1L0NE

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 33
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0nE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0nE02
3FOUA 2YFIA 4HKVA 2BMQA 2BMOA 2E76D 3GCEA 3GOBA 1NDOA 4NB8D 1O7WA 2GBWA 2HMOA 1NYKA 4HM6A 3VMGD 3N0QA 4NBCD 2DE5D 1Q90C 3H1LE 1O7NA 1SQVE 2YIUC 1SQBE 3GB4A 4QDDA 5BOKA 3L75E 3H1KE 4EMJB 2FYUE 3BCCE 3VCAA 2JO6A 3CX5E 3GZXA 3VCPA 1L0LE 3CWBE 4OGQD 3L74E 2CKFA 2E4PA 4QDFA 1RIEA 1BE3E 2A06E 1WQLA 2Q3WA 4NBDD 1UUVA 2B1XA 3TGUE 2FYNC 2QJPC 4D6TE 4NBED 2XSHA 3GKEA 4AAYB 2DE7D 4HM1A 2YVJB 2XSOA 5AEWA 5KLVE 1PP9E 2ZT9D 2E74D 1SQQE 3L70E 2NUMA 4QCKA 3L73E 4QURA 1VF5D 2XR8A 4HM8A 2D2CD 2DE6D 2NVEA 3DQYA 2QPZA 4HM4A 4HM3A 4NBHD 1EZVE 1O7GA 4U3FE 3D89A 1ULJA 1NTKE 2HMJA 3EQQA 1NTZE 4QDFB 3C0DA 4PV1D 1ZRTE 5AEUA 2E4QA 1SQPE 2HMLA 3L71E 4QUPA 2YFJA 4QUQA 2ZYLA 3VMID 1FQTA 2NUKA 2IBZE 1BGYE 2YFLA 2QJYC 1ULIA 4NB9D 4P1BH 5CXMA 2HMMA 1VCKA 4NBAD 1NU1E 2QJKC 1O7PA 2NVFA 3H1IE 1VM9A 1UUWA 4P1CH 4NBBD 1SQXE 3H1HE 3H1JE 3GTSA 4PD4E 1G8KB 1KYOE 1O7HA 2E75D 2XRXA 3EN1A 2BMRA 4H0LD 1SJGA 3AZCA 1NTME 4H44D 3GTEA 1G8JB 3GL0A 2NWFA 2BCCE 2HMNA 2NVGA 4H13D 1O7MA 2HMKA 1P84E 4QDCA 1KB9E 3L72E 1JM1A 5HL4A 3VMHD 4HJLA 4AIVA 2I7FA 4HM5A 3CXHE 3GL2A 4NBFD 3GZYA 4HM7A 5KLIC 5KKZC 1L0NE 2GBXA 1BCCE 1RFSA 4HM0A 2B24A 1EG9A 4HM2A 1PPJE 2JZAA 4NBGD
chains in the Genus database with same CATH superfamily
2P10A 4PD4H 1AJYA 1OWAA 1URQC 2L5GB 3KDPB 3I5CA 4UB8H 1NVOA 2QA4P 3QWOC 1N8RQ 3TK1A 2M5AA 5KAFE 3GG2A 4GOFA 1Q90C 2KSEA 2B87A 3CX5E 5CBNA 1L0LE 1YJNP 3TDKA 3H1ID 1IFDA 2Q3WA 1LTJB 3V2PA 3H32A 1N7SA 1J2JB 2JR8A 2HLOA 2OYHB 2FYZA 3G71P 2NUMA 1MZ9A 1G2CA 2OYOA 1JO5A 3DQYA 3MIWA 4O9BA 2Z5IA 1L0LK 2N9BA 1USDA 4PV1D 5AEUA 1QL1A 1SFCA 1BDDA 5AW0B 4GT1A 1S1CX 4GDOA 4XE5B 1W5CE 2LXCB 4NBBD 2KK7A 3MUDC 1KQGB 1NO4A 5AVTB 3AZCA 3JCUH 3N4XA 4DCKA 1L4AA 3AE9C 3M0DA 1X9VA 3GW6A 4JBZA 3SWFA 3B8EB 3GHGC 5CCHC 4NBFD 5AW2B 3H1HJ 1L0NE 4BWNA 3HD7A 3H1HG 3CX5D 2WT7B 1PIXA 2ZYDA 2NPSB 3BCCJ 2PGDA 4BXLA 1VPCA 3CLQA 1JY2O 3JC22 2OTKE 1NKZB 3S4RA 1JY3O 2Q7CA 2YKQA 1BE3J 4QDFA 1LJ2A 1T2KC 1FJKA 4K3AA 1L0NK 3NTNA 2FYNC 3SSUA 1S5LE 3G3ZA 1WRGA 2WSCJ 2KI7B 2JO1A 3VOPA 2WSSH 4HJGH 4EIJA 1OMIA 1FZCB 2POHA 1N2DC 4P1BH 2HMMA 1N7SC 1T3UA 1RF1A 3L75D 4PJ0E 4PD4E 1O7HA 4GKGA 3NMDA 4UB8E 1NHLA 3JSVC 2IPPA 1KILA 2MKVA 2W83C 2NPSD 5KAIE 5KJ7A 1SFCC 2R44A 1KTMA 3GZYA 2KYVA 2E75B 1EG9A 1PPJE 4H0LB 1LWUB 2BMOA 2HPCB 1EZVD 1JMMA 2HMOA 2GBWA 3VMGD 1NJIQ 3VP8A 1OVVA 1IK9A 3H1LE 2QEXP 1QVFO 2FFDA 3H1KE 1L4AC 1J1DB 3P8MC 4WB4A 2JWDA 1HJ0A 3GZXA 1AVYA 3M0DC 2R32A 2PRRA 4NBDD 1ZR2A 4HB1A 1GTWA 1PV3A 1WMKA 1Q81Q 3CCEP 3MD0A 2M0BA 1PP9E 2M8RA 1FAVA 1JNMA 1GU4A 4QURA 2DE6D 2W6JH 2H88C 1KQSO 4EYYQ 1QLED 2HMLA 5CXMA 4EOTA 3VMAA 3C9IA 3BASA 1FOSF 3B5NB 1JUNA 2E75D 1KFMA 2IDBA 5AW7B 4H0LD 3AEBC 1X8YA 3V4QA 1H88A 5DJUB 5B5EH 1LTBC 1GDTA 2JP3A 3HUSB 3AE4C 3O8ZA 1KYOI 1SQPG 3VYIA 4QDCA 1SP4A 1U7JA 4L75A 3RL0C 5KKZB 2ZYGA 3H1LD 1R8EA 1A02J 2PFXA 3L4FA 1NU1G 4RKUJ 2H7HA 4HM2A 2O1JA 5DJTB 2O1KA 3CCJP 3CCLP 3W67A 3WU2H 1RF1C 1T3JA 1M1KQ 3KPEA 2P7JA 2C0XA 1FDIA 4H13B 4NBCD 1OVRA 1NTKK 2FXPA 2YIUC 1SQBE 2B89A 3OJAB 1KILC 5TJHA 1HBWA 2QM7A 3CWBE 4W80A 1AV1A 5KJ7C 1GL2B 1AQTA 2IYOA 2QJPC 4D6TE 2WWWA 5KLVJ 1PGPA 4U7JA 3T97B 5KLVG 4C7NA 5GTHE 4IOIH 1SQBK 3B5ND 3SFDC 2FFDC 4HM3A 2WSEH 5GTIH 2HR3A 3TGUG 1FU1A 1KMIZ 2ITAA 1IK7A 3D71A 1BGYE 3L73J 4R4MA 3RK2C 3A7OA 3L73G 3CX5H 2YKPA 2KSJA 4EI2A 2I8DA 3G6EP 3Q3DA 1X22A 2BCCE 1KZUB 4H13D 2XNXA 3L72E 3C1LA 4AIVA 2QJKB 1EC5A 3TNUA 1URQA 5CMZA 2J58A 1KQFB 4N78E 1HH0A 1W2BO 2V7QJ 3GCEA 3CWBD 3CXHI 1GL2D 1S9KE 1NTMG 3M91A 4B86A 4D6TD 1SQPD 1QEXA 3SWYA 4EMJB 3AECC 2FYUE 4YXDC 1J1EC 1BDCA 3VCPA 1NU1D 4OWFA 2XKMA 2A06E 1IZNB 3AEEC 4AAYB 3ITKA 1Y47A 3HE4A 5AVZB 1QGKB 5H2FE 1BGYD 3L70E 1LT9A 1G1JA 1LTIC 2YMYA 3LW5J 2FYUK 2P2UA 1NTZJ 5AVRB 1BCCD 1JM0A 4U3FE 3D89A 1LTGC 1OX3A 1H0TA 3PH0A 1CI6A 1RE3A 4QUPA 1ZP0C 2NUKA 2R5DA 3HTKA 3UIAA 1SQVD 1JTHA 1SLQA 2ZT9C 1VL2A 2RMZA 1M1JB 1O7PA 3H1IE 4P1CH 1HJBA 1FZEA 2QIWA 3WU2E 2N1TB 5KTBA 4N78D 5CCGA 3U1AA 3GHGA 3TGUD 1FBMA 1FDMA 1O7MA 2IZ0A 1MFTA 1E5WA 4HM7A 5KLIC 3E1IA 3CMEP 1JEKA 2B24A 1P84I 3N7NA 4Z1MH 2JZAA 2YFIA 2BMQA 1JOCA 3B71A 1HF9A 2A06D 1VQMP 4HM6A 3LIEA 2O01H 2DE5D 5APYA 1T8ZA 3U1CA 3GB4A 2Y0CA 2ZFCA 1PZQA 2AXCA 1L0LJ 4WBAA 3CL3D 3FGAD 3L70D 3H6PA 4RESB 4PJ0H 3KXDA 1M90Q 1KYOD 5GTIE 4L74A 3RGUA 4BRYB 4U3FD 1NTMD 1ZXGA 2KS1A 3WUTA 4R4LA 5AEWA 3MP7B 1W2EA 1Q2NA 3MHVA 3C8VA 5KAIH 1HGZA 3B4SA 3A5TA 1NOHA 4OGQB 2ZYAA 3VN0A 2M3BA 2G3AA 2HMJA 3IF4A 4ZKUA 2HG5D 2E42A 3Q5PA 2H89C 2YO2A 2E74C 1JCCA 4AQRD 2IBZI 2XRXA 2P58A 3L74D 2KLVA 4EDFA 1LT9C 1LT1A 2FKWB 2CPSA 3Q5RA 2HODB 5C39A 1KV4A 1KB9E 2OGUA 3H25A 1EDIA 2WTYA 2NPSC 1RE3C 1L0NJ 3W68A 3H1JJ 3NFQA 1L0NG 4HM0A 3IN6A 2K37A 3H1JG 2G8YA 2A45I 2E76D 2KLUA 1GMJA 4H44B 4ZNCA 5CJ0A 1EDJA 1N73A 3M9HA 5AVWB 3L75E 5CCGC 4IFMA 5AVYB 4L76A 4OGQD 3Q5SA 1T6AA 1GW4A 1IFIA 2BASA 4JYCA 4QMAA 4N6JA 1VDFA 3K5BA 3CCRP 2XSHA 1IFNA 4YTPC 5APVA 1EDKA 3GF7A 3BCCG 2QM8A 4ZKPA 4DOJA 4YPCA 1EZVE 3BATA 1M57D 1BE3G 2YXQB 1YQ4C 3AEGC 3L36A 2GM4A 2YFLA 1ULIA 4KHXA 1KORA 3GF3A 3D70A 1FE6A 1KB9D 1FOSE 4GODA 2WSFH 3H1HE 2R3CA 3GTSA 2Z4EA 1SJGA 2HFED 3RBZA 4H44D 2C9LY 1Q90D 3GL0A 4N3YB 2OYIB 1ZOYC 3VMXA 2HMKA 1VQ7P 2IBZG 2I7FA 2H43A 1HVVA 3AE2C 5GTHH 4C46A 1PPJG 4NBGD 2JJLA 4NB8D 3A3YB 2KZIA 5TISH 1Y8AA 1RH5B 3H1KJ 1AVOA 1X79B 1OVUA 3HE5A 3H1KG 2A45G 2RH0A 3VCAA 3AEDC 4I7ZC 2ZXXA 2O3JA 2Q3EA 1GK6A 3KZIE 3L35A 1PP9J 1PGJA 2XSOA 2H8PD 3D6YA 2KS1B 2M5AB 1YJ9P 1P84D 1PP9G 3I56P 4QCKA 1N73C 4ASWA 2NVEA 2B87B 1MFZA 4NBHD 5AW9B 2FXOA 3H1HD 4WY4A 4HKZH 1LP1A 2Y0EA 3H32B 1N7SB 3HUSC 2QJYC 2IX7C 1FZFA 5CCHD 2K9JA 5AVQB 1ZW0A 2E5YA 4HYTB 2QRXA 1OFCX 2YNYA 2NVFA 2I1JA 3BCCD 3WUUA 1NAYA 1NTKJ 3EN1A 4IL6X 1G2CB 1NTKG 1BE3D 4MN4C 3L71J 3GTEA 2P67A 4HH2A 2ZAEB 3L71G 4I6MC 1SFCB 1FZBA 4H13C 3S1KA 4GIFA 1SVFA 3PHLA 5H2FH 2B88A 1OW6A 1OXZA 5AW6B 3ZDMA 3FOUA 1M56D 3OAKA 1KYOH 4TT3H 3FWNA 1K04A 3GOBA 3BRVB 4DZOA 1SQBJ 3N0QA 1RHZB 1E79H 1L4AB 3CI9A 1SQBG 1QX8A 2UWJE 2LXBA 2CKFA 4I1LA 1WQLA 5M1BA 3HD7B 1GU5A 1UUVA 1JMBA 2KNCA 3IFMA 2AXTE 1VQ8P 1K8AQ 1VQKP 2W8ZA 1N7SD 1MV8A 1RQUA 4JQ0D 4I2LC 3O6QA 1VQ4P 3R2PA 3EQQA 4QDFB 2KB7P 2WPQA 1SQPE 2OQQA 1FDOA 2JWAA 3F5HA 3VMZA 3OA7A 1SFCD 4L73A 1SQQJ 4XA4A 2B9BA 1NU1E 2QG4A 2QJKC 1SQQG 1VM9A 1JB0J 3GMAA 1VF5C 3WMM0 1G8KB 2W90A 3AEAC 1K05A 1ZV8A 5CBOA 5AVVB 5TISE 2BCCJ 3L72J 5APQA 4WY4C 1L4AD 1SQPK 1LGHB 4W7ZA 2HYNA 3GLMA 1SQXJ 2NZ2A 1BCCE 1RFSA 1ZN5A 3CCUP 1LTJA 1RF1B 1SQXG 1NU1K 3MTUE 1LTAC 3HD7D 1CW5A 2K88A 2YIUB 2OYHA 1KILE 1USEA 1SQVE 1KILB 2FYUJ 2OARA 2PP6A 4JYBA 3V2QA 1EQ7A 1IJDB 3CX5I 3TGUE 2JKVA 4NBED 2K9YA 3R4YA 3Q1MA 2KXPB 2Q6QA 2YVJB 1AQ5A 4CPGA 2M3EA 1KB9H 3EQ2A 3NXSA 4OH8B 3PJSK 2YXRB 1SQVK 3L73E 2FFDB 2WVRA 3P7KA 1M1JC 4NPFX 3CPWO 2KUBA 3U59A 3PTZA 5CHXA 2E4QA 4DT0A 1PGQA 2IFNA 2ZYLA 1BSHA 3EFFK 3EWKA 3H1IJ 5APXA 2D2CB 1UUWA 3H1IG 1DD3A 2WT7A 1KYOE 4DJGA 2K3RA 2ZVNB 2Z5HA 3AE3C 1OZHA 4JPZB 3TSIA 1BSNA 1NTME 3A0BH 1NTZG 5BVZA 2NPSA 4PV1C 3HRNA 3RBXA 2YMKA 1S3JA 3SWKA 2WZ7A 4LLHA 1KILD 5KLVD 3F89A 4LGDE 2XZRA 1A02F 5AW3B 1IC2A 1YTZI 1YIJP 4Y99C 2E76C 5EFWB 3E1RA 1NAFA 1PFIA 3CC2P 1NTMK 1DD4A 1GK4A 5AVSB 2FBWC 1J1EB 1P84H 5BOKA 2E43A 2WMMA 1IFPA 1QL2A 1DIPA 2WPSA 4KT0J 2WSEJ 3L74E 3L73D 1RIEA 4C7RA 1FZCA 1VQ9P 1KQLA 1LTJC 1VQ6P 4HM1A 4XFJA 1Z56A 2O01N 3AEFC 2J5UA 3M9BA 3V4WA 1OW8A 1LNQA 1X0TA 1SS1A 2OYHC 3RK3E 2AEMA 2D2CD 4Y28J 3RK3B 2C9NY 1L0LG 5BU8B 3WUVA 3I55P 4RO0A 2VRSA 3C0DA 1CZQA 2R3SA 2YFJA 2FY8A 5B66H 2ZJSE 1GZLA 2ZT9B 4NBAD 4C7NB 1LWUA 1YQ3C 2KP8A 2HPCA 5AW1B 2WSCH 4IL6H 1FJPA 2YKOA 2WQYC 2N1TD 1DH3A 3KZIH 4H44C 5K5GB 4PD4I 2NWFA 2HMNA 5E79E 4RJTA 5KLIB 3CXHE 3GL2A 2Y9ZA 1Q86Q 2GBXA 1VQOP 1R5LA 1NTZD 3VTPC 1M8OB 3CCMP 3Q2YA 3AE1C 3L75J 1S4XA 5APSA 3L75G 3KYQA 2A45H 2XU6A 3TNUB 1URQB 2JDIH 2IFMA 1DX7A 1JY2N 3RK3D 2KIKA 1JY3N 2B1XA 1U7MA 1N86A 1NWQA 1N7LA 2ZVOB 3B5NA 2L91A 2ZT9D 3CCSP 1U57A 3KQGA 1EZVG 3A0BE 1JY2P 3HUSA 2P1JA 1JY3P 1R5SA 1XTCC 3V6IA 3CCQP 1FZCC 4NB9D 2OYIC 2E74B 3HE4B 1VCKA 3A0HH 4JF7A 1DEEG 3CXHD 3H1JE 1LT9B 2BMRA 1L0LD 2QSIA 5APTA 2O01J 1ZLLA 3AE5C 3P8CE 1VQ5P 1H0TB 1CI6B 2AXTH 2GA1A 1VQPP 1P84E 1JM1A 3VMHD 2V4HA 4HJLA 1TU3F 1YYCA 1H8AA 3HTKB 3CCVP 2KZJA 4TLFA 1GL2A 1JTHB 4UB6H 3G9RA 1URQD 2PAJA 2E75C 4ASVA 3TF5A 3MGNA 4H0LC 1LWUC 1NDOA 1OIPA 3T97A 1Q7YQ 1NYKA 1LTSC 4KJMA 3CC4P 1YITP 1S72P 1FC2C 4QDDA 3GHGB 5AW8B 5CJ4A 3L37A 3BCCE 2RKLA 3SFEC 3D6ZA 1J1DC 2W6AA 2AEFA 4ZMDA 1BE3E 5APWA 1FZGA 3CD6P 2W6BA 5BU5A 3H1LJ 5B66E 3H1LG 2E74D 2LKMA 1CSBA 3CMAP 2BEQD 4IL6E 3AE8C 4HM4A 1L0ND 2FYNB 3H1JD 3USSA 1HGVA 3E7KA 3P8CD 3VMID 2IBZE 1S5LX 3CC7P 1L2PA 1Q82Q 2LR2A 1YI2P 3B5NC 5AVUB 1HTLC 1YJWP 2WPVB 2GUSA 3S9OA 1HUCA 2OTJP 1K9MQ 2I1KA 2R5BA 5CCGD 2E5TA 1LTTC 2Y9YA 1RF0A 1NGMB 1VQNP 5KKZC 3PRJA 4HKVA 3HD7C 1O7WA 1UIIA 2IYPA 3OW2O 3BRTB 1VQLP 2MJZA 1JCDA 4I7ZB 5L8RJ 2J59M 3ABVC 4W7YA 1NYHA 1T2KD 2E4PA 3JCUE 1D7MA 3QH9A 4PD4D 2FXMA 4WWIA 1ZMEC 1GL2C 2V7QH 2DE7D 1M1JA 2WSFJ 1IO4A 3A0HE 3PP5A 1N73B 3VMYA 2IBZD 3CWBJ 3M0AA 1WT6A 2N1TA 3BVHA 2QPZA 3CWBG 2C0WA 1O7GA 1PPJD 1IFJA 1NTKE 4D6TJ 1ZR4A 1SQPJ 3EFGA 3M9QA 1G1IA 2IZ1A 3AE6C 4D6TG 2QJYB 3L71E 4WVZA 4QUQA 2BEZF 1NU1J 3FXDA 3H1KD 4UB6E 4OVNF 3LW5H 1BGYJ 5HL4A 1GW3A 1BGYG 4HM5A 3FWLA 1BCCJ 3RL0g 1PP9D 3IAOA 1BCCG 4YXWH 2Q1KA 4BRYA 2XNDH 1SQVJ 3RL0B 2BCCG 1SQVG 3L72G 1KN7A 2JO6A 2YO3A 1RF0C 3TGUJ 1RQVA 4M3LA 2W27A 4IFFA 1S2EA 1NTKD 1Y9BA 2DW3A 2Y0DA 5KAFH 3MZWB 1DEBA 3P32A 5KLVE 3L71D 5E79H 1FS0E 1UIXA 2ZXEB 1SQQE 1RE4A 1QVGO 2FYUG 4IFDK 3CXHH 2Q3IA 3HE5B 2XR8A 3AE7C 2D2CC 1KC8Q 2RN0A 2SPZA 2A06G 2QJPB 2HODA 1ZRTE 2N9YB 3V2NA 1OW7A 1HWTC 2CPBA 3IR9A 5AW4B 2JEEA 1FQTA 2WPRA 5AW5B 1YTZT 3L70J 1SQBD 1VF5B 3L70G 5KLVK 1SQXE 4U3FJ 2XV5A 2Q9IA 1KFNA 1SQQK 1NTMJ 1RY3A 4U3FG 1PL5A 3KHUA 2N1TC 5APUA 4NPEA 4NPDA 4WY4B 2WITA 2CK3H 1LP1B 3RL0D 5AVXB 3RK2B 2K9JB 2KOGA 4K35A 1KB9I 2QVAA 3G4SP 1IFMA 1NH4A 3A2AA 1SQXK 3V2RA 4A7PA 2QE7H 1O7NA 2OTLP 3L74J 3M06A 1SQQD 1PGOA 3L74G 5KJ7D 5B5EE 3RK3C 3TYYA 3FX0A 1EXIA 1AFOA 3GKEA 1MKMA 4LC1A 4AYCA 1GD2E 1ZRTD 1AA0A 2BCCD 3MUDA 3VP9A 3L72D 1M7LA 2GUVA 2AEJA 2NRGA 1KD1Q 2Q5UA 1VF5D 1K73Q 4HM8A 1FZAA 1YHQP 4OGQC 1ULJA 1SQXD 2XDJA 1NTZE 3PLNA 2OYIA 1YBKA 3LIDA 4GOEA 5CCHA 1S9KD 2KNCB 4WY4D 1EDLA 1EZVI 1XTGB 1S5LH 4AUWA 1NKNA 3RK2D 2FYUD 2K1AA 1RE4C 4PV1B 3II6A 1MUUA 3O6QB 1G8JB 3FXEA 1NTZK 2NVGA 3V5BA 1H89A 4Y99B 2E76B 1EXJA
chains in the Genus database with same CATH topology
3FOUA 2YFIA 4HKVA 2BMQA 2BMOA 2E76D 3GCEA 3GOBA 1NDOA 4NB8D 1O7WA 2GBWA 2HMOA 1NYKA 4HM6A 3VMGD 3N0QA 4NBCD 2DE5D 1Q90C 3H1LE 1O7NA 1SQVE 2YIUC 1SQBE 3GB4A 4QDDA 5BOKA 3L75E 3H1KE 4EMJB 2FYUE 3BCCE 3VCAA 2JO6A 3CX5E 3GZXA 3VCPA 1L0LE 3CWBE 4OGQD 3L74E 2CKFA 2E4PA 4QDFA 1RIEA 1BE3E 2A06E 1WQLA 2Q3WA 4NBDD 1UUVA 2B1XA 3TGUE 2FYNC 2QJPC 4D6TE 4NBED 2XSHA 3GKEA 4AAYB 2DE7D 4HM1A 2YVJB 2XSOA 5AEWA 5KLVE 1PP9E 2ZT9D 2E74D 1SQQE 3L70E 2NUMA 4QCKA 3L73E 4QURA 1VF5D 2XR8A 4HM8A 2D2CD 2DE6D 2NVEA 3DQYA 2QPZA 4HM4A 4HM3A 4NBHD 1EZVE 1O7GA 4U3FE 3D89A 1ULJA 1NTKE 2HMJA 3EQQA 1NTZE 4QDFB 3C0DA 4PV1D 1ZRTE 5AEUA 2E4QA 1SQPE 2HMLA 3L71E 4QUPA 2YFJA 4QUQA 2ZYLA 3VMID 1FQTA 2NUKA 2IBZE 1BGYE 2YFLA 2QJYC 1ULIA 4NB9D 4P1BH 5CXMA 2HMMA 1VCKA 4NBAD 1NU1E 2QJKC 1O7PA 2NVFA 3H1IE 1VM9A 1UUWA 4P1CH 4NBBD 1SQXE 3H1HE 3H1JE 3GTSA 4PD4E 1G8KB 1KYOE 1O7HA 2E75D 2XRXA 3EN1A 2BMRA 4H0LD 1SJGA 3AZCA 1NTME 4H44D 3GTEA 1G8JB 3GL0A 2NWFA 2BCCE 2HMNA 2NVGA 4H13D 1O7MA 2HMKA 1P84E 4QDCA 1KB9E 3L72E 1JM1A 5HL4A 3VMHD 4HJLA 4AIVA 2I7FA 4HM5A 3CXHE 3GL2A 4NBFD 3GZYA 4HM7A 5KLIC 5KKZC 1L0NE 2GBXA 1BCCE 1RFSA 4HM0A 2B24A 1EG9A 4HM2A 1PPJE 2JZAA 4NBGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOU A;  2YFI A;  4HKV A;  2BMQ A;  2BMO A;  2E76 D;  3GCE A;  3GOB A;  1NDO A;  4NB8 D;  1O7W A;  2GBW A;  2HMO A;  1NYK A;  4HM6 A;  3VMG D;  3N0Q A;  4NBC D;  2DE5 D;  1Q90 C;  3H1L E;  1O7N A;  1SQV E;  2YIU C;  1SQB E;  3GB4 A;  4QDD A;  5BOK A;  3L75 E;  3H1K E;  4EMJ B;  2FYU E;  3BCC E;  3VCA A;  2JO6 A;  3CX5 E;  3GZX A;  3VCP A;  1L0L E;  3CWB E;  4OGQ D;  3L74 E;  2CKF A;  2E4P A;  4QDF A;  1RIE A;  1BE3 E;  2A06 E;  1WQL A;  2Q3W A;  4NBD D;  1UUV A;  2B1X A;  3TGU E;  2FYN C;  2QJP C;  4D6T E;  4NBE D;  2XSH A;  3GKE A;  4AAY B;  2DE7 D;  4HM1 A;  2YVJ B;  2XSO A;  5AEW A;  5KLV E;  1PP9 E;  2ZT9 D;  2E74 D;  1SQQ E;  3L70 E;  2NUM A;  4QCK A;  3L73 E;  4QUR A;  1VF5 D;  2XR8 A;  4HM8 A;  2D2C D;  2DE6 D;  2NVE A;  3DQY A;  2QPZ A;  4HM4 A;  4HM3 A;  4NBH D;  1EZV E;  1O7G A;  4U3F E;  3D89 A;  1ULJ A;  1NTK E;  2HMJ A;  3EQQ A;  1NTZ E;  4QDF B;  3C0D A;  4PV1 D;  1ZRT E;  5AEU A;  2E4Q A;  1SQP E;  2HML A;  3L71 E;  4QUP A;  2YFJ A;  4QUQ A;  2ZYL A;  3VMI D;  1FQT A;  2NUK A;  2IBZ E;  1BGY E;  2YFL A;  2QJY C;  1ULI A;  4NB9 D;  4P1B H;  5CXM A;  2HMM A;  1VCK A;  4NBA D;  1NU1 E;  2QJK C;  1O7P A;  2NVF A;  3H1I E;  1VM9 A;  1UUW A;  4P1C H;  4NBB D;  1SQX E;  3H1H E;  3H1J E;  3GTS A;  4PD4 E;  1G8K B;  1KYO E;  1O7H A;  2E75 D;  2XRX A;  3EN1 A;  2BMR A;  4H0L D;  1SJG A;  3AZC A;  1NTM E;  4H44 D;  3GTE A;  1G8J B;  3GL0 A;  2NWF A;  2BCC E;  2HMN A;  2NVG A;  4H13 D;  1O7M A;  2HMK A;  1P84 E;  4QDC A;  1KB9 E;  3L72 E;  1JM1 A;  5HL4 A;  3VMH D;  4HJL A;  4AIV A;  2I7F A;  4HM5 A;  3CXH E;  3GL2 A;  4NBF D;  3GZY A;  4HM7 A;  5KLI C;  5KKZ C;  1L0N E;  2GBX A;  1BCC E;  1RFS A;  4HM0 A;  2B24 A;  1EG9 A;  4HM2 A;  1PPJ E;  2JZA A;  4NBG D; 
#chains in the Genus database with same CATH topology
 2P10 A;  4PD4 H;  1AJY A;  1OWA A;  1URQ C;  2L5G B;  3KDP B;  3I5C A;  4UB8 H;  1NVO A;  2QA4 P;  3QWO C;  1N8R Q;  3TK1 A;  2M5A A;  5KAF E;  3GG2 A;  4GOF A;  1Q90 C;  2KSE A;  2B87 A;  3CX5 E;  5CBN A;  1L0L E;  1YJN P;  3TDK A;  3H1I D;  1IFD A;  2Q3W A;  1LTJ B;  3V2P A;  3H32 A;  1N7S A;  1J2J B;  2JR8 A;  2HLO A;  2OYH B;  2FYZ A;  3G71 P;  2NUM A;  1MZ9 A;  1G2C A;  2OYO A;  1JO5 A;  3DQY A;  3MIW A;  4O9B A;  2Z5I A;  1L0L K;  2N9B A;  1USD A;  4PV1 D;  5AEU A;  1QL1 A;  1SFC A;  1BDD A;  5AW0 B;  4GT1 A;  1S1C X;  4GDO A;  4XE5 B;  1W5C E;  2LXC B;  4NBB D;  2KK7 A;  3MUD C;  1KQG B;  1NO4 A;  5AVT B;  3AZC A;  3JCU H;  3N4X A;  4DCK A;  1L4A A;  3AE9 C;  3M0D A;  1X9V A;  3GW6 A;  4JBZ A;  3SWF A;  3B8E B;  3GHG C;  5CCH C;  4NBF D;  5AW2 B;  3H1H J;  1L0N E;  4BWN A;  3HD7 A;  3H1H G;  3CX5 D;  2WT7 B;  1PIX A;  2ZYD A;  2NPS B;  3BCC J;  2PGD A;  4BXL A;  1VPC A;  3CLQ A;  1JY2 O;  3JC2 2;  2OTK E;  1NKZ B;  3S4R A;  1JY3 O;  2Q7C A;  2YKQ A;  1BE3 J;  4QDF A;  1LJ2 A;  1T2K C;  1FJK A;  4K3A A;  1L0N K;  3NTN A;  2FYN C;  3SSU A;  1S5L E;  3G3Z A;  1WRG A;  2WSC J;  2KI7 B;  2JO1 A;  3VOP A;  2WSS H;  4HJG H;  4EIJ A;  1OMI A;  1FZC B;  2POH A;  1N2D C;  4P1B H;  2HMM A;  1N7S C;  1T3U A;  1RF1 A;  3L75 D;  4PJ0 E;  4PD4 E;  1O7H A;  4GKG A;  3NMD A;  4UB8 E;  1NHL A;  3JSV C;  2IPP A;  1KIL A;  2MKV A;  2W83 C;  2NPS D;  5KAI E;  5KJ7 A;  1SFC C;  2R44 A;  1KTM A;  3GZY A;  2KYV A;  2E75 B;  1EG9 A;  1PPJ E;  4H0L B;  1LWU B;  2BMO A;  2HPC B;  1EZV D;  1JMM A;  2HMO A;  2GBW A;  3VMG D;  1NJI Q;  3VP8 A;  1OVV A;  1IK9 A;  3H1L E;  2QEX P;  1QVF O;  2FFD A;  3H1K E;  1L4A C;  1J1D B;  3P8M C;  4WB4 A;  2JWD A;  1HJ0 A;  3GZX A;  1AVY A;  3M0D C;  2R32 A;  2PRR A;  4NBD D;  1ZR2 A;  4HB1 A;  1GTW A;  1PV3 A;  1WMK A;  1Q81 Q;  3CCE P;  3MD0 A;  2M0B A;  1PP9 E;  2M8R A;  1FAV A;  1JNM A;  1GU4 A;  4QUR A;  2DE6 D;  2W6J H;  2H88 C;  1KQS O;  4EYY Q;  1QLE D;  2HML A;  5CXM A;  4EOT A;  3VMA A;  3C9I A;  3BAS A;  1FOS F;  3B5N B;  1JUN A;  2E75 D;  1KFM A;  2IDB A;  5AW7 B;  4H0L D;  3AEB C;  1X8Y A;  3V4Q A;  1H88 A;  5DJU B;  5B5E H;  1LTB C;  1GDT A;  2JP3 A;  3HUS B;  3AE4 C;  3O8Z A;  1KYO I;  1SQP G;  3VYI A;  4QDC A;  1SP4 A;  1U7J A;  4L75 A;  3RL0 C;  5KKZ B;  2ZYG A;  3H1L D;  1R8E A;  1A02 J;  2PFX A;  3L4F A;  1NU1 G;  4RKU J;  2H7H A;  4HM2 A;  2O1J A;  5DJT B;  2O1K A;  3CCJ P;  3CCL P;  3W67 A;  3WU2 H;  1RF1 C;  1T3J A;  1M1K Q;  3KPE A;  2P7J A;  2C0X A;  1FDI A;  4H13 B;  4NBC D;  1OVR A;  1NTK K;  2FXP A;  2YIU C;  1SQB E;  2B89 A;  3OJA B;  1KIL C;  5TJH A;  1HBW A;  2QM7 A;  3CWB E;  4W80 A;  1AV1 A;  5KJ7 C;  1GL2 B;  1AQT A;  2IYO A;  2QJP C;  4D6T E;  2WWW A;  5KLV J;  1PGP A;  4U7J A;  3T97 B;  5KLV G;  4C7N A;  5GTH E;  4IOI H;  1SQB K;  3B5N D;  3SFD C;  2FFD C;  4HM3 A;  2WSE H;  5GTI H;  2HR3 A;  3TGU G;  1FU1 A;  1KMI Z;  2ITA A;  1IK7 A;  3D71 A;  1BGY E;  3L73 J;  4R4M A;  3RK2 C;  3A7O A;  3L73 G;  3CX5 H;  2YKP A;  2KSJ A;  4EI2 A;  2I8D A;  3G6E P;  3Q3D A;  1X22 A;  2BCC E;  1KZU B;  4H13 D;  2XNX A;  3L72 E;  3C1L A;  4AIV A;  2QJK B;  1EC5 A;  3TNU A;  1URQ A;  5CMZ A;  2J58 A;  1KQF B;  4N78 E;  1HH0 A;  1W2B O;  2V7Q J;  3GCE A;  3CWB D;  3CXH I;  1GL2 D;  1S9K E;  1NTM G;  3M91 A;  4B86 A;  4D6T D;  1SQP D;  1QEX A;  3SWY A;  4EMJ B;  3AEC C;  2FYU E;  4YXD C;  1J1E C;  1BDC A;  3VCP A;  1NU1 D;  4OWF A;  2XKM A;  2A06 E;  1IZN B;  3AEE C;  4AAY B;  3ITK A;  1Y47 A;  3HE4 A;  5AVZ B;  1QGK B;  5H2F E;  1BGY D;  3L70 E;  1LT9 A;  1G1J A;  1LTI C;  2YMY A;  3LW5 J;  2FYU K;  2P2U A;  1NTZ J;  5AVR B;  1BCC D;  1JM0 A;  4U3F E;  3D89 A;  1LTG C;  1OX3 A;  1H0T A;  3PH0 A;  1CI6 A;  1RE3 A;  4QUP A;  1ZP0 C;  2NUK A;  2R5D A;  3HTK A;  3UIA A;  1SQV D;  1JTH A;  1SLQ A;  2ZT9 C;  1VL2 A;  2RMZ A;  1M1J B;  1O7P A;  3H1I E;  4P1C H;  1HJB A;  1FZE A;  2QIW A;  3WU2 E;  2N1T B;  5KTB A;  4N78 D;  5CCG A;  3U1A A;  3GHG A;  3TGU D;  1FBM A;  1FDM A;  1O7M A;  2IZ0 A;  1MFT A;  1E5W A;  4HM7 A;  5KLI C;  3E1I A;  3CME P;  1JEK A;  2B24 A;  1P84 I;  3N7N A;  4Z1M H;  2JZA A;  2YFI A;  2BMQ A;  1JOC A;  3B71 A;  1HF9 A;  2A06 D;  1VQM P;  4HM6 A;  3LIE A;  2O01 H;  2DE5 D;  5APY A;  1T8Z A;  3U1C A;  3GB4 A;  2Y0C A;  2ZFC A;  1PZQ A;  2AXC A;  1L0L J;  4WBA A;  3CL3 D;  3FGA D;  3L70 D;  3H6P A;  4RES B;  4PJ0 H;  3KXD A;  1M90 Q;  1KYO D;  5GTI E;  4L74 A;  3RGU A;  4BRY B;  4U3F D;  1NTM D;  1ZXG A;  2KS1 A;  3WUT A;  4R4L A;  5AEW A;  3MP7 B;  1W2E A;  1Q2N A;  3MHV A;  3C8V A;  5KAI H;  1HGZ A;  3B4S A;  3A5T A;  1NOH A;  4OGQ B;  2ZYA A;  3VN0 A;  2M3B A;  2G3A A;  2HMJ A;  3IF4 A;  4ZKU A;  2HG5 D;  2E42 A;  3Q5P A;  2H89 C;  2YO2 A;  2E74 C;  1JCC A;  4AQR D;  2IBZ I;  2XRX A;  2P58 A;  3L74 D;  2KLV A;  4EDF A;  1LT9 C;  1LT1 A;  2FKW B;  2CPS A;  3Q5R A;  2HOD B;  5C39 A;  1KV4 A;  1KB9 E;  2OGU A;  3H25 A;  1EDI A;  2WTY A;  2NPS C;  1RE3 C;  1L0N J;  3W68 A;  3H1J J;  3NFQ A;  1L0N G;  4HM0 A;  3IN6 A;  2K37 A;  3H1J G;  2G8Y A;  2A45 I;  2E76 D;  2KLU A;  1GMJ A;  4H44 B;  4ZNC A;  5CJ0 A;  1EDJ A;  1N73 A;  3M9H A;  5AVW B;  3L75 E;  5CCG C;  4IFM A;  5AVY B;  4L76 A;  4OGQ D;  3Q5S A;  1T6A A;  1GW4 A;  1IFI A;  2BAS A;  4JYC A;  4QMA A;  4N6J A;  1VDF A;  3K5B A;  3CCR P;  2XSH A;  1IFN A;  4YTP C;  5APV A;  1EDK A;  3GF7 A;  3BCC G;  2QM8 A;  4ZKP A;  4DOJ A;  4YPC A;  1EZV E;  3BAT A;  1M57 D;  1BE3 G;  2YXQ B;  1YQ4 C;  3AEG C;  3L36 A;  2GM4 A;  2YFL A;  1ULI A;  4KHX A;  1KOR A;  3GF3 A;  3D70 A;  1FE6 A;  1KB9 D;  1FOS E;  4GOD A;  2WSF H;  3H1H E;  2R3C A;  3GTS A;  2Z4E A;  1SJG A;  2HFE D;  3RBZ A;  4H44 D;  2C9L Y;  1Q90 D;  3GL0 A;  4N3Y B;  2OYI B;  1ZOY C;  3VMX A;  2HMK A;  1VQ7 P;  2IBZ G;  2I7F A;  2H43 A;  1HVV A;  3AE2 C;  5GTH H;  4C46 A;  1PPJ G;  4NBG D;  2JJL A;  4NB8 D;  3A3Y B;  2KZI A;  5TIS H;  1Y8A A;  1RH5 B;  3H1K J;  1AVO A;  1X79 B;  1OVU A;  3HE5 A;  3H1K G;  2A45 G;  2RH0 A;  3VCA A;  3AED C;  4I7Z C;  2ZXX A;  2O3J A;  2Q3E A;  1GK6 A;  3KZI E;  3L35 A;  1PP9 J;  1PGJ A;  2XSO A;  2H8P D;  3D6Y A;  2KS1 B;  2M5A B;  1YJ9 P;  1P84 D;  1PP9 G;  3I56 P;  4QCK A;  1N73 C;  4ASW A;  2NVE A;  2B87 B;  1MFZ A;  4NBH D;  5AW9 B;  2FXO A;  3H1H D;  4WY4 A;  4HKZ H;  1LP1 A;  2Y0E A;  3H32 B;  1N7S B;  3HUS C;  2QJY C;  2IX7 C;  1FZF A;  5CCH D;  2K9J A;  5AVQ B;  1ZW0 A;  2E5Y A;  4HYT B;  2QRX A;  1OFC X;  2YNY A;  2NVF A;  2I1J A;  3BCC D;  3WUU A;  1NAY A;  1NTK J;  3EN1 A;  4IL6 X;  1G2C B;  1NTK G;  1BE3 D;  4MN4 C;  3L71 J;  3GTE A;  2P67 A;  4HH2 A;  2ZAE B;  3L71 G;  4I6M C;  1SFC B;  1FZB A;  4H13 C;  3S1K A;  4GIF A;  1SVF A;  3PHL A;  5H2F H;  2B88 A;  1OW6 A;  1OXZ A;  5AW6 B;  3ZDM A;  3FOU A;  1M56 D;  3OAK A;  1KYO H;  4TT3 H;  3FWN A;  1K04 A;  3GOB A;  3BRV B;  4DZO A;  1SQB J;  3N0Q A;  1RHZ B;  1E79 H;  1L4A B;  3CI9 A;  1SQB G;  1QX8 A;  2UWJ E;  2LXB A;  2CKF A;  4I1L A;  1WQL A;  5M1B A;  3HD7 B;  1GU5 A;  1UUV A;  1JMB A;  2KNC A;  3IFM A;  2AXT E;  1VQ8 P;  1K8A Q;  1VQK P;  2W8Z A;  1N7S D;  1MV8 A;  1RQU A;  4JQ0 D;  4I2L C;  3O6Q A;  1VQ4 P;  3R2P A;  3EQQ A;  4QDF B;  2KB7 P;  2WPQ A;  1SQP E;  2OQQ A;  1FDO A;  2JWA A;  3F5H A;  3VMZ A;  3OA7 A;  1SFC D;  4L73 A;  1SQQ J;  4XA4 A;  2B9B A;  1NU1 E;  2QG4 A;  2QJK C;  1SQQ G;  1VM9 A;  1JB0 J;  3GMA A;  1VF5 C;  3WMM 0;  1G8K B;  2W90 A;  3AEA C;  1K05 A;  1ZV8 A;  5CBO A;  5AVV B;  5TIS E;  2BCC J;  3L72 J;  5APQ A;  4WY4 C;  1L4A D;  1SQP K;  1LGH B;  4W7Z A;  2HYN A;  3GLM A;  1SQX J;  2NZ2 A;  1BCC E;  1RFS A;  1ZN5 A;  3CCU P;  1LTJ A;  1RF1 B;  1SQX G;  1NU1 K;  3MTU E;  1LTA C;  3HD7 D;  1CW5 A;  2K88 A;  2YIU B;  2OYH A;  1KIL E;  1USE A;  1SQV E;  1KIL B;  2FYU J;  2OAR A;  2PP6 A;  4JYB A;  3V2Q A;  1EQ7 A;  1IJD B;  3CX5 I;  3TGU E;  2JKV A;  4NBE D;  2K9Y A;  3R4Y A;  3Q1M A;  2KXP B;  2Q6Q A;  2YVJ B;  1AQ5 A;  4CPG A;  2M3E A;  1KB9 H;  3EQ2 A;  3NXS A;  4OH8 B;  3PJS K;  2YXR B;  1SQV K;  3L73 E;  2FFD B;  2WVR A;  3P7K A;  1M1J C;  4NPF X;  3CPW O;  2KUB A;  3U59 A;  3PTZ A;  5CHX A;  2E4Q A;  4DT0 A;  1PGQ A;  2IFN A;  2ZYL A;  1BSH A;  3EFF K;  3EWK A;  3H1I J;  5APX A;  2D2C B;  1UUW A;  3H1I G;  1DD3 A;  2WT7 A;  1KYO E;  4DJG A;  2K3R A;  2ZVN B;  2Z5H A;  3AE3 C;  1OZH A;  4JPZ B;  3TSI A;  1BSN A;  1NTM E;  3A0B H;  1NTZ G;  5BVZ A;  2NPS A;  4PV1 C;  3HRN A;  3RBX A;  2YMK A;  1S3J A;  3SWK A;  2WZ7 A;  4LLH A;  1KIL D;  5KLV D;  3F89 A;  4LGD E;  2XZR A;  1A02 F;  5AW3 B;  1IC2 A;  1YTZ I;  1YIJ P;  4Y99 C;  2E76 C;  5EFW B;  3E1R A;  1NAF A;  1PFI A;  3CC2 P;  1NTM K;  1DD4 A;  1GK4 A;  5AVS B;  2FBW C;  1J1E B;  1P84 H;  5BOK A;  2E43 A;  2WMM A;  1IFP A;  1QL2 A;  1DIP A;  2WPS A;  4KT0 J;  2WSE J;  3L74 E;  3L73 D;  1RIE A;  4C7R A;  1FZC A;  1VQ9 P;  1KQL A;  1LTJ C;  1VQ6 P;  4HM1 A;  4XFJ A;  1Z56 A;  2O01 N;  3AEF C;  2J5U A;  3M9B A;  3V4W A;  1OW8 A;  1LNQ A;  1X0T A;  1SS1 A;  2OYH C;  3RK3 E;  2AEM A;  2D2C D;  4Y28 J;  3RK3 B;  2C9N Y;  1L0L G;  5BU8 B;  3WUV A;  3I55 P;  4RO0 A;  2VRS A;  3C0D A;  1CZQ A;  2R3S A;  2YFJ A;  2FY8 A;  5B66 H;  2ZJS E;  1GZL A;  2ZT9 B;  4NBA D;  4C7N B;  1LWU A;  1YQ3 C;  2KP8 A;  2HPC A;  5AW1 B;  2WSC H;  4IL6 H;  1FJP A;  2YKO A;  2WQY C;  2N1T D;  1DH3 A;  3KZI H;  4H44 C;  5K5G B;  4PD4 I;  2NWF A;  2HMN A;  5E79 E;  4RJT A;  5KLI B;  3CXH E;  3GL2 A;  2Y9Z A;  1Q86 Q;  2GBX A;  1VQO P;  1R5L A;  1NTZ D;  3VTP C;  1M8O B;  3CCM P;  3Q2Y A;  3AE1 C;  3L75 J;  1S4X A;  5APS A;  3L75 G;  3KYQ A;  2A45 H;  2XU6 A;  3TNU B;  1URQ B;  2JDI H;  2IFM A;  1DX7 A;  1JY2 N;  3RK3 D;  2KIK A;  1JY3 N;  2B1X A;  1U7M A;  1N86 A;  1NWQ A;  1N7L A;  2ZVO B;  3B5N A;  2L91 A;  2ZT9 D;  3CCS P;  1U57 A;  3KQG A;  1EZV G;  3A0B E;  1JY2 P;  3HUS A;  2P1J A;  1JY3 P;  1R5S A;  1XTC C;  3V6I A;  3CCQ P;  1FZC C;  4NB9 D;  2OYI C;  2E74 B;  3HE4 B;  1VCK A;  3A0H H;  4JF7 A;  1DEE G;  3CXH D;  3H1J E;  1LT9 B;  2BMR A;  1L0L D;  2QSI A;  5APT A;  2O01 J;  1ZLL A;  3AE5 C;  3P8C E;  1VQ5 P;  1H0T B;  1CI6 B;  2AXT H;  2GA1 A;  1VQP P;  1P84 E;  1JM1 A;  3VMH D;  2V4H A;  4HJL A;  1TU3 F;  1YYC A;  1H8A A;  3HTK B;  3CCV P;  2KZJ A;  4TLF A;  1GL2 A;  1JTH B;  4UB6 H;  3G9R A;  1URQ D;  2PAJ A;  2E75 C;  4ASV A;  3TF5 A;  3MGN A;  4H0L C;  1LWU C;  1NDO A;  1OIP A;  3T97 A;  1Q7Y Q;  1NYK A;  1LTS C;  4KJM A;  3CC4 P;  1YIT P;  1S72 P;  1FC2 C;  4QDD A;  3GHG B;  5AW8 B;  5CJ4 A;  3L37 A;  3BCC E;  2RKL A;  3SFE C;  3D6Z A;  1J1D C;  2W6A A;  2AEF A;  4ZMD A;  1BE3 E;  5APW A;  1FZG A;  3CD6 P;  2W6B A;  5BU5 A;  3H1L J;  5B66 E;  3H1L G;  2E74 D;  2LKM A;  1CSB A;  3CMA P;  2BEQ D;  4IL6 E;  3AE8 C;  4HM4 A;  1L0N D;  2FYN B;  3H1J D;  3USS A;  1HGV A;  3E7K A;  3P8C D;  3VMI D;  2IBZ E;  1S5L X;  3CC7 P;  1L2P A;  1Q82 Q;  2LR2 A;  1YI2 P;  3B5N C;  5AVU B;  1HTL C;  1YJW P;  2WPV B;  2GUS A;  3S9O A;  1HUC A;  2OTJ P;  1K9M Q;  2I1K A;  2R5B A;  5CCG D;  2E5T A;  1LTT C;  2Y9Y A;  1RF0 A;  1NGM B;  1VQN P;  5KKZ C;  3PRJ A;  4HKV A;  3HD7 C;  1O7W A;  1UII A;  2IYP A;  3OW2 O;  3BRT B;  1VQL P;  2MJZ A;  1JCD A;  4I7Z B;  5L8R J;  2J59 M;  3ABV C;  4W7Y A;  1NYH A;  1T2K D;  2E4P A;  3JCU E;  1D7M A;  3QH9 A;  4PD4 D;  2FXM A;  4WWI A;  1ZME C;  1GL2 C;  2V7Q H;  2DE7 D;  1M1J A;  2WSF J;  1IO4 A;  3A0H E;  3PP5 A;  1N73 B;  3VMY A;  2IBZ D;  3CWB J;  3M0A A;  1WT6 A;  2N1T A;  3BVH A;  2QPZ A;  3CWB G;  2C0W A;  1O7G A;  1PPJ D;  1IFJ A;  1NTK E;  4D6T J;  1ZR4 A;  1SQP J;  3EFG A;  3M9Q A;  1G1I A;  2IZ1 A;  3AE6 C;  4D6T G;  2QJY B;  3L71 E;  4WVZ A;  4QUQ A;  2BEZ F;  1NU1 J;  3FXD A;  3H1K D;  4UB6 E;  4OVN F;  3LW5 H;  1BGY J;  5HL4 A;  1GW3 A;  1BGY G;  4HM5 A;  3FWL A;  1BCC J;  3RL0 g;  1PP9 D;  3IAO A;  1BCC G;  4YXW H;  2Q1K A;  4BRY A;  2XND H;  1SQV J;  3RL0 B;  2BCC G;  1SQV G;  3L72 G;  1KN7 A;  2JO6 A;  2YO3 A;  1RF0 C;  3TGU J;  1RQV A;  4M3L A;  2W27 A;  4IFF A;  1S2E A;  1NTK D;  1Y9B A;  2DW3 A;  2Y0D A;  5KAF H;  3MZW B;  1DEB A;  3P32 A;  5KLV E;  3L71 D;  5E79 H;  1FS0 E;  1UIX A;  2ZXE B;  1SQQ E;  1RE4 A;  1QVG O;  2FYU G;  4IFD K;  3CXH H;  2Q3I A;  3HE5 B;  2XR8 A;  3AE7 C;  2D2C C;  1KC8 Q;  2RN0 A;  2SPZ A;  2A06 G;  2QJP B;  2HOD A;  1ZRT E;  2N9Y B;  3V2N A;  1OW7 A;  1HWT C;  2CPB A;  3IR9 A;  5AW4 B;  2JEE A;  1FQT A;  2WPR A;  5AW5 B;  1YTZ T;  3L70 J;  1SQB D;  1VF5 B;  3L70 G;  5KLV K;  1SQX E;  4U3F J;  2XV5 A;  2Q9I A;  1KFN A;  1SQQ K;  1NTM J;  1RY3 A;  4U3F G;  1PL5 A;  3KHU A;  2N1T C;  5APU A;  4NPE A;  4NPD A;  4WY4 B;  2WIT A;  2CK3 H;  1LP1 B;  3RL0 D;  5AVX B;  3RK2 B;  2K9J B;  2KOG A;  4K35 A;  1KB9 I;  2QVA A;  3G4S P;  1IFM A;  1NH4 A;  3A2A A;  1SQX K;  3V2R A;  4A7P A;  2QE7 H;  1O7N A;  2OTL P;  3L74 J;  3M06 A;  1SQQ D;  1PGO A;  3L74 G;  5KJ7 D;  5B5E E;  3RK3 C;  3TYY A;  3FX0 A;  1EXI A;  1AFO A;  3GKE A;  1MKM A;  4LC1 A;  4AYC A;  1GD2 E;  1ZRT D;  1AA0 A;  2BCC D;  3MUD A;  3VP9 A;  3L72 D;  1M7L A;  2GUV A;  2AEJ A;  2NRG A;  1KD1 Q;  2Q5U A;  1VF5 D;  1K73 Q;  4HM8 A;  1FZA A;  1YHQ P;  4OGQ C;  1ULJ A;  1SQX D;  2XDJ A;  1NTZ E;  3PLN A;  2OYI A;  1YBK A;  3LID A;  4GOE A;  5CCH A;  1S9K D;  2KNC B;  4WY4 D;  1EDL A;  1EZV I;  1XTG B;  1S5L H;  4AUW A;  1NKN A;  3RK2 D;  2FYU D;  2K1A A;  1RE4 C;  4PV1 B;  3II6 A;  1MUU A;  3O6Q B;  1G8J B;  3FXE A;  1NTZ K;  2NVG A;  3V5B A;  1H89 A;  4Y99 B;  2E76 B;  1EXJ A; 
#chains in the Genus database with same CATH homology
 3FOU A;  2YFI A;  4HKV A;  2BMQ A;  2BMO A;  2E76 D;  3GCE A;  3GOB A;  1NDO A;  4NB8 D;  1O7W A;  2GBW A;  2HMO A;  1NYK A;  4HM6 A;  3VMG D;  3N0Q A;  4NBC D;  2DE5 D;  1Q90 C;  3H1L E;  1O7N A;  1SQV E;  2YIU C;  1SQB E;  3GB4 A;  4QDD A;  5BOK A;  3L75 E;  3H1K E;  4EMJ B;  2FYU E;  3BCC E;  3VCA A;  2JO6 A;  3CX5 E;  3GZX A;  3VCP A;  1L0L E;  3CWB E;  4OGQ D;  3L74 E;  2CKF A;  2E4P A;  4QDF A;  1RIE A;  1BE3 E;  2A06 E;  1WQL A;  2Q3W A;  4NBD D;  1UUV A;  2B1X A;  3TGU E;  2FYN C;  2QJP C;  4D6T E;  4NBE D;  2XSH A;  3GKE A;  4AAY B;  2DE7 D;  4HM1 A;  2YVJ B;  2XSO A;  5AEW A;  5KLV E;  1PP9 E;  2ZT9 D;  2E74 D;  1SQQ E;  3L70 E;  2NUM A;  4QCK A;  3L73 E;  4QUR A;  1VF5 D;  2XR8 A;  4HM8 A;  2D2C D;  2DE6 D;  2NVE A;  3DQY A;  2QPZ A;  4HM4 A;  4HM3 A;  4NBH D;  1EZV E;  1O7G A;  4U3F E;  3D89 A;  1ULJ A;  1NTK E;  2HMJ A;  3EQQ A;  1NTZ E;  4QDF B;  3C0D A;  4PV1 D;  1ZRT E;  5AEU A;  2E4Q A;  1SQP E;  2HML A;  3L71 E;  4QUP A;  2YFJ A;  4QUQ A;  2ZYL A;  3VMI D;  1FQT A;  2NUK A;  2IBZ E;  1BGY E;  2YFL A;  2QJY C;  1ULI A;  4NB9 D;  4P1B H;  5CXM A;  2HMM A;  1VCK A;  4NBA D;  1NU1 E;  2QJK C;  1O7P A;  2NVF A;  3H1I E;  1VM9 A;  1UUW A;  4P1C H;  4NBB D;  1SQX E;  3H1H E;  3H1J E;  3GTS A;  4PD4 E;  1G8K B;  1KYO E;  1O7H A;  2E75 D;  2XRX A;  3EN1 A;  2BMR A;  4H0L D;  1SJG A;  3AZC A;  1NTM E;  4H44 D;  3GTE A;  1G8J B;  3GL0 A;  2NWF A;  2BCC E;  2HMN A;  2NVG A;  4H13 D;  1O7M A;  2HMK A;  1P84 E;  4QDC A;  1KB9 E;  3L72 E;  1JM1 A;  5HL4 A;  3VMH D;  4HJL A;  4AIV A;  2I7F A;  4HM5 A;  3CXH E;  3GL2 A;  4NBF D;  3GZY A;  4HM7 A;  5KLI C;  5KKZ C;  1L0N E;  2GBX A;  1BCC E;  1RFS A;  4HM0 A;  2B24 A;  1EG9 A;  4HM2 A;  1PPJ E;  2JZA A;  4NBG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...