1L0NE

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase
total genus 33
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0nE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0nE02
2NUKA 3GZYA 1VF5D 4NBCD 4QUPA 2NVGA 2I7FA 4QCKA 3L70E 3EQQA 1BCCE 4PD4E 3TGUE 1VM9A 2QPZA 4NBHD 4QDFB 4NB8D 1O7WA 1O7HA 5CXMA 1SJGA 1UUWA 2ZYLA 4HM2A 2NVFA 1NTKE 2NWFA 3GTEA 2B1XA 1O7MA 1PPJE 1Q90C 5BOKA 4U3FE 2GBWA 2DE5D 1ZRTE 2HMKA 4HM0A 3GB4A 3CX5E 1P84E 4P1BH 1NTME 1RFSA 5AEWA 1NU1E 1FQTA 3GZXA 3VCPA 2DE6D 4NBGD 2XSHA 4EMJB 4NBED 1SQBE 4PV1D 2Q3WA 5KLIC 3C0DA 4NBAD 4HKVA 4QURA 1KB9E 4HM5A 5HL4A 4QDCA 3VCAA 3CWBE 4HM8A 2A06E 4AIVA 2XSOA 2GBXA 3L74E 2IBZE 2QJKC 1ULJA 2XR8A 4HJLA 1NDOA 4OGQD 3H1IE 1G8KB 2BMOA 2JO6A 3VMGD 1NYKA 1EG9A 1VCKA 4HM1A 3H1JE 4QDFA 3GTSA 1RIEA 2BMRA 1EZVE 1PP9E 1JM1A 1SQQE 3H1HE 1O7PA 2E74D 3VMID 3L75E 3FOUA 3L73E 2HMMA 3D89A 3AZCA 2E76D 4H13D 4NBBD 3GOBA 4HM4A 2BMQA 2HMNA 1KYOE 2NUMA 2QJYC 5KLVE 4NB9D 2CKFA 4HM3A 3GCEA 5AEUA 2JZAA 1BE3E 4QUQA 2DE7D 2E4PA 2YFJA 2YFIA 3N0QA 1O7NA 2B24A 2XRXA 2YFLA 2YVJB 1BGYE 3EN1A 2FYUE 4H0LD 4NBDD 1UUVA 3L71E 3BCCE 4HM7A 4P1CH 1G8JB 4QDDA 2ZT9D 2E4QA 1ULIA 1L0NE 4NBFD 3VMHD 1NTZE 2HMLA 2D2CD 2QJPC 3H1KE 4AAYB 3CXHE 1L0LE 3GL0A 2HMJA 2FYNC 2YIUC 4H44D 1O7GA 4D6TE 2E75D 3DQYA 3GL2A 5KKZC 2NVEA 2BCCE 3H1LE 1WQLA 4HM6A 1SQXE 1SQVE 2HMOA 3GKEA 3L72E 1SQPE
chains in the Genus database with same CATH superfamily
2CK3H 5APYA 5AVYB 4BXLA 1S5LX 3HE4A 1FAVA 5APWA 5AW9B 2XDJA 3LW5H 2B1XA 3D6YA 3AEDC 1BE3G 2GBWA 3CI9A 2K1AA 3B5NA 4P1BH 1ZLLA 3WU2H 4ASVA 1KMIZ 2BCCJ 4EYYQ 4PV1D 3BCCG 1KORA 1Q2NA 5CCGD 1L0ND 5APUA 4BWNA 4AUWA 3CMAP 1TU3F 4GOEA 1OVRA 2XR8A 2OYIC 3P8MC 1X0TA 1RH5B 1KC8Q 1NDOA 5AVXB 3T97B 2KOGA 3L71D 2KNCB 1JY2N 3BRTB 4XE5B 1NTKG 4EIJA 1M1JC 5H2FE 5AEUA 3CWBJ 1HJBA 3O6QA 1GL2C 1ZOYC 1NU1G 1KQFB 3L71E 3QH9A 3GMAA 2C0WA 3S1KA 3L74D 2YIUC 2NZ2A 4NPEA 1PPJD 1SQQK 3L37A 4Y99C 3PTZA 3A5TA 2KSJA 1YQ4C 1HBWA 2N1TB 4YXWH 2Q5UA 1HTLC 2SPZA 2PAJA 3Q2YA 3V2NA 3BASA 2OYIA 5AVTB 2A45I 1JY3N 1PPJE 2IYOA 2M0BA 2NPSB 2ITAA 3SFDC 1NKNA 2WSFH 1J1EB 3B8EB 4N3YB 3L36A 1URQC 1VQ9P 5AW6B 5TISE 2XSOA 3HE4B 4IL6X 1M1JA 1JO5A 4N78D 2WSCH 4C46A 4W7ZA 2N1TD 2PFXA 1SQVG 1L4AD 1ZMEC 4R4MA 1JTHA 3KZIE 2ZAEB 1KTMA 2FYUD 3NTNA 4RKUJ 4RO0A 1BDDA 1LTJA 1IJDB 3M0DC 3HE5A 4NBBD 1KN7A 2N9YB 2WQYC 1T8ZA 1MV8A 4N78E 2NPSD 1EDIA 3GF7A 1JB0J 1X79B 3SSUA 1NTMG 2C0XA 3AE1C 2YFLA 2FYUE 1BCCD 4PD4D 2KXPB 2YO2A 1HF9A 1PL5A 2HLOA 2HMLA 3LIDA 1AQ5A 5GTIE 2HYNA 3JC22 1FBMA 1DD4A 1IFNA 3VMID 2K9YA 2NVGA 3O6QB 1BCCE 4PD4E 1URQA 3VP9A 2W90A 1KB9D 3A0HE 1NTZG 4K35A 4OVNF 4UB6E 3Q5SA 3FGAD 3L71J 2IZ0A 2YKQA 2YMKA 3G9RA 2KZIA 1GMJA 1RQVA 4TLFA 3AE6C 4NBGD 1USDA 1YJNP 1KB9E 1IK9A 1ZV8A 1KQSO 4PD4I 3E1IA 3U59A 4AIVA 1SVFA 1GK4A 2LKMA 1KYOD 4DCKA 1RE3C 2FXOA 2WT7A 4GKGA 2OYIB 3L74J 1S5LH 5CJ0A 1AA0A 3TNUB 1RIEA 2POHA 2P10A 5APVA 3OJAB 3CWBG 1KB9I 1CI6A 1KYOE 5GTHH 3CXHD 3MGNA 1NU1K 4UB8H 5KAFH 3JCUH 2XNXA 1EXIA 1M1JB 1OVVA 3P32A 2J58A 2I1KA 1NHLA 2YFIA 1GL2B 1QEXA 2I1JA 3EN1A 1SQBD 4PJ0E 5B66H 2WWWA 2Y0CA 1JTHB 3CCSP 2QJPC 2A06G 4ZKUA 3CXHE 1YIJP 3E7KA 2HMJA 3HE5B 1OW8A 2Q9IA 1MZ9A 2IBZG 1KYOI 2R5DA 5KKZC 2YIUB 3ABVC 3H1IG 4Y99B 3TK1A 3H1JG 3TDKA 1YJWP 3KQGA 2HG5D 2KSEA 1PP9G 2WTYA 4WY4C 3CMEP 2GUVA 5AW7B 1JY2P 2YMYA 2P7JA 3H32A 2ZYLA 2FYUJ 4DOJA 1RE3A 5KLVD 4H44C 5AW3B 3USSA 3CXHI 3LIEA 1GDTA 1LTAC 5AVQB 4HM0A 1GL2D 1OW6A 2XKMA 3IF4A 1BGYG 1NAFA 1S2EA 3H1HD 4H0LB 1T2KD 2Y9YA 3C1LA 1SQVK 1BCCJ 1KFMA 1WMKA 1IZNB 2JDIH 1RF1C 2Z5IA 2E75B 2O1KA 1EDKA 1NJIQ 2BMRA 2M5AB 3H1HE 3TGUG 2HMMA 1U7JA 2AXCA 5KLIB 2GA1A 2OYOA 3H1KD 5AW4B 5AW8B 3PH0A 2E43A 2YXQB 1NKZB 1SQXD 3WU2E 4RJTA 1OIPA 4H0LD 1G1JA 1W5CE 1UUVA 4K3AA 4H13C 2L91A 4GOFA 1SFCC 1HVVA 1QL1A 3H1KE 3CCQP 3S9OA 1AVOA 2E75D 1SQXE 1LTGC 3V4WA 1NTZK 4QMAA 2Q3EA 2FYZA 1EZVG 3L71G 2R3SA 4L73A 2WPQA 3L73G 1K05A 4ZMDA 3SWKA 1RF1A 1X8YA 1PV3A 3W67A 5BOKA 3ITKA 1YBKA 2B88A 1VF5C 2IFNA 4LGDE 4EMJB 1JUNA 3Q5RA 2Q3WA 3U1AA 1LTSC 3C0DA 4HM5A 1EXJA 1YQ3C 2M8RA 2ZFCA 2QJKC 3H32B 1FZAA 1PPJG 3VMYA 3AEBC 2PRRA 3CCVP 4KT0J 1K04A 1CSBA 4NPFX 1SQPG 1P84H 3CX5H 1VQ6P 1GU5A 3D6ZA 1JM1A 3L70G 4Z1MH 1CZQA 4W80A 1SFCA 1LJ2A 1L0LD 3GCEA 4IOIH 1ZRTD 4U3FG 1HGZA 2VRSA 3CCEP 1O7NA 2P2UA 3CCLP 1N73C 1PFIA 4JQ0D 5B5EH 5AVVB 4C7RA 1RHZB 3VOPA 3H1HJ 1L0LE 1PGPA 2QJPB 2NVEA 1RQUA 4HM6A 1G2CA 5KKZB 4L75A 3CD6P 3GZYA 4NBCD 4QUPA 3A2AA 1EC5A 1IFDA 1KQGB 5AVWB 1H88A 2NRGA 2KLUA 4WY4B 3TYYA 1UUWA 3BVHA 2Q7CA 1N7SC 1QL2A 3GTEA 3H25A 4EDFA 4H44B 1BSNA 3H1KJ 1VDFA 3OA7A 4TT3H 1RFSA 3VCPA 5KTBA 2XSHA 1FZEA 4NBED 3CCMP 1SQXJ 2W6JH 1MFZA 1XTCC 2K9JA 2V7QH 1FJPA 1OZHA 3U1CA 3QWOC 3H1LG 4XFJA 4QDFA 1Y8AA 1N73A 3L72G 1H89A 2J59M 1SP4A 1FZBA 3FX0A 1O7PA 1J1DC 4WY4D 5CCHA 2G3AA 3SWYA 1XTGB 1DH3A 3G6EP 2CPBA 2GUSA 1KD1Q 2OARA 2MJZA 2RMZA 3AEAC 5L8RJ 3P7KA 1Z56A 2WZ7A 3Q3DA 3R2PA 2OYHC 2YKPA 1L0NE 3AEGC 1N7SA 3AEFC 1SFCB 4GDOA 5AW0B 1S5LE 1Q90D 2WSEH 1SLQA 1GD2E 1AFOA 2ZXEB 2K3RA 2WSFJ 3AE9C 3G3ZA 4N6JA 1O7WA 3HTKA 3AE3C 2IPPA 4UB8E 5KAFE 4HM2A 1LTJC 4ZNCA 1O7MA 2JP3A 4AYCA 3HD7B 3SWFA 1FDIA 1L0LJ 3GHGC 2QSIA 1PGQA 1PIXA 5B66E 5EFWB 1SQQD 1QX8A 2ZT9C 3A0BH 3RK3C 4NBAD 1SFCD 1VQKP 4WB4A 2D2CC 1YTZI 3L74E 1SQPK 3VTPC 1FE6A 1U7MA 4D6TG 1NAYA 2QJKB 1G8KB 5E79H 2R44A 2DW3A 2OYHA 1SQQE 1X22A 1KILC 3RBZA 1FZFA 2K9JB 3HD7D 3CC4P 4ZKPA 1GW3A 3RK2C 2PP6A 1Y47A 2OGUA 1FDOA 1OVUA 3EQ2A 5KAIH 1VQNP 4NBDD 2ZVNB 1G8JB 1DEEG 3B5NB 1D7MA 1N73B 2M3EA 1DX7A 2KLVA 4NBFD 4MN4C 3AE2C 4AAYB 2QRXA 3FXDA 2FYUK 3AEEC 2FFDC 1LT1A 3GHGA 3EQQA 2WPRA 2B89A 2J5UA 1T6AA 1O7HA 5CXMA 3R4YA 3IR9A 3H1KG 1KQLA 2JEEA 4Y28J 5BVZA 5AVUB 3FWNA 1L0NJ 1LTIC 1N7SB 3IFMA 1J2JB 2KUBA 1M56D 2E5YA 3PHLA 5AEWA 4IL6E 5K5GB 3GZXA 1MUUA 3GF3A 3B5ND 1KILA 4HJGH 3BATA 2QIWA 3V5BA 5AW2B 2H89C 2AXTE 4IFMA 5AVSB 1BE3D 2BCCG 3MTUE 3N7NA 2FY8A 2O01N 3AE5C 3BCCD 1VQ7P 1J1DB 1IO4A 2Q6QA 3L4FA 1N7SD 2FFDA 3PLNA 2Q1KA 1BE3E 2BEQD 1LTTC 5DJTB 2JJLA 3CX5D 3PP5A 3CC2P 2IX7C 2B24A 1OFCX 1WRGA 3BCCE 4QDDA 1DEBA 1N8RQ 1UIXA 2E76C 1NYHA 2OYHB 1SQQJ 2JWDA 2B87A 1NTKD 1FU1A 2FYNC 2HPCA 3L35A 4OGQC 2WSSH 1K73Q 1HGVA 1Q7YQ 5H2FH 1CW5A 1VQ4P 1WQLA 2HMOA 3C8VA 1NU1D 2W83C 2XZRA 2FXPA 1LWUC 2WITA 1YHQP 4NBHD 2H8PD 3WUUA 1U57A 1DIPA 4KHXA 2C9LY 2A45H 1NTKE 3M0AA 2AEFA 1LTJB 2P1JA 3JSVC 1AJYA 2KS1A 2OTKE 3ZDMA 1NU1E 1FQTA 4BRYA 3W68A 3CX5I 3H6PA 1SQBE 3PJSK 2XU6A 3K5BA 4YXDC 2ZT9B 3RK3B 2KYVA 3KPEA 2HODA 2D2CB 2R3CA 1LP1A 2WMMA 2JO6A 3I56P 1EG9A 1Q86Q 3WMM0 1PGOA 4PV1C 5CCGC 2QA4P 1NH4A 2JWAA 3CCUP 1NGMB 2ZYDA 3AE7C 1VQOP 5TISH 2H7HA 1ZW0A 1URQB 3I5CA 5KLVE 3AECC 1A02J 4EI2A 1SQVD 2AEJA 2WVRA 1UIIA 3N0QA 1LWUA 3RK2B 2RKLA 4I1LA 3KZIH 2ZT9D 3HRNA 3RK3D 2D2CD 3DQYA 1BDCA 2QVAA 1SQVE 3GKEA 3O8ZA 1NTMD 1BE3J 2WT7B 2KB7P 3RK3E 1L0NG 2CPSA 3UIAA 1SQXK 1URQD 2YKOA 1T3UA 3BCCJ 4AQRD 1GU4A 5GTIH 1HJ0A 2AEMA 4NPDA 2K88A 1CI6B 3RK2D 3HUSA 5KJ7C 2HPCB 2DE5D 1W2BO 1JY2O 3GB4A 1NTME 1JOCA 5CCGA 3MZWB 4JPZB 4ASWA 5HL4A 4PD4H 1NTZD 4EOTA 3VCAA 2A45G 3A0HH 4UB6H 5AVRB 1JCDA 2R32A 3MIWA 2O1JA 2BMOA 1NTKJ 1NYKA 1VCKA 3KHUA 1ZR4A 2WPVB 4OWFA 1IFPA 2KS1B 1M57D 1SS1A 2KP8A 3FOUA 3Q5PA 4BRYB 1NU1J 1KB9H 2HMNA 1SQBJ 1K9MQ 1FZCC 3L74G 2CKFA 1JNMA 4QUQA 1L4AC 3CPWO 1M1KQ 2K37A 2ZVOB 2E42A 3F89A 1JY3O 1N7LA 2RH0A 4P1CH 3TSIA 3VMHD 3CWBD 2E76B 2QEXP 3T97A 2H88C 4I7ZC 3GL2A 2O01J 5E79E 5KJ7A 1Y9BA 1R8EA 4OGQB 2P67A 5KLVJ 2KNCA 2NUKA 1M8OB 1IC2A 1L0LK 1S4XA 1H8AA 4PJ0H 4I2LC 4DZOA 2R5BA 3B4SA 5CCHC 2A06D 4YTPC 2IBZD 3H1ID 3LW5J 5KAIE 1K8AQ 1YJ9P 1ZRTE 3H1JD 1JM0A 3MP7B 1FZGA 3WUVA 1PP9D 2FYUG 3IN6A 1SQVJ 2W6BA 2LR2A 1GZLA 2B9BA 1FZCA 2OTLP 2A06E 2JKVA 2IBZE 1BSHA 1ULJA 1IFJA 5CBNA 1L4AA 1QVFO 4OGQD 3H1IE 1IK7A 1ZP0C 3H1JE 2OTJP 3II6A 2QM7A 1PP9E 1BGYD 1BCCG 1NTMJ 3AZCA 3GOBA 2QJYC 2KK7A 4C7NA 2IBZI 2YFJA 1RF1B 2WSEJ 1BGYE 4HM7A 3TGUD 3N4XA 2E4QA 4IFDK 2I8DA 5CBOA 1AV1A 2XNDH 3CL3D 1NTZJ 4H44D 1L2PA 3RL0C 3EFFK 4RESB 1L0NK 4R4LA 1M7LA 1T3JA 4QCKA 3TGUE 2E74C 5CMZA 5AVZB 4NB8D 4WBAA 4H13B 2NWFA 3C9IA 2FKWB 2WPSA 2FBWC 1KZUB 2RN0A 3VMAA 1EZVD 1E5WA 2YNYA 3OAKA 4QURA 3L75D 3L73D 5GTHE 2GBXA 1NO4A 3JCUE 3CC7P 3KYQA 4HH2A 4JBZA 2O3JA 4HM1A 2WSCJ 1EZVE 1PGJA 1SQBG 1VF5B 1G2CB 4GIFA 1T2KC 3L75E 3L73E 2UWJE 4H13D 1IFMA 4JF7A 1FZCB 4L74A 4WWIA 5BU8B 5KJ7D 2ZYAA 3CLQA 1L4AB 1SQPD 3F5HA 3M9HA 1S1CX 3V4QA 1X9VA 1YTZT 3H1IJ 3L70D 2ZYGA 1JEKA 1EZVI 3H1JJ 4U7JA 2L5GB 1PP9J 3G71P 1KFNA 3V6IA 2W8ZA 5KLVG 3KXDA 1EDJA 3TNUA 1FOSF 2Z4EA 1LT9C 2PGDA 3RGUA 4I7ZB 4U3FD 1OWAA 1SQPE 5APQA 1VF5D 4H0LC 4C7NB 1HUCA 3L70E 3H1HG 3SFEC 1S3JA 4QDFB 5AW1B 1FJKA 1BGYJ 3I55P 1RE4C 2NVFA 1N86A 2E75C 1GL2A 4DJGA 2V4HA 3GW6A 4YPCA 4U3FE 2HMKA 3KDPB 3FXEA 4GT1A 1JMBA 2YXRB 5KLIC 4HKVA 4QDCA 3VP8A 3TGUJ 3RBXA 2IYPA 3Q1MA 2LXBA 5CJ4A 2H43A 1QVGO 2P58A 1SQXG 2Y0EA 3D89A 3VMXA 5CCHD 2NUMA 1EQ7A 2ZJSE 1LT9A 1VPCA 2QJYB 5M1BA 3HTKB 3IAOA 3H1LD 1NWQA 2DE7D 1YITP 2E4PA 2Z5HA 3L72D 3D70A 3A3YB 1RE4A 2GM4A 5APSA 3L75J 1VL2A 3L73J 3MD0A 1LNQA 2MKVA 1O7GA 2C9NY 2M5AA 5DJUB 1N2DC 3H1LE 3RL0B 3FWLA 1P84D 2IFMA 3L72E 1QGKB 3NXSA 2I7FA 3M0DA 2FXMA 1YI2P 2E74B 4JYBA 3V2PA 3NMDA 3G4SP 1RY3A 4M3LA 1JMMA 1P84E 2ZXXA 3CX5E 4GODA 1NTKK 1SQPJ 3L70J 1L0LG 4IFFA 1R5LA 1VQPP 4HJLA 3V2QA 1AVYA 1SQBK 3RL0D 4HB1A 3OW2O 1GW4A 1FC2C 3M06A 5APTA 2HR3A 1AQTA 5BU5A 2QE7H 4LLHA 1P84I 5B5EE 3GHGB 4U3FJ 4HYTB 2E74D 2JO1A 2Y9ZA 4HM4A 3VMZA 2IDBA 1S72P 2Y0DA 1USEA 4NB9D 4HM3A 1GTWA 2W27A 4D6TD 3CCRP 3MHVA 1LTBC 2XRXA 2YVJB 3HUSC 5KLVK 4L76A 1OX3A 2M3BA 1KILB 4W7YA 1DD3A 5APXA 4D6TE 2BEZF 5CHXA 1G1IA 3BRVB 3RL0g 1R5SA 1LT9B 1Q81Q 2KIKA 1E79H 3GLMA 1FS0E 1SJGA 1ZXGA 3EWKA 1Q90C 3M91A 1S9KD 1H0TA 2FFDB 3MUDC 3PRJA 4A7PA 1OMIA 3H1LJ 1OW7A 2IZ1A 3L72J 1KILD 1ZN5A 2W6AA 1NTMK 1WT6A 1JY3P 2QG4A 2BASA 1S9KE 1JCCA 2B87B 1MFTA 3S4RA 3GTSA 2KZJA 4WY4A 4IL6H 1IFIA 1KILE 1ZR2A 2BMQA 5C39A 4WVZA 2N9BA 3WUTA 3B71A 2XV5A 3TF5A 2AXTH 1NOHA 2BCCD 1HWTC 4XA4A 2HFED 4HKZH 1HH0A 3M9BA 3L75G 4B86A 1NTZE 4JYCA 2Q3IA 3GL0A 3HD7C 2OQQA 2BCCE 1FOSE 2N1TC 3MUDA 4DT0A 2HODB 1LP1B 1M90Q 3A0BE 1SQQG 1VM9A 2QPZA 1A02F 2JR8A 1VQLP 1KYOH 2YO3A 4I6MC 2NPSC 2FYNB 1FDMA 1J1EC 1PZQA 1YYCA 3AE4C 4D6TJ 1VQ8P 2DE6D 1RF0C 1NVOA 1LWUB 3CWBE 3GG2A 4HM8A 3EFGA 4LC1A 3E1RA 3CXHH 4O9BA 2V7QJ 3CCJP 3NFQA 2QM8A 3VMGD 5AW5B 1Q82Q 4KJMA 3B5NC 1QLED 1H0TB 4OH8B 2E76D 1VQMP 3HD7A 3P8CD 1MKMA 2KI7B 5TJHA 3VN0A 2N1TA 1KV4A 2JZAA 1VQ5P 1EDLA 3M9QA 3AE8C 1W2EA 3V2RA 3HUSB 1OXZA 4CPGA 1ULIA 4PV1B 1LGHB 3D71A 3P8CE 3VYIA 2O01H 2G8YA 2NPSA 2E5TA 2LXCB 1GK6A 3A7OA 1RF0A
chains in the Genus database with same CATH topology
2NUKA 3GZYA 1VF5D 4NBCD 4QUPA 2NVGA 2I7FA 4QCKA 3L70E 3EQQA 1BCCE 4PD4E 3TGUE 1VM9A 2QPZA 4NBHD 4QDFB 4NB8D 1O7WA 1O7HA 5CXMA 1SJGA 1UUWA 2ZYLA 4HM2A 2NVFA 1NTKE 2NWFA 3GTEA 2B1XA 1O7MA 1PPJE 1Q90C 5BOKA 4U3FE 2GBWA 2DE5D 1ZRTE 2HMKA 4HM0A 3GB4A 3CX5E 1P84E 4P1BH 1NTME 1RFSA 5AEWA 1NU1E 1FQTA 3GZXA 3VCPA 2DE6D 4NBGD 2XSHA 4EMJB 4NBED 1SQBE 4PV1D 2Q3WA 5KLIC 3C0DA 4NBAD 4HKVA 4QURA 1KB9E 4HM5A 5HL4A 4QDCA 3VCAA 3CWBE 4HM8A 2A06E 4AIVA 2XSOA 2GBXA 3L74E 2IBZE 2QJKC 1ULJA 2XR8A 4HJLA 1NDOA 4OGQD 3H1IE 1G8KB 2BMOA 2JO6A 3VMGD 1NYKA 1EG9A 1VCKA 4HM1A 3H1JE 4QDFA 3GTSA 1RIEA 2BMRA 1EZVE 1PP9E 1JM1A 1SQQE 3H1HE 1O7PA 2E74D 3VMID 3L75E 3FOUA 3L73E 2HMMA 3D89A 3AZCA 2E76D 4H13D 4NBBD 3GOBA 4HM4A 2BMQA 2HMNA 1KYOE 2NUMA 2QJYC 5KLVE 4NB9D 2CKFA 4HM3A 3GCEA 5AEUA 2JZAA 1BE3E 4QUQA 2DE7D 2E4PA 2YFJA 2YFIA 3N0QA 1O7NA 2B24A 2XRXA 2YFLA 2YVJB 1BGYE 3EN1A 2FYUE 4H0LD 4NBDD 1UUVA 3L71E 3BCCE 4HM7A 4P1CH 1G8JB 4QDDA 2ZT9D 2E4QA 1ULIA 1L0NE 4NBFD 3VMHD 1NTZE 2HMLA 2D2CD 2QJPC 3H1KE 4AAYB 3CXHE 1L0LE 3GL0A 2HMJA 2FYNC 2YIUC 4H44D 1O7GA 4D6TE 2E75D 3DQYA 3GL2A 5KKZC 2NVEA 2BCCE 3H1LE 1WQLA 4HM6A 1SQXE 1SQVE 2HMOA 3GKEA 3L72E 1SQPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUK A;  3GZY A;  1VF5 D;  4NBC D;  4QUP A;  2NVG A;  2I7F A;  4QCK A;  3L70 E;  3EQQ A;  1BCC E;  4PD4 E;  3TGU E;  1VM9 A;  2QPZ A;  4NBH D;  4QDF B;  4NB8 D;  1O7W A;  1O7H A;  5CXM A;  1SJG A;  1UUW A;  2ZYL A;  4HM2 A;  2NVF A;  1NTK E;  2NWF A;  3GTE A;  2B1X A;  1O7M A;  1PPJ E;  1Q90 C;  5BOK A;  4U3F E;  2GBW A;  2DE5 D;  1ZRT E;  2HMK A;  4HM0 A;  3GB4 A;  3CX5 E;  1P84 E;  4P1B H;  1NTM E;  1RFS A;  5AEW A;  1NU1 E;  1FQT A;  3GZX A;  3VCP A;  2DE6 D;  4NBG D;  2XSH A;  4EMJ B;  4NBE D;  1SQB E;  4PV1 D;  2Q3W A;  5KLI C;  3C0D A;  4NBA D;  4HKV A;  4QUR A;  1KB9 E;  4HM5 A;  5HL4 A;  4QDC A;  3VCA A;  3CWB E;  4HM8 A;  2A06 E;  4AIV A;  2XSO A;  2GBX A;  3L74 E;  2IBZ E;  2QJK C;  1ULJ A;  2XR8 A;  4HJL A;  1NDO A;  4OGQ D;  3H1I E;  1G8K B;  2BMO A;  2JO6 A;  3VMG D;  1NYK A;  1EG9 A;  1VCK A;  4HM1 A;  3H1J E;  4QDF A;  3GTS A;  1RIE A;  2BMR A;  1EZV E;  1PP9 E;  1JM1 A;  1SQQ E;  3H1H E;  1O7P A;  2E74 D;  3VMI D;  3L75 E;  3FOU A;  3L73 E;  2HMM A;  3D89 A;  3AZC A;  2E76 D;  4H13 D;  4NBB D;  3GOB A;  4HM4 A;  2BMQ A;  2HMN A;  1KYO E;  2NUM A;  2QJY C;  5KLV E;  4NB9 D;  2CKF A;  4HM3 A;  3GCE A;  5AEU A;  2JZA A;  1BE3 E;  4QUQ A;  2DE7 D;  2E4P A;  2YFJ A;  2YFI A;  3N0Q A;  1O7N A;  2B24 A;  2XRX A;  2YFL A;  2YVJ B;  1BGY E;  3EN1 A;  2FYU E;  4H0L D;  4NBD D;  1UUV A;  3L71 E;  3BCC E;  4HM7 A;  4P1C H;  1G8J B;  4QDD A;  2ZT9 D;  2E4Q A;  1ULI A;  1L0N E;  4NBF D;  3VMH D;  1NTZ E;  2HML A;  2D2C D;  2QJP C;  3H1K E;  4AAY B;  3CXH E;  1L0L E;  3GL0 A;  2HMJ A;  2FYN C;  2YIU C;  4H44 D;  1O7G A;  4D6T E;  2E75 D;  3DQY A;  3GL2 A;  5KKZ C;  2NVE A;  2BCC E;  3H1L E;  1WQL A;  4HM6 A;  1SQX E;  1SQV E;  2HMO A;  3GKE A;  3L72 E;  1SQP E; 
#chains in the Genus database with same CATH topology
 2CK3 H;  5APY A;  5AVY B;  4BXL A;  1S5L X;  3HE4 A;  1FAV A;  5APW A;  5AW9 B;  2XDJ A;  3LW5 H;  2B1X A;  3D6Y A;  3AED C;  1BE3 G;  2GBW A;  3CI9 A;  2K1A A;  3B5N A;  4P1B H;  1ZLL A;  3WU2 H;  4ASV A;  1KMI Z;  2BCC J;  4EYY Q;  4PV1 D;  3BCC G;  1KOR A;  1Q2N A;  5CCG D;  1L0N D;  5APU A;  4BWN A;  4AUW A;  3CMA P;  1TU3 F;  4GOE A;  1OVR A;  2XR8 A;  2OYI C;  3P8M C;  1X0T A;  1RH5 B;  1KC8 Q;  1NDO A;  5AVX B;  3T97 B;  2KOG A;  3L71 D;  2KNC B;  1JY2 N;  3BRT B;  4XE5 B;  1NTK G;  4EIJ A;  1M1J C;  5H2F E;  5AEU A;  3CWB J;  1HJB A;  3O6Q A;  1GL2 C;  1ZOY C;  1NU1 G;  1KQF B;  3L71 E;  3QH9 A;  3GMA A;  2C0W A;  3S1K A;  3L74 D;  2YIU C;  2NZ2 A;  4NPE A;  1PPJ D;  1SQQ K;  3L37 A;  4Y99 C;  3PTZ A;  3A5T A;  2KSJ A;  1YQ4 C;  1HBW A;  2N1T B;  4YXW H;  2Q5U A;  1HTL C;  2SPZ A;  2PAJ A;  3Q2Y A;  3V2N A;  3BAS A;  2OYI A;  5AVT B;  2A45 I;  1JY3 N;  1PPJ E;  2IYO A;  2M0B A;  2NPS B;  2ITA A;  3SFD C;  1NKN A;  2WSF H;  1J1E B;  3B8E B;  4N3Y B;  3L36 A;  1URQ C;  1VQ9 P;  5AW6 B;  5TIS E;  2XSO A;  3HE4 B;  4IL6 X;  1M1J A;  1JO5 A;  4N78 D;  2WSC H;  4C46 A;  4W7Z A;  2N1T D;  2PFX A;  1SQV G;  1L4A D;  1ZME C;  4R4M A;  1JTH A;  3KZI E;  2ZAE B;  1KTM A;  2FYU D;  3NTN A;  4RKU J;  4RO0 A;  1BDD A;  1LTJ A;  1IJD B;  3M0D C;  3HE5 A;  4NBB D;  1KN7 A;  2N9Y B;  2WQY C;  1T8Z A;  1MV8 A;  4N78 E;  2NPS D;  1EDI A;  3GF7 A;  1JB0 J;  1X79 B;  3SSU A;  1NTM G;  2C0X A;  3AE1 C;  2YFL A;  2FYU E;  1BCC D;  4PD4 D;  2KXP B;  2YO2 A;  1HF9 A;  1PL5 A;  2HLO A;  2HML A;  3LID A;  1AQ5 A;  5GTI E;  2HYN A;  3JC2 2;  1FBM A;  1DD4 A;  1IFN A;  3VMI D;  2K9Y A;  2NVG A;  3O6Q B;  1BCC E;  4PD4 E;  1URQ A;  3VP9 A;  2W90 A;  1KB9 D;  3A0H E;  1NTZ G;  4K35 A;  4OVN F;  4UB6 E;  3Q5S A;  3FGA D;  3L71 J;  2IZ0 A;  2YKQ A;  2YMK A;  3G9R A;  2KZI A;  1GMJ A;  1RQV A;  4TLF A;  3AE6 C;  4NBG D;  1USD A;  1YJN P;  1KB9 E;  1IK9 A;  1ZV8 A;  1KQS O;  4PD4 I;  3E1I A;  3U59 A;  4AIV A;  1SVF A;  1GK4 A;  2LKM A;  1KYO D;  4DCK A;  1RE3 C;  2FXO A;  2WT7 A;  4GKG A;  2OYI B;  3L74 J;  1S5L H;  5CJ0 A;  1AA0 A;  3TNU B;  1RIE A;  2POH A;  2P10 A;  5APV A;  3OJA B;  3CWB G;  1KB9 I;  1CI6 A;  1KYO E;  5GTH H;  3CXH D;  3MGN A;  1NU1 K;  4UB8 H;  5KAF H;  3JCU H;  2XNX A;  1EXI A;  1M1J B;  1OVV A;  3P32 A;  2J58 A;  2I1K A;  1NHL A;  2YFI A;  1GL2 B;  1QEX A;  2I1J A;  3EN1 A;  1SQB D;  4PJ0 E;  5B66 H;  2WWW A;  2Y0C A;  1JTH B;  3CCS P;  2QJP C;  2A06 G;  4ZKU A;  3CXH E;  1YIJ P;  3E7K A;  2HMJ A;  3HE5 B;  1OW8 A;  2Q9I A;  1MZ9 A;  2IBZ G;  1KYO I;  2R5D A;  5KKZ C;  2YIU B;  3ABV C;  3H1I G;  4Y99 B;  3TK1 A;  3H1J G;  3TDK A;  1YJW P;  3KQG A;  2HG5 D;  2KSE A;  1PP9 G;  2WTY A;  4WY4 C;  3CME P;  2GUV A;  5AW7 B;  1JY2 P;  2YMY A;  2P7J A;  3H32 A;  2ZYL A;  2FYU J;  4DOJ A;  1RE3 A;  5KLV D;  4H44 C;  5AW3 B;  3USS A;  3CXH I;  3LIE A;  1GDT A;  1LTA C;  5AVQ B;  4HM0 A;  1GL2 D;  1OW6 A;  2XKM A;  3IF4 A;  1BGY G;  1NAF A;  1S2E A;  3H1H D;  4H0L B;  1T2K D;  2Y9Y A;  3C1L A;  1SQV K;  1BCC J;  1KFM A;  1WMK A;  1IZN B;  2JDI H;  1RF1 C;  2Z5I A;  2E75 B;  2O1K A;  1EDK A;  1NJI Q;  2BMR A;  2M5A B;  3H1H E;  3TGU G;  2HMM A;  1U7J A;  2AXC A;  5KLI B;  2GA1 A;  2OYO A;  3H1K D;  5AW4 B;  5AW8 B;  3PH0 A;  2E43 A;  2YXQ B;  1NKZ B;  1SQX D;  3WU2 E;  4RJT A;  1OIP A;  4H0L D;  1G1J A;  1W5C E;  1UUV A;  4K3A A;  4H13 C;  2L91 A;  4GOF A;  1SFC C;  1HVV A;  1QL1 A;  3H1K E;  3CCQ P;  3S9O A;  1AVO A;  2E75 D;  1SQX E;  1LTG C;  3V4W A;  1NTZ K;  4QMA A;  2Q3E A;  2FYZ A;  1EZV G;  3L71 G;  2R3S A;  4L73 A;  2WPQ A;  3L73 G;  1K05 A;  4ZMD A;  3SWK A;  1RF1 A;  1X8Y A;  1PV3 A;  3W67 A;  5BOK A;  3ITK A;  1YBK A;  2B88 A;  1VF5 C;  2IFN A;  4LGD E;  4EMJ B;  1JUN A;  3Q5R A;  2Q3W A;  3U1A A;  1LTS C;  3C0D A;  4HM5 A;  1EXJ A;  1YQ3 C;  2M8R A;  2ZFC A;  2QJK C;  3H32 B;  1FZA A;  1PPJ G;  3VMY A;  3AEB C;  2PRR A;  3CCV P;  4KT0 J;  1K04 A;  1CSB A;  4NPF X;  1SQP G;  1P84 H;  3CX5 H;  1VQ6 P;  1GU5 A;  3D6Z A;  1JM1 A;  3L70 G;  4Z1M H;  1CZQ A;  4W80 A;  1SFC A;  1LJ2 A;  1L0L D;  3GCE A;  4IOI H;  1ZRT D;  4U3F G;  1HGZ A;  2VRS A;  3CCE P;  1O7N A;  2P2U A;  3CCL P;  1N73 C;  1PFI A;  4JQ0 D;  5B5E H;  5AVV B;  4C7R A;  1RHZ B;  3VOP A;  3H1H J;  1L0L E;  1PGP A;  2QJP B;  2NVE A;  1RQU A;  4HM6 A;  1G2C A;  5KKZ B;  4L75 A;  3CD6 P;  3GZY A;  4NBC D;  4QUP A;  3A2A A;  1EC5 A;  1IFD A;  1KQG B;  5AVW B;  1H88 A;  2NRG A;  2KLU A;  4WY4 B;  3TYY A;  1UUW A;  3BVH A;  2Q7C A;  1N7S C;  1QL2 A;  3GTE A;  3H25 A;  4EDF A;  4H44 B;  1BSN A;  3H1K J;  1VDF A;  3OA7 A;  4TT3 H;  1RFS A;  3VCP A;  5KTB A;  2XSH A;  1FZE A;  4NBE D;  3CCM P;  1SQX J;  2W6J H;  1MFZ A;  1XTC C;  2K9J A;  2V7Q H;  1FJP A;  1OZH A;  3U1C A;  3QWO C;  3H1L G;  4XFJ A;  4QDF A;  1Y8A A;  1N73 A;  3L72 G;  1H89 A;  2J59 M;  1SP4 A;  1FZB A;  3FX0 A;  1O7P A;  1J1D C;  4WY4 D;  5CCH A;  2G3A A;  3SWY A;  1XTG B;  1DH3 A;  3G6E P;  2CPB A;  2GUS A;  1KD1 Q;  2OAR A;  2MJZ A;  2RMZ A;  3AEA C;  5L8R J;  3P7K A;  1Z56 A;  2WZ7 A;  3Q3D A;  3R2P A;  2OYH C;  2YKP A;  1L0N E;  3AEG C;  1N7S A;  3AEF C;  1SFC B;  4GDO A;  5AW0 B;  1S5L E;  1Q90 D;  2WSE H;  1SLQ A;  1GD2 E;  1AFO A;  2ZXE B;  2K3R A;  2WSF J;  3AE9 C;  3G3Z A;  4N6J A;  1O7W A;  3HTK A;  3AE3 C;  2IPP A;  4UB8 E;  5KAF E;  4HM2 A;  1LTJ C;  4ZNC A;  1O7M A;  2JP3 A;  4AYC A;  3HD7 B;  3SWF A;  1FDI A;  1L0L J;  3GHG C;  2QSI A;  1PGQ A;  1PIX A;  5B66 E;  5EFW B;  1SQQ D;  1QX8 A;  2ZT9 C;  3A0B H;  3RK3 C;  4NBA D;  1SFC D;  1VQK P;  4WB4 A;  2D2C C;  1YTZ I;  3L74 E;  1SQP K;  3VTP C;  1FE6 A;  1U7M A;  4D6T G;  1NAY A;  2QJK B;  1G8K B;  5E79 H;  2R44 A;  2DW3 A;  2OYH A;  1SQQ E;  1X22 A;  1KIL C;  3RBZ A;  1FZF A;  2K9J B;  3HD7 D;  3CC4 P;  4ZKP A;  1GW3 A;  3RK2 C;  2PP6 A;  1Y47 A;  2OGU A;  1FDO A;  1OVU A;  3EQ2 A;  5KAI H;  1VQN P;  4NBD D;  2ZVN B;  1G8J B;  1DEE G;  3B5N B;  1D7M A;  1N73 B;  2M3E A;  1DX7 A;  2KLV A;  4NBF D;  4MN4 C;  3AE2 C;  4AAY B;  2QRX A;  3FXD A;  2FYU K;  3AEE C;  2FFD C;  1LT1 A;  3GHG A;  3EQQ A;  2WPR A;  2B89 A;  2J5U A;  1T6A A;  1O7H A;  5CXM A;  3R4Y A;  3IR9 A;  3H1K G;  1KQL A;  2JEE A;  4Y28 J;  5BVZ A;  5AVU B;  3FWN A;  1L0N J;  1LTI C;  1N7S B;  3IFM A;  1J2J B;  2KUB A;  1M56 D;  2E5Y A;  3PHL A;  5AEW A;  4IL6 E;  5K5G B;  3GZX A;  1MUU A;  3GF3 A;  3B5N D;  1KIL A;  4HJG H;  3BAT A;  2QIW A;  3V5B A;  5AW2 B;  2H89 C;  2AXT E;  4IFM A;  5AVS B;  1BE3 D;  2BCC G;  3MTU E;  3N7N A;  2FY8 A;  2O01 N;  3AE5 C;  3BCC D;  1VQ7 P;  1J1D B;  1IO4 A;  2Q6Q A;  3L4F A;  1N7S D;  2FFD A;  3PLN A;  2Q1K A;  1BE3 E;  2BEQ D;  1LTT C;  5DJT B;  2JJL A;  3CX5 D;  3PP5 A;  3CC2 P;  2IX7 C;  2B24 A;  1OFC X;  1WRG A;  3BCC E;  4QDD A;  1DEB A;  1N8R Q;  1UIX A;  2E76 C;  1NYH A;  2OYH B;  1SQQ J;  2JWD A;  2B87 A;  1NTK D;  1FU1 A;  2FYN C;  2HPC A;  3L35 A;  4OGQ C;  2WSS H;  1K73 Q;  1HGV A;  1Q7Y Q;  5H2F H;  1CW5 A;  1VQ4 P;  1WQL A;  2HMO A;  3C8V A;  1NU1 D;  2W83 C;  2XZR A;  2FXP A;  1LWU C;  2WIT A;  1YHQ P;  4NBH D;  2H8P D;  3WUU A;  1U57 A;  1DIP A;  4KHX A;  2C9L Y;  2A45 H;  1NTK E;  3M0A A;  2AEF A;  1LTJ B;  2P1J A;  3JSV C;  1AJY A;  2KS1 A;  2OTK E;  3ZDM A;  1NU1 E;  1FQT A;  4BRY A;  3W68 A;  3CX5 I;  3H6P A;  1SQB E;  3PJS K;  2XU6 A;  3K5B A;  4YXD C;  2ZT9 B;  3RK3 B;  2KYV A;  3KPE A;  2HOD A;  2D2C B;  2R3C A;  1LP1 A;  2WMM A;  2JO6 A;  3I56 P;  1EG9 A;  1Q86 Q;  3WMM 0;  1PGO A;  4PV1 C;  5CCG C;  2QA4 P;  1NH4 A;  2JWA A;  3CCU P;  1NGM B;  2ZYD A;  3AE7 C;  1VQO P;  5TIS H;  2H7H A;  1ZW0 A;  1URQ B;  3I5C A;  5KLV E;  3AEC C;  1A02 J;  4EI2 A;  1SQV D;  2AEJ A;  2WVR A;  1UII A;  3N0Q A;  1LWU A;  3RK2 B;  2RKL A;  4I1L A;  3KZI H;  2ZT9 D;  3HRN A;  3RK3 D;  2D2C D;  3DQY A;  1BDC A;  2QVA A;  1SQV E;  3GKE A;  3O8Z A;  1NTM D;  1BE3 J;  2WT7 B;  2KB7 P;  3RK3 E;  1L0N G;  2CPS A;  3UIA A;  1SQX K;  1URQ D;  2YKO A;  1T3U A;  3BCC J;  4AQR D;  1GU4 A;  5GTI H;  1HJ0 A;  2AEM A;  4NPD A;  2K88 A;  1CI6 B;  3RK2 D;  3HUS A;  5KJ7 C;  2HPC B;  2DE5 D;  1W2B O;  1JY2 O;  3GB4 A;  1NTM E;  1JOC A;  5CCG A;  3MZW B;  4JPZ B;  4ASW A;  5HL4 A;  4PD4 H;  1NTZ D;  4EOT A;  3VCA A;  2A45 G;  3A0H H;  4UB6 H;  5AVR B;  1JCD A;  2R32 A;  3MIW A;  2O1J A;  2BMO A;  1NTK J;  1NYK A;  1VCK A;  3KHU A;  1ZR4 A;  2WPV B;  4OWF A;  1IFP A;  2KS1 B;  1M57 D;  1SS1 A;  2KP8 A;  3FOU A;  3Q5P A;  4BRY B;  1NU1 J;  1KB9 H;  2HMN A;  1SQB J;  1K9M Q;  1FZC C;  3L74 G;  2CKF A;  1JNM A;  4QUQ A;  1L4A C;  3CPW O;  1M1K Q;  2K37 A;  2ZVO B;  2E42 A;  3F89 A;  1JY3 O;  1N7L A;  2RH0 A;  4P1C H;  3TSI A;  3VMH D;  3CWB D;  2E76 B;  2QEX P;  3T97 A;  2H88 C;  4I7Z C;  3GL2 A;  2O01 J;  5E79 E;  5KJ7 A;  1Y9B A;  1R8E A;  4OGQ B;  2P67 A;  5KLV J;  2KNC A;  2NUK A;  1M8O B;  1IC2 A;  1L0L K;  1S4X A;  1H8A A;  4PJ0 H;  4I2L C;  4DZO A;  2R5B A;  3B4S A;  5CCH C;  2A06 D;  4YTP C;  2IBZ D;  3H1I D;  3LW5 J;  5KAI E;  1K8A Q;  1YJ9 P;  1ZRT E;  3H1J D;  1JM0 A;  3MP7 B;  1FZG A;  3WUV A;  1PP9 D;  2FYU G;  3IN6 A;  1SQV J;  2W6B A;  2LR2 A;  1GZL A;  2B9B A;  1FZC A;  2OTL P;  2A06 E;  2JKV A;  2IBZ E;  1BSH A;  1ULJ A;  1IFJ A;  5CBN A;  1L4A A;  1QVF O;  4OGQ D;  3H1I E;  1IK7 A;  1ZP0 C;  3H1J E;  2OTJ P;  3II6 A;  2QM7 A;  1PP9 E;  1BGY D;  1BCC G;  1NTM J;  3AZC A;  3GOB A;  2QJY C;  2KK7 A;  4C7N A;  2IBZ I;  2YFJ A;  1RF1 B;  2WSE J;  1BGY E;  4HM7 A;  3TGU D;  3N4X A;  2E4Q A;  4IFD K;  2I8D A;  5CBO A;  1AV1 A;  2XND H;  3CL3 D;  1NTZ J;  4H44 D;  1L2P A;  3RL0 C;  3EFF K;  4RES B;  1L0N K;  4R4L A;  1M7L A;  1T3J A;  4QCK A;  3TGU E;  2E74 C;  5CMZ A;  5AVZ B;  4NB8 D;  4WBA A;  4H13 B;  2NWF A;  3C9I A;  2FKW B;  2WPS A;  2FBW C;  1KZU B;  2RN0 A;  3VMA A;  1EZV D;  1E5W A;  2YNY A;  3OAK A;  4QUR A;  3L75 D;  3L73 D;  5GTH E;  2GBX A;  1NO4 A;  3JCU E;  3CC7 P;  3KYQ A;  4HH2 A;  4JBZ A;  2O3J A;  4HM1 A;  2WSC J;  1EZV E;  1PGJ A;  1SQB G;  1VF5 B;  1G2C B;  4GIF A;  1T2K C;  3L75 E;  3L73 E;  2UWJ E;  4H13 D;  1IFM A;  4JF7 A;  1FZC B;  4L74 A;  4WWI A;  5BU8 B;  5KJ7 D;  2ZYA A;  3CLQ A;  1L4A B;  1SQP D;  3F5H A;  3M9H A;  1S1C X;  3V4Q A;  1X9V A;  1YTZ T;  3H1I J;  3L70 D;  2ZYG A;  1JEK A;  1EZV I;  3H1J J;  4U7J A;  2L5G B;  1PP9 J;  3G71 P;  1KFN A;  3V6I A;  2W8Z A;  5KLV G;  3KXD A;  1EDJ A;  3TNU A;  1FOS F;  2Z4E A;  1LT9 C;  2PGD A;  3RGU A;  4I7Z B;  4U3F D;  1OWA A;  1SQP E;  5APQ A;  1VF5 D;  4H0L C;  4C7N B;  1HUC A;  3L70 E;  3H1H G;  3SFE C;  1S3J A;  4QDF B;  5AW1 B;  1FJK A;  1BGY J;  3I55 P;  1RE4 C;  2NVF A;  1N86 A;  2E75 C;  1GL2 A;  4DJG A;  2V4H A;  3GW6 A;  4YPC A;  4U3F E;  2HMK A;  3KDP B;  3FXE A;  4GT1 A;  1JMB A;  2YXR B;  5KLI C;  4HKV A;  4QDC A;  3VP8 A;  3TGU J;  3RBX A;  2IYP A;  3Q1M A;  2LXB A;  5CJ4 A;  2H43 A;  1QVG O;  2P58 A;  1SQX G;  2Y0E A;  3D89 A;  3VMX A;  5CCH D;  2NUM A;  1EQ7 A;  2ZJS E;  1LT9 A;  1VPC A;  2QJY B;  5M1B A;  3HTK B;  3IAO A;  3H1L D;  1NWQ A;  2DE7 D;  1YIT P;  2E4P A;  2Z5H A;  3L72 D;  3D70 A;  3A3Y B;  1RE4 A;  2GM4 A;  5APS A;  3L75 J;  1VL2 A;  3L73 J;  3MD0 A;  1LNQ A;  2MKV A;  1O7G A;  2C9N Y;  2M5A A;  5DJU B;  1N2D C;  3H1L E;  3RL0 B;  3FWL A;  1P84 D;  2IFM A;  3L72 E;  1QGK B;  3NXS A;  2I7F A;  3M0D A;  2FXM A;  1YI2 P;  2E74 B;  4JYB A;  3V2P A;  3NMD A;  3G4S P;  1RY3 A;  4M3L A;  1JMM A;  1P84 E;  2ZXX A;  3CX5 E;  4GOD A;  1NTK K;  1SQP J;  3L70 J;  1L0L G;  4IFF A;  1R5L A;  1VQP P;  4HJL A;  3V2Q A;  1AVY A;  1SQB K;  3RL0 D;  4HB1 A;  3OW2 O;  1GW4 A;  1FC2 C;  3M06 A;  5APT A;  2HR3 A;  1AQT A;  5BU5 A;  2QE7 H;  4LLH A;  1P84 I;  5B5E E;  3GHG B;  4U3F J;  4HYT B;  2E74 D;  2JO1 A;  2Y9Z A;  4HM4 A;  3VMZ A;  2IDB A;  1S72 P;  2Y0D A;  1USE A;  4NB9 D;  4HM3 A;  1GTW A;  2W27 A;  4D6T D;  3CCR P;  3MHV A;  1LTB C;  2XRX A;  2YVJ B;  3HUS C;  5KLV K;  4L76 A;  1OX3 A;  2M3B A;  1KIL B;  4W7Y A;  1DD3 A;  5APX A;  4D6T E;  2BEZ F;  5CHX A;  1G1I A;  3BRV B;  3RL0 g;  1R5S A;  1LT9 B;  1Q81 Q;  2KIK A;  1E79 H;  3GLM A;  1FS0 E;  1SJG A;  1ZXG A;  3EWK A;  1Q90 C;  3M91 A;  1S9K D;  1H0T A;  2FFD B;  3MUD C;  3PRJ A;  4A7P A;  1OMI A;  3H1L J;  1OW7 A;  2IZ1 A;  3L72 J;  1KIL D;  1ZN5 A;  2W6A A;  1NTM K;  1WT6 A;  1JY3 P;  2QG4 A;  2BAS A;  1S9K E;  1JCC A;  2B87 B;  1MFT A;  3S4R A;  3GTS A;  2KZJ A;  4WY4 A;  4IL6 H;  1IFI A;  1KIL E;  1ZR2 A;  2BMQ A;  5C39 A;  4WVZ A;  2N9B A;  3WUT A;  3B71 A;  2XV5 A;  3TF5 A;  2AXT H;  1NOH A;  2BCC D;  1HWT C;  4XA4 A;  2HFE D;  4HKZ H;  1HH0 A;  3M9B A;  3L75 G;  4B86 A;  1NTZ E;  4JYC A;  2Q3I A;  3GL0 A;  3HD7 C;  2OQQ A;  2BCC E;  1FOS E;  2N1T C;  3MUD A;  4DT0 A;  2HOD B;  1LP1 B;  1M90 Q;  3A0B E;  1SQQ G;  1VM9 A;  2QPZ A;  1A02 F;  2JR8 A;  1VQL P;  1KYO H;  2YO3 A;  4I6M C;  2NPS C;  2FYN B;  1FDM A;  1J1E C;  1PZQ A;  1YYC A;  3AE4 C;  4D6T J;  1VQ8 P;  2DE6 D;  1RF0 C;  1NVO A;  1LWU B;  3CWB E;  3GG2 A;  4HM8 A;  3EFG A;  4LC1 A;  3E1R A;  3CXH H;  4O9B A;  2V7Q J;  3CCJ P;  3NFQ A;  2QM8 A;  3VMG D;  5AW5 B;  1Q82 Q;  4KJM A;  3B5N C;  1QLE D;  1H0T B;  4OH8 B;  2E76 D;  1VQM P;  3HD7 A;  3P8C D;  1MKM A;  2KI7 B;  5TJH A;  3VN0 A;  2N1T A;  1KV4 A;  2JZA A;  1VQ5 P;  1EDL A;  3M9Q A;  3AE8 C;  1W2E A;  3V2R A;  3HUS B;  1OXZ A;  4CPG A;  1ULI A;  4PV1 B;  1LGH B;  3D71 A;  3P8C E;  3VYI A;  2O01 H;  2G8Y A;  2NPS A;  2E5T A;  2LXC B;  1GK6 A;  3A7O A;  1RF0 A; 
#chains in the Genus database with same CATH homology
 2NUK A;  3GZY A;  1VF5 D;  4NBC D;  4QUP A;  2NVG A;  2I7F A;  4QCK A;  3L70 E;  3EQQ A;  1BCC E;  4PD4 E;  3TGU E;  1VM9 A;  2QPZ A;  4NBH D;  4QDF B;  4NB8 D;  1O7W A;  1O7H A;  5CXM A;  1SJG A;  1UUW A;  2ZYL A;  4HM2 A;  2NVF A;  1NTK E;  2NWF A;  3GTE A;  2B1X A;  1O7M A;  1PPJ E;  1Q90 C;  5BOK A;  4U3F E;  2GBW A;  2DE5 D;  1ZRT E;  2HMK A;  4HM0 A;  3GB4 A;  3CX5 E;  1P84 E;  4P1B H;  1NTM E;  1RFS A;  5AEW A;  1NU1 E;  1FQT A;  3GZX A;  3VCP A;  2DE6 D;  4NBG D;  2XSH A;  4EMJ B;  4NBE D;  1SQB E;  4PV1 D;  2Q3W A;  5KLI C;  3C0D A;  4NBA D;  4HKV A;  4QUR A;  1KB9 E;  4HM5 A;  5HL4 A;  4QDC A;  3VCA A;  3CWB E;  4HM8 A;  2A06 E;  4AIV A;  2XSO A;  2GBX A;  3L74 E;  2IBZ E;  2QJK C;  1ULJ A;  2XR8 A;  4HJL A;  1NDO A;  4OGQ D;  3H1I E;  1G8K B;  2BMO A;  2JO6 A;  3VMG D;  1NYK A;  1EG9 A;  1VCK A;  4HM1 A;  3H1J E;  4QDF A;  3GTS A;  1RIE A;  2BMR A;  1EZV E;  1PP9 E;  1JM1 A;  1SQQ E;  3H1H E;  1O7P A;  2E74 D;  3VMI D;  3L75 E;  3FOU A;  3L73 E;  2HMM A;  3D89 A;  3AZC A;  2E76 D;  4H13 D;  4NBB D;  3GOB A;  4HM4 A;  2BMQ A;  2HMN A;  1KYO E;  2NUM A;  2QJY C;  5KLV E;  4NB9 D;  2CKF A;  4HM3 A;  3GCE A;  5AEU A;  2JZA A;  1BE3 E;  4QUQ A;  2DE7 D;  2E4P A;  2YFJ A;  2YFI A;  3N0Q A;  1O7N A;  2B24 A;  2XRX A;  2YFL A;  2YVJ B;  1BGY E;  3EN1 A;  2FYU E;  4H0L D;  4NBD D;  1UUV A;  3L71 E;  3BCC E;  4HM7 A;  4P1C H;  1G8J B;  4QDD A;  2ZT9 D;  2E4Q A;  1ULI A;  1L0N E;  4NBF D;  3VMH D;  1NTZ E;  2HML A;  2D2C D;  2QJP C;  3H1K E;  4AAY B;  3CXH E;  1L0L E;  3GL0 A;  2HMJ A;  2FYN C;  2YIU C;  4H44 D;  1O7G A;  4D6T E;  2E75 D;  3DQY A;  3GL2 A;  5KKZ C;  2NVE A;  2BCC E;  3H1L E;  1WQL A;  4HM6 A;  1SQX E;  1SQV E;  2HMO A;  3GKE A;  3L72 E;  1SQP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...