1L0HA

Crystal structure of butyryl-acp from e.coli
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies on butyryl-ACP reveal flexibility of the structure around a putative acyl chain binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords ACYL CARRIER PROTEIN
total genus 25
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1l0hA00
2KW2A 1AF8A 2KR5A 5KP6B 2N98A 2EHSA 2JQ4A 4NEOA 2MVUA 2N50A 4CA3A 2KGDA 2L4BA 2MR7A 5KP8B 2FAEA 2KGEA 1OR5A 2FADA 2KOPA 2AFDA 2K0YA 4BPGA 2QNWA 5HVCA 4DG9A 2LIUA 2KOSA 2DNWA 2FQ0A 4H2WC 1HY8A 2L0QA 2KG8A 2KG9A 1HQBA 2KGCA 5KP7B 2K2QA 3EJDA 2N6YA 1DV5A 2CQ8A 4BPFA 2M5RA 2FVEA 2AVAA 5HV8A 1F80D 2GDXA 3GZMA 4IZ6A 2EHTA 2X2BA 2XZ0D 2CG5B 2MD9A 2L9FA 3GZLA 1VKUA 2AF8A 4H2YC 4H2XC 2KG6A 1DNYA 2ROQA 1X3OA 2FHSC 2LOLA 2LL8A 2PNGA 3CE7A 2AFEA 2VSQA 2CGQA 2KOQA 2JU2A 2K0XA 2KORA 2N6ZA 1L0IA 5EJDA 2CNRA 3EJEA 3NY7B 4MRTC 5CZDB 3RG2A 2LKIA 2FACA 2KOOA 2FQ2A 2MY5A 2LIWA 2MR8A 3EJBA 2L22A 1T8KA 1L0HA 2GDWA 2KGAA 1KLPA 2KWLA 2MVVA 2JU1A 2K94A 2LTEA 2FQ1A 3LMOA 2MF4A 4BPHA 4PWVB 2FVFA 2GDYA 2K92A 2K93A 2LMLA 4R0MA 2JGPA 2N5IA 1NQ4A 2FVAA 2N5HA 4HKGA 1ACPA 2LPKA 2XZ1C 4PXHB
chains in the Genus database with same CATH superfamily
2QA4P 1S72P 1K8AQ 1RO2A 1NJIQ 3GKLC 2M8NA 4CA3A 2MR7A 2FAEA 1YITP 3LRYA 4XFYA 1N8RQ 2QNWA 4DG9A 2KOSA 2XXMA 1A8OA 2EIAA 4H2WC 1HY8A 3DS1A 4U0FA 2KG9A 5KP7B 3EJDA 2CQ8A 2M8LA 1EOQA 5I4TG 3G1IA 4PH0A 1F80D 2GDXA 3G71P 2EHTA 3GJNA 2XZ0D 1YI2P 2OTLP 2VLPA 2PEIA 1VKUA 2Z44A 1GPJA 2KG6A 1DNYA 2PEMA 2JYGA 1RNIA 2PEOA 3HYBA 2WPTA 2PNGA 2K5XA 2VSQA 3CCSP 2GZJA 3CMAP 2JU2A 2K0XA 3EJEA 1VQPP 5CZDB 2PEQA 3RG2A 2LKIA 1IMQA 7CEIA 2LIWA 3I56P 2MR8A 3H4EA 1T8KA 1KLPA 5EW5E 2MVVA 2PENA 3H0DA 1KD1Q 1ZNVA 4BPHA 1AYIA 3G1GA 1KQSO 2K92A 1QRJA 2LMLA 2N5IA 1NQ4A 2FVAA 3M1MA 2DGYA 3G29A 3H47A 2EG5A 1A43A 3G0VA 1AF8A 1VQ8P 4COCA 2XV6A 1EMVA 3CCMP 3Q20A 1EIAA 2EHSA 2JQ4A 2N50A 4XFXA 2KGDA 2VLNA 5HGNA 1OR5A 2FADA 2KOPA 2M8PA 1IMPA 2OARA 4COPA 4GR6A 5HVCA 4BPGA 1IUQA 2Z45A 5HGLA 2KG8A 1K73Q 1M6NA 2N6YA 3CCVP 4PH1A 3G4SP 3VRLC 1Q82Q 2GZGA 4U0CA 4WYMA 1GXHA 2ROQA 3CCUP 2BHVA 1Q81Q 5F2OA 3G21A 3I55P 3U43A 3CE7A 3DPHA 2CGQA 1M90Q 2N6ZA 2CNRA 4QNBA 3MGEA 1VQ9P 4MRTC 1YIJP 2FQ2A 2L6EA 3CCRP 3EJBA 2GZEA 2L22A 1L0HA 3CMEP 2KWLA 2P9XA 2JO0A 1M6EX 1AUMA 2OTJP 1W2BO 2LTEA 3RG6C 2FQ1A 3LMOA 1VHNA 2FVFA 2K93A 2JBGA 1E0HA 1VQ6P 1ACPA 2LPKA 3CCEP 2XZ1C 4PXHB 1YJ9P 2KW2A 4GR2A 2KR5A 3CD6P 5KP6B 2N98A 3NTEA 1VQ4P 4U0AA 2KGEA 4M0IA 1MZ8A 2JAZA 1K30A 1E6JP 1D1DA 2ONTA 1HQBA 2VLOA 2KGCA 2K2QA 2EFJA 1UJZA 2M5RA 4XFZA 2AVAA 5HV8A 2ERHA 4IZ6A 2CG5B 2JYLA 1VQOP 2L9FA 2AF8A 4H2XC 3WBHA 1QVGO 1X3OA 2FHSC 1K9MQ 2LF4A 1VQNP 2AFEA 1Q86Q 2PEKA 2XT1A 2GYKA 3DS4A 3DS0A 2GZFA 2KOQA 3CC2P 1Q7YQ 1ZMBA 2NO8A 5DCKA 3NY7B 5BS1A 2FACA 4F37A 2KOOA 2GZIA 1CEIA 1JJ2O 1BXIA 5HGMA 3CC4P 2Z46A 1YHQP 2JU1A 3E2DA 5F2KA 2GDYA 3CPWO 2JGPA 1UNKA 3CCLP 5BS2A 2PY8A 1M74A 4HKGA 3CCJP 1VQKP 3B5IA 5F2NA 2QEXP 1KC8Q 4NEOA 2MVUA 2L4BA 3B4QA 5KP8B 3G28A 1VQ5P 4U0DA 2AFDA 2K0YA 2K0DX 2LIUA 2DNWA 2FQ0A 4IPYA 4UHPB 2L0QA 3OW2O 3DTJA 1DV5A 4BPFA 1VQLP 2FVEA 2KODA 4U0BA 5JPAA 1QVFO 3GZMA 1VQ7P 2X2BA 1GXGA 2MD9A 3DS5A 3GZLA 4H2YC 3HZQA 1M1KQ 5HGOA 2LOLA 2LL8A 2E1MA 1BAJA 3CCQP 2KORA 1L0IA 5EJDA 3CXCO 4XRQA 2VLQA 2MY5A 1FR2A 3P05A 1YJWP 1Z6MA 2CWOA 2GDWA 2KGAA 1VQMP 3G6EP 2JB0A 2K94A 1YJNP 2MF4A 4PWVB 1RO0A 4QKOA 4U0EA 3CC7P 4R0MA 4XROA 3DS2A 2N5HA 2PEJA 3G26A 2BUOA 3DS3A
chains in the Genus database with same CATH topology
2KW2A 1AF8A 2KR5A 5KP6B 2N98A 2EHSA 2JQ4A 4NEOA 2MVUA 2N50A 4CA3A 2KGDA 2L4BA 2MR7A 5KP8B 2FAEA 2KGEA 1OR5A 2FADA 2KOPA 2AFDA 2K0YA 4BPGA 2QNWA 5HVCA 4DG9A 2LIUA 2KOSA 2DNWA 2FQ0A 4H2WC 1HY8A 2L0QA 2KG8A 2KG9A 1HQBA 2KGCA 5KP7B 2K2QA 3EJDA 2N6YA 1DV5A 2CQ8A 4BPFA 2M5RA 2FVEA 2AVAA 5HV8A 1F80D 2GDXA 3GZMA 4IZ6A 2EHTA 2X2BA 2XZ0D 2CG5B 2MD9A 2L9FA 3GZLA 1VKUA 2AF8A 4H2YC 4H2XC 2KG6A 1DNYA 2ROQA 1X3OA 2FHSC 2LOLA 2LL8A 2PNGA 3CE7A 2AFEA 2VSQA 2CGQA 2KOQA 2JU2A 2K0XA 2KORA 2N6ZA 1L0IA 5EJDA 2CNRA 3EJEA 3NY7B 4MRTC 5CZDB 3RG2A 2LKIA 2FACA 2KOOA 2FQ2A 2MY5A 2LIWA 2MR8A 3EJBA 2L22A 1T8KA 1L0HA 2GDWA 2KGAA 1KLPA 2KWLA 2MVVA 2JU1A 2K94A 2LTEA 2FQ1A 3LMOA 2MF4A 4BPHA 4PWVB 2FVFA 2GDYA 2K92A 2K93A 2LMLA 4R0MA 2JGPA 2N5IA 1NQ4A 2FVAA 2N5HA 4HKGA 1ACPA 2LPKA 2XZ1C 4PXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW2 A;  1AF8 A;  2KR5 A;  5KP6 B;  2N98 A;  2EHS A;  2JQ4 A;  4NEO A;  2MVU A;  2N50 A;  4CA3 A;  2KGD A;  2L4B A;  2MR7 A;  5KP8 B;  2FAE A;  2KGE A;  1OR5 A;  2FAD A;  2KOP A;  2AFD A;  2K0Y A;  4BPG A;  2QNW A;  5HVC A;  4DG9 A;  2LIU A;  2KOS A;  2DNW A;  2FQ0 A;  4H2W C;  1HY8 A;  2L0Q A;  2KG8 A;  2KG9 A;  1HQB A;  2KGC A;  5KP7 B;  2K2Q A;  3EJD A;  2N6Y A;  1DV5 A;  2CQ8 A;  4BPF A;  2M5R A;  2FVE A;  2AVA A;  5HV8 A;  1F80 D;  2GDX A;  3GZM A;  4IZ6 A;  2EHT A;  2X2B A;  2XZ0 D;  2CG5 B;  2MD9 A;  2L9F A;  3GZL A;  1VKU A;  2AF8 A;  4H2Y C;  4H2X C;  2KG6 A;  1DNY A;  2ROQ A;  1X3O A;  2FHS C;  2LOL A;  2LL8 A;  2PNG A;  3CE7 A;  2AFE A;  2VSQ A;  2CGQ A;  2KOQ A;  2JU2 A;  2K0X A;  2KOR A;  2N6Z A;  1L0I A;  5EJD A;  2CNR A;  3EJE A;  3NY7 B;  4MRT C;  5CZD B;  3RG2 A;  2LKI A;  2FAC A;  2KOO A;  2FQ2 A;  2MY5 A;  2LIW A;  2MR8 A;  3EJB A;  2L22 A;  1T8K A;  1L0H A;  2GDW A;  2KGA A;  1KLP A;  2KWL A;  2MVV A;  2JU1 A;  2K94 A;  2LTE A;  2FQ1 A;  3LMO A;  2MF4 A;  4BPH A;  4PWV B;  2FVF A;  2GDY A;  2K92 A;  2K93 A;  2LML A;  4R0M A;  2JGP A;  2N5I A;  1NQ4 A;  2FVA A;  2N5H A;  4HKG A;  1ACP A;  2LPK A;  2XZ1 C;  4PXH B; 
#chains in the Genus database with same CATH topology
 2QA4 P;  1S72 P;  1K8A Q;  1RO2 A;  1NJI Q;  3GKL C;  2M8N A;  4CA3 A;  2MR7 A;  2FAE A;  1YIT P;  3LRY A;  4XFY A;  1N8R Q;  2QNW A;  4DG9 A;  2KOS A;  2XXM A;  1A8O A;  2EIA A;  4H2W C;  1HY8 A;  3DS1 A;  4U0F A;  2KG9 A;  5KP7 B;  3EJD A;  2CQ8 A;  2M8L A;  1EOQ A;  5I4T G;  3G1I A;  4PH0 A;  1F80 D;  2GDX A;  3G71 P;  2EHT A;  3GJN A;  2XZ0 D;  1YI2 P;  2OTL P;  2VLP A;  2PEI A;  1VKU A;  2Z44 A;  1GPJ A;  2KG6 A;  1DNY A;  2PEM A;  2JYG A;  1RNI A;  2PEO A;  3HYB A;  2WPT A;  2PNG A;  2K5X A;  2VSQ A;  3CCS P;  2GZJ A;  3CMA P;  2JU2 A;  2K0X A;  3EJE A;  1VQP P;  5CZD B;  2PEQ A;  3RG2 A;  2LKI A;  1IMQ A;  7CEI A;  2LIW A;  3I56 P;  2MR8 A;  3H4E A;  1T8K A;  1KLP A;  5EW5 E;  2MVV A;  2PEN A;  3H0D A;  1KD1 Q;  1ZNV A;  4BPH A;  1AYI A;  3G1G A;  1KQS O;  2K92 A;  1QRJ A;  2LML A;  2N5I A;  1NQ4 A;  2FVA A;  3M1M A;  2DGY A;  3G29 A;  3H47 A;  2EG5 A;  1A43 A;  3G0V A;  1AF8 A;  1VQ8 P;  4COC A;  2XV6 A;  1EMV A;  3CCM P;  3Q20 A;  1EIA A;  2EHS A;  2JQ4 A;  2N50 A;  4XFX A;  2KGD A;  2VLN A;  5HGN A;  1OR5 A;  2FAD A;  2KOP A;  2M8P A;  1IMP A;  2OAR A;  4COP A;  4GR6 A;  5HVC A;  4BPG A;  1IUQ A;  2Z45 A;  5HGL A;  2KG8 A;  1K73 Q;  1M6N A;  2N6Y A;  3CCV P;  4PH1 A;  3G4S P;  3VRL C;  1Q82 Q;  2GZG A;  4U0C A;  4WYM A;  1GXH A;  2ROQ A;  3CCU P;  2BHV A;  1Q81 Q;  5F2O A;  3G21 A;  3I55 P;  3U43 A;  3CE7 A;  3DPH A;  2CGQ A;  1M90 Q;  2N6Z A;  2CNR A;  4QNB A;  3MGE A;  1VQ9 P;  4MRT C;  1YIJ P;  2FQ2 A;  2L6E A;  3CCR P;  3EJB A;  2GZE A;  2L22 A;  1L0H A;  3CME P;  2KWL A;  2P9X A;  2JO0 A;  1M6E X;  1AUM A;  2OTJ P;  1W2B O;  2LTE A;  3RG6 C;  2FQ1 A;  3LMO A;  1VHN A;  2FVF A;  2K93 A;  2JBG A;  1E0H A;  1VQ6 P;  1ACP A;  2LPK A;  3CCE P;  2XZ1 C;  4PXH B;  1YJ9 P;  2KW2 A;  4GR2 A;  2KR5 A;  3CD6 P;  5KP6 B;  2N98 A;  3NTE A;  1VQ4 P;  4U0A A;  2KGE A;  4M0I A;  1MZ8 A;  2JAZ A;  1K30 A;  1E6J P;  1D1D A;  2ONT A;  1HQB A;  2VLO A;  2KGC A;  2K2Q A;  2EFJ A;  1UJZ A;  2M5R A;  4XFZ A;  2AVA A;  5HV8 A;  2ERH A;  4IZ6 A;  2CG5 B;  2JYL A;  1VQO P;  2L9F A;  2AF8 A;  4H2X C;  3WBH A;  1QVG O;  1X3O A;  2FHS C;  1K9M Q;  2LF4 A;  1VQN P;  2AFE A;  1Q86 Q;  2PEK A;  2XT1 A;  2GYK A;  3DS4 A;  3DS0 A;  2GZF A;  2KOQ A;  3CC2 P;  1Q7Y Q;  1ZMB A;  2NO8 A;  5DCK A;  3NY7 B;  5BS1 A;  2FAC A;  4F37 A;  2KOO A;  2GZI A;  1CEI A;  1JJ2 O;  1BXI A;  5HGM A;  3CC4 P;  2Z46 A;  1YHQ P;  2JU1 A;  3E2D A;  5F2K A;  2GDY A;  3CPW O;  2JGP A;  1UNK A;  3CCL P;  5BS2 A;  2PY8 A;  1M74 A;  4HKG A;  3CCJ P;  1VQK P;  3B5I A;  5F2N A;  2QEX P;  1KC8 Q;  4NEO A;  2MVU A;  2L4B A;  3B4Q A;  5KP8 B;  3G28 A;  1VQ5 P;  4U0D A;  2AFD A;  2K0Y A;  2K0D X;  2LIU A;  2DNW A;  2FQ0 A;  4IPY A;  4UHP B;  2L0Q A;  3OW2 O;  3DTJ A;  1DV5 A;  4BPF A;  1VQL P;  2FVE A;  2KOD A;  4U0B A;  5JPA A;  1QVF O;  3GZM A;  1VQ7 P;  2X2B A;  1GXG A;  2MD9 A;  3DS5 A;  3GZL A;  4H2Y C;  3HZQ A;  1M1K Q;  5HGO A;  2LOL A;  2LL8 A;  2E1M A;  1BAJ A;  3CCQ P;  2KOR A;  1L0I A;  5EJD A;  3CXC O;  4XRQ A;  2VLQ A;  2MY5 A;  1FR2 A;  3P05 A;  1YJW P;  1Z6M A;  2CWO A;  2GDW A;  2KGA A;  1VQM P;  3G6E P;  2JB0 A;  2K94 A;  1YJN P;  2MF4 A;  4PWV B;  1RO0 A;  4QKO A;  4U0E A;  3CC7 P;  4R0M A;  4XRO A;  3DS2 A;  2N5H A;  2PEJ A;  3G26 A;  2BUO A;  3DS3 A; 
#chains in the Genus database with same CATH homology
 2KW2 A;  1AF8 A;  2KR5 A;  5KP6 B;  2N98 A;  2EHS A;  2JQ4 A;  4NEO A;  2MVU A;  2N50 A;  4CA3 A;  2KGD A;  2L4B A;  2MR7 A;  5KP8 B;  2FAE A;  2KGE A;  1OR5 A;  2FAD A;  2KOP A;  2AFD A;  2K0Y A;  4BPG A;  2QNW A;  5HVC A;  4DG9 A;  2LIU A;  2KOS A;  2DNW A;  2FQ0 A;  4H2W C;  1HY8 A;  2L0Q A;  2KG8 A;  2KG9 A;  1HQB A;  2KGC A;  5KP7 B;  2K2Q A;  3EJD A;  2N6Y A;  1DV5 A;  2CQ8 A;  4BPF A;  2M5R A;  2FVE A;  2AVA A;  5HV8 A;  1F80 D;  2GDX A;  3GZM A;  4IZ6 A;  2EHT A;  2X2B A;  2XZ0 D;  2CG5 B;  2MD9 A;  2L9F A;  3GZL A;  1VKU A;  2AF8 A;  4H2Y C;  4H2X C;  2KG6 A;  1DNY A;  2ROQ A;  1X3O A;  2FHS C;  2LOL A;  2LL8 A;  2PNG A;  3CE7 A;  2AFE A;  2VSQ A;  2CGQ A;  2KOQ A;  2JU2 A;  2K0X A;  2KOR A;  2N6Z A;  1L0I A;  5EJD A;  2CNR A;  3EJE A;  3NY7 B;  4MRT C;  5CZD B;  3RG2 A;  2LKI A;  2FAC A;  2KOO A;  2FQ2 A;  2MY5 A;  2LIW A;  2MR8 A;  3EJB A;  2L22 A;  1T8K A;  1L0H A;  2GDW A;  2KGA A;  1KLP A;  2KWL A;  2MVV A;  2JU1 A;  2K94 A;  2LTE A;  2FQ1 A;  3LMO A;  2MF4 A;  4BPH A;  4PWV B;  2FVF A;  2GDY A;  2K92 A;  2K93 A;  2LML A;  4R0M A;  2JGP A;  2N5I A;  1NQ4 A;  2FVA A;  2N5H A;  4HKG A;  1ACP A;  2LPK A;  2XZ1 C;  4PXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...