1L0IA

Crystal structure of butyryl-acp i62m mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKMTTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title X-ray Crystallographic Studies on Butyryl-ACP Reveal Flexibility of the Structure around a Putative Acyl Chain Binding Site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1l0iA00
3EJDA 2KOSA 2EHSA 2LMLA 1NQ4A 2MY5A 4BPFA 2L4BA 2FADA 3EJBA 2DNWA 1DV5A 5CZDB 4R0MA 2FQ2A 5HV8A 2MF4A 1HY8A 2KR5A 1KLPA 2N5HA 2CGQA 2QNWA 2L9FA 2LIUA 4CA3A 3EJEA 1T8KA 2LKIA 2LL8A 1F80D 1VKUA 5KP8B 2MVVA 2N6YA 2M5RA 2JU1A 2N5IA 2PNGA 2K0YA 2AF8A 2FVEA 4BPHA 2AVAA 2LPKA 2KGEA 3GZLA 2JQ4A 2K94A 2AFDA 2XZ1C 2FVAA 5KP7B 2KWLA 2FVFA 3NY7B 2N98A 1L0HA 2AFEA 3CE7A 2KGDA 2LIWA 1AF8A 4H2YC 3GZMA 2K93A 2KOQA 2N50A 2FQ1A 4H2XC 2KG8A 3LMOA 2JGPA 2KG9A 1X3OA 2GDXA 2EHTA 1OR5A 2CQ8A 2FHSC 2FACA 1DNYA 2KG6A 2XZ0D 2GDWA 2CNRA 2LOLA 2L22A 2FQ0A 4PXHB 2CG5B 2KW2A 4MRTC 2ROQA 1HQBA 2KGAA 2GDYA 2LTEA 2FAEA 5EJDA 4BPGA 2K0XA 1ACPA 2MR8A 2JU2A 2K2QA 4PWVB 2N6ZA 2VSQA 5HVCA 2K92A 2X2BA 4H2WC 2KOPA 4HKGA 2MVUA 4IZ6A 4DG9A 2MD9A 2KOOA 4NEOA 1L0IA 2KGCA 2MR7A 2KORA 3RG2A 2L0QA 5KP6B
chains in the Genus database with same CATH superfamily
2E1MA 5BS2A 5HGOA 3CCEP 1YHQP 5F2NA 1K73Q 2EIAA 4U0AA 1YJWP 2LIUA 1T8KA 1UJZA 5KP8B 2QA4P 1VQ6P 3G1IA 2PY8A 2K0YA 2AF8A 2OTJP 2FVEA 2BHVA 1QVFO 2PEJA 1VQLP 2KGEA 3G1GA 2ERHA 2JYGA 2XZ1C 5KP7B 2FVFA 3DS1A 2ONTA 3CC4P 1AUMA 2JAZA 3DS5A 5BS1A 4IPYA 2PENA 2K93A 1MZ8A 3P05A 3B4QA 3CCMP 4U0FA 2FQ1A 1M90Q 1UNKA 4U0DA 3CCSP 1OR5A 1Q86Q 1DNYA 2KG6A 3GKLC 2L22A 4U0EA 4XFZA 4QNBA 2GYKA 4PH0A 1ZMBA 5HGMA 3CCJP 2KGAA 2GDYA 4XFXA 3CCVP 2GZEA 2MR8A 1ZNVA 5DCKA 2PEKA 4PH1A 4PWVB 4HKGA 1IUQA 1Q82Q 4UHPB 3H0DA 4IZ6A 3DPHA 2PEMA 3M1MA 4XFYA 2KOSA 1VQ4P 1NQ4A 5F2KA 2MY5A 1GXGA 3RG6C 2PEIA 2KODA 3EJBA 2NO8A 2PEQA 1DV5A 2M8LA 5CZDB 4R0MA 5HGNA 3G6EP 2KR5A 2N5HA 4CA3A 3EJEA 2LKIA 2Z46A 2N6YA 2VLOA 4GR2A 3G71P 2AVAA 2LPKA 3G21A 1VQPP 2N98A 1Z6MA 1FR2A 2AFEA 1AF8A 3G0VA 3CD6P 1A43A 1IMQA 2N50A 4H2XC 1BAJA 2KG9A 2GDXA 4COCA 1YJ9P 2CQ8A 2FHSC 1VHNA 1QVGO 2GDWA 2FQ0A 4PXHB 1GXHA 1D1DA 1YIJP 2LF4A 5F2OA 2XV6A 2GZJA 1Q81Q 5EJDA 3VRLC 3CCUP 1E0HA 2GZGA 4COPA 5EW5E 2VSQA 2JYLA 4H2WC 2XXMA 2Z45A 3HYBA 1Q7YQ 2MD9A 4NEOA 2PEOA 2DGYA 1L0IA 2L0QA 5KP6B 3EJDA 3Q20A 2LMLA 3DS4A 2L4BA 4WYMA 2FADA 2DNWA 4GR6A 5HV8A 1HY8A 2MF4A 1KLPA 2CGQA 5I4TG 2QNWA 2LL8A 1M74A 2OTLP 2M5RA 2N5IA 1M1KQ 1VQ7P 4BPHA 1M6EX 3GZLA 2K94A 1RO2A 3CMEP 1NJIQ 2KWLA 3NY7B 1K30A 2QEXP 3DS3A 3CE7A 2KGDA 2LIWA 3CPWO 3DS0A 1RNIA 3GZMA 1BXIA 1JJ2O 2JO0A 3B5IA 3LMOA 3GJNA 1X3OA 3NTEA 2EHTA 2FACA 3LRYA 1AYIA 2CNRA 2K0DX 2GZIA 1YITP 2CG5B 4MRTC 3U43A 1HQBA 2LTEA 2FAEA 3WBHA 2K0XA 3DTJA 1KQSO 1ACPA 3CCRP 2K2QA 3E2DA 2K92A 3G4SP 1IMPA 4M0IA 1YI2P 3MGEA 2KGCA 2KORA 2M8PA 1YJNP 3I55P 3RG2A 1M6NA 1KC8Q 1VQ5P 2EHSA 7CEIA 1KD1Q 3I56P 4BPFA 2JBGA 2VLPA 3G28A 2L6EA 2FQ2A 1N8RQ 1K9MQ 2BUOA 2L9FA 1EIAA 1W2BO 3CCQP 1F80D 1VKUA 2MVVA 1VQNP 2JU1A 2PNGA 4QKOA 2P9XA 4U0CA 2CWOA 1RO0A 2M8NA 2JQ4A 2AFDA 2OARA 2FVAA 1S72P 2WPTA 2Z44A 3CMAP 2GZFA 3HZQA 1L0HA 2JB0A 4F37A 3H47A 5HGLA 4XROA 3CCLP 4H2YC 1A8OA 3OW2O 3CXCO 2KOQA 1VQMP 2KG8A 1VQOP 2JGPA 2XZ0D 1QRJA 2LOLA 2XT1A 1EMVA 3H4EA 1CEIA 2KW2A 1VQKP 5JPAA 3DS2A 2ROQA 1VQ9P 1GPJA 4BPGA 2VLNA 1EOQA 4XRQA 3CC2P 3G29A 2JU2A 2N6ZA 1VQ8P 4U0BA 5HVCA 2X2BA 2KOPA 1K8AQ 2MVUA 1E6JP 4DG9A 2KOOA 3G26A 2VLQA 2MR7A 2K5XA 2EFJA 3CC7P 2EG5A
chains in the Genus database with same CATH topology
3EJDA 2KOSA 2EHSA 2LMLA 1NQ4A 2MY5A 4BPFA 2L4BA 2FADA 3EJBA 2DNWA 1DV5A 5CZDB 4R0MA 2FQ2A 5HV8A 2MF4A 1HY8A 2KR5A 1KLPA 2N5HA 2CGQA 2QNWA 2L9FA 2LIUA 4CA3A 3EJEA 1T8KA 2LKIA 2LL8A 1F80D 1VKUA 5KP8B 2MVVA 2N6YA 2M5RA 2JU1A 2N5IA 2PNGA 2K0YA 2AF8A 2FVEA 4BPHA 2AVAA 2LPKA 2KGEA 3GZLA 2JQ4A 2K94A 2AFDA 2XZ1C 2FVAA 5KP7B 2KWLA 2FVFA 3NY7B 2N98A 1L0HA 2AFEA 3CE7A 2KGDA 2LIWA 1AF8A 4H2YC 3GZMA 2K93A 2KOQA 2N50A 2FQ1A 4H2XC 2KG8A 3LMOA 2JGPA 2KG9A 1X3OA 2GDXA 2EHTA 1OR5A 2CQ8A 2FHSC 2FACA 1DNYA 2KG6A 2XZ0D 2GDWA 2CNRA 2LOLA 2L22A 2FQ0A 4PXHB 2CG5B 2KW2A 4MRTC 2ROQA 1HQBA 2KGAA 2GDYA 2LTEA 2FAEA 5EJDA 4BPGA 2K0XA 1ACPA 2MR8A 2JU2A 2K2QA 4PWVB 2N6ZA 2VSQA 5HVCA 2K92A 2X2BA 4H2WC 2KOPA 4HKGA 2MVUA 4IZ6A 4DG9A 2MD9A 2KOOA 4NEOA 1L0IA 2KGCA 2MR7A 2KORA 3RG2A 2L0QA 5KP6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJD A;  2KOS A;  2EHS A;  2LML A;  1NQ4 A;  2MY5 A;  4BPF A;  2L4B A;  2FAD A;  3EJB A;  2DNW A;  1DV5 A;  5CZD B;  4R0M A;  2FQ2 A;  5HV8 A;  2MF4 A;  1HY8 A;  2KR5 A;  1KLP A;  2N5H A;  2CGQ A;  2QNW A;  2L9F A;  2LIU A;  4CA3 A;  3EJE A;  1T8K A;  2LKI A;  2LL8 A;  1F80 D;  1VKU A;  5KP8 B;  2MVV A;  2N6Y A;  2M5R A;  2JU1 A;  2N5I A;  2PNG A;  2K0Y A;  2AF8 A;  2FVE A;  4BPH A;  2AVA A;  2LPK A;  2KGE A;  3GZL A;  2JQ4 A;  2K94 A;  2AFD A;  2XZ1 C;  2FVA A;  5KP7 B;  2KWL A;  2FVF A;  3NY7 B;  2N98 A;  1L0H A;  2AFE A;  3CE7 A;  2KGD A;  2LIW A;  1AF8 A;  4H2Y C;  3GZM A;  2K93 A;  2KOQ A;  2N50 A;  2FQ1 A;  4H2X C;  2KG8 A;  3LMO A;  2JGP A;  2KG9 A;  1X3O A;  2GDX A;  2EHT A;  1OR5 A;  2CQ8 A;  2FHS C;  2FAC A;  1DNY A;  2KG6 A;  2XZ0 D;  2GDW A;  2CNR A;  2LOL A;  2L22 A;  2FQ0 A;  4PXH B;  2CG5 B;  2KW2 A;  4MRT C;  2ROQ A;  1HQB A;  2KGA A;  2GDY A;  2LTE A;  2FAE A;  5EJD A;  4BPG A;  2K0X A;  1ACP A;  2MR8 A;  2JU2 A;  2K2Q A;  4PWV B;  2N6Z A;  2VSQ A;  5HVC A;  2K92 A;  2X2B A;  4H2W C;  2KOP A;  4HKG A;  2MVU A;  4IZ6 A;  4DG9 A;  2MD9 A;  2KOO A;  4NEO A;  1L0I A;  2KGC A;  2MR7 A;  2KOR A;  3RG2 A;  2L0Q A;  5KP6 B; 
#chains in the Genus database with same CATH topology
 2E1M A;  5BS2 A;  5HGO A;  3CCE P;  1YHQ P;  5F2N A;  1K73 Q;  2EIA A;  4U0A A;  1YJW P;  2LIU A;  1T8K A;  1UJZ A;  5KP8 B;  2QA4 P;  1VQ6 P;  3G1I A;  2PY8 A;  2K0Y A;  2AF8 A;  2OTJ P;  2FVE A;  2BHV A;  1QVF O;  2PEJ A;  1VQL P;  2KGE A;  3G1G A;  2ERH A;  2JYG A;  2XZ1 C;  5KP7 B;  2FVF A;  3DS1 A;  2ONT A;  3CC4 P;  1AUM A;  2JAZ A;  3DS5 A;  5BS1 A;  4IPY A;  2PEN A;  2K93 A;  1MZ8 A;  3P05 A;  3B4Q A;  3CCM P;  4U0F A;  2FQ1 A;  1M90 Q;  1UNK A;  4U0D A;  3CCS P;  1OR5 A;  1Q86 Q;  1DNY A;  2KG6 A;  3GKL C;  2L22 A;  4U0E A;  4XFZ A;  4QNB A;  2GYK A;  4PH0 A;  1ZMB A;  5HGM A;  3CCJ P;  2KGA A;  2GDY A;  4XFX A;  3CCV P;  2GZE A;  2MR8 A;  1ZNV A;  5DCK A;  2PEK A;  4PH1 A;  4PWV B;  4HKG A;  1IUQ A;  1Q82 Q;  4UHP B;  3H0D A;  4IZ6 A;  3DPH A;  2PEM A;  3M1M A;  4XFY A;  2KOS A;  1VQ4 P;  1NQ4 A;  5F2K A;  2MY5 A;  1GXG A;  3RG6 C;  2PEI A;  2KOD A;  3EJB A;  2NO8 A;  2PEQ A;  1DV5 A;  2M8L A;  5CZD B;  4R0M A;  5HGN A;  3G6E P;  2KR5 A;  2N5H A;  4CA3 A;  3EJE A;  2LKI A;  2Z46 A;  2N6Y A;  2VLO A;  4GR2 A;  3G71 P;  2AVA A;  2LPK A;  3G21 A;  1VQP P;  2N98 A;  1Z6M A;  1FR2 A;  2AFE A;  1AF8 A;  3G0V A;  3CD6 P;  1A43 A;  1IMQ A;  2N50 A;  4H2X C;  1BAJ A;  2KG9 A;  2GDX A;  4COC A;  1YJ9 P;  2CQ8 A;  2FHS C;  1VHN A;  1QVG O;  2GDW A;  2FQ0 A;  4PXH B;  1GXH A;  1D1D A;  1YIJ P;  2LF4 A;  5F2O A;  2XV6 A;  2GZJ A;  1Q81 Q;  5EJD A;  3VRL C;  3CCU P;  1E0H A;  2GZG A;  4COP A;  5EW5 E;  2VSQ A;  2JYL A;  4H2W C;  2XXM A;  2Z45 A;  3HYB A;  1Q7Y Q;  2MD9 A;  4NEO A;  2PEO A;  2DGY A;  1L0I A;  2L0Q A;  5KP6 B;  3EJD A;  3Q20 A;  2LML A;  3DS4 A;  2L4B A;  4WYM A;  2FAD A;  2DNW A;  4GR6 A;  5HV8 A;  1HY8 A;  2MF4 A;  1KLP A;  2CGQ A;  5I4T G;  2QNW A;  2LL8 A;  1M74 A;  2OTL P;  2M5R A;  2N5I A;  1M1K Q;  1VQ7 P;  4BPH A;  1M6E X;  3GZL A;  2K94 A;  1RO2 A;  3CME P;  1NJI Q;  2KWL A;  3NY7 B;  1K30 A;  2QEX P;  3DS3 A;  3CE7 A;  2KGD A;  2LIW A;  3CPW O;  3DS0 A;  1RNI A;  3GZM A;  1BXI A;  1JJ2 O;  2JO0 A;  3B5I A;  3LMO A;  3GJN A;  1X3O A;  3NTE A;  2EHT A;  2FAC A;  3LRY A;  1AYI A;  2CNR A;  2K0D X;  2GZI A;  1YIT P;  2CG5 B;  4MRT C;  3U43 A;  1HQB A;  2LTE A;  2FAE A;  3WBH A;  2K0X A;  3DTJ A;  1KQS O;  1ACP A;  3CCR P;  2K2Q A;  3E2D A;  2K92 A;  3G4S P;  1IMP A;  4M0I A;  1YI2 P;  3MGE A;  2KGC A;  2KOR A;  2M8P A;  1YJN P;  3I55 P;  3RG2 A;  1M6N A;  1KC8 Q;  1VQ5 P;  2EHS A;  7CEI A;  1KD1 Q;  3I56 P;  4BPF A;  2JBG A;  2VLP A;  3G28 A;  2L6E A;  2FQ2 A;  1N8R Q;  1K9M Q;  2BUO A;  2L9F A;  1EIA A;  1W2B O;  3CCQ P;  1F80 D;  1VKU A;  2MVV A;  1VQN P;  2JU1 A;  2PNG A;  4QKO A;  2P9X A;  4U0C A;  2CWO A;  1RO0 A;  2M8N A;  2JQ4 A;  2AFD A;  2OAR A;  2FVA A;  1S72 P;  2WPT A;  2Z44 A;  3CMA P;  2GZF A;  3HZQ A;  1L0H A;  2JB0 A;  4F37 A;  3H47 A;  5HGL A;  4XRO A;  3CCL P;  4H2Y C;  1A8O A;  3OW2 O;  3CXC O;  2KOQ A;  1VQM P;  2KG8 A;  1VQO P;  2JGP A;  2XZ0 D;  1QRJ A;  2LOL A;  2XT1 A;  1EMV A;  3H4E A;  1CEI A;  2KW2 A;  1VQK P;  5JPA A;  3DS2 A;  2ROQ A;  1VQ9 P;  1GPJ A;  4BPG A;  2VLN A;  1EOQ A;  4XRQ A;  3CC2 P;  3G29 A;  2JU2 A;  2N6Z A;  1VQ8 P;  4U0B A;  5HVC A;  2X2B A;  2KOP A;  1K8A Q;  2MVU A;  1E6J P;  4DG9 A;  2KOO A;  3G26 A;  2VLQ A;  2MR7 A;  2K5X A;  2EFJ A;  3CC7 P;  2EG5 A; 
#chains in the Genus database with same CATH homology
 3EJD A;  2KOS A;  2EHS A;  2LML A;  1NQ4 A;  2MY5 A;  4BPF A;  2L4B A;  2FAD A;  3EJB A;  2DNW A;  1DV5 A;  5CZD B;  4R0M A;  2FQ2 A;  5HV8 A;  2MF4 A;  1HY8 A;  2KR5 A;  1KLP A;  2N5H A;  2CGQ A;  2QNW A;  2L9F A;  2LIU A;  4CA3 A;  3EJE A;  1T8K A;  2LKI A;  2LL8 A;  1F80 D;  1VKU A;  5KP8 B;  2MVV A;  2N6Y A;  2M5R A;  2JU1 A;  2N5I A;  2PNG A;  2K0Y A;  2AF8 A;  2FVE A;  4BPH A;  2AVA A;  2LPK A;  2KGE A;  3GZL A;  2JQ4 A;  2K94 A;  2AFD A;  2XZ1 C;  2FVA A;  5KP7 B;  2KWL A;  2FVF A;  3NY7 B;  2N98 A;  1L0H A;  2AFE A;  3CE7 A;  2KGD A;  2LIW A;  1AF8 A;  4H2Y C;  3GZM A;  2K93 A;  2KOQ A;  2N50 A;  2FQ1 A;  4H2X C;  2KG8 A;  3LMO A;  2JGP A;  2KG9 A;  1X3O A;  2GDX A;  2EHT A;  1OR5 A;  2CQ8 A;  2FHS C;  2FAC A;  1DNY A;  2KG6 A;  2XZ0 D;  2GDW A;  2CNR A;  2LOL A;  2L22 A;  2FQ0 A;  4PXH B;  2CG5 B;  2KW2 A;  4MRT C;  2ROQ A;  1HQB A;  2KGA A;  2GDY A;  2LTE A;  2FAE A;  5EJD A;  4BPG A;  2K0X A;  1ACP A;  2MR8 A;  2JU2 A;  2K2Q A;  4PWV B;  2N6Z A;  2VSQ A;  5HVC A;  2K92 A;  2X2B A;  4H2W C;  2KOP A;  4HKG A;  2MVU A;  4IZ6 A;  4DG9 A;  2MD9 A;  2KOO A;  4NEO A;  1L0I A;  2KGC A;  2MR7 A;  2KOR A;  3RG2 A;  2L0Q A;  5KP6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...