1L0IA

Crystal structure of butyryl-acp i62m mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKMTTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystallographic Studies on Butyryl-ACP Reveal Flexibility of the Structure around a Putative Acyl Chain Binding Site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1l0iA00
3EJDA 2JGPA 1HY8A 2LMLA 2N5IA 2XZ0D 3RG2A 4PXHB 2KOSA 2QNWA 2MVUA 2KG8A 2CGQA 2EHSA 2N6YA 2KOQA 2KOOA 2FQ0A 2L0QA 4DG9A 1OR5A 2K0YA 2L9FA 1AF8A 2VSQA 4BPFA 1DV5A 2K2QA 2AF8A 2K93A 2K94A 5CZDB 3NY7B 4BPGA 2MVVA 2X2BA 3LMOA 2PNGA 1L0HA 2FQ1A 4PWVB 2L4BA 2AFEA 2MR7A 2N6ZA 2AFDA 2K0XA 5EJDA 4HKGA 2JU1A 3GZLA 2KGDA 2MR8A 1ACPA 2XZ1C 1F80D 2CG5B 2N50A 2FHSC 2FAEA 2M5RA 5KP6B 4NEOA 1VKUA 2ROQA 2KORA 2DNWA 2EHTA 2LPKA 2KWLA 2K92A 4H2YC 5KP7B 1X3OA 1DNYA 4IZ6A 2AVAA 2FVFA 2LL8A 3EJEA 2GDYA 2MF4A 2FVAA 2N5HA 1KLPA 5HVCA 2KG6A 2KW2A 2KGCA 1HQBA 2KGAA 2MD9A 2N98A 2JU2A 2LOLA 2JQ4A 2FADA 5KP8B 2LIUA 2CNRA 4H2XC 2FACA 4MRTC 2FVEA 4BPHA 1L0IA 2GDWA 1T8KA 4R0MA 2KG9A 2CQ8A 3EJBA 5HV8A 3GZMA 4H2WC 2LTEA 2LKIA 2KR5A 3CE7A 2MY5A 2LIWA 2KOPA 2L22A 1NQ4A 2GDXA 2FQ2A 4CA3A 2KGEA
chains in the Genus database with same CATH superfamily
3EJDA 2LMLA 2JYGA 1AYIA 1IUQA 3G1GA 2GZIA 2N6YA 2WPTA 3CCEP 3CPWO 2L0QA 4XRQA 1OR5A 1NJIQ 1AF8A 3MGEA 2GYKA 4F37A 2K2QA 2Z45A 5CZDB 3G1IA 1M6NA 3HYBA 4BPGA 2MVVA 1QVGO 5DCKA 3LMOA 3DS2A 4M0IA 4PWVB 2L4BA 1E0HA 1VQNP 1W2BO 2QA4P 3CMAP 2OARA 2JU1A 5F2KA 2CG5B 2N50A 2M5RA 2ROQA 2KORA 1KD1Q 2KWLA 2K92A 1VQLP 2QEXP 1DNYA 4IZ6A 4XFYA 1GXHA 1M74A 2JB0A 2LL8A 2MF4A 2FVAA 2BUOA 3CCJP 2KG6A 2KW2A 2KGCA 4U0FA 3CCSP 2KGAA 2MD9A 2N98A 3DS0A 3CMEP 1VQ6P 2LIUA 3H0DA 2LF4A 3G21A 1VQ9P 3I56P 1VQ8P 2PEOA 4XFZA 3EJBA 3CCQP 2LTEA 2LKIA 3CE7A 1NQ4A 2PEMA 4GR2A 2JGPA 4XROA 1HY8A 2JO0A 3CCRP 5I4TG 3WBHA 2PEIA 3G0VA 3RG2A 2QNWA 2KG8A 2CGQA 2EHSA 1QRJA 2FQ0A 3DPHA 3LRYA 1Q81Q 5HGLA 1YJWP 3DS3A 2BHVA 3GJNA 2K93A 1K8AQ 3DTJA 1CEIA 3CC2P 3CCVP 3Q20A 2K0DX 2PNGA 4COCA 3H47A 5BS2A 2JYLA 3RG6C 2AFEA 3NTEA 4HKGA 1EIAA 1JJ2O 2E1MA 3CXCO 1N8RQ 1ZNVA 2KGDA 1RO2A 1ACPA 1VQMP 2XZ1C 1YJNP 2LPKA 3CC7P 1M1KQ 3H4EA 5EW5E 1ZMBA 2FVFA 1VHNA 2OTLP 2ONTA 5HGOA 2N5HA 3GKLC 1KLPA 3G29A 1RO0A 1HQBA 2P9XA 2JQ4A 4U0CA 5KP8B 2CWOA 1UJZA 4MRTC 4BPHA 3G6EP 1VQOP 1T8KA 4R0MA 2CQ8A 2Z44A 5HV8A 3GZMA 3G71P 2GZJA 4IPYA 4GR6A 4U0DA 2MY5A 2LIWA 1KC8Q 1VQ7P 2VLNA 2KGEA 1Q86Q 2XV6A 2XXMA 2N5IA 1AUMA 3DS1A 4PXHB 4QNBA 4COPA 2K0YA 3E2DA 4BPFA 3M1MA 2AF8A 1VQPP 1K30A 4U0BA 5F2OA 2ERHA 2X2BA 1BAJA 2FQ1A 1KQSO 2MR7A 2N6ZA 2K0XA 5EJDA 2GZFA 2DGYA 3U43A 3G28A 2MR8A 2VLPA 4PH0A 1F80D 1VQKP 4UHPB 2DNWA 2PY8A 1Q7YQ 4H2YC 1X3OA 1FR2A 1VQ5P 3I55P 3EJEA 2GDYA 3G26A 1IMQA 5HVCA 3CD6P 1EMVA 2EIAA 3CCMP 2JAZA 5HGNA 2NO8A 2JU2A 1M90Q 2FADA 5JPAA 2GZGA 4U0AA 3B4QA 5HGMA 2PEQA 2KOPA 2PEJA 1GPJA 3B5IA 3DS5A 3OW2O 2FQ2A 2PEKA 4PH1A 3G4SP 3CCUP 2VLQA 1A43A 2L6EA 2XT1A 2XZ0D 2KOSA 2MVUA 3P05A 1UNKA 1YJ9P 2GZEA 2KOQA 1BXIA 1YI2P 2KOOA 1YIJP 4DG9A 2L9FA 2VSQA 1D1DA 2OTJP 1DV5A 1RNIA 3VRLC 2K5XA 2K94A 4XFXA 3NY7B 1K9MQ 4U0EA 3DS4A 2M8NA 1K73Q 2KODA 1L0HA 1M6EX 1EOQA 2AFDA 1A8OA 1YHQP 4QKOA 4WYMA 3CCLP 3GZLA 1GXGA 2EFJA 2FHSC 2FAEA 1Z6MA 5KP6B 4NEOA 1YITP 1VKUA 5F2NA 2EHTA 7CEIA 2PENA 5KP7B 1E6JP 1Q82Q 2VLOA 2AVAA 2JBGA 1VQ4P 1QVFO 2M8LA 2LOLA 2M8PA 3CC4P 5BS1A 2CNRA 4H2XC 2FACA 2Z46A 2FVEA 2EG5A 1L0IA 1S72P 2GDWA 1IMPA 3HZQA 2KG9A 1MZ8A 4H2WC 2KR5A 2L22A 2GDXA 4CA3A
chains in the Genus database with same CATH topology
3EJDA 2JGPA 1HY8A 2LMLA 2N5IA 2XZ0D 3RG2A 4PXHB 2KOSA 2QNWA 2MVUA 2KG8A 2CGQA 2EHSA 2N6YA 2KOQA 2KOOA 2FQ0A 2L0QA 4DG9A 1OR5A 2K0YA 2L9FA 1AF8A 2VSQA 4BPFA 1DV5A 2K2QA 2AF8A 2K93A 2K94A 5CZDB 3NY7B 4BPGA 2MVVA 2X2BA 3LMOA 2PNGA 1L0HA 2FQ1A 4PWVB 2L4BA 2AFEA 2MR7A 2N6ZA 2AFDA 2K0XA 5EJDA 4HKGA 2JU1A 3GZLA 2KGDA 2MR8A 1ACPA 2XZ1C 1F80D 2CG5B 2N50A 2FHSC 2FAEA 2M5RA 5KP6B 4NEOA 1VKUA 2ROQA 2KORA 2DNWA 2EHTA 2LPKA 2KWLA 2K92A 4H2YC 5KP7B 1X3OA 1DNYA 4IZ6A 2AVAA 2FVFA 2LL8A 3EJEA 2GDYA 2MF4A 2FVAA 2N5HA 1KLPA 5HVCA 2KG6A 2KW2A 2KGCA 1HQBA 2KGAA 2MD9A 2N98A 2JU2A 2LOLA 2JQ4A 2FADA 5KP8B 2LIUA 2CNRA 4H2XC 2FACA 4MRTC 2FVEA 4BPHA 1L0IA 2GDWA 1T8KA 4R0MA 2KG9A 2CQ8A 3EJBA 5HV8A 3GZMA 4H2WC 2LTEA 2LKIA 2KR5A 3CE7A 2MY5A 2LIWA 2KOPA 2L22A 1NQ4A 2GDXA 2FQ2A 4CA3A 2KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJD A;  2JGP A;  1HY8 A;  2LML A;  2N5I A;  2XZ0 D;  3RG2 A;  4PXH B;  2KOS A;  2QNW A;  2MVU A;  2KG8 A;  2CGQ A;  2EHS A;  2N6Y A;  2KOQ A;  2KOO A;  2FQ0 A;  2L0Q A;  4DG9 A;  1OR5 A;  2K0Y A;  2L9F A;  1AF8 A;  2VSQ A;  4BPF A;  1DV5 A;  2K2Q A;  2AF8 A;  2K93 A;  2K94 A;  5CZD B;  3NY7 B;  4BPG A;  2MVV A;  2X2B A;  3LMO A;  2PNG A;  1L0H A;  2FQ1 A;  4PWV B;  2L4B A;  2AFE A;  2MR7 A;  2N6Z A;  2AFD A;  2K0X A;  5EJD A;  4HKG A;  2JU1 A;  3GZL A;  2KGD A;  2MR8 A;  1ACP A;  2XZ1 C;  1F80 D;  2CG5 B;  2N50 A;  2FHS C;  2FAE A;  2M5R A;  5KP6 B;  4NEO A;  1VKU A;  2ROQ A;  2KOR A;  2DNW A;  2EHT A;  2LPK A;  2KWL A;  2K92 A;  4H2Y C;  5KP7 B;  1X3O A;  1DNY A;  4IZ6 A;  2AVA A;  2FVF A;  2LL8 A;  3EJE A;  2GDY A;  2MF4 A;  2FVA A;  2N5H A;  1KLP A;  5HVC A;  2KG6 A;  2KW2 A;  2KGC A;  1HQB A;  2KGA A;  2MD9 A;  2N98 A;  2JU2 A;  2LOL A;  2JQ4 A;  2FAD A;  5KP8 B;  2LIU A;  2CNR A;  4H2X C;  2FAC A;  4MRT C;  2FVE A;  4BPH A;  1L0I A;  2GDW A;  1T8K A;  4R0M A;  2KG9 A;  2CQ8 A;  3EJB A;  5HV8 A;  3GZM A;  4H2W C;  2LTE A;  2LKI A;  2KR5 A;  3CE7 A;  2MY5 A;  2LIW A;  2KOP A;  2L22 A;  1NQ4 A;  2GDX A;  2FQ2 A;  4CA3 A;  2KGE A; 
#chains in the Genus database with same CATH topology
 3EJD A;  2LML A;  2JYG A;  1AYI A;  1IUQ A;  3G1G A;  2GZI A;  2N6Y A;  2WPT A;  3CCE P;  3CPW O;  2L0Q A;  4XRQ A;  1OR5 A;  1NJI Q;  1AF8 A;  3MGE A;  2GYK A;  4F37 A;  2K2Q A;  2Z45 A;  5CZD B;  3G1I A;  1M6N A;  3HYB A;  4BPG A;  2MVV A;  1QVG O;  5DCK A;  3LMO A;  3DS2 A;  4M0I A;  4PWV B;  2L4B A;  1E0H A;  1VQN P;  1W2B O;  2QA4 P;  3CMA P;  2OAR A;  2JU1 A;  5F2K A;  2CG5 B;  2N50 A;  2M5R A;  2ROQ A;  2KOR A;  1KD1 Q;  2KWL A;  2K92 A;  1VQL P;  2QEX P;  1DNY A;  4IZ6 A;  4XFY A;  1GXH A;  1M74 A;  2JB0 A;  2LL8 A;  2MF4 A;  2FVA A;  2BUO A;  3CCJ P;  2KG6 A;  2KW2 A;  2KGC A;  4U0F A;  3CCS P;  2KGA A;  2MD9 A;  2N98 A;  3DS0 A;  3CME P;  1VQ6 P;  2LIU A;  3H0D A;  2LF4 A;  3G21 A;  1VQ9 P;  3I56 P;  1VQ8 P;  2PEO A;  4XFZ A;  3EJB A;  3CCQ P;  2LTE A;  2LKI A;  3CE7 A;  1NQ4 A;  2PEM A;  4GR2 A;  2JGP A;  4XRO A;  1HY8 A;  2JO0 A;  3CCR P;  5I4T G;  3WBH A;  2PEI A;  3G0V A;  3RG2 A;  2QNW A;  2KG8 A;  2CGQ A;  2EHS A;  1QRJ A;  2FQ0 A;  3DPH A;  3LRY A;  1Q81 Q;  5HGL A;  1YJW P;  3DS3 A;  2BHV A;  3GJN A;  2K93 A;  1K8A Q;  3DTJ A;  1CEI A;  3CC2 P;  3CCV P;  3Q20 A;  2K0D X;  2PNG A;  4COC A;  3H47 A;  5BS2 A;  2JYL A;  3RG6 C;  2AFE A;  3NTE A;  4HKG A;  1EIA A;  1JJ2 O;  2E1M A;  3CXC O;  1N8R Q;  1ZNV A;  2KGD A;  1RO2 A;  1ACP A;  1VQM P;  2XZ1 C;  1YJN P;  2LPK A;  3CC7 P;  1M1K Q;  3H4E A;  5EW5 E;  1ZMB A;  2FVF A;  1VHN A;  2OTL P;  2ONT A;  5HGO A;  2N5H A;  3GKL C;  1KLP A;  3G29 A;  1RO0 A;  1HQB A;  2P9X A;  2JQ4 A;  4U0C A;  5KP8 B;  2CWO A;  1UJZ A;  4MRT C;  4BPH A;  3G6E P;  1VQO P;  1T8K A;  4R0M A;  2CQ8 A;  2Z44 A;  5HV8 A;  3GZM A;  3G71 P;  2GZJ A;  4IPY A;  4GR6 A;  4U0D A;  2MY5 A;  2LIW A;  1KC8 Q;  1VQ7 P;  2VLN A;  2KGE A;  1Q86 Q;  2XV6 A;  2XXM A;  2N5I A;  1AUM A;  3DS1 A;  4PXH B;  4QNB A;  4COP A;  2K0Y A;  3E2D A;  4BPF A;  3M1M A;  2AF8 A;  1VQP P;  1K30 A;  4U0B A;  5F2O A;  2ERH A;  2X2B A;  1BAJ A;  2FQ1 A;  1KQS O;  2MR7 A;  2N6Z A;  2K0X A;  5EJD A;  2GZF A;  2DGY A;  3U43 A;  3G28 A;  2MR8 A;  2VLP A;  4PH0 A;  1F80 D;  1VQK P;  4UHP B;  2DNW A;  2PY8 A;  1Q7Y Q;  4H2Y C;  1X3O A;  1FR2 A;  1VQ5 P;  3I55 P;  3EJE A;  2GDY A;  3G26 A;  1IMQ A;  5HVC A;  3CD6 P;  1EMV A;  2EIA A;  3CCM P;  2JAZ A;  5HGN A;  2NO8 A;  2JU2 A;  1M90 Q;  2FAD A;  5JPA A;  2GZG A;  4U0A A;  3B4Q A;  5HGM A;  2PEQ A;  2KOP A;  2PEJ A;  1GPJ A;  3B5I A;  3DS5 A;  3OW2 O;  2FQ2 A;  2PEK A;  4PH1 A;  3G4S P;  3CCU P;  2VLQ A;  1A43 A;  2L6E A;  2XT1 A;  2XZ0 D;  2KOS A;  2MVU A;  3P05 A;  1UNK A;  1YJ9 P;  2GZE A;  2KOQ A;  1BXI A;  1YI2 P;  2KOO A;  1YIJ P;  4DG9 A;  2L9F A;  2VSQ A;  1D1D A;  2OTJ P;  1DV5 A;  1RNI A;  3VRL C;  2K5X A;  2K94 A;  4XFX A;  3NY7 B;  1K9M Q;  4U0E A;  3DS4 A;  2M8N A;  1K73 Q;  2KOD A;  1L0H A;  1M6E X;  1EOQ A;  2AFD A;  1A8O A;  1YHQ P;  4QKO A;  4WYM A;  3CCL P;  3GZL A;  1GXG A;  2EFJ A;  2FHS C;  2FAE A;  1Z6M A;  5KP6 B;  4NEO A;  1YIT P;  1VKU A;  5F2N A;  2EHT A;  7CEI A;  2PEN A;  5KP7 B;  1E6J P;  1Q82 Q;  2VLO A;  2AVA A;  2JBG A;  1VQ4 P;  1QVF O;  2M8L A;  2LOL A;  2M8P A;  3CC4 P;  5BS1 A;  2CNR A;  4H2X C;  2FAC A;  2Z46 A;  2FVE A;  2EG5 A;  1L0I A;  1S72 P;  2GDW A;  1IMP A;  3HZQ A;  2KG9 A;  1MZ8 A;  4H2W C;  2KR5 A;  2L22 A;  2GDX A;  4CA3 A; 
#chains in the Genus database with same CATH homology
 3EJD A;  2JGP A;  1HY8 A;  2LML A;  2N5I A;  2XZ0 D;  3RG2 A;  4PXH B;  2KOS A;  2QNW A;  2MVU A;  2KG8 A;  2CGQ A;  2EHS A;  2N6Y A;  2KOQ A;  2KOO A;  2FQ0 A;  2L0Q A;  4DG9 A;  1OR5 A;  2K0Y A;  2L9F A;  1AF8 A;  2VSQ A;  4BPF A;  1DV5 A;  2K2Q A;  2AF8 A;  2K93 A;  2K94 A;  5CZD B;  3NY7 B;  4BPG A;  2MVV A;  2X2B A;  3LMO A;  2PNG A;  1L0H A;  2FQ1 A;  4PWV B;  2L4B A;  2AFE A;  2MR7 A;  2N6Z A;  2AFD A;  2K0X A;  5EJD A;  4HKG A;  2JU1 A;  3GZL A;  2KGD A;  2MR8 A;  1ACP A;  2XZ1 C;  1F80 D;  2CG5 B;  2N50 A;  2FHS C;  2FAE A;  2M5R A;  5KP6 B;  4NEO A;  1VKU A;  2ROQ A;  2KOR A;  2DNW A;  2EHT A;  2LPK A;  2KWL A;  2K92 A;  4H2Y C;  5KP7 B;  1X3O A;  1DNY A;  4IZ6 A;  2AVA A;  2FVF A;  2LL8 A;  3EJE A;  2GDY A;  2MF4 A;  2FVA A;  2N5H A;  1KLP A;  5HVC A;  2KG6 A;  2KW2 A;  2KGC A;  1HQB A;  2KGA A;  2MD9 A;  2N98 A;  2JU2 A;  2LOL A;  2JQ4 A;  2FAD A;  5KP8 B;  2LIU A;  2CNR A;  4H2X C;  2FAC A;  4MRT C;  2FVE A;  4BPH A;  1L0I A;  2GDW A;  1T8K A;  4R0M A;  2KG9 A;  2CQ8 A;  3EJB A;  5HV8 A;  3GZM A;  4H2W C;  2LTE A;  2LKI A;  2KR5 A;  3CE7 A;  2MY5 A;  2LIW A;  2KOP A;  2L22 A;  1NQ4 A;  2GDX A;  2FQ2 A;  4CA3 A;  2KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...