A;  1KVL A;  1MKI A;  3LCE A;  1ONG A;  4FD8 A;  4E3N A;  1KGE A;  4IED A;  1BLH A;  4HEF A;  1RP5 A;  5GLB A;  5GHX A;  1ALQ A;  3IXD A;  5CRF A;  2WAD A;  3M2K A;  3HUM A;  4E6X A;  2J9P A;  1LL5 A;  3TSG A;  3IH8 A;  5E2H A;  1K6S A;  1LHY A;  3V5M A;  4JBF A;  5FQ9 A;  3IXG A;  1BZA A;  3HL9 A;  2XR0 A;  2XDM A;  3UDI A;  4E6W A;  5U47 A;  4WYY A;  1KVM A;  1TDL A;  1RCJ A;  4BD1 A;  4B4Z A;  1KGG A;  2J8Y A;  3E2L A;  3GQZ A;  5HFO A;  1FCM A;  4OKP A;  4PM5 A;  2I72 A;  1ERO A;  5EOO A;  4EWF A;  5KMW A;  4ZDX A;  4JLF A;  2ZC3 B;  5AQA A;  3MKF A;  2Q9M A;  5FA7 A;  3O3V A;  1G68 A;  4OP5 A;  1K56 A;  3FYZ A;  1S0W A;  3NBL A;  3A3I A;  3IF5 A;  1NZO A;  3C5A A;  3UE0 A;  4CJN A;  2DCF A;  4QB8 A;  4WBG A;  4OOM A;  5G18 A;  4ZJ1 A;  3VP1 A;  3CMZ A;  3AGF A;  3SH8 A;  1DJC A;  1WYC A;  1BTL A;  3BFG A;  1PWC A;  1ESI A;  3ZG9 B;  3Q7V B;  4S2N C;  5AQ7 A;  1IYQ A;  3VP4 A;  4XUX A;  3ZGA B;  3BFF A;  4FSF A;  4S2K A;  5D3O A;  3AGD A;  1VQQ A;  3IH9 A;  3MKE A;  1WE4 A;  4NK3 A;  4WM9 A;  4H8R A;  1NYY A;  5CTN A;  2HDQ A;  4NET A;  1YLP A;  1YLW A;  4ZTK A;  5CHM A;  1PI5 A;  3G32 A;  3WWX A;  1KE3 A;  5DF9 A;  1FCN A;  1ZC2 A;  3UNW A;  5HAQ A;  5M18 A;  5CHU A;  5M1A A;  4RYE A;  4EBP A;  3PBT A;  1CEF A;  4S2L A;  3WS0 A;  2XD5 A;  3HUN A;  2Y2J A;  2HDU A;  3MZE A;  5DTK A;  3WRT A;  1M6K A;  5EUA A;  2IWB A;  1L0F A;  3MZD A;  4X55 A;  4OLG A;  1S6R A;  1XA1 A;  2WGI A;  3BRM A;  3UPP A;  5A91 A;  3DWK A;  4QHC A;  5F82 A;  4LV3 A;  1BT5 A;  3FKW A;  3I7J A;  3QNC A;  2WK0 A;  1DJB A;  2H0Y A;  4WMC A;  4JF5 A;  5M19 A;  1DJA A;  2OLV A;  1CK3 A;  4JXG A;  1KE4 A;  4R1G A;  1ES2 A;  4EBN A;  5A90 A;  4FH4 A;  3OZH A;  5E2G A;  1BUL A;  1DY6 A;  1E4D A;  4X68 A;  4WEK A;  1PYY A;  2V1Z A;  1ONH A;  4O7D A;  4UAA A;  3OPL A;  1NXY A;  4LV1 A;  1H8Z A;  2JBF A;  1I2W A;  1JVJ A;  3C4O A;  2EX6 A;  3FZC A;  2ZC6 B;  4WEL A;  4FCF A;  4P6B A;  4XXR A;  5I94 A;  2P74 A;  1JWV A;  3Q81 A;  4P87 A;  2B5R A;  1NYM A;  4N9L A;  2WKE A;  4ZAM A;  3OPH A;  4K0W A;  5FAT A;  3VFF A;  1ESU A;  3OCN A;  4OPZ A;  3DWZ A;  4OON A;  3VSK A;  4PM7 A;  5EVL A;  3HLW A;  1MXO A;  3FV7 A;  1JTG A;  2JCH A;  3ZG7 B;  1CI8 A;  5E43 A;  1W7F A;  5DTT A;  3B3X A;  5CGX A;  1XGI A;  1E3U A;  3VSL A;  4EUZ A;  3PBQ A;  3HLD A;  2ZQA A;  4KQO A;  3BLM A;  5DF8 A;  5KZH A;  3IQA A;  2G2W A;  3PBR A;  1PIO A;  3ISG A;  4IBX A;  2C5W B;  1RGZ A;  3MFD A;  1ES5 A;  2H10 A;  5F1F A;  1K54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...