1L0NE

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 33
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0nE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0nE02
1G8KB 2NVGA 2HMJA 4QUPA 1WQLA 4NBDD 1NTKE 4HM5A 4NB8D 4QCKA 5KKZC 4QDFB 1SQVE 1VM9A 2YFJA 3GL0A 4HM4A 3VMID 3H1LE 2JO6A 4QUQA 1ULJA 1KB9E 3CX5E 3TGUE 2XR8A 1PP9E 2XSOA 4NBGD 1O7MA 1SQQE 4QDCA 2D2CD 3VCAA 3H1IE 4H44D 4NBED 4P1CH 2HMKA 3EQQA 1Q90C 1NYKA 2QJPC 1O7NA 3GZXA 1NTZE 4QDFA 4HKVA 1SQXE 2B24A 4HM1A 3L72E 3VCPA 4EMJB 4PV1D 2HMMA 2E75D 3BCCE 2YFIA 1NTME 1O7GA 3L70E 1RFSA 4AAYB 2ZT9D 2QJYC 2A06E 1BCCE 2YIUC 1L0LE 2NVEA 1UUWA 2HMOA 4NBHD 1KYOE 1EG9A 5HL4A 3N0QA 3GZYA 2E4QA 3CXHE 3L71E 1UUVA 2BCCE 1BGYE 2I7FA 3D89A 2GBWA 2JZAA 3GTSA 4OGQD 1NU1E 2ZYLA 1PPJE 4HM3A 2NUKA 2QPZA 4H13D 3GTEA 3VMGD 4U3FE 2BMQA 1O7HA 2E4PA 3L73E 1G8JB 2HMNA 2IBZE 2QJKC 1O7PA 3AZCA 4NBCD 2DE7D 4NBFD 4HM6A 2BMRA 3L74E 1FQTA 2CKFA 2Q3WA 3GKEA 5KLVE 2NUMA 4H0LD 3GCEA 1VCKA 2BMOA 1O7WA 2E74D 2GBXA 3L75E 1L0NE 4P1BH 4D6TE 2DE6D 4HM0A 1NDOA 2B1XA 2NVFA 5KLIC 3H1KE 3GOBA 3EN1A 3FOUA 1SQBE 4HJLA 1ZRTE 4QDDA 5AEUA 3C0DA 4PD4E 2DE5D 2NWFA 2FYUE 4HM2A 1VF5D 2XSHA 4HM7A 2YVJB 3GL2A 3CWBE 4NBAD 1SJGA 2E76D 2XRXA 1P84E 1BE3E 1EZVE 4HM8A 4QURA 3DQYA 4NB9D 1ULIA 2HMLA 3VMHD 1SQPE 4AIVA 5AEWA 3H1HE 1JM1A 2FYNC 5BOKA 2YFLA 5CXMA 3GB4A 4NBBD 1RIEA 3H1JE
chains in the Genus database with same CATH superfamily
3Q5RA 1URQD 1FZCC 3AE1C 1AQ5A 3BATA 3F89A 3G6EP 1DEEG 2ZFCA 4NBGD 4M3LA 3OW2O 1T8ZA 3L74D 1JCCA 4XFJA 2VRSA 4TLFA 1PL5A 2O1JA 4HM1A 2Q7CA 3EFFK 1X0TA 3SFEC 1PP9G 5KAIE 1K73Q 4PD4I 3EFGA 1SP4A 1QLED 1G2CB 1UUWA 3A0HH 1GU5A 3O6QA 3PP5A 4KHXA 5CCHD 1HJ0A 1XTGB 1MFTA 1SQQJ 1ZN5A 2QPZA 3CXHI 2ZJSE 5KLVJ 3P32A 4L74A 3IF4A 2C9NY 1L4AA 2QM8A 1S9KE 2DE7D 2BMRA 4YTPC 3RL0g 3B5NA 5CBNA 1URQB 4D6TG 2XU6A 1LP1A 4UB6H 2CPSA 1YTZI 2KK7A 2WPRA 5APYA 1HGVA 1LNQA 3LW5J 1SFCB 3EN1A 4QDDA 1FC2C 2XSHA 1FJPA 2FYUD 2P2UA 2ZXXA 2M3EA 1MZ9A 3H1HE 4CPGA 2LR2A 3RGUA 1VQPP 4ZNCA 2E75C 3AE3C 1Y9BA 1JTHB 1GMJA 3MUDA 2XZRA 4RKUJ 4IL6E 2KLVA 1ULJA 3M91A 1H0TA 2GA1A 1M56D 1AVYA 4L75A 1AV1A 4OGQB 1KILC 1RHZB 3H1LG 1KQLA 4GIFA 1RE4C 3AE4C 2NPSB 1BGYD 1NTKG 1SQVJ 2H7HA 1LWUB 3L70J 3P8CD 3CXHE 3H1KG 3EQ2A 2JZAA 1SQPK 1KB9H 3CX5H 1H89A 1ZP0C 4H13D 1KORA 1NU1D 3WUVA 2ZXEB 2KOGA 2BEQD 1IK9A 2M0BA 3ITKA 2CKFA 4WBAA 1FOSF 5AVVB 2FXPA 3HE4B 2BMOA 1PP9D 5KAFE 2Z4EA 3UIAA 2P1JA 3IFMA 4D6TE 1M1JB 4N3YB 5BU5A 3TYYA 1MFZA 1CI6B 3C0DA 2HYNA 3VMZA 1S4XA 2DE5D 1QX8A 2QSIA 1NU1G 1JM1A 5CCHA 1OWAA 1S72P 5CXMA 1OXZA 2B88A 2JO1A 4HM5A 2FYUK 3WU2H 4I7ZB 5KKZC 3II6A 1RF0A 2GUVA 2Q6QA 3TK1A 3L73D 1PP9E 3QWOC 2QM7A 2WQYC 1URQA 3H1LD 4P1CH 1SS1A 1Q90C 2O01N 1VQ4P 4JBZA 2FFDC 4JYBA 1KYOH 2Q5UA 2XV5A 2PGDA 1DX7A 1M7LA 2I8DA 4NBHD 1BDCA 1N73B 2WWWA 3E1IA 2WPVB 1OW6A 3WUTA 2N9YB 1OMIA 2JR8A 4U3FE 1ZMEC 1QEXA 3M0AA 4GT1A 3MHVA 3L71G 3CI9A 4QMAA 1RH5B 1LTSC 4PD4H 1SFCC 1KILB 2WT7B 1LJ2A 4U7JA 2FY8A 3GMAA 1VL2A 2DE6D 2RKLA 1J1EC 3CC4P 2KS1A 4D6TD 3M0DC 4EDFA 2KSJA 4NBAD 4U3FG 5AW1B 2V7QH 1NU1J 4U3FJ 2WSCH 2HMLA 2ZVOB 3JCUH 4ASWA 4LGDE 2HODA 3GB4A 3R2PA 5AVRB 3P8MC 4BWNA 1PP9J 1PGPA 1AVOA 5C39A 1D7MA 1GK6A 1IFDA 3F5HA 1NOHA 1IFIA 1S2EA 1T3UA 3CMAP 1J1DB 3P7KA 5AVUB 2K3RA 1KQSO 3HRNA 2N1TD 2E75B 1SQXD 3AE7C 2J59M 4HB1A 4DCKA 5L8RJ 3RK3D 4N78D 1L4AB 3HD7C 3QH9A 2FFDA 3U59A 1JEKA 2C9LY 1EDKA 2GM4A 3D89A 1GL2A 1FU1A 2N1TC 1NU1E 2ZYLA 1PPJE 1OVRA 1SVFA 2V4HA 3AE8C 4PJ0H 3BCCG 2E42A 1LTBC 4PJ0E 2QJKC 2BCCJ 4W80A 1R8EA 3L74E 4EIJA 2NUMA 3L35A 1VCKA 4OGQC 1JY2N 4PV1B 3HTKA 3PLNA 3L37A 3C8VA 1BE3E 2OTJP 5B66E 1SQPE 4WY4B 3L74J 4KT0J 3CXHD 1NTKE 1NAYA 4QCKA 2PAJA 4XE5B 2AEMA 5AW7B 4HM4A 3H1LE 4N6JA 5M1BA 1S3JA 1NAFA 2XSOA 3JSVC 1M8OB 2R44A 3GZXA 1BE3J 1CSBA 1IFJA 1RE4A 3VCPA 3V4QA 2YFIA 2QJYC 4IFMA 1S5LH 2RH0A 3GLMA 4R4LA 1VQLP 3N7NA 3N0QA 2YMYA 3GF7A 2Y0CA 2I7FA 3TGUJ 5AVWB 5B5EH 1Q2NA 1OIPA 5AVXB 2FXOA 5APWA 3V2NA 1W2BO 3GKEA 4W7YA 3GCEA 5AVQB 3AE9C 1N7SC 4AQRD 1FOSE 3TGUG 2K88A 3GOBA 2QIWA 3L75J 3NFQA 1JNMA 2OYHB 1VF5D 5KAFH 2P58A 1KN7A 2XRXA 2E76D 1QL2A 2QRXA 3U1AA 2JJLA 1NKNA 2Q1KA 4QUPA 4NB8D 3W68A 2L5GB 3WU2E 1GK4A 2WPSA 2I1KA 1SQPG 4Y28J 2W6BA 2KUBA 3S9OA 4RESB 3EWKA 4BRYA 4UB8H 3CC7P 2QJKB 3K5BA 1RFSA 1U7JA 2QG4A 2XNDH 4IL6X 3TSIA 1L0LE 2KI7B 2WSSH 3VMAA 1KYOE 1JY2O 3N4XA 1UUVA 3RBZA 4BRYB 2Q3IA 1ZR4A 2YXQB 1G8JB 4DJGA 1PV3A 2IBZE 1G2CA 2IZ1A 3NMDA 3WUUA 1YJWP 5BU8B 2KXPB 1FQTA 2NPSD 3M06A 3A5TA 4A7PA 2IYPA 2AXTH 5CCGD 4IFFA 1L0NE 1SQPJ 1J1DC 3B5ND 2KP8A 4HJLA 1SQBE 1LTAC 3CWBE 1FZFA 1AJYA 4HM8A 2LXBA 1GZLA 2WSEJ 1FDIA 3VMHD 3W67A 1MV8A 3H1LJ 1YQ3C 2B9BA 3H1JE 2YKQA 5AW2B 3VMYA 1DD3A 4YXDC 1NTKK 2Z5IA 2A45H 1LT9B 2CPBA 3A0HE 2B87A 1S9KD 3C9IA 4EOTA 1YBKA 1RF1C 3CCRP 2R3SA 3H1JG 5KAIH 2JWAA 3TNUB 1EZVD 4H44B 2J58A 2V7QJ 4WB4A 3L70D 4UB6E 2OYIB 2IDBA 1USEA 1L0LD 3L71E 1NYHA 2KZJA 2OQQA 1L0NG 1FE6A 1BDDA 3VMGD 1OFCX 1BGYG 1NTKD 1YJNP 2HMNA 2YKOA 1NU1K 1JY2P 3KQGA 1FS0E 3RL0C 2Q3WA 2IBZD 2IBZG 4H0LD 1IZNB 5CJ0A 4WY4A 1SQVK 4P1BH 1S5LE 2YO3A 1GL2C 2ITAA 2WSFH 5KLIC 2KSEA 2R5DA 2W6AA 5KKZB 4LLHA 3IR9A 3L71D 2E74C 1EDJA 2G8YA 5AW6B 1BSNA 3VN0A 2BCCG 4YXWH 2QE7H 1U57A 4H44C 2NVGA 2HMJA 4HJGH 2K9JB 1BCCJ 1CI6A 3H1JD 4DT0A 3G9RA 3FXDA 2RMZA 2E76C 1S1CX 3Q3DA 1L4AC 3HD7B 1SQXJ 2JO6A 1K9MQ 1JUNA 3JC22 1FZBA 1S5LX 2D2CD 1VQ9P 2HMKA 3A2AA 5AVZB 1O7NA 1NTZE 1ZLLA 1HH0A 3CC2P 2QA4P 1MUUA 1URQC 1Q86Q 3BRVB 1EDLA 3CCJP 4AAYB 3MUDC 1KYOD 1GTWA 2WSCJ 1CZQA 4TT3H 1TU3F 1N7SD 1KQFB 3RK3E 3KDPB 2ZT9B 1EG9A 5KLVK 2CK3H 4WWIA 2KNCB 1LWUC 3SSUA 2NUKA 2FYNB 1SLQA 3RK3C 2BMQA 2G3AA 3AZCA 4NBFD 3TNUA 3HE4A 1YHQP 1FZCA 1M90Q 1N7SB 5GTIE 1LTJC 2IBZI 3V6IA 2M5AB 3BRTB 1FZEA 4Z1MH 1L0LJ 3SFDC 1WMKA 4I1LA 3L72D 1ULIA 1FJKA 3AEDC 4IFDK 2FYNC 1FZCB 1WQLA 1NTZG 3CCVP 3D6ZA 3HE5A 2LXCB 1NGMB 3RBXA 4DOJA 1SQVE 3AEAC 2PP6A 1QVFO 2B87B 3VMID 2R3CA 5B5EE 1KB9I 3CX5I 1Y47A 1Q7YQ 1LWUA 2OTLP 3IAOA 1HF9A 1L2PA 1Q81Q 3D70A 1NYKA 2QJPC 2HPCB 4OH8B 2W83C 4Y99C 5CCHC 3L72E 2E76B 1NJIQ 2BASA 3RK2B 3L70E 3U1CA 3H1JJ 3BCCJ 3C1LA 1U7MA 3I56P 2WZ7A 1L0LK 1GW3A 2OTKE 4C7NA 3MGNA 1JMMA 1FDMA 2FBWC 1YIJP 2FYUG 4ASVA 2BEZF 1UIXA 4KJMA 2HLOA 4EYYQ 1EC5A 4HH2A 2GBXA 2ZYDA 3PH0A 5APQA 3T97A 1JB0J 1G1JA 1KYOI 1JOCA 4H13C 5KTBA 2YVJB 3GL2A 5APUA 1SQQG 3PJSK 1L4AD 2W90A 1EZVE 3DQYA 4NB9D 4AYCA 2IPPA 1N7SA 2WTYA 4H0LB 5AW3B 3CMEP 4I2LC 1ZOYC 2A45I 2OGUA 1DD4A 3CPWO 2WVRA 3KHUA 3FWNA 1VQMP 1JO5A 1NTMK 2C0WA 1KILD 2YMKA 1SQQD 2AEFA 3JCUE 3V2RA 1E79H 1T6AA 3L72J 3CLQA 1LT9A 3KZIH 3V5BA 1FDOA 5CHXA 4ZKUA 3FX0A 1JCDA 1SQQK 3CWBD 2IZ0A 2YO2A 2ZT9D 3B71A 2XKMA 3KPEA 3E7KA 2IYOA 4JQ0D 2OYHA 4K3AA 3LIDA 1UIIA 5AVTB 2ZYAA 5HL4A 2NPSC 3Q2YA 3M9BA 5AW8B 1KILE 1LTTC 5GTIH 4JPZB 4GDOA 3B5NC 2NPSA 4AUWA 1HTLC 1NTZK 5K5GB 3CCLP 2O3JA 3L75G 1RF0C 3I5CA 3H25A 3BCCD 3L75D 2Z5HA 1NTZD 1YI2P 1EZVI 2FYUE 1P84E 4XA4A 2JP3A 1NH4A 2D2CB 2YFLA 2H89C 1OX3A 4NBBD 3SWKA 3CWBG 1QL1A 3M0DA 2K9JA 1VM9A 1AFOA 3D71A 1WT6A 1X79B 2O01H 2XR8A 2J5UA 3R4YA 1H8AA 3L72G 1E5WA 1HUCA 2DW3A 3VCAA 4Y99B 1JY3N 4DZOA 3AECC 1KD1Q 1N86A 1LGHB 3VOPA 5APVA 4W7ZA 3AEGC 3S1KA 2K1AA 5APTA 1NTKJ 1SQVG 1BCCE 4NPFX 1PGQA 2JWDA 2QJYB 2PRRA 3KZIE 3LW5H 3D6YA 4GOFA 4HM3A 2ZAEB 4GOEA 3MIWA 3H1HJ 4GODA 1VQ6P 1IFPA 2AXTE 3CXHH 1VF5C 3SWYA 5GTHE 1VQOP 1O7WA 3L73J 1NTMG 1RF1B 2MKVA 3GF3A 4HM0A 1K05A 2B1XA 4WY4D 3MP7B 1BCCD 1ZRTE 2XDJA 3H1IJ 3H1IG 3VTPC 1SFCD 2QEXP 3ZDMA 1Y8AA 3G71P 1RQUA 4IL6H 4ZMDA 4R4MA 1DEBA 1NTMJ 2NRGA 2XNXA 2BCCD 2E43A 2I1JA 3HUSC 1FBMA 2JEEA 1NTZJ 3A7OA 2Y0EA 1NWQA 3GW6A 2L91A 1X9VA 3H1IE 4H44D 1QGKB 3KXDA 1RF1A 3O6QB 4QDFA 2WITA 1ZRTD 1KFNA 4PV1D 3Q1MA 5H2FE 5DJUB 1NTME 3S4RA 3B5NB 3PTZA 1OW8A 1N2DC 2Y9YA 4H0LC 2YIUC 2NVEA 1G1IA 2OYIC 4PD4D 4D6TJ 2KZIA 3H32A 1IC2A 2E4QA 1YYCA 2OYHC 2A45G 4WY4C 1PFIA 1ZW0A 1LTIC 3HTKB 3GTEA 2E4PA 1O7PA 4NBCD 1DIPA 4I6MC 3L74G 4NPDA 3AE6C 1N8RQ 3OA7A 1RY3A 1LT9C 2HPCA 1GL2B 3L75E 2P10A 2IX7C 1KC8Q 1IO4A 1PGJA 3Q5PA 5B66H 4JF7A 4YPCA 1EQ7A 4OWFA 2OYOA 5AW9B 1BSHA 2AXCA 3RK3B 4PD4E 1VF5B 3H1KD 3L71J 3SWFA 1OW7A 3P8CE 4NPEA 2Y9ZA 1R5SA 2A06D 3RL0D 2FYUJ 1AQTA 5AW4B 1W2EA 1G8KB 1DH3A 3AEFC 3OAKA 3HD7D 2POHA 1YJ9P 1OVVA 2JDIH 3GL0A 2RN0A 3FWLA 3MTUE 4JYCA 2H8PD 1PZQA 1IFMA 3T97B 2IFMA 2B24A 5AW0B 4N78E 2P67A 2E75D 3BCCE 1JY3P 1FAVA 3HUSB 1MKMA 1JMBA 1KTMA 5TJHA 1O7GA 2K9YA 5H2FH 1X22A 2HMOA 5EFWB 1NHLA 3A0BH 3GHGB 5APSA 2GBWA 3FGAD 3M9HA 3CCUP 2WSFJ 4EI2A 2E74B 2SPZA 1NO4A 2OARA 3VP9A 3NTNA 1O7HA 3L73E 3AE2C 5KLVG 4PV1C 4C7RA 2YIUB 5KJ7D 3IN6A 1LTJB 2KYVA 1SQBK 1KZUB 2ZYGA 2QJPB 1GW4A 2E74D 1ZV8A 2KNCA 1RQVA 3ABVC 1Q82Q 2M3BA 3G4SP 2FYZA 3FOUA 1L0ND 2KS1B 1BE3D 2NWFA 5APXA 1EXJA 1LT1A 4LC1A 3CCQP 3L36A 1M1KQ 4BXLA 1N73A 1P84H 5AEWA 1VDFA 1GL2D 1KQGB 2FXMA 2M5AA 1YITP 3GG2A 2O1KA 1AA0A 5CCGC 1R5LA 3BVHA 1OZHA 1L0LG 1L0NK 1SQBG 4RO0A 3CCSP 3TGUD 2YFJA 3AE5C 3L70G 3H6PA 4QUQA 3MZWB 1EZVG 1M57D 1VQNP 1SQQE 4NBED 3H1KJ 5AVSB 3EQQA 1Z56A 3B8EB 4B86A 2GUSA 1P84I 1T3JA 4EMJB 3VP8A 1P84D 2HR3A 2H88C 3O8ZA 2WT7A 3E1RA 1SQBJ 3USSA 4UB8E 3PHLA 4OGQD 1USDA 1HJBA 1Q90D 4ZKPA 2W27A 5KJ7A 2ZT9C 1HVVA 1K04A 3M9QA 1T2KC 2Q3EA 2R32A 4HM6A 1BGYJ 1SQVD 3V2QA 3Q5SA 1SQXK 5AVYB 1LTGC 3I55P 1VQ8P 1X8YA 1NDOA 2W8ZA 2KIKA 3G3ZA 3H1KE 2Y0DA 1A02J 1GDTA 2MJZA 4HM2A 1PIXA 4IOIH 1K8AQ 1FZAA 2FKWB 4C46A 3H32B 4QURA 3WMM0 1LTJA 1PPJD 2NZ2A 3TDKA 5BOKA 3HE5B 1J2JB 4HYTB 1HWTC 2N1TA 4NBDD 5CCGA 2P7JA 1FZGA 1VQ7P 1VQKP 2C0XA 1H0TB 2B89A 3NXSA 2WSEH 1QVGO 1RE3A 3TGUE 2WPQA 1L0NJ 1EXIA 5KLIB 1JM0A 1WRGA 3BASA 3CWBJ 4OVNF 1PGOA 1M1JA 4I7ZC 2M8RA 3A0BE 1A02F 1SQPD 2E5YA 3H1HD 2ZVNB 3HUSA 1KILA 1NKZB 3GHGC 3FXEA 1VQ5P 5TISE 2BCCE 1W5CE 4WVZA 2IFNA 1JY3O 4C7NB 5E79E 1M1JC 1JTHA 2HFED 3CL3D 3AEBC 3H1ID 1ZXGA 2R5BA 4GKGA 3CD6P 1VPCA 1IK7A 1BCCG 2KLUA 3OJAB 3V4WA 1H88A 3LIEA 5BVZA 1SQBD 4K35A 3VYIA 3L4FA 1NTMD 1YTZT 5CMZA 1CW5A 1IFNA 1GU4A 2NVFA 1HBWA 3CCMP 1SFCA 5CBOA 1SJGA 3HD7A 2O01J 1N73C 3H1HG 4MN4C 1N7LA 2H43A 2WMMA 1SQXG 1BE3G 2D2CC 2LKMA 4QDFB 3MD0A 2FFDB 1J1EB 3PRJA 1ZR2A 2E5TA 4L76A 4U3FD 3RK2C 1KB9E 3AEEC 3CX5E 2KB7P 4H13B 1O7MA 4QDCA 5KLVD 3GHGA 4HKVA 1SQXE 1KFMA 4O9BA 2YXRB 3RL0B 2JKVA 3CCEP 2HMMA 3TF5A 5KJ7C 1GD2E 1PPJG 2A06E 1T2KD 2AEJA 1LP1B 1NVOA 3A3YB 4RJTA 1IJDB 3KYQA 2UWJE 3GZYA 1HGZA 3B4SA 1BGYE 3GTSA 1RE3C 1EDIA 2HODB 1KV4A 3VMXA 2Q9IA 1YQ4C 1KB9D 3CX5D 5AW5B 2YKPA 5CJ4A 5E79H 2HG5D 3V2PA 5KLVE 2OYIA 3L73G 1OVUA 4HKZH 5TISH 1KMIZ 5DJTB 2YNYA 4L73A 2QVAA 5GTHH 5AEUA 3RK2D 4HM7A 2A06G 2PFXA 1XTCC 2W6JH 4AIVA 2N1TB 2K37A 1RIEA 2N9BA
chains in the Genus database with same CATH topology
1G8KB 2NVGA 2HMJA 4QUPA 1WQLA 4NBDD 1NTKE 4HM5A 4NB8D 4QCKA 5KKZC 4QDFB 1SQVE 1VM9A 2YFJA 3GL0A 4HM4A 3VMID 3H1LE 2JO6A 4QUQA 1ULJA 1KB9E 3CX5E 3TGUE 2XR8A 1PP9E 2XSOA 4NBGD 1O7MA 1SQQE 4QDCA 2D2CD 3VCAA 3H1IE 4H44D 4NBED 4P1CH 2HMKA 3EQQA 1Q90C 1NYKA 2QJPC 1O7NA 3GZXA 1NTZE 4QDFA 4HKVA 1SQXE 2B24A 4HM1A 3L72E 3VCPA 4EMJB 4PV1D 2HMMA 2E75D 3BCCE 2YFIA 1NTME 1O7GA 3L70E 1RFSA 4AAYB 2ZT9D 2QJYC 2A06E 1BCCE 2YIUC 1L0LE 2NVEA 1UUWA 2HMOA 4NBHD 1KYOE 1EG9A 5HL4A 3N0QA 3GZYA 2E4QA 3CXHE 3L71E 1UUVA 2BCCE 1BGYE 2I7FA 3D89A 2GBWA 2JZAA 3GTSA 4OGQD 1NU1E 2ZYLA 1PPJE 4HM3A 2NUKA 2QPZA 4H13D 3GTEA 3VMGD 4U3FE 2BMQA 1O7HA 2E4PA 3L73E 1G8JB 2HMNA 2IBZE 2QJKC 1O7PA 3AZCA 4NBCD 2DE7D 4NBFD 4HM6A 2BMRA 3L74E 1FQTA 2CKFA 2Q3WA 3GKEA 5KLVE 2NUMA 4H0LD 3GCEA 1VCKA 2BMOA 1O7WA 2E74D 2GBXA 3L75E 1L0NE 4P1BH 4D6TE 2DE6D 4HM0A 1NDOA 2B1XA 2NVFA 5KLIC 3H1KE 3GOBA 3EN1A 3FOUA 1SQBE 4HJLA 1ZRTE 4QDDA 5AEUA 3C0DA 4PD4E 2DE5D 2NWFA 2FYUE 4HM2A 1VF5D 2XSHA 4HM7A 2YVJB 3GL2A 3CWBE 4NBAD 1SJGA 2E76D 2XRXA 1P84E 1BE3E 1EZVE 4HM8A 4QURA 3DQYA 4NB9D 1ULIA 2HMLA 3VMHD 1SQPE 4AIVA 5AEWA 3H1HE 1JM1A 2FYNC 5BOKA 2YFLA 5CXMA 3GB4A 4NBBD 1RIEA 3H1JE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8K B;  2NVG A;  2HMJ A;  4QUP A;  1WQL A;  4NBD D;  1NTK E;  4HM5 A;  4NB8 D;  4QCK A;  5KKZ C;  4QDF B;  1SQV E;  1VM9 A;  2YFJ A;  3GL0 A;  4HM4 A;  3VMI D;  3H1L E;  2JO6 A;  4QUQ A;  1ULJ A;  1KB9 E;  3CX5 E;  3TGU E;  2XR8 A;  1PP9 E;  2XSO A;  4NBG D;  1O7M A;  1SQQ E;  4QDC A;  2D2C D;  3VCA A;  3H1I E;  4H44 D;  4NBE D;  4P1C H;  2HMK A;  3EQQ A;  1Q90 C;  1NYK A;  2QJP C;  1O7N A;  3GZX A;  1NTZ E;  4QDF A;  4HKV A;  1SQX E;  2B24 A;  4HM1 A;  3L72 E;  3VCP A;  4EMJ B;  4PV1 D;  2HMM A;  2E75 D;  3BCC E;  2YFI A;  1NTM E;  1O7G A;  3L70 E;  1RFS A;  4AAY B;  2ZT9 D;  2QJY C;  2A06 E;  1BCC E;  2YIU C;  1L0L E;  2NVE A;  1UUW A;  2HMO A;  4NBH D;  1KYO E;  1EG9 A;  5HL4 A;  3N0Q A;  3GZY A;  2E4Q A;  3CXH E;  3L71 E;  1UUV A;  2BCC E;  1BGY E;  2I7F A;  3D89 A;  2GBW A;  2JZA A;  3GTS A;  4OGQ D;  1NU1 E;  2ZYL A;  1PPJ E;  4HM3 A;  2NUK A;  2QPZ A;  4H13 D;  3GTE A;  3VMG D;  4U3F E;  2BMQ A;  1O7H A;  2E4P A;  3L73 E;  1G8J B;  2HMN A;  2IBZ E;  2QJK C;  1O7P A;  3AZC A;  4NBC D;  2DE7 D;  4NBF D;  4HM6 A;  2BMR A;  3L74 E;  1FQT A;  2CKF A;  2Q3W A;  3GKE A;  5KLV E;  2NUM A;  4H0L D;  3GCE A;  1VCK A;  2BMO A;  1O7W A;  2E74 D;  2GBX A;  3L75 E;  1L0N E;  4P1B H;  4D6T E;  2DE6 D;  4HM0 A;  1NDO A;  2B1X A;  2NVF A;  5KLI C;  3H1K E;  3GOB A;  3EN1 A;  3FOU A;  1SQB E;  4HJL A;  1ZRT E;  4QDD A;  5AEU A;  3C0D A;  4PD4 E;  2DE5 D;  2NWF A;  2FYU E;  4HM2 A;  1VF5 D;  2XSH A;  4HM7 A;  2YVJ B;  3GL2 A;  3CWB E;  4NBA D;  1SJG A;  2E76 D;  2XRX A;  1P84 E;  1BE3 E;  1EZV E;  4HM8 A;  4QUR A;  3DQY A;  4NB9 D;  1ULI A;  2HML A;  3VMH D;  1SQP E;  4AIV A;  5AEW A;  3H1H E;  1JM1 A;  2FYN C;  5BOK A;  2YFL A;  5CXM A;  3GB4 A;  4NBB D;  1RIE A;  3H1J E; 
#chains in the Genus database with same CATH topology
 3Q5R A;  1URQ D;  1FZC C;  3AE1 C;  1AQ5 A;  3BAT A;  3F89 A;  3G6E P;  1DEE G;  2ZFC A;  4NBG D;  4M3L A;  3OW2 O;  1T8Z A;  3L74 D;  1JCC A;  4XFJ A;  2VRS A;  4TLF A;  1PL5 A;  2O1J A;  4HM1 A;  2Q7C A;  3EFF K;  1X0T A;  3SFE C;  1PP9 G;  5KAI E;  1K73 Q;  4PD4 I;  3EFG A;  1SP4 A;  1QLE D;  1G2C B;  1UUW A;  3A0H H;  1GU5 A;  3O6Q A;  3PP5 A;  4KHX A;  5CCH D;  1HJ0 A;  1XTG B;  1MFT A;  1SQQ J;  1ZN5 A;  2QPZ A;  3CXH I;  2ZJS E;  5KLV J;  3P32 A;  4L74 A;  3IF4 A;  2C9N Y;  1L4A A;  2QM8 A;  1S9K E;  2DE7 D;  2BMR A;  4YTP C;  3RL0 g;  3B5N A;  5CBN A;  1URQ B;  4D6T G;  2XU6 A;  1LP1 A;  4UB6 H;  2CPS A;  1YTZ I;  2KK7 A;  2WPR A;  5APY A;  1HGV A;  1LNQ A;  3LW5 J;  1SFC B;  3EN1 A;  4QDD A;  1FC2 C;  2XSH A;  1FJP A;  2FYU D;  2P2U A;  2ZXX A;  2M3E A;  1MZ9 A;  3H1H E;  4CPG A;  2LR2 A;  3RGU A;  1VQP P;  4ZNC A;  2E75 C;  3AE3 C;  1Y9B A;  1JTH B;  1GMJ A;  3MUD A;  2XZR A;  4RKU J;  4IL6 E;  2KLV A;  1ULJ A;  3M91 A;  1H0T A;  2GA1 A;  1M56 D;  1AVY A;  4L75 A;  1AV1 A;  4OGQ B;  1KIL C;  1RHZ B;  3H1L G;  1KQL A;  4GIF A;  1RE4 C;  3AE4 C;  2NPS B;  1BGY D;  1NTK G;  1SQV J;  2H7H A;  1LWU B;  3L70 J;  3P8C D;  3CXH E;  3H1K G;  3EQ2 A;  2JZA A;  1SQP K;  1KB9 H;  3CX5 H;  1H89 A;  1ZP0 C;  4H13 D;  1KOR A;  1NU1 D;  3WUV A;  2ZXE B;  2KOG A;  2BEQ D;  1IK9 A;  2M0B A;  3ITK A;  2CKF A;  4WBA A;  1FOS F;  5AVV B;  2FXP A;  3HE4 B;  2BMO A;  1PP9 D;  5KAF E;  2Z4E A;  3UIA A;  2P1J A;  3IFM A;  4D6T E;  1M1J B;  4N3Y B;  5BU5 A;  3TYY A;  1MFZ A;  1CI6 B;  3C0D A;  2HYN A;  3VMZ A;  1S4X A;  2DE5 D;  1QX8 A;  2QSI A;  1NU1 G;  1JM1 A;  5CCH A;  1OWA A;  1S72 P;  5CXM A;  1OXZ A;  2B88 A;  2JO1 A;  4HM5 A;  2FYU K;  3WU2 H;  4I7Z B;  5KKZ C;  3II6 A;  1RF0 A;  2GUV A;  2Q6Q A;  3TK1 A;  3L73 D;  1PP9 E;  3QWO C;  2QM7 A;  2WQY C;  1URQ A;  3H1L D;  4P1C H;  1SS1 A;  1Q90 C;  2O01 N;  1VQ4 P;  4JBZ A;  2FFD C;  4JYB A;  1KYO H;  2Q5U A;  2XV5 A;  2PGD A;  1DX7 A;  1M7L A;  2I8D A;  4NBH D;  1BDC A;  1N73 B;  2WWW A;  3E1I A;  2WPV B;  1OW6 A;  3WUT A;  2N9Y B;  1OMI A;  2JR8 A;  4U3F E;  1ZME C;  1QEX A;  3M0A A;  4GT1 A;  3MHV A;  3L71 G;  3CI9 A;  4QMA A;  1RH5 B;  1LTS C;  4PD4 H;  1SFC C;  1KIL B;  2WT7 B;  1LJ2 A;  4U7J A;  2FY8 A;  3GMA A;  1VL2 A;  2DE6 D;  2RKL A;  1J1E C;  3CC4 P;  2KS1 A;  4D6T D;  3M0D C;  4EDF A;  2KSJ A;  4NBA D;  4U3F G;  5AW1 B;  2V7Q H;  1NU1 J;  4U3F J;  2WSC H;  2HML A;  2ZVO B;  3JCU H;  4ASW A;  4LGD E;  2HOD A;  3GB4 A;  3R2P A;  5AVR B;  3P8M C;  4BWN A;  1PP9 J;  1PGP A;  1AVO A;  5C39 A;  1D7M A;  1GK6 A;  1IFD A;  3F5H A;  1NOH A;  1IFI A;  1S2E A;  1T3U A;  3CMA P;  1J1D B;  3P7K A;  5AVU B;  2K3R A;  1KQS O;  3HRN A;  2N1T D;  2E75 B;  1SQX D;  3AE7 C;  2J59 M;  4HB1 A;  4DCK A;  5L8R J;  3RK3 D;  4N78 D;  1L4A B;  3HD7 C;  3QH9 A;  2FFD A;  3U59 A;  1JEK A;  2C9L Y;  1EDK A;  2GM4 A;  3D89 A;  1GL2 A;  1FU1 A;  2N1T C;  1NU1 E;  2ZYL A;  1PPJ E;  1OVR A;  1SVF A;  2V4H A;  3AE8 C;  4PJ0 H;  3BCC G;  2E42 A;  1LTB C;  4PJ0 E;  2QJK C;  2BCC J;  4W80 A;  1R8E A;  3L74 E;  4EIJ A;  2NUM A;  3L35 A;  1VCK A;  4OGQ C;  1JY2 N;  4PV1 B;  3HTK A;  3PLN A;  3L37 A;  3C8V A;  1BE3 E;  2OTJ P;  5B66 E;  1SQP E;  4WY4 B;  3L74 J;  4KT0 J;  3CXH D;  1NTK E;  1NAY A;  4QCK A;  2PAJ A;  4XE5 B;  2AEM A;  5AW7 B;  4HM4 A;  3H1L E;  4N6J A;  5M1B A;  1S3J A;  1NAF A;  2XSO A;  3JSV C;  1M8O B;  2R44 A;  3GZX A;  1BE3 J;  1CSB A;  1IFJ A;  1RE4 A;  3VCP A;  3V4Q A;  2YFI A;  2QJY C;  4IFM A;  1S5L H;  2RH0 A;  3GLM A;  4R4L A;  1VQL P;  3N7N A;  3N0Q A;  2YMY A;  3GF7 A;  2Y0C A;  2I7F A;  3TGU J;  5AVW B;  5B5E H;  1Q2N A;  1OIP A;  5AVX B;  2FXO A;  5APW A;  3V2N A;  1W2B O;  3GKE A;  4W7Y A;  3GCE A;  5AVQ B;  3AE9 C;  1N7S C;  4AQR D;  1FOS E;  3TGU G;  2K88 A;  3GOB A;  2QIW A;  3L75 J;  3NFQ A;  1JNM A;  2OYH B;  1VF5 D;  5KAF H;  2P58 A;  1KN7 A;  2XRX A;  2E76 D;  1QL2 A;  2QRX A;  3U1A A;  2JJL A;  1NKN A;  2Q1K A;  4QUP A;  4NB8 D;  3W68 A;  2L5G B;  3WU2 E;  1GK4 A;  2WPS A;  2I1K A;  1SQP G;  4Y28 J;  2W6B A;  2KUB A;  3S9O A;  4RES B;  3EWK A;  4BRY A;  4UB8 H;  3CC7 P;  2QJK B;  3K5B A;  1RFS A;  1U7J A;  2QG4 A;  2XND H;  4IL6 X;  3TSI A;  1L0L E;  2KI7 B;  2WSS H;  3VMA A;  1KYO E;  1JY2 O;  3N4X A;  1UUV A;  3RBZ A;  4BRY B;  2Q3I A;  1ZR4 A;  2YXQ B;  1G8J B;  4DJG A;  1PV3 A;  2IBZ E;  1G2C A;  2IZ1 A;  3NMD A;  3WUU A;  1YJW P;  5BU8 B;  2KXP B;  1FQT A;  2NPS D;  3M06 A;  3A5T A;  4A7P A;  2IYP A;  2AXT H;  5CCG D;  4IFF A;  1L0N E;  1SQP J;  1J1D C;  3B5N D;  2KP8 A;  4HJL A;  1SQB E;  1LTA C;  3CWB E;  1FZF A;  1AJY A;  4HM8 A;  2LXB A;  1GZL A;  2WSE J;  1FDI A;  3VMH D;  3W67 A;  1MV8 A;  3H1L J;  1YQ3 C;  2B9B A;  3H1J E;  2YKQ A;  5AW2 B;  3VMY A;  1DD3 A;  4YXD C;  1NTK K;  2Z5I A;  2A45 H;  1LT9 B;  2CPB A;  3A0H E;  2B87 A;  1S9K D;  3C9I A;  4EOT A;  1YBK A;  1RF1 C;  3CCR P;  2R3S A;  3H1J G;  5KAI H;  2JWA A;  3TNU B;  1EZV D;  4H44 B;  2J58 A;  2V7Q J;  4WB4 A;  3L70 D;  4UB6 E;  2OYI B;  2IDB A;  1USE A;  1L0L D;  3L71 E;  1NYH A;  2KZJ A;  2OQQ A;  1L0N G;  1FE6 A;  1BDD A;  3VMG D;  1OFC X;  1BGY G;  1NTK D;  1YJN P;  2HMN A;  2YKO A;  1NU1 K;  1JY2 P;  3KQG A;  1FS0 E;  3RL0 C;  2Q3W A;  2IBZ D;  2IBZ G;  4H0L D;  1IZN B;  5CJ0 A;  4WY4 A;  1SQV K;  4P1B H;  1S5L E;  2YO3 A;  1GL2 C;  2ITA A;  2WSF H;  5KLI C;  2KSE A;  2R5D A;  2W6A A;  5KKZ B;  4LLH A;  3IR9 A;  3L71 D;  2E74 C;  1EDJ A;  2G8Y A;  5AW6 B;  1BSN A;  3VN0 A;  2BCC G;  4YXW H;  2QE7 H;  1U57 A;  4H44 C;  2NVG A;  2HMJ A;  4HJG H;  2K9J B;  1BCC J;  1CI6 A;  3H1J D;  4DT0 A;  3G9R A;  3FXD A;  2RMZ A;  2E76 C;  1S1C X;  3Q3D A;  1L4A C;  3HD7 B;  1SQX J;  2JO6 A;  1K9M Q;  1JUN A;  3JC2 2;  1FZB A;  1S5L X;  2D2C D;  1VQ9 P;  2HMK A;  3A2A A;  5AVZ B;  1O7N A;  1NTZ E;  1ZLL A;  1HH0 A;  3CC2 P;  2QA4 P;  1MUU A;  1URQ C;  1Q86 Q;  3BRV B;  1EDL A;  3CCJ P;  4AAY B;  3MUD C;  1KYO D;  1GTW A;  2WSC J;  1CZQ A;  4TT3 H;  1TU3 F;  1N7S D;  1KQF B;  3RK3 E;  3KDP B;  2ZT9 B;  1EG9 A;  5KLV K;  2CK3 H;  4WWI A;  2KNC B;  1LWU C;  3SSU A;  2NUK A;  2FYN B;  1SLQ A;  3RK3 C;  2BMQ A;  2G3A A;  3AZC A;  4NBF D;  3TNU A;  3HE4 A;  1YHQ P;  1FZC A;  1M90 Q;  1N7S B;  5GTI E;  1LTJ C;  2IBZ I;  3V6I A;  2M5A B;  3BRT B;  1FZE A;  4Z1M H;  1L0L J;  3SFD C;  1WMK A;  4I1L A;  3L72 D;  1ULI A;  1FJK A;  3AED C;  4IFD K;  2FYN C;  1FZC B;  1WQL A;  1NTZ G;  3CCV P;  3D6Z A;  3HE5 A;  2LXC B;  1NGM B;  3RBX A;  4DOJ A;  1SQV E;  3AEA C;  2PP6 A;  1QVF O;  2B87 B;  3VMI D;  2R3C A;  5B5E E;  1KB9 I;  3CX5 I;  1Y47 A;  1Q7Y Q;  1LWU A;  2OTL P;  3IAO A;  1HF9 A;  1L2P A;  1Q81 Q;  3D70 A;  1NYK A;  2QJP C;  2HPC B;  4OH8 B;  2W83 C;  4Y99 C;  5CCH C;  3L72 E;  2E76 B;  1NJI Q;  2BAS A;  3RK2 B;  3L70 E;  3U1C A;  3H1J J;  3BCC J;  3C1L A;  1U7M A;  3I56 P;  2WZ7 A;  1L0L K;  1GW3 A;  2OTK E;  4C7N A;  3MGN A;  1JMM A;  1FDM A;  2FBW C;  1YIJ P;  2FYU G;  4ASV A;  2BEZ F;  1UIX A;  4KJM A;  2HLO A;  4EYY Q;  1EC5 A;  4HH2 A;  2GBX A;  2ZYD A;  3PH0 A;  5APQ A;  3T97 A;  1JB0 J;  1G1J A;  1KYO I;  1JOC A;  4H13 C;  5KTB A;  2YVJ B;  3GL2 A;  5APU A;  1SQQ G;  3PJS K;  1L4A D;  2W90 A;  1EZV E;  3DQY A;  4NB9 D;  4AYC A;  2IPP A;  1N7S A;  2WTY A;  4H0L B;  5AW3 B;  3CME P;  4I2L C;  1ZOY C;  2A45 I;  2OGU A;  1DD4 A;  3CPW O;  2WVR A;  3KHU A;  3FWN A;  1VQM P;  1JO5 A;  1NTM K;  2C0W A;  1KIL D;  2YMK A;  1SQQ D;  2AEF A;  3JCU E;  3V2R A;  1E79 H;  1T6A A;  3L72 J;  3CLQ A;  1LT9 A;  3KZI H;  3V5B A;  1FDO A;  5CHX A;  4ZKU A;  3FX0 A;  1JCD A;  1SQQ K;  3CWB D;  2IZ0 A;  2YO2 A;  2ZT9 D;  3B71 A;  2XKM A;  3KPE A;  3E7K A;  2IYO A;  4JQ0 D;  2OYH A;  4K3A A;  3LID A;  1UII A;  5AVT B;  2ZYA A;  5HL4 A;  2NPS C;  3Q2Y A;  3M9B A;  5AW8 B;  1KIL E;  1LTT C;  5GTI H;  4JPZ B;  4GDO A;  3B5N C;  2NPS A;  4AUW A;  1HTL C;  1NTZ K;  5K5G B;  3CCL P;  2O3J A;  3L75 G;  1RF0 C;  3I5C A;  3H25 A;  3BCC D;  3L75 D;  2Z5H A;  1NTZ D;  1YI2 P;  1EZV I;  2FYU E;  1P84 E;  4XA4 A;  2JP3 A;  1NH4 A;  2D2C B;  2YFL A;  2H89 C;  1OX3 A;  4NBB D;  3SWK A;  3CWB G;  1QL1 A;  3M0D A;  2K9J A;  1VM9 A;  1AFO A;  3D71 A;  1WT6 A;  1X79 B;  2O01 H;  2XR8 A;  2J5U A;  3R4Y A;  1H8A A;  3L72 G;  1E5W A;  1HUC A;  2DW3 A;  3VCA A;  4Y99 B;  1JY3 N;  4DZO A;  3AEC C;  1KD1 Q;  1N86 A;  1LGH B;  3VOP A;  5APV A;  4W7Z A;  3AEG C;  3S1K A;  2K1A A;  5APT A;  1NTK J;  1SQV G;  1BCC E;  4NPF X;  1PGQ A;  2JWD A;  2QJY B;  2PRR A;  3KZI E;  3LW5 H;  3D6Y A;  4GOF A;  4HM3 A;  2ZAE B;  4GOE A;  3MIW A;  3H1H J;  4GOD A;  1VQ6 P;  1IFP A;  2AXT E;  3CXH H;  1VF5 C;  3SWY A;  5GTH E;  1VQO P;  1O7W A;  3L73 J;  1NTM G;  1RF1 B;  2MKV A;  3GF3 A;  4HM0 A;  1K05 A;  2B1X A;  4WY4 D;  3MP7 B;  1BCC D;  1ZRT E;  2XDJ A;  3H1I J;  3H1I G;  3VTP C;  1SFC D;  2QEX P;  3ZDM A;  1Y8A A;  3G71 P;  1RQU A;  4IL6 H;  4ZMD A;  4R4M A;  1DEB A;  1NTM J;  2NRG A;  2XNX A;  2BCC D;  2E43 A;  2I1J A;  3HUS C;  1FBM A;  2JEE A;  1NTZ J;  3A7O A;  2Y0E A;  1NWQ A;  3GW6 A;  2L91 A;  1X9V A;  3H1I E;  4H44 D;  1QGK B;  3KXD A;  1RF1 A;  3O6Q B;  4QDF A;  2WIT A;  1ZRT D;  1KFN A;  4PV1 D;  3Q1M A;  5H2F E;  5DJU B;  1NTM E;  3S4R A;  3B5N B;  3PTZ A;  1OW8 A;  1N2D C;  2Y9Y A;  4H0L C;  2YIU C;  2NVE A;  1G1I A;  2OYI C;  4PD4 D;  4D6T J;  2KZI A;  3H32 A;  1IC2 A;  2E4Q A;  1YYC A;  2OYH C;  2A45 G;  4WY4 C;  1PFI A;  1ZW0 A;  1LTI C;  3HTK B;  3GTE A;  2E4P A;  1O7P A;  4NBC D;  1DIP A;  4I6M C;  3L74 G;  4NPD A;  3AE6 C;  1N8R Q;  3OA7 A;  1RY3 A;  1LT9 C;  2HPC A;  1GL2 B;  3L75 E;  2P10 A;  2IX7 C;  1KC8 Q;  1IO4 A;  1PGJ A;  3Q5P A;  5B66 H;  4JF7 A;  4YPC A;  1EQ7 A;  4OWF A;  2OYO A;  5AW9 B;  1BSH A;  2AXC A;  3RK3 B;  4PD4 E;  1VF5 B;  3H1K D;  3L71 J;  3SWF A;  1OW7 A;  3P8C E;  4NPE A;  2Y9Z A;  1R5S A;  2A06 D;  3RL0 D;  2FYU J;  1AQT A;  5AW4 B;  1W2E A;  1G8K B;  1DH3 A;  3AEF C;  3OAK A;  3HD7 D;  2POH A;  1YJ9 P;  1OVV A;  2JDI H;  3GL0 A;  2RN0 A;  3FWL A;  3MTU E;  4JYC A;  2H8P D;  1PZQ A;  1IFM A;  3T97 B;  2IFM A;  2B24 A;  5AW0 B;  4N78 E;  2P67 A;  2E75 D;  3BCC E;  1JY3 P;  1FAV A;  3HUS B;  1MKM A;  1JMB A;  1KTM A;  5TJH A;  1O7G A;  2K9Y A;  5H2F H;  1X22 A;  2HMO A;  5EFW B;  1NHL A;  3A0B H;  3GHG B;  5APS A;  2GBW A;  3FGA D;  3M9H A;  3CCU P;  2WSF J;  4EI2 A;  2E74 B;  2SPZ A;  1NO4 A;  2OAR A;  3VP9 A;  3NTN A;  1O7H A;  3L73 E;  3AE2 C;  5KLV G;  4PV1 C;  4C7R A;  2YIU B;  5KJ7 D;  3IN6 A;  1LTJ B;  2KYV A;  1SQB K;  1KZU B;  2ZYG A;  2QJP B;  1GW4 A;  2E74 D;  1ZV8 A;  2KNC A;  1RQV A;  3ABV C;  1Q82 Q;  2M3B A;  3G4S P;  2FYZ A;  3FOU A;  1L0N D;  2KS1 B;  1BE3 D;  2NWF A;  5APX A;  1EXJ A;  1LT1 A;  4LC1 A;  3CCQ P;  3L36 A;  1M1K Q;  4BXL A;  1N73 A;  1P84 H;  5AEW A;  1VDF A;  1GL2 D;  1KQG B;  2FXM A;  2M5A A;  1YIT P;  3GG2 A;  2O1K A;  1AA0 A;  5CCG C;  1R5L A;  3BVH A;  1OZH A;  1L0L G;  1L0N K;  1SQB G;  4RO0 A;  3CCS P;  3TGU D;  2YFJ A;  3AE5 C;  3L70 G;  3H6P A;  4QUQ A;  3MZW B;  1EZV G;  1M57 D;  1VQN P;  1SQQ E;  4NBE D;  3H1K J;  5AVS B;  3EQQ A;  1Z56 A;  3B8E B;  4B86 A;  2GUS A;  1P84 I;  1T3J A;  4EMJ B;  3VP8 A;  1P84 D;  2HR3 A;  2H88 C;  3O8Z A;  2WT7 A;  3E1R A;  1SQB J;  3USS A;  4UB8 E;  3PHL A;  4OGQ D;  1USD A;  1HJB A;  1Q90 D;  4ZKP A;  2W27 A;  5KJ7 A;  2ZT9 C;  1HVV A;  1K04 A;  3M9Q A;  1T2K C;  2Q3E A;  2R32 A;  4HM6 A;  1BGY J;  1SQV D;  3V2Q A;  3Q5S A;  1SQX K;  5AVY B;  1LTG C;  3I55 P;  1VQ8 P;  1X8Y A;  1NDO A;  2W8Z A;  2KIK A;  3G3Z A;  3H1K E;  2Y0D A;  1A02 J;  1GDT A;  2MJZ A;  4HM2 A;  1PIX A;  4IOI H;  1K8A Q;  1FZA A;  2FKW B;  4C46 A;  3H32 B;  4QUR A;  3WMM 0;  1LTJ A;  1PPJ D;  2NZ2 A;  3TDK A;  5BOK A;  3HE5 B;  1J2J B;  4HYT B;  1HWT C;  2N1T A;  4NBD D;  5CCG A;  2P7J A;  1FZG A;  1VQ7 P;  1VQK P;  2C0X A;  1H0T B;  2B89 A;  3NXS A;  2WSE H;  1QVG O;  1RE3 A;  3TGU E;  2WPQ A;  1L0N J;  1EXI A;  5KLI B;  1JM0 A;  1WRG A;  3BAS A;  3CWB J;  4OVN F;  1PGO A;  1M1J A;  4I7Z C;  2M8R A;  3A0B E;  1A02 F;  1SQP D;  2E5Y A;  3H1H D;  2ZVN B;  3HUS A;  1KIL A;  1NKZ B;  3GHG C;  3FXE A;  1VQ5 P;  5TIS E;  2BCC E;  1W5C E;  4WVZ A;  2IFN A;  1JY3 O;  4C7N B;  5E79 E;  1M1J C;  1JTH A;  2HFE D;  3CL3 D;  3AEB C;  3H1I D;  1ZXG A;  2R5B A;  4GKG A;  3CD6 P;  1VPC A;  1IK7 A;  1BCC G;  2KLU A;  3OJA B;  3V4W A;  1H88 A;  3LIE A;  5BVZ A;  1SQB D;  4K35 A;  3VYI A;  3L4F A;  1NTM D;  1YTZ T;  5CMZ A;  1CW5 A;  1IFN A;  1GU4 A;  2NVF A;  1HBW A;  3CCM P;  1SFC A;  5CBO A;  1SJG A;  3HD7 A;  2O01 J;  1N73 C;  3H1H G;  4MN4 C;  1N7L A;  2H43 A;  2WMM A;  1SQX G;  1BE3 G;  2D2C C;  2LKM A;  4QDF B;  3MD0 A;  2FFD B;  1J1E B;  3PRJ A;  1ZR2 A;  2E5T A;  4L76 A;  4U3F D;  3RK2 C;  1KB9 E;  3AEE C;  3CX5 E;  2KB7 P;  4H13 B;  1O7M A;  4QDC A;  5KLV D;  3GHG A;  4HKV A;  1SQX E;  1KFM A;  4O9B A;  2YXR B;  3RL0 B;  2JKV A;  3CCE P;  2HMM A;  3TF5 A;  5KJ7 C;  1GD2 E;  1PPJ G;  2A06 E;  1T2K D;  2AEJ A;  1LP1 B;  1NVO A;  3A3Y B;  4RJT A;  1IJD B;  3KYQ A;  2UWJ E;  3GZY A;  1HGZ A;  3B4S A;  1BGY E;  3GTS A;  1RE3 C;  1EDI A;  2HOD B;  1KV4 A;  3VMX A;  2Q9I A;  1YQ4 C;  1KB9 D;  3CX5 D;  5AW5 B;  2YKP A;  5CJ4 A;  5E79 H;  2HG5 D;  3V2P A;  5KLV E;  2OYI A;  3L73 G;  1OVU A;  4HKZ H;  5TIS H;  1KMI Z;  5DJT B;  2YNY A;  4L73 A;  2QVA A;  5GTH H;  5AEU A;  3RK2 D;  4HM7 A;  2A06 G;  2PFX A;  1XTC C;  2W6J H;  4AIV A;  2N1T B;  2K37 A;  1RIE A;  2N9B A; 
#chains in the Genus database with same CATH homology
 1G8K B;  2NVG A;  2HMJ A;  4QUP A;  1WQL A;  4NBD D;  1NTK E;  4HM5 A;  4NB8 D;  4QCK A;  5KKZ C;  4QDF B;  1SQV E;  1VM9 A;  2YFJ A;  3GL0 A;  4HM4 A;  3VMI D;  3H1L E;  2JO6 A;  4QUQ A;  1ULJ A;  1KB9 E;  3CX5 E;  3TGU E;  2XR8 A;  1PP9 E;  2XSO A;  4NBG D;  1O7M A;  1SQQ E;  4QDC A;  2D2C D;  3VCA A;  3H1I E;  4H44 D;  4NBE D;  4P1C H;  2HMK A;  3EQQ A;  1Q90 C;  1NYK A;  2QJP C;  1O7N A;  3GZX A;  1NTZ E;  4QDF A;  4HKV A;  1SQX E;  2B24 A;  4HM1 A;  3L72 E;  3VCP A;  4EMJ B;  4PV1 D;  2HMM A;  2E75 D;  3BCC E;  2YFI A;  1NTM E;  1O7G A;  3L70 E;  1RFS A;  4AAY B;  2ZT9 D;  2QJY C;  2A06 E;  1BCC E;  2YIU C;  1L0L E;  2NVE A;  1UUW A;  2HMO A;  4NBH D;  1KYO E;  1EG9 A;  5HL4 A;  3N0Q A;  3GZY A;  2E4Q A;  3CXH E;  3L71 E;  1UUV A;  2BCC E;  1BGY E;  2I7F A;  3D89 A;  2GBW A;  2JZA A;  3GTS A;  4OGQ D;  1NU1 E;  2ZYL A;  1PPJ E;  4HM3 A;  2NUK A;  2QPZ A;  4H13 D;  3GTE A;  3VMG D;  4U3F E;  2BMQ A;  1O7H A;  2E4P A;  3L73 E;  1G8J B;  2HMN A;  2IBZ E;  2QJK C;  1O7P A;  3AZC A;  4NBC D;  2DE7 D;  4NBF D;  4HM6 A;  2BMR A;  3L74 E;  1FQT A;  2CKF A;  2Q3W A;  3GKE A;  5KLV E;  2NUM A;  4H0L D;  3GCE A;  1VCK A;  2BMO A;  1O7W A;  2E74 D;  2GBX A;  3L75 E;  1L0N E;  4P1B H;  4D6T E;  2DE6 D;  4HM0 A;  1NDO A;  2B1X A;  2NVF A;  5KLI C;  3H1K E;  3GOB A;  3EN1 A;  3FOU A;  1SQB E;  4HJL A;  1ZRT E;  4QDD A;  5AEU A;  3C0D A;  4PD4 E;  2DE5 D;  2NWF A;  2FYU E;  4HM2 A;  1VF5 D;  2XSH A;  4HM7 A;  2YVJ B;  3GL2 A;  3CWB E;  4NBA D;  1SJG A;  2E76 D;  2XRX A;  1P84 E;  1BE3 E;  1EZV E;  4HM8 A;  4QUR A;  3DQY A;  4NB9 D;  1ULI A;  2HML A;  3VMH D;  1SQP E;  4AIV A;  5AEW A;  3H1H E;  1JM1 A;  2FYN C;  5BOK A;  2YFL A;  5CXM A;  3GB4 A;  4NBB D;  1RIE A;  3H1J E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...