1L0NE

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 33
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0nE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0nE02
1KYOE 2HMNA 2A06E 4NBHD 4NB9D 4QUPA 2QPZA 1ULIA 2BCCE 2DE7D 2E4QA 5AEWA 1EZVE 3EN1A 1VM9A 1NU1E 3D89A 1O7WA 2XSOA 2DE6D 2NUMA 3DQYA 3VMHD 2YFLA 5KKZC 4NBGD 5CXMA 2HMOA 3GL2A 2JO6A 4NBFD 4QCKA 2QJYC 3CXHE 1NTKE 2CKFA 2HMJA 2XRXA 1NTME 1KB9E 3H1JE 2HMKA 5AEUA 1O7NA 4AIVA 5KLVE 4PD4E 4HM6A 3L71E 4HM4A 2I7FA 3H1KE 3GTEA 4NBBD 1O7GA 1WQLA 4QUQA 4QURA 4HM0A 4HM1A 4P1BH 4NB8D 2QJKC 2ZT9D 1O7PA 3GB4A 3VCAA 1L0LE 3BCCE 5KLIC 4NBDD 3L72E 2HMLA 1SQPE 2YFIA 4HKVA 4QDFB 2E75D 4QDCA 3GOBA 3VCPA 2NUKA 1ULJA 3VMGD 1NDOA 3L73E 4PV1D 4HM7A 3L75E 3GL0A 3L74E 4HM5A 4U3FE 3AZCA 4AAYB 3L70E 1BGYE 2QJPC 3GTSA 3GCEA 1VF5D 1SQBE 2GBXA 2FYNC 4OGQD 2JZAA 3TGUE 3C0DA 2FYUE 4QDDA 1SJGA 1VCKA 4NBED 2E4PA 3CX5E 1PPJE 2E76D 1NTZE 4H13D 1O7MA 1NYKA 2XR8A 1G8JB 3VMID 2YFJA 1Q90C 1EG9A 1ZRTE 3H1IE 1BE3E 3GZYA 1P84E 3FOUA 1BCCE 1G8KB 1SQQE 4H0LD 1UUVA 5HL4A 1FQTA 1RIEA 2BMOA 2NVEA 2NWFA 2ZYLA 4HJLA 4P1CH 4EMJB 1SQVE 4D6TE 2HMMA 2NVFA 3GZXA 2Q3WA 1O7HA 2E74D 3EQQA 2B1XA 2BMQA 2XSHA 3H1HE 4HM3A 2BMRA 3GKEA 2B24A 2YIUC 4QDFA 5BOKA 4HM8A 2DE5D 1PP9E 4H44D 1L0NE 2IBZE 1SQXE 3H1LE 4HM2A 3N0QA 2D2CD 2NVGA 4NBCD 1UUWA 3CWBE 1RFSA 2GBWA 2YVJB 4NBAD 1JM1A
chains in the Genus database with same CATH superfamily
2QM7A 1PPJG 4CPGA 2WT7A 1J1DB 1DD4A 3B5NA 3MGNA 1NHLA 2BCCE 2PFXA 5APWA 5AW3B 1AVYA 4Y99B 3VMHD 3L74J 1U7JA 1FZCC 1P84D 1EZVD 1L0LD 1KB9E 1GW3A 2A06D 5KLVE 3RK2C 4HM6A 1GK4A 1EZVG 1ZR2A 4QURA 5CCGA 2SPZA 4ZMDA 2Y9ZA 2KIKA 2QJKC 1LTJA 3RK3D 4RKUJ 2LKMA 2V4HA 3RK2D 1PFIA 1K05A 3L74E 5K5GB 1SQXG 2I1KA 2KI7B 2W6BA 3H6PA 1Y8AA 1EDKA 5KLVG 3V2QA 5AVTB 1FE6A 1YIJP 5KLVJ 4NPDA 2KB7P 3H1HD 4H44C 2O01H 1L0LK 3VMID 2O1JA 4H13C 1IFIA 1G8KB 3RL0B 2QJYB 1K04A 5GTIH 3GZXA 2KUBA 2XDJA 2KP8A 2YKPA 1SQPD 2Z4EA 4H44D 2J59M 4I7ZB 2Q7CA 4N3YB 1S3JA 1FBMA 3LIEA 3NFQA 3WUUA 3AE7C 2XV5A 1YQ3C 2ZAEB 1HJBA 1N73C 1NU1E 4H13B 2ZYGA 2FYZA 3GF7A 1H89A 3PHLA 1RE4A 4LC1A 3BCCD 2HFED 2WZ7A 2KZJA 2W6AA 2HMKA 4W80A 3L70J 2H7HA 3B5NC 4N78D 3PP5A 3HE4B 3AE9C 2N1TA 2FY8A 2QJPB 1NTZD 5APTA 2QEXP 1VF5C 2WSCJ 1O7PA 2XKMA 5E79H 4JPZB 2HMLA 3AEDC 4HYTB 5APUA 1J1DC 1JMBA 2FXOA 4IL6H 1LTTC 1QVFO 3L70E 1BGYE 3RK3B 3A0HE 5CCGC 2N1TD 1YJ9P 1GD2E 1SFCB 1CW5A 4I1LA 3UIAA 2J5UA 2E75C 2YIUB 1FZAA 5AW2B 1G1IA 2XR8A 3GG2A 3HD7D 5BVZA 3K5BA 1Q90C 3U1CA 2FYUK 3H1IE 3GF3A 3Q3DA 3CMEP 1UUVA 2E74C 1SFCD 2N9BA 3OJAB 2E5TA 1IJDB 4N78E 2M8RA 2BMRA 1N7SC 2OYIC 1L0NG 1EC5A 2AEFA 1KILB 3TYYA 1L0NJ 2FFDA 3JCUH 2A06E 1HJ0A 1H0TA 3RBZA 3L37A 1YI2P 3II6A 2M0BA 3MZWB 2C0WA 1SQXK 2NPSA 2IFMA 5AVRB 2UWJE 3AEBC 3P32A 1SQBK 4DOJA 1N73A 3NTNA 4AQRD 1OVUA 4HM0A 2ZT9D 2K3RA 4NPFX 2B87A 2W8ZA 2OARA 1RF1B 3V4QA 3V4WA 1JY2N 2QA4P 1OIPA 4DJGA 2CPBA 1JY2O 3L4FA 3GHGA 5CMZA 1FOSE 1VCKA 2E75B 3CCQP 2WSEH 1K73Q 1S5LE 3LIDA 1LT9A 2R44A 1JCDA 2IYOA 1KD1Q 1N8RQ 2PGDA 3L75G 4D6TD 1SQQE 2Q3IA 2BMOA 1OWAA 3LW5H 4P1CH 3CPWO 1KQFB 1OVVA 2R32A 2BMQA 1JTHB 2R5DA 1BGYJ 2OYHB 2M5AB 1CZQA 2OGUA 3TGUD 2D2CD 4KT0J 5CJ4A 1NKNA 1KYOE 3M0DC 2YNYA 2W83C 2YKOA 2OYIA 3H1KJ 3MUDC 2FFDB 2BASA 1KILA 4PJ0E 1PP9J 5C39A 1DEEG 2L91A 5AVYB 4TLFA 3HE5A 1FJKA 3HD7A 1LWUB 2O01N 5CJ0A 1WQLA 2WITA 1NJIQ 4KJMA 1SQBG 5GTIE 1LTAC 1AV1A 3CCLP 4OGQB 3M91A 1M90Q 2K88A 2XNXA 5BU5A 2YFIA 1URQA 3KXDA 2ZVOB 1RY3A 4A7PA 3BASA 4DZOA 2OYIB 1VQ6P 2L5GB 3L71D 1NAYA 2B9BA 2KLUA 2JZAA 2O1KA 3C0DA 1LP1A 4DCKA 2OYHA 1M7LA 1N7SA 3H1LG 4H13D 3RBXA 1OXZA 2P2UA 3CWBG 2NPSD 1EG9A 1JCCA 3FXEA 1W2BO 4IL6E 3A0HH 3MD0A 4D6TE 5AVVB 1AQTA 3E7KA 4HM3A 3P7KA 5KAFH 5APYA 5E79E 2IBZE 2QE7H 3KZIE 1LTBC 4HM2A 1E79H 2C9NY 3LW5J 1Z56A 1FDMA 3MIWA 2FYUE 4GT1A 1ZP0C 1GDTA 3CC4P 1MZ9A 1W2EA 2XSOA 1X9VA 2H89C 2KOGA 1GU5A 4ASWA 2K9JA 1QX8A 1KQGB 3CXHE 2P1JA 1USDA 4EIJA 3AE1C 1N73B 1E5WA 4L76A 3HD7B 2KLVA 2V7QJ 3TF5A 2BEQD 3HE5B 1M8OB 3JC22 1KB9I 3AEEC 3VCAA 4D6TG 2M3EA 3AEFC 3M0AA 4QDFB 2JWAA 1EDIA 2WPSA 2WSEJ 3SFDC 3L75E 2O3JA 1PGPA 3QH9A 1JOCA 3AE8C 3A0BE 1VF5D 1SQBE 2K9YA 2GBXA 2H8PD 2Y0DA 2H43A 3CCUP 2OTLP 2AEJA 1ZXGA 4HJGH 1URQC 3H1KG 2KS1B 1S4XA 1FC2C 1AJYA 4N6JA 1U7MA 1T2KD 5HL4A 3S9OA 1JY2P 1SFCC 1QEXA 2XZRA 4GDOA 2WWWA 3H1HE 1QL1A 3MHVA 1X0TA 2FXMA 5DJUB 2G3AA 2FYUJ 2OTKE 4NBCD 2FYNB 3Q1MA 2O01J 3S4RA 4ZKUA 2DE7D 1EZVE 2CPSA 2WSCH 1M56D 4NBFD 3H1ID 1NTKE 2WPVB 5CCHD 3CXHD 1KMIZ 4C7NB 1VL2A 3E1RA 1LTJC 4AIVA 1Q82Q 3BRTB 2HODA 3AE3C 3HE4A 4NBBD 1LT9C 2ZT9C 3E1IA 2JDIH 4P1BH 1H88A 1LTIC 1LP1B 2OYOA 1L0LE 1HTLC 2HG5D 1R5SA 3N4XA 2LR2A 1NTMK 2NUKA 1H0TB 1YTZI 1NDOA 5KAFE 1OW8A 3FXDA 2R5BA 1P84I 2K1AA 2E5YA 4O9BA 1NTMJ 1KILC 2JP3A 4XA4A 3BATA 5KLIB 2ZXEB 1M1KQ 1RF0A 4PV1C 1NTZJ 1W5CE 3HD7C 3TSIA 1NTKJ 3FOUA 1BSNA 4KHXA 1G2CB 1SQQG 2C9LY 3CLQA 3O6QA 3WUTA 4WVZA 2WTYA 2KSEA 3C8VA 3C9IA 2W90A 2YIUC 1YITP 3D6YA 3BCCG 3RK2B 3T97B 1XTCC 1Q86Q 5CBOA 4JYCA 3I56P 1TU3F 3GL2A 1MUUA 3KDPB 3BRVB 2CKFA 2HMJA 1IK9A 1LTGC 1LTJB 2QRXA 1O7NA 3CCMP 2R3CA 4HM4A 4WB4A 3QWOC 3JSVC 1AQ5A 4HM1A 3HTKA 2KYVA 3W67A 1R5LA 4RESB 2DW3A 2I8DA 1OVRA 1FS0E 1AFOA 5CBNA 1UIXA 1NVOA 1NTKK 3H1IG 4WY4C 1BSHA 4U3FE 4AAYB 2QJKB 1L0LJ 1NH4A 1QL2A 2B87B 4NBED 3L36A 1HGVA 1PPJE 1DH3A 2YKQA 1NTZE 1Y9BA 1VQNP 3AECC 2FFDC 3NXSA 1RIEA 1FDIA 3VP9A 1IFDA 5M1BA 1FZGA 3IN6A 1UIIA 1KQLA 1JM0A 3VYIA 1O7HA 1ZRTD 3H1LD 3PTZA 2ZYDA 1ZW0A 4TT3H 1GZLA 3L71J 2DE5D 1BGYG 1SP4A 1RFSA 4H0LB 3S1KA 1VQ7P 2GUSA 3FGAD 4QUPA 5AW5B 2AXCA 3DQYA 4UB6E 4JYBA 1SQQD 3P8CE 3VP8A 1LT1A 1SVFA 5H2FH 4IFMA 4U7JA 1OW6A 2B88A 1JEKA 2QSIA 1DD3A 2YXQB 2PRRA 1S9KE 2Z5HA 3P8MC 4PV1B 4WWIA 1PP9D 1IC2A 1BCCG 1GK6A 3H32A 3V5BA 3L72E 5BU8B 4W7ZA 5KJ7D 2BEZF 1ZN5A 4WY4B 1FOSF 1BDCA 2P7JA 3AZCA 3B4SA 3O8ZA 4XFJA 4DT0A 2M3BA 4OGQC 5DJTB 1RHZB 3RK3E 1YBKA 1PZQA 3P8CD 3VMAA 3G9RA 5KJ7A 1GL2C 1KILE 1S2EA 1IO4A 1FQTA 4I6MC 2NWFA 1BCCJ 2JR8A 3H1KD 1YJNP 3M0DA 1S72P 4OVNF 3HRNA 1NYHA 4QDFA 2RN0A 3Q5PA 4M3LA 1N86A 1VQPP 3H1LE 2H88C 1BE3G 1KFMA 1SQPJ 3O6QB 2KXPB 1A02J 2PAJA 1KORA 1VM9A 1NU1G 2IBZD 3CCEP 5CXMA 1PV3A 2Q5UA 1SQXJ 1YYCA 2K9JB 3W68A 2E42A 5AEUA 1IFNA 1RE3A 1NU1D 2NRGA 3G4SP 2I7FA 1YTZT 3B5ND 3Q2YA 1G1JA 3BCCE 4AUWA 5AW7B 3VCPA 1KYOD 1MKMA 3RGUA 3VMGD 4PV1D 1A02F 3RL0C 1LGHB 2FYNC 1NU1K 3M9QA 1JY3P 3SWKA 4BRYB 3CXHI 1G8JB 3T97A 1QLED 1HGZA 3R4YA 4EMJB 4LGDE 3KZIH 2POHA 1FZEA 3L74D 3A5TA 3H1HG 1WRGA 3AE6C 3KPEA 1URQB 1VQMP 1IFJA 2N9YB 1NKZB 1NAFA 2GUVA 1NTZK 3SWYA 5AVUB 1VF5B 2WT7B 1G2CA 1KZUB 4NB9D 3CX5H 2P10A 2LXCB 3L73J 5APSA 2QJYC 3L70G 1NTME 2IBZI 1L4AD 4NPEA 2YMYA 3IAOA 1N7LA 3WU2E 3CCJP 3SWFA 3Q5RA 3H1JD 2RH0A 3L35A 3VMYA 1NTKD 2FYUD 1VQOP 5APQA 4NB8D 3WMM0 1PGOA 4YPCA 1PGQA 5H2FE 4C7RA 1H8AA 4QDCA 3L72J 4UB6H 3L73G 2Y0EA 2QJPC 2JEEA 1JMMA 3I55P 1NOHA 1T3JA 1J2JB 2ZJSE 1SQBD 2JO1A 1NYKA 3GHGB 4L73A 1BE3E 3GZYA 1P84E 5TJHA 2PP6A 3U59A 4GOEA 5CCHA 3TDKA 1SQQJ 1RQVA 3ITKA 3Q5SA 1RF1A 1YQ4C 4Y99C 5L8RJ 1FU1A 1BE3J 3FWLA 1S9KD 2W27A 4NBAD 3VOPA 2XNDH 2QPZA 1Q81Q 3USSA 1KN7A 2KS1A 5AW9B 3HUSA 3GHGC 1N7SB 2NPSB 3L74G 2HYNA 1VQ4P 4GOFA 2NZ2A 1GL2A 1OX3A 3OA7A 1OZHA 1JY3O 1MFTA 3ZDMA 1QVGO 1ZLLA 2ZFCA 1FZCB 3CWBD 5TISH 3GB4A 3CCRP 1LJ2A 3H1JJ 3RK3C 4NBDD 3M9HA 4HKVA 5AVQB 4GIFA 3CMAP 2IYPA 1GL2D 1T3UA 3F5HA 4HM7A 2KNCA 2OYHC 1AA0A 3GTSA 3CC2P 2WPRA 4R4LA 3HUSC 4OGQD 1NO4A 3VTPC 4IOIH 1SJGA 2IX7C 4Y28J 3CX5E 5AVZB 3CXHH 4RJTA 2E76C 4U3FD 3OAKA 1FZCA 3TK1A 5KTBA 4UB8E 2Q3WA 2K37A 1SQVJ 3G71P 1LNQA 5AW1B 3CD6P 2W6JH 1Y47A 2WQYC 5BOKA 1PP9E 1JY3N 3N0QA 2NVGA 1LTSC 2GBWA 3HUSB 2WMMA 4ASVA 1QGKB 2FYUG 2N1TB 2HODB 5AVWB 1LWUC 1DEBA 1ULIA 3RL0g 2HLOA 3GMAA 2OTJP 1LT9B 1HBWA 3V2PA 4U3FJ 2V7QH 2CK3H 1SS1A 1M1JC 4K35A 4GODA 1VQ9P 1ZR4A 4PD4I 1KB9D 1SQVK 3PH0A 1O7GA 1IK7A 3R2PA 4JF7A 1KILD 1WT6A 2A06G 2A45I 4IFFA 3CCVP 4EYYQ 5KKZB 3GOBA 3TNUA 3JCUE 2RMZA 2IZ0A 3M9BA 1LWUA 3GL0A 4EDFA 3A7OA 3D71A 1AVOA 5AW8B 4AYCA 1RE4C 2JJLA 2E4PA 1GMJA 2IZ1A 1O7MA 1URQD 2FKWB 4EI2A 5EFWB 2BCCD 1ZRTE 1FDOA 2C0XA 5KLVD 2HR3A 2ZYLA 2NVEA 4HH2A 2Y0CA 4JBZA 3EQQA 2QM8A 2MJZA 1JTHA 3CX5D 1N7SD 1VQ8P 3SFEC 5KAIE 4PJ0H 4D6TJ 2HMNA 1JNMA 3TNUB 1SQPG 3EN1A 4HB1A 3VMZA 2YFLA 1EDLA 2Q1KA 1P84H 4YXWH 1JB0J 3A2AA 2GM4A 2WSFH 4K3AA 3CC7P 2HPCA 3L71E 2AXTE 1GU4A 4WY4D 1WMKA 1GTWA 3L70D 4OWFA 1X8YA 3B71A 4BRYA 5B66E 3EQ2A 1SQVG 1SQPE 3H1JG 2Q3EA 1RE3C 5AW0B 3N7NA 1KYOH 3IF4A 1X79B 1FJPA 1PIXA 4HM5A 3H1IJ 5CHXA 4H0LC 3TGUJ 3MP7B 2IDBA 3VMXA 4Z1MH 5TISE 3TGUG 3EFGA 2LXBA 1L4AB 3KHUA 4WBAA 4LLHA 2I1JA 2NPSC 1L0NK 2MKVA 3U1AA 5B5EH 1OFCX 2YO3A 4YTPC 2HPCB 4BWNA 1BE3D 1KTMA 1J1EB 3L71G 2Q9IA 3GLMA 2B89A 1DIPA 1SQBJ 3EFFK 3EWKA 1M1JA 2IBZG 2KK7A 1T6AA 4XE5B 3AE4C 1L0LG 4NBHD 1EXJA 1SLQA 3FWNA 2BCCG 1L0ND 4IFDK 3G3ZA 1CSBA 2JO6A 3VN0A 1U57A 1SFCA 2ZYAA 2D2CC 2XRXA 1NTMG 1FZBA 3PLNA 5APVA 1NGMB 4UB8H 4ZNCA 2E76B 4PD4E 1ZOYC 3ABVC 5APXA 1T8ZA 1GL2B 4QUQA 2JWDA 1FAVA 2A45H 2M5AA 4YXDC 3KQGA 2Q6QA 3V2NA 5KLIC 1SQXD 1K8AQ 3A0BH 3L72G 4QMAA 1ULJA 1MV8A 3A3YB 3L73E 2GA1A 3H25A 1HWTC 5GTHE 4L75A 2N1TC 1VQKP 3GCEA 3L72D 4ZKPA 3BCCJ 1VQLP 4QDDA 2E76D 2YFJA 1FZFA 3D6ZA 5AW6B 1S5LX 1BCCE 4W7YA 2P58A 2WSSH 1BDDA 1KB9H 1S5LH 4OH8B 1HF9A 2ZVNB 3C1LA 1VQ5P 2XSHA 1K9MQ 1OW7A 2B24A 4R4MA 2JKVA 2VRSA 1Q2NA 1KQSO 2KSJA 3CI9A 2WSFJ 4HKZH 5KLVK 3D70A 1BCCD 1NU1J 3CCSP 1PL5A 2YXRB 3SSUA 1SQVD 1L2PA 3IR9A 1XTGB 1O7WA 1OMIA 3F89A 3WU2H 1EZVI 4GKGA 1NTKG 1VDFA 2ZT9B 3H1JE 2ZXXA 3G6EP 2AEMA 3GW6A 1IFMA 1RF0C 5AW4B 1IFPA 1PPJD 2FXPA 4BXLA 1EXIA 2E75D 2E43A 1KYOI 5KJ7C 1USEA 5KAIH 2AXTH 2KNCB 1X22A 1ZV8A 1N2DC 2WVRA 3NMDA 2OQQA 3KYQA 1GW4A 4L74A 3AE2C 1SQPK 3V2RA 4B86A 1YJWP 3AEGC 3OW2O 1PGJA 3HTKB 2QIWA 3B5NB 3PJSK 2D2CB 3WUVA 4PD4D 1BGYD 5B66H 5CCGD 3CX5I 2KZIA 3H1HJ 1CI6B 1NTMD 2E74D 2B1XA 3MUDA 3M06A 2YMKA 1HH0A 1L0NE 1Q90D 1EQ7A 5AVSB 1UUWA 3CWBE 1T2KC 1CI6A 3AE5C 1DX7A 2J58A 2RKLA 1EDJA 1VPCA 2E4QA 4EOTA 5AEWA 3I5CA 3D89A 1MFZA 5KKZC 2DE6D 2NUMA 4WY4A 4NBGD 2HMOA 4I2LC 2A45G 1RQUA 4QCKA 1IZNB 1NWQA 3H32B 1PP9G 3L75J 5CCHC 2G8YA 1L4AC 1M57D 1JO5A 1D7MA 5B5EE 2E74B 1YHQP 3H1KE 3GTEA 3CWBJ 1JUNA 3BVHA 2QG4A 1M1JB 2Y9YA 1ZMEC 1J1EC 1RH5B 1RF1C 4PD4H 1HUCA 2BCCJ 4JQ0D 1KFNA 1S1CX 4MN4C 2XU6A 4U3FG 2ITAA 3RL0D 2R3SA 3L75D 3TGUE 3B8EB 3PRJA 4IL6X 1L4AA 1NTZG 2IPPA 2IFNA 2P67A 4H44B 3H1LJ 4H0LD 4HJLA 2YO2A 1SQVE 3AEAC 2HMMA 2NVFA 2WPQA 1KC8Q 3MTUE 3FX0A 3L73D 1KV4A 3V6IA 1Q7YQ 5AVXB 3GKEA 2Z5IA 4C7NA 4HM8A 3IFMA 2FBWC 1HVVA 5GTHH 1SQXE 4RO0A 1SQQK 3CL3D 4I7ZC 2YVJB 1R8EA 2QVAA 4C46A 1JM1A
chains in the Genus database with same CATH topology
1KYOE 2HMNA 2A06E 4NBHD 4NB9D 4QUPA 2QPZA 1ULIA 2BCCE 2DE7D 2E4QA 5AEWA 1EZVE 3EN1A 1VM9A 1NU1E 3D89A 1O7WA 2XSOA 2DE6D 2NUMA 3DQYA 3VMHD 2YFLA 5KKZC 4NBGD 5CXMA 2HMOA 3GL2A 2JO6A 4NBFD 4QCKA 2QJYC 3CXHE 1NTKE 2CKFA 2HMJA 2XRXA 1NTME 1KB9E 3H1JE 2HMKA 5AEUA 1O7NA 4AIVA 5KLVE 4PD4E 4HM6A 3L71E 4HM4A 2I7FA 3H1KE 3GTEA 4NBBD 1O7GA 1WQLA 4QUQA 4QURA 4HM0A 4HM1A 4P1BH 4NB8D 2QJKC 2ZT9D 1O7PA 3GB4A 3VCAA 1L0LE 3BCCE 5KLIC 4NBDD 3L72E 2HMLA 1SQPE 2YFIA 4HKVA 4QDFB 2E75D 4QDCA 3GOBA 3VCPA 2NUKA 1ULJA 3VMGD 1NDOA 3L73E 4PV1D 4HM7A 3L75E 3GL0A 3L74E 4HM5A 4U3FE 3AZCA 4AAYB 3L70E 1BGYE 2QJPC 3GTSA 3GCEA 1VF5D 1SQBE 2GBXA 2FYNC 4OGQD 2JZAA 3TGUE 3C0DA 2FYUE 4QDDA 1SJGA 1VCKA 4NBED 2E4PA 3CX5E 1PPJE 2E76D 1NTZE 4H13D 1O7MA 1NYKA 2XR8A 1G8JB 3VMID 2YFJA 1Q90C 1EG9A 1ZRTE 3H1IE 1BE3E 3GZYA 1P84E 3FOUA 1BCCE 1G8KB 1SQQE 4H0LD 1UUVA 5HL4A 1FQTA 1RIEA 2BMOA 2NVEA 2NWFA 2ZYLA 4HJLA 4P1CH 4EMJB 1SQVE 4D6TE 2HMMA 2NVFA 3GZXA 2Q3WA 1O7HA 2E74D 3EQQA 2B1XA 2BMQA 2XSHA 3H1HE 4HM3A 2BMRA 3GKEA 2B24A 2YIUC 4QDFA 5BOKA 4HM8A 2DE5D 1PP9E 4H44D 1L0NE 2IBZE 1SQXE 3H1LE 4HM2A 3N0QA 2D2CD 2NVGA 4NBCD 1UUWA 3CWBE 1RFSA 2GBWA 2YVJB 4NBAD 1JM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO E;  2HMN A;  2A06 E;  4NBH D;  4NB9 D;  4QUP A;  2QPZ A;  1ULI A;  2BCC E;  2DE7 D;  2E4Q A;  5AEW A;  1EZV E;  3EN1 A;  1VM9 A;  1NU1 E;  3D89 A;  1O7W A;  2XSO A;  2DE6 D;  2NUM A;  3DQY A;  3VMH D;  2YFL A;  5KKZ C;  4NBG D;  5CXM A;  2HMO A;  3GL2 A;  2JO6 A;  4NBF D;  4QCK A;  2QJY C;  3CXH E;  1NTK E;  2CKF A;  2HMJ A;  2XRX A;  1NTM E;  1KB9 E;  3H1J E;  2HMK A;  5AEU A;  1O7N A;  4AIV A;  5KLV E;  4PD4 E;  4HM6 A;  3L71 E;  4HM4 A;  2I7F A;  3H1K E;  3GTE A;  4NBB D;  1O7G A;  1WQL A;  4QUQ A;  4QUR A;  4HM0 A;  4HM1 A;  4P1B H;  4NB8 D;  2QJK C;  2ZT9 D;  1O7P A;  3GB4 A;  3VCA A;  1L0L E;  3BCC E;  5KLI C;  4NBD D;  3L72 E;  2HML A;  1SQP E;  2YFI A;  4HKV A;  4QDF B;  2E75 D;  4QDC A;  3GOB A;  3VCP A;  2NUK A;  1ULJ A;  3VMG D;  1NDO A;  3L73 E;  4PV1 D;  4HM7 A;  3L75 E;  3GL0 A;  3L74 E;  4HM5 A;  4U3F E;  3AZC A;  4AAY B;  3L70 E;  1BGY E;  2QJP C;  3GTS A;  3GCE A;  1VF5 D;  1SQB E;  2GBX A;  2FYN C;  4OGQ D;  2JZA A;  3TGU E;  3C0D A;  2FYU E;  4QDD A;  1SJG A;  1VCK A;  4NBE D;  2E4P A;  3CX5 E;  1PPJ E;  2E76 D;  1NTZ E;  4H13 D;  1O7M A;  1NYK A;  2XR8 A;  1G8J B;  3VMI D;  2YFJ A;  1Q90 C;  1EG9 A;  1ZRT E;  3H1I E;  1BE3 E;  3GZY A;  1P84 E;  3FOU A;  1BCC E;  1G8K B;  1SQQ E;  4H0L D;  1UUV A;  5HL4 A;  1FQT A;  1RIE A;  2BMO A;  2NVE A;  2NWF A;  2ZYL A;  4HJL A;  4P1C H;  4EMJ B;  1SQV E;  4D6T E;  2HMM A;  2NVF A;  3GZX A;  2Q3W A;  1O7H A;  2E74 D;  3EQQ A;  2B1X A;  2BMQ A;  2XSH A;  3H1H E;  4HM3 A;  2BMR A;  3GKE A;  2B24 A;  2YIU C;  4QDF A;  5BOK A;  4HM8 A;  2DE5 D;  1PP9 E;  4H44 D;  1L0N E;  2IBZ E;  1SQX E;  3H1L E;  4HM2 A;  3N0Q A;  2D2C D;  2NVG A;  4NBC D;  1UUW A;  3CWB E;  1RFS A;  2GBW A;  2YVJ B;  4NBA D;  1JM1 A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  1PPJ G;  4CPG A;  2WT7 A;  1J1D B;  1DD4 A;  3B5N A;  3MGN A;  1NHL A;  2BCC E;  2PFX A;  5APW A;  5AW3 B;  1AVY A;  4Y99 B;  3VMH D;  3L74 J;  1U7J A;  1FZC C;  1P84 D;  1EZV D;  1L0L D;  1KB9 E;  1GW3 A;  2A06 D;  5KLV E;  3RK2 C;  4HM6 A;  1GK4 A;  1EZV G;  1ZR2 A;  4QUR A;  5CCG A;  2SPZ A;  4ZMD A;  2Y9Z A;  2KIK A;  2QJK C;  1LTJ A;  3RK3 D;  4RKU J;  2LKM A;  2V4H A;  3RK2 D;  1PFI A;  1K05 A;  3L74 E;  5K5G B;  1SQX G;  2I1K A;  2KI7 B;  2W6B A;  3H6P A;  1Y8A A;  1EDK A;  5KLV G;  3V2Q A;  5AVT B;  1FE6 A;  1YIJ P;  5KLV J;  4NPD A;  2KB7 P;  3H1H D;  4H44 C;  2O01 H;  1L0L K;  3VMI D;  2O1J A;  4H13 C;  1IFI A;  1G8K B;  3RL0 B;  2QJY B;  1K04 A;  5GTI H;  3GZX A;  2KUB A;  2XDJ A;  2KP8 A;  2YKP A;  1SQP D;  2Z4E A;  4H44 D;  2J59 M;  4I7Z B;  2Q7C A;  4N3Y B;  1S3J A;  1FBM A;  3LIE A;  3NFQ A;  3WUU A;  3AE7 C;  2XV5 A;  1YQ3 C;  2ZAE B;  1HJB A;  1N73 C;  1NU1 E;  4H13 B;  2ZYG A;  2FYZ A;  3GF7 A;  1H89 A;  3PHL A;  1RE4 A;  4LC1 A;  3BCC D;  2HFE D;  2WZ7 A;  2KZJ A;  2W6A A;  2HMK A;  4W80 A;  3L70 J;  2H7H A;  3B5N C;  4N78 D;  3PP5 A;  3HE4 B;  3AE9 C;  2N1T A;  2FY8 A;  2QJP B;  1NTZ D;  5APT A;  2QEX P;  1VF5 C;  2WSC J;  1O7P A;  2XKM A;  5E79 H;  4JPZ B;  2HML A;  3AED C;  4HYT B;  5APU A;  1J1D C;  1JMB A;  2FXO A;  4IL6 H;  1LTT C;  1QVF O;  3L70 E;  1BGY E;  3RK3 B;  3A0H E;  5CCG C;  2N1T D;  1YJ9 P;  1GD2 E;  1SFC B;  1CW5 A;  4I1L A;  3UIA A;  2J5U A;  2E75 C;  2YIU B;  1FZA A;  5AW2 B;  1G1I A;  2XR8 A;  3GG2 A;  3HD7 D;  5BVZ A;  3K5B A;  1Q90 C;  3U1C A;  2FYU K;  3H1I E;  3GF3 A;  3Q3D A;  3CME P;  1UUV A;  2E74 C;  1SFC D;  2N9B A;  3OJA B;  2E5T A;  1IJD B;  4N78 E;  2M8R A;  2BMR A;  1N7S C;  2OYI C;  1L0N G;  1EC5 A;  2AEF A;  1KIL B;  3TYY A;  1L0N J;  2FFD A;  3JCU H;  2A06 E;  1HJ0 A;  1H0T A;  3RBZ A;  3L37 A;  1YI2 P;  3II6 A;  2M0B A;  3MZW B;  2C0W A;  1SQX K;  2NPS A;  2IFM A;  5AVR B;  2UWJ E;  3AEB C;  3P32 A;  1SQB K;  4DOJ A;  1N73 A;  3NTN A;  4AQR D;  1OVU A;  4HM0 A;  2ZT9 D;  2K3R A;  4NPF X;  2B87 A;  2W8Z A;  2OAR A;  1RF1 B;  3V4Q A;  3V4W A;  1JY2 N;  2QA4 P;  1OIP A;  4DJG A;  2CPB A;  1JY2 O;  3L4F A;  3GHG A;  5CMZ A;  1FOS E;  1VCK A;  2E75 B;  3CCQ P;  2WSE H;  1K73 Q;  1S5L E;  3LID A;  1LT9 A;  2R44 A;  1JCD A;  2IYO A;  1KD1 Q;  1N8R Q;  2PGD A;  3L75 G;  4D6T D;  1SQQ E;  2Q3I A;  2BMO A;  1OWA A;  3LW5 H;  4P1C H;  3CPW O;  1KQF B;  1OVV A;  2R32 A;  2BMQ A;  1JTH B;  2R5D A;  1BGY J;  2OYH B;  2M5A B;  1CZQ A;  2OGU A;  3TGU D;  2D2C D;  4KT0 J;  5CJ4 A;  1NKN A;  1KYO E;  3M0D C;  2YNY A;  2W83 C;  2YKO A;  2OYI A;  3H1K J;  3MUD C;  2FFD B;  2BAS A;  1KIL A;  4PJ0 E;  1PP9 J;  5C39 A;  1DEE G;  2L91 A;  5AVY B;  4TLF A;  3HE5 A;  1FJK A;  3HD7 A;  1LWU B;  2O01 N;  5CJ0 A;  1WQL A;  2WIT A;  1NJI Q;  4KJM A;  1SQB G;  5GTI E;  1LTA C;  1AV1 A;  3CCL P;  4OGQ B;  3M91 A;  1M90 Q;  2K88 A;  2XNX A;  5BU5 A;  2YFI A;  1URQ A;  3KXD A;  2ZVO B;  1RY3 A;  4A7P A;  3BAS A;  4DZO A;  2OYI B;  1VQ6 P;  2L5G B;  3L71 D;  1NAY A;  2B9B A;  2KLU A;  2JZA A;  2O1K A;  3C0D A;  1LP1 A;  4DCK A;  2OYH A;  1M7L A;  1N7S A;  3H1L G;  4H13 D;  3RBX A;  1OXZ A;  2P2U A;  3CWB G;  2NPS D;  1EG9 A;  1JCC A;  3FXE A;  1W2B O;  4IL6 E;  3A0H H;  3MD0 A;  4D6T E;  5AVV B;  1AQT A;  3E7K A;  4HM3 A;  3P7K A;  5KAF H;  5APY A;  5E79 E;  2IBZ E;  2QE7 H;  3KZI E;  1LTB C;  4HM2 A;  1E79 H;  2C9N Y;  3LW5 J;  1Z56 A;  1FDM A;  3MIW A;  2FYU E;  4GT1 A;  1ZP0 C;  1GDT A;  3CC4 P;  1MZ9 A;  1W2E A;  2XSO A;  1X9V A;  2H89 C;  2KOG A;  1GU5 A;  4ASW A;  2K9J A;  1QX8 A;  1KQG B;  3CXH E;  2P1J A;  1USD A;  4EIJ A;  3AE1 C;  1N73 B;  1E5W A;  4L76 A;  3HD7 B;  2KLV A;  2V7Q J;  3TF5 A;  2BEQ D;  3HE5 B;  1M8O B;  3JC2 2;  1KB9 I;  3AEE C;  3VCA A;  4D6T G;  2M3E A;  3AEF C;  3M0A A;  4QDF B;  2JWA A;  1EDI A;  2WPS A;  2WSE J;  3SFD C;  3L75 E;  2O3J A;  1PGP A;  3QH9 A;  1JOC A;  3AE8 C;  3A0B E;  1VF5 D;  1SQB E;  2K9Y A;  2GBX A;  2H8P D;  2Y0D A;  2H43 A;  3CCU P;  2OTL P;  2AEJ A;  1ZXG A;  4HJG H;  1URQ C;  3H1K G;  2KS1 B;  1S4X A;  1FC2 C;  1AJY A;  4N6J A;  1U7M A;  1T2K D;  5HL4 A;  3S9O A;  1JY2 P;  1SFC C;  1QEX A;  2XZR A;  4GDO A;  2WWW A;  3H1H E;  1QL1 A;  3MHV A;  1X0T A;  2FXM A;  5DJU B;  2G3A A;  2FYU J;  2OTK E;  4NBC D;  2FYN B;  3Q1M A;  2O01 J;  3S4R A;  4ZKU A;  2DE7 D;  1EZV E;  2CPS A;  2WSC H;  1M56 D;  4NBF D;  3H1I D;  1NTK E;  2WPV B;  5CCH D;  3CXH D;  1KMI Z;  4C7N B;  1VL2 A;  3E1R A;  1LTJ C;  4AIV A;  1Q82 Q;  3BRT B;  2HOD A;  3AE3 C;  3HE4 A;  4NBB D;  1LT9 C;  2ZT9 C;  3E1I A;  2JDI H;  4P1B H;  1H88 A;  1LTI C;  1LP1 B;  2OYO A;  1L0L E;  1HTL C;  2HG5 D;  1R5S A;  3N4X A;  2LR2 A;  1NTM K;  2NUK A;  1H0T B;  1YTZ I;  1NDO A;  5KAF E;  1OW8 A;  3FXD A;  2R5B A;  1P84 I;  2K1A A;  2E5Y A;  4O9B A;  1NTM J;  1KIL C;  2JP3 A;  4XA4 A;  3BAT A;  5KLI B;  2ZXE B;  1M1K Q;  1RF0 A;  4PV1 C;  1NTZ J;  1W5C E;  3HD7 C;  3TSI A;  1NTK J;  3FOU A;  1BSN A;  4KHX A;  1G2C B;  1SQQ G;  2C9L Y;  3CLQ A;  3O6Q A;  3WUT A;  4WVZ A;  2WTY A;  2KSE A;  3C8V A;  3C9I A;  2W90 A;  2YIU C;  1YIT P;  3D6Y A;  3BCC G;  3RK2 B;  3T97 B;  1XTC C;  1Q86 Q;  5CBO A;  4JYC A;  3I56 P;  1TU3 F;  3GL2 A;  1MUU A;  3KDP B;  3BRV B;  2CKF A;  2HMJ A;  1IK9 A;  1LTG C;  1LTJ B;  2QRX A;  1O7N A;  3CCM P;  2R3C A;  4HM4 A;  4WB4 A;  3QWO C;  3JSV C;  1AQ5 A;  4HM1 A;  3HTK A;  2KYV A;  3W67 A;  1R5L A;  4RES B;  2DW3 A;  2I8D A;  1OVR A;  1FS0 E;  1AFO A;  5CBN A;  1UIX A;  1NVO A;  1NTK K;  3H1I G;  4WY4 C;  1BSH A;  4U3F E;  4AAY B;  2QJK B;  1L0L J;  1NH4 A;  1QL2 A;  2B87 B;  4NBE D;  3L36 A;  1HGV A;  1PPJ E;  1DH3 A;  2YKQ A;  1NTZ E;  1Y9B A;  1VQN P;  3AEC C;  2FFD C;  3NXS A;  1RIE A;  1FDI A;  3VP9 A;  1IFD A;  5M1B A;  1FZG A;  3IN6 A;  1UII A;  1KQL A;  1JM0 A;  3VYI A;  1O7H A;  1ZRT D;  3H1L D;  3PTZ A;  2ZYD A;  1ZW0 A;  4TT3 H;  1GZL A;  3L71 J;  2DE5 D;  1BGY G;  1SP4 A;  1RFS A;  4H0L B;  3S1K A;  1VQ7 P;  2GUS A;  3FGA D;  4QUP A;  5AW5 B;  2AXC A;  3DQY A;  4UB6 E;  4JYB A;  1SQQ D;  3P8C E;  3VP8 A;  1LT1 A;  1SVF A;  5H2F H;  4IFM A;  4U7J A;  1OW6 A;  2B88 A;  1JEK A;  2QSI A;  1DD3 A;  2YXQ B;  2PRR A;  1S9K E;  2Z5H A;  3P8M C;  4PV1 B;  4WWI A;  1PP9 D;  1IC2 A;  1BCC G;  1GK6 A;  3H32 A;  3V5B A;  3L72 E;  5BU8 B;  4W7Z A;  5KJ7 D;  2BEZ F;  1ZN5 A;  4WY4 B;  1FOS F;  1BDC A;  2P7J A;  3AZC A;  3B4S A;  3O8Z A;  4XFJ A;  4DT0 A;  2M3B A;  4OGQ C;  5DJT B;  1RHZ B;  3RK3 E;  1YBK A;  1PZQ A;  3P8C D;  3VMA A;  3G9R A;  5KJ7 A;  1GL2 C;  1KIL E;  1S2E A;  1IO4 A;  1FQT A;  4I6M C;  2NWF A;  1BCC J;  2JR8 A;  3H1K D;  1YJN P;  3M0D A;  1S72 P;  4OVN F;  3HRN A;  1NYH A;  4QDF A;  2RN0 A;  3Q5P A;  4M3L A;  1N86 A;  1VQP P;  3H1L E;  2H88 C;  1BE3 G;  1KFM A;  1SQP J;  3O6Q B;  2KXP B;  1A02 J;  2PAJ A;  1KOR A;  1VM9 A;  1NU1 G;  2IBZ D;  3CCE P;  5CXM A;  1PV3 A;  2Q5U A;  1SQX J;  1YYC A;  2K9J B;  3W68 A;  2E42 A;  5AEU A;  1IFN A;  1RE3 A;  1NU1 D;  2NRG A;  3G4S P;  2I7F A;  1YTZ T;  3B5N D;  3Q2Y A;  1G1J A;  3BCC E;  4AUW A;  5AW7 B;  3VCP A;  1KYO D;  1MKM A;  3RGU A;  3VMG D;  4PV1 D;  1A02 F;  3RL0 C;  1LGH B;  2FYN C;  1NU1 K;  3M9Q A;  1JY3 P;  3SWK A;  4BRY B;  3CXH I;  1G8J B;  3T97 A;  1QLE D;  1HGZ A;  3R4Y A;  4EMJ B;  4LGD E;  3KZI H;  2POH A;  1FZE A;  3L74 D;  3A5T A;  3H1H G;  1WRG A;  3AE6 C;  3KPE A;  1URQ B;  1VQM P;  1IFJ A;  2N9Y B;  1NKZ B;  1NAF A;  2GUV A;  1NTZ K;  3SWY A;  5AVU B;  1VF5 B;  2WT7 B;  1G2C A;  1KZU B;  4NB9 D;  3CX5 H;  2P10 A;  2LXC B;  3L73 J;  5APS A;  2QJY C;  3L70 G;  1NTM E;  2IBZ I;  1L4A D;  4NPE A;  2YMY A;  3IAO A;  1N7L A;  3WU2 E;  3CCJ P;  3SWF A;  3Q5R A;  3H1J D;  2RH0 A;  3L35 A;  3VMY A;  1NTK D;  2FYU D;  1VQO P;  5APQ A;  4NB8 D;  3WMM 0;  1PGO A;  4YPC A;  1PGQ A;  5H2F E;  4C7R A;  1H8A A;  4QDC A;  3L72 J;  4UB6 H;  3L73 G;  2Y0E A;  2QJP C;  2JEE A;  1JMM A;  3I55 P;  1NOH A;  1T3J A;  1J2J B;  2ZJS E;  1SQB D;  2JO1 A;  1NYK A;  3GHG B;  4L73 A;  1BE3 E;  3GZY A;  1P84 E;  5TJH A;  2PP6 A;  3U59 A;  4GOE A;  5CCH A;  3TDK A;  1SQQ J;  1RQV A;  3ITK A;  3Q5S A;  1RF1 A;  1YQ4 C;  4Y99 C;  5L8R J;  1FU1 A;  1BE3 J;  3FWL A;  1S9K D;  2W27 A;  4NBA D;  3VOP A;  2XND H;  2QPZ A;  1Q81 Q;  3USS A;  1KN7 A;  2KS1 A;  5AW9 B;  3HUS A;  3GHG C;  1N7S B;  2NPS B;  3L74 G;  2HYN A;  1VQ4 P;  4GOF A;  2NZ2 A;  1GL2 A;  1OX3 A;  3OA7 A;  1OZH A;  1JY3 O;  1MFT A;  3ZDM A;  1QVG O;  1ZLL A;  2ZFC A;  1FZC B;  3CWB D;  5TIS H;  3GB4 A;  3CCR P;  1LJ2 A;  3H1J J;  3RK3 C;  4NBD D;  3M9H A;  4HKV A;  5AVQ B;  4GIF A;  3CMA P;  2IYP A;  1GL2 D;  1T3U A;  3F5H A;  4HM7 A;  2KNC A;  2OYH C;  1AA0 A;  3GTS A;  3CC2 P;  2WPR A;  4R4L A;  3HUS C;  4OGQ D;  1NO4 A;  3VTP C;  4IOI H;  1SJG A;  2IX7 C;  4Y28 J;  3CX5 E;  5AVZ B;  3CXH H;  4RJT A;  2E76 C;  4U3F D;  3OAK A;  1FZC A;  3TK1 A;  5KTB A;  4UB8 E;  2Q3W A;  2K37 A;  1SQV J;  3G71 P;  1LNQ A;  5AW1 B;  3CD6 P;  2W6J H;  1Y47 A;  2WQY C;  5BOK A;  1PP9 E;  1JY3 N;  3N0Q A;  2NVG A;  1LTS C;  2GBW A;  3HUS B;  2WMM A;  4ASV A;  1QGK B;  2FYU G;  2N1T B;  2HOD B;  5AVW B;  1LWU C;  1DEB A;  1ULI A;  3RL0 g;  2HLO A;  3GMA A;  2OTJ P;  1LT9 B;  1HBW A;  3V2P A;  4U3F J;  2V7Q H;  2CK3 H;  1SS1 A;  1M1J C;  4K35 A;  4GOD A;  1VQ9 P;  1ZR4 A;  4PD4 I;  1KB9 D;  1SQV K;  3PH0 A;  1O7G A;  1IK7 A;  3R2P A;  4JF7 A;  1KIL D;  1WT6 A;  2A06 G;  2A45 I;  4IFF A;  3CCV P;  4EYY Q;  5KKZ B;  3GOB A;  3TNU A;  3JCU E;  2RMZ A;  2IZ0 A;  3M9B A;  1LWU A;  3GL0 A;  4EDF A;  3A7O A;  3D71 A;  1AVO A;  5AW8 B;  4AYC A;  1RE4 C;  2JJL A;  2E4P A;  1GMJ A;  2IZ1 A;  1O7M A;  1URQ D;  2FKW B;  4EI2 A;  5EFW B;  2BCC D;  1ZRT E;  1FDO A;  2C0X A;  5KLV D;  2HR3 A;  2ZYL A;  2NVE A;  4HH2 A;  2Y0C A;  4JBZ A;  3EQQ A;  2QM8 A;  2MJZ A;  1JTH A;  3CX5 D;  1N7S D;  1VQ8 P;  3SFE C;  5KAI E;  4PJ0 H;  4D6T J;  2HMN A;  1JNM A;  3TNU B;  1SQP G;  3EN1 A;  4HB1 A;  3VMZ A;  2YFL A;  1EDL A;  2Q1K A;  1P84 H;  4YXW H;  1JB0 J;  3A2A A;  2GM4 A;  2WSF H;  4K3A A;  3CC7 P;  2HPC A;  3L71 E;  2AXT E;  1GU4 A;  4WY4 D;  1WMK A;  1GTW A;  3L70 D;  4OWF A;  1X8Y A;  3B71 A;  4BRY A;  5B66 E;  3EQ2 A;  1SQV G;  1SQP E;  3H1J G;  2Q3E A;  1RE3 C;  5AW0 B;  3N7N A;  1KYO H;  3IF4 A;  1X79 B;  1FJP A;  1PIX A;  4HM5 A;  3H1I J;  5CHX A;  4H0L C;  3TGU J;  3MP7 B;  2IDB A;  3VMX A;  4Z1M H;  5TIS E;  3TGU G;  3EFG A;  2LXB A;  1L4A B;  3KHU A;  4WBA A;  4LLH A;  2I1J A;  2NPS C;  1L0N K;  2MKV A;  3U1A A;  5B5E H;  1OFC X;  2YO3 A;  4YTP C;  2HPC B;  4BWN A;  1BE3 D;  1KTM A;  1J1E B;  3L71 G;  2Q9I A;  3GLM A;  2B89 A;  1DIP A;  1SQB J;  3EFF K;  3EWK A;  1M1J A;  2IBZ G;  2KK7 A;  1T6A A;  4XE5 B;  3AE4 C;  1L0L G;  4NBH D;  1EXJ A;  1SLQ A;  3FWN A;  2BCC G;  1L0N D;  4IFD K;  3G3Z A;  1CSB A;  2JO6 A;  3VN0 A;  1U57 A;  1SFC A;  2ZYA A;  2D2C C;  2XRX A;  1NTM G;  1FZB A;  3PLN A;  5APV A;  1NGM B;  4UB8 H;  4ZNC A;  2E76 B;  4PD4 E;  1ZOY C;  3ABV C;  5APX A;  1T8Z A;  1GL2 B;  4QUQ A;  2JWD A;  1FAV A;  2A45 H;  2M5A A;  4YXD C;  3KQG A;  2Q6Q A;  3V2N A;  5KLI C;  1SQX D;  1K8A Q;  3A0B H;  3L72 G;  4QMA A;  1ULJ A;  1MV8 A;  3A3Y B;  3L73 E;  2GA1 A;  3H25 A;  1HWT C;  5GTH E;  4L75 A;  2N1T C;  1VQK P;  3GCE A;  3L72 D;  4ZKP A;  3BCC J;  1VQL P;  4QDD A;  2E76 D;  2YFJ A;  1FZF A;  3D6Z A;  5AW6 B;  1S5L X;  1BCC E;  4W7Y A;  2P58 A;  2WSS H;  1BDD A;  1KB9 H;  1S5L H;  4OH8 B;  1HF9 A;  2ZVN B;  3C1L A;  1VQ5 P;  2XSH A;  1K9M Q;  1OW7 A;  2B24 A;  4R4M A;  2JKV A;  2VRS A;  1Q2N A;  1KQS O;  2KSJ A;  3CI9 A;  2WSF J;  4HKZ H;  5KLV K;  3D70 A;  1BCC D;  1NU1 J;  3CCS P;  1PL5 A;  2YXR B;  3SSU A;  1SQV D;  1L2P A;  3IR9 A;  1XTG B;  1O7W A;  1OMI A;  3F89 A;  3WU2 H;  1EZV I;  4GKG A;  1NTK G;  1VDF A;  2ZT9 B;  3H1J E;  2ZXX A;  3G6E P;  2AEM A;  3GW6 A;  1IFM A;  1RF0 C;  5AW4 B;  1IFP A;  1PPJ D;  2FXP A;  4BXL A;  1EXI A;  2E75 D;  2E43 A;  1KYO I;  5KJ7 C;  1USE A;  5KAI H;  2AXT H;  2KNC B;  1X22 A;  1ZV8 A;  1N2D C;  2WVR A;  3NMD A;  2OQQ A;  3KYQ A;  1GW4 A;  4L74 A;  3AE2 C;  1SQP K;  3V2R A;  4B86 A;  1YJW P;  3AEG C;  3OW2 O;  1PGJ A;  3HTK B;  2QIW A;  3B5N B;  3PJS K;  2D2C B;  3WUV A;  4PD4 D;  1BGY D;  5B66 H;  5CCG D;  3CX5 I;  2KZI A;  3H1H J;  1CI6 B;  1NTM D;  2E74 D;  2B1X A;  3MUD A;  3M06 A;  2YMK A;  1HH0 A;  1L0N E;  1Q90 D;  1EQ7 A;  5AVS B;  1UUW A;  3CWB E;  1T2K C;  1CI6 A;  3AE5 C;  1DX7 A;  2J58 A;  2RKL A;  1EDJ A;  1VPC A;  2E4Q A;  4EOT A;  5AEW A;  3I5C A;  3D89 A;  1MFZ A;  5KKZ C;  2DE6 D;  2NUM A;  4WY4 A;  4NBG D;  2HMO A;  4I2L C;  2A45 G;  1RQU A;  4QCK A;  1IZN B;  1NWQ A;  3H32 B;  1PP9 G;  3L75 J;  5CCH C;  2G8Y A;  1L4A C;  1M57 D;  1JO5 A;  1D7M A;  5B5E E;  2E74 B;  1YHQ P;  3H1K E;  3GTE A;  3CWB J;  1JUN A;  3BVH A;  2QG4 A;  1M1J B;  2Y9Y A;  1ZME C;  1J1E C;  1RH5 B;  1RF1 C;  4PD4 H;  1HUC A;  2BCC J;  4JQ0 D;  1KFN A;  1S1C X;  4MN4 C;  2XU6 A;  4U3F G;  2ITA A;  3RL0 D;  2R3S A;  3L75 D;  3TGU E;  3B8E B;  3PRJ A;  4IL6 X;  1L4A A;  1NTZ G;  2IPP A;  2IFN A;  2P67 A;  4H44 B;  3H1L J;  4H0L D;  4HJL A;  2YO2 A;  1SQV E;  3AEA C;  2HMM A;  2NVF A;  2WPQ A;  1KC8 Q;  3MTU E;  3FX0 A;  3L73 D;  1KV4 A;  3V6I A;  1Q7Y Q;  5AVX B;  3GKE A;  2Z5I A;  4C7N A;  4HM8 A;  3IFM A;  2FBW C;  1HVV A;  5GTH H;  1SQX E;  4RO0 A;  1SQQ K;  3CL3 D;  4I7Z C;  2YVJ B;  1R8E A;  2QVA A;  4C46 A;  1JM1 A; 
#chains in the Genus database with same CATH homology
 1KYO E;  2HMN A;  2A06 E;  4NBH D;  4NB9 D;  4QUP A;  2QPZ A;  1ULI A;  2BCC E;  2DE7 D;  2E4Q A;  5AEW A;  1EZV E;  3EN1 A;  1VM9 A;  1NU1 E;  3D89 A;  1O7W A;  2XSO A;  2DE6 D;  2NUM A;  3DQY A;  3VMH D;  2YFL A;  5KKZ C;  4NBG D;  5CXM A;  2HMO A;  3GL2 A;  2JO6 A;  4NBF D;  4QCK A;  2QJY C;  3CXH E;  1NTK E;  2CKF A;  2HMJ A;  2XRX A;  1NTM E;  1KB9 E;  3H1J E;  2HMK A;  5AEU A;  1O7N A;  4AIV A;  5KLV E;  4PD4 E;  4HM6 A;  3L71 E;  4HM4 A;  2I7F A;  3H1K E;  3GTE A;  4NBB D;  1O7G A;  1WQL A;  4QUQ A;  4QUR A;  4HM0 A;  4HM1 A;  4P1B H;  4NB8 D;  2QJK C;  2ZT9 D;  1O7P A;  3GB4 A;  3VCA A;  1L0L E;  3BCC E;  5KLI C;  4NBD D;  3L72 E;  2HML A;  1SQP E;  2YFI A;  4HKV A;  4QDF B;  2E75 D;  4QDC A;  3GOB A;  3VCP A;  2NUK A;  1ULJ A;  3VMG D;  1NDO A;  3L73 E;  4PV1 D;  4HM7 A;  3L75 E;  3GL0 A;  3L74 E;  4HM5 A;  4U3F E;  3AZC A;  4AAY B;  3L70 E;  1BGY E;  2QJP C;  3GTS A;  3GCE A;  1VF5 D;  1SQB E;  2GBX A;  2FYN C;  4OGQ D;  2JZA A;  3TGU E;  3C0D A;  2FYU E;  4QDD A;  1SJG A;  1VCK A;  4NBE D;  2E4P A;  3CX5 E;  1PPJ E;  2E76 D;  1NTZ E;  4H13 D;  1O7M A;  1NYK A;  2XR8 A;  1G8J B;  3VMI D;  2YFJ A;  1Q90 C;  1EG9 A;  1ZRT E;  3H1I E;  1BE3 E;  3GZY A;  1P84 E;  3FOU A;  1BCC E;  1G8K B;  1SQQ E;  4H0L D;  1UUV A;  5HL4 A;  1FQT A;  1RIE A;  2BMO A;  2NVE A;  2NWF A;  2ZYL A;  4HJL A;  4P1C H;  4EMJ B;  1SQV E;  4D6T E;  2HMM A;  2NVF A;  3GZX A;  2Q3W A;  1O7H A;  2E74 D;  3EQQ A;  2B1X A;  2BMQ A;  2XSH A;  3H1H E;  4HM3 A;  2BMR A;  3GKE A;  2B24 A;  2YIU C;  4QDF A;  5BOK A;  4HM8 A;  2DE5 D;  1PP9 E;  4H44 D;  1L0N E;  2IBZ E;  1SQX E;  3H1L E;  4HM2 A;  3N0Q A;  2D2C D;  2NVG A;  4NBC D;  1UUW A;  3CWB E;  1RFS A;  2GBW A;  2YVJ B;  4NBA D;  1JM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...