1L0NE

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 33
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0nE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0nE02
2NUKA 4NB8D 4HM4A 2BMOA 2DE6D 2ZYLA 3VMID 2XSHA 2ZT9D 3L73E 1L0NE 1NTME 4HKVA 3AZCA 4HM6A 4QUQA 3L75E 1BCCE 4NBFD 1NU1E 1PP9E 4HM0A 4HM7A 1P84E 2CKFA 1SQBE 5CXMA 2NVEA 2QJYC 3EQQA 2HMOA 2HMKA 2Q3WA 4QCKA 2E74D 2B1XA 1O7HA 2E75D 2HMLA 2QJKC 3GTEA 3GB4A 2NUMA 5AEWA 3GZYA 3H1JE 4QUPA 4QDFA 1KYOE 3H1HE 1NTZE 2A06E 2HMNA 4AAYB 3GCEA 1VM9A 3DQYA 3L71E 4PD4E 2GBXA 4P1CH 1EG9A 1PPJE 2HMJA 3L74E 4OGQD 4D6TE 2GBWA 2NVGA 2BCCE 1Q90C 1O7GA 2YFLA 2QJPC 2YVJB 4NBCD 3VMGD 2YFJA 1BGYE 3H1LE 1O7PA 4P1BH 2YIUC 3GL0A 4HM8A 3H1IE 2XRXA 2E4QA 4PV1D 2I7FA 4HJLA 4EMJB 4NB9D 4NBED 1ULJA 4NBDD 2DE7D 4NBAD 1EZVE 1BE3E 3BCCE 1G8JB 3FOUA 4NBBD 5KLVE 1NYKA 4QDCA 2E4PA 4QURA 3GOBA 3CWBE 1WQLA 2BMQA 2HMMA 4AIVA 3CXHE 1NTKE 4U3FE 4HM1A 3GZXA 3GL2A 2E76D 4HM2A 3GTSA 4NBHD 3C0DA 4QDFB 2JZAA 1SQVE 3EN1A 1VF5D 2YFIA 1G8KB 2JO6A 1UUVA 2XSOA 5AEUA 2FYUE 1RFSA 5BOKA 2QPZA 1ZRTE 3GKEA 3N0QA 4NBGD 1UUWA 1JM1A 3TGUE 1L0LE 2FYNC 3H1KE 1NDOA 3VMHD 3CX5E 2NWFA 2D2CD 1KB9E 1VCKA 4H13D 1SQPE 5HL4A 2DE5D 2XR8A 5KLIC 3VCPA 5KKZC 1ULIA 3VCAA 1O7WA 4QDDA 1FQTA 1O7MA 1SJGA 1O7NA 1RIEA 4HM5A 3L70E 4HM3A 2IBZE 3L72E 2NVFA 1SQQE 3D89A 2B24A 4H0LD 4H44D 2BMRA 1SQXE
chains in the Genus database with same CATH superfamily
4EYYQ 4RKUJ 5BU5A 3D6YA 1NU1E 3U1AA 1PPJG 1KQGB 2E75D 3MGNA 4HH2A 1HUCA 3GZYA 3HUSB 4PJ0E 1MKMA 3BASA 3CMAP 1PPJE 5KAFE 2FXMA 4OGQD 1IFDA 2KS1A 1HGVA 1YBKA 2E75C 1U7JA 1M1JA 1RE4A 1W2BO 2XRXA 1HF9A 4EOTA 1PZQA 3C1LA 1KQLA 5AVSB 1SS1A 2DE7D 1Q86Q 4NBBD 2IPPA 4BRYB 1CI6A 1G2CA 2ITAA 1LTAC 1QL2A 3BATA 1Y9BA 4GODA 2H43A 2QIWA 2YO3A 5KJ7A 1DEBA 3RBXA 1VQ8P 1T3UA 1GZLA 1FOSF 2K9JB 1UIIA 3CCQP 1N7LA 4NPEA 2QRXA 1KILA 4KHXA 1S72P 3RK2D 1KZUB 1RF0C 4GDOA 2GA1A 1LTIC 5BVZA 3GF3A 4QMAA 2HODA 1GL2C 4NB8D 1URQA 3G3ZA 1KFNA 1YJWP 1LT9C 2YMYA 3CCJP 3RK2C 2M8RA 5AW3B 3BCCG 1H8AA 2KUBA 4GKGA 1MFTA 5CXMA 3QWOC 2E75B 2N1TD 2QJYC 2FKWB 2B88A 1T6AA 5CCHD 1P84I 2QVAA 1PGQA 1FJKA 1VQ4P 2P10A 1X79B 3WU2H 3EWKA 3M9HA 1NTKD 3RK3D 4OGQB 2D2CC 1EG9A 2N1TC 2GM4A 2GBWA 3O6QB 3QH9A 3M0AA 2YVJB 2YFJA 3EFFK 1K8AQ 1JY3P 2M3BA 1NTKJ 2XZRA 1H0TA 1KMIZ 3RK3C 2E4QA 4TT3H 3CX5D 1FBMA 1SQQG 5E79H 1JY2N 3CC4P 3AE9C 1NTKE 1G1JA 2IZ0A 1OMIA 2KLVA 1NKZB 4O9BA 4WY4D 2L91A 2RN0A 3CCRP 4DOJA 2GUSA 1S5LE 3GF7A 4B86A 4RO0A 1SLQA 3CX5E 3RK2B 2LXBA 4WY4C 2CPBA 3H1HG 2AEMA 5KKZC 5AW2B 4GOFA 2OYOA 2QE7H 3D89A 4N78D 1E79H 2NUKA 2KLUA 1J1DC 3KXDA 1RF0A 2XSHA 2N1TB 2JEEA 2WPQA 2C9NY 2I1KA 1GL2A 3HD7A 1LT9A 2HMOA 3RK3B 1BSNA 3RGUA 4QDFA 4N78E 2BCCD 1RQVA 1T8ZA 3TSIA 1EZVG 2JWDA 1ZP0C 1Y47A 4IL6X 2KNCB 1YITP 2YKQA 2B87A 2Q3IA 3MD0A 3IF4A 4UB8E 3M91A 1IO4A 1EZVE 1N7SA 2IYOA 1WQLA 2I1JA 1FJPA 4Y99B 3H32A 2W8ZA 3MHVA 4WY4B 1L0NG 2YXRB 2WT7B 3MP7B 1W5CE 2R3CA 3W68A 4RESB 5K5GB 1S4XA 2H89C 3L75D 1LTJA 4NBGD 3T97B 3V4WA 3VMHD 1JUNA 3A0HE 4GIFA 2POHA 3AE6C 2A06G 5KLIC 3G4SP 5CBNA 1PGPA 3VCAA 1O7MA 2K1AA 2Q6QA 4HM3A 3L75G 2O01J 2NVFA 1Z56A 3L75J 1KYOD 3E7KA 2CK3H 1SFCD 1X22A 4W7ZA 1GK6A 3LIDA 2QSIA 2Y0EA 2H88C 5AW5B 3KDPB 3H1LD 3L75E 2E43A 1T3JA 2SPZA 3AE8C 1X8YA 2LR2A 3L71G 2WSEH 3Q2YA 2HPCA 2R3SA 1SFCC 3L71J 1O7HA 2HMLA 1IK7A 1IJDB 5AEWA 1IK9A 2KSEA 3H1LJ 1KYOE 2FFDB 3K5BA 2JP3A 2R5DA 2WPVB 1H89A 3S1KA 3DQYA 3L71E 1IFNA 4Y28J 1NAFA 2KIKA 2Y9ZA 5AVZB 2O1JA 3H1LE 4YPCA 1LWUC 1ZRTD 2R5BA 2Y0CA 2W6AA 1K04A 3IAOA 5TISE 1LP1B 1KB9D 1X9VA 1L4AD 1HVVA 1KD1Q 1K73Q 2M5AB 3HTKA 5BU8B 1ZN5A 1VF5D 3KZIE 2QJKB 1NKNA 3H1KD 1JCDA 1ZRTE 3UIAA 2P2UA 1RHZB 1PP9D 3BRVB 4EI2A 1KB9E 2XR8A 5B66E 1ULIA 3II6A 2QG4A 3JC22 1SFCB 2QEXP 4H0LD 2DW3A 1KV4A 1PP9J 4PD4D 1KC8Q 1PFIA 3AE3C 1NWQA 2J59M 2C9LY 3VMID 4HKVA 4HM6A 1YYCA 2H7HA 1BE3G 1JTHA 3H1ID 1PP9E 3CMEP 1QVGO 3CWBG 3LIEA 1LWUB 5AW1B 3EQ2A 1Q7YQ 3KPEA 3ITKA 1SQVG 5AVUB 1M57D 4AAYB 3H1IJ 2FYUG 4PD4E 4K35A 3WMM0 2FYUJ 2OYHA 2C0WA 3B5NC 3CC2P 2ZFCA 1L0LG 1Y8AA 2QJPC 1L0LJ 4I2LC 3AEDC 4HM8A 3H1IE 2P67A 3TGUD 4PV1D 4YXDC 1L4AB 1FAVA 2I7FA 2R44A 3FOUA 4QDCA 1NAYA 2JKVA 3AEEC 3L70D 1VF5B 3TGUJ 4PV1C 1IFJA 1RQUA 3CXHH 4IL6H 4TLFA 1AVOA 3L73D 1HJBA 3L70G 5APQA 3TGUE 3L70J 3RL0g 1P84D 3H1JG 4H13D 2HFED 4H0LB 1KFMA 1FZEA 3L70E 3L73J 3TF5A 1SQBG 1JOCA 2MJZA 3LW5J 1SQBJ 4D6TD 4H13C 2YKOA 3L73E 3HE4B 1RF1B 3A3YB 4QUQA 2RMZA 4HB1A 3SWYA 2WSCH 3D71A 5GTHE 1P84E 4WVZA 1SQBE 1URQD 2B1XA 1EDJA 4D6TJ 3GB4A 3ABVC 3L35A 1OFCX 1PPJD 4HJGH 1ZW0A 1NJIQ 1VQ7P 1AFOA 2JDIH 4D6TE 2NVGA 1DEEG 2YFLA 2KYVA 4PV1B 3GLMA 2HYNA 1N73C 3GG2A 1DD3A 4BXLA 3B5NA 4HJLA 4AYCA 2MKVA 3CCVP 5APUA 1K05A 3A5TA 1HH0A 4IOIH 2WPRA 4A7PA 3W67A 3I5CA 2KSJA 3C0DA 3WUVA 1FU1A 2KK7A 5CCGA 1NTMD 3V2RA 4H13B 4OGQC 1OVVA 2JWAA 4XFJA 1AQTA 4ASWA 3HUSA 1BSHA 1NTMG 4CPGA 1NTMJ 2ZJSE 3FWLA 2IYPA 1S9KD 2B89A 2W27A 1NTME 2OGUA 1G1IA 2OYIC 1AA0A 1URQB 2Z5IA 1FZCC 2WSFH 2CKFA 1Q90D 1SQPK 1N73B 3VMYA 4BRYA 1HBWA 3BCCD 3G9RA 1OX3A 4IFMA 3HD7D 2JJLA 3M06A 3A0BH 1S9KE 3JCUH 2HMJA 2FYZA 3SFEC 1Q90C 3VP8A 1Q82Q 4JBZA 3AE7C 3BCCJ 3L36A 2K9JA 5B5EH 4P1BH 2UWJE 2A45H 5CMZA 1M1KQ 3CC7P 2YMKA 1ZR2A 4KJMA 5M1BA 1QX8A 2LXCB 3BCCE 4Z1MH 3GZXA 4ZNCA 5AW7B 1SQQD 3CXHI 5CCHC 4N3YB 2KZIA 5H2FH 4JYBA 5AEUA 3GMAA 5GTIH 1H88A 1UUWA 2WTYA 3NFQA 1SQQJ 4DJGA 2OYIB 1VCKA 3IN6A 5KLVK 1FZCB 1M56D 3MUDC 1SQQE 1LT1A 2NRGA 3H1HD 3O6QA 1SVFA 1R5LA 1S3JA 4ASVA 2ZYLA 2BEQD 2IDBA 3M0DC 4WWIA 3AZCA 1S1CX 1OXZA 4Y99C 1AJYA 1M7LA 3WU2E 1NTZG 1OVUA 3H1HJ 1NTZJ 3CCMP 1GMJA 1VL2A 2QM7A 2E74D 3PRJA 4EDFA 2NUMA 3HD7B 4ZKUA 1MUUA 1MFZA 4C7RA 1OW8A 1ZOYC 1W2EA 5AVXB 3H1HE 1NTZE 2WITA 3Q1MA 1WT6A 1QGKB 1IZNB 1JY3N 2LKMA 2V7QH 3AEAC 4GOEA 2P1JA 4OH8B 2Q9IA 2E74C 2KP8A 3G6EP 2KB7P 5E79E 3AEGC 1NU1K 3O8ZA 4L74A 1EZVD 1SP4A 5AW8B 4EMJB 2YKPA 2XV5A 3CD6P 1RE3C 3GOBA 1SQXG 2FXOA 4HM1A 2IX7C 2E76D 3RBZA 3PP5A 1DH3A 2NPSD 3EN1A 1PL5A 1VPCA 2QM8A 2N1TA 1RFSA 1L0ND 5CCHA 1EQ7A 3AE1C 1JO5A 3A2AA 2FFDC 1NDOA 3L4FA 2NPSC 3VMXA 3CCEP 4L73A 1U57A 2YNYA 2O01N 4I7ZC 1L0NJ 2AXCA 3AE5C 2A06D 1BGYG 2O1KA 1A02J 3PH0A 5AW6B 2WWWA 2KNCA 3Q5RA 1L0NE 5AVRB 3OW2O 3KHUA 2Q7CA 2WQYC 3SFDC 2E74B 2N9BA 3EQQA 2RKLA 3GHGB 1JY2O 5KAIH 2QJKC 2AXTH 1J2JB 4WY4A 2W6JH 4WB4A 3L71D 5CBOA 2WT7A 1VDFA 2A06E 2Q1KA 5AW9B 2CPSA 2A45I 3Q5PA 3VMZA 1USEA 4HYTB 3IR9A 3G71P 1NVOA 3T97A 1MV8A 1GU4A 1AVYA 3M9QA 2IFNA 4ZMDA 4NB9D 1G8JB 3H6PA 2E76B 1PV3A 2NPSB 2E5TA 3HRNA 2P7JA 3GTSA 4NBHD 4I7ZB 2FBWC 3CCLP 1KB9H 5EFWB 4JYCA 1UUVA 2XSOA 1KQFB 3S4RA 2WSSH 3B71A 3FXEA 3PJSK 5APTA 1GK4A 4R4MA 1YJNP 1EXJA 1ZMEC 4QDDA 1FQTA 1NTKK 2WSEJ 1BCCG 2FFDA 1KTMA 1BCCJ 1NOHA 4R4LA 2BMRA 1L4AC 2XU6A 4L75A 4JPZB 5KTBA 1BCCE 4NBFD 4C46A 1VF5C 2Z4EA 2H8PD 3VYIA 3F5HA 2HLOA 1LP1A 3RL0D 1BE3D 3FWNA 4I1LA 3CWBD 4GT1A 2RH0A 2M5AA 3V2NA 2NZ2A 4P1CH 2GBXA 2V4HA 1SQVD 1QL1A 3RL0C 1LNQA 1BE3J 3PHLA 2FYUD 4H0LC 1VQMP 3R2PA 1SQPG 3CWBJ 1KN7A 1L0LD 4L76A 1WMKA 1FS0E 1LTGC 1SQVJ 1BE3E 3TNUB 2K37A 3CWBE 1SFCA 2HG5D 1S5LX 1RF1C 4HM2A 4UB6E 5APYA 1Q81Q 3P7KA 1SQVE 5AVYB 3P8MC 1OW7A 3ZDMA 2YO2A 3P8CD 2FYUE 2I8DA 4XE5B 3N0QA 1X0TA 1L0LE 2FYNC 3SSUA 4DT0A 3MTUE 1LWUA 2ZXXA 1JMMA 1AV1A 3PTZA 5C39A 5AW4B 2YXQB 4DZOA 1FZFA 3H1JD 1Q2NA 2M0BA 4H44D 1BDCA 1AQ5A 1NHLA 4K3AA 4HM4A 3HE5B 1M1JC 3P8CE 3JSVC 4C7NA 1DD4A 1KYOI 2BEZF 3V4QA 1SQBD 5KLVG 5KJ7D 1L4AA 3RL0B 4HM0A 3H1JJ 1IFPA 1RY3A 3FX0A 4H44C 4U3FG 2Q3WA 1GW4A 4LLHA 2XNXA 4MN4C 3CXHD 3H1JE 1KILD 3V5BA 2HMNA 1LTTC 1QEXA 1VM9A 3S9OA 1VQ9P 3A7OA 4PJ0H 1U7MA 1EDIA 1FDMA 5KAFH 1T2KD 1ULJA 2IBZG 4NBAD 2KI7B 2FYNB 3CXHE 2WVRA 1KILE 4IL6E 1URQC 1KB9I 3FXDA 1IC2A 1CSBA 5AVVB 1G8KB 1NU1G 3HE4A 1RF1A 2KS1B 5BOKA 1LTBC 1M1JB 1M8OB 5HL4A 2DE5D 2WSCJ 1CI6B 4H44B 5AVQB 1G2CB 2YIUB 5APVA 2B24A 2R32A 4OWFA 1FZAA 3MZWB 2Z5HA 1OW6A 4PD4I 2PAJA 5AVTB 2JO1A 1XTGB 3GTEA 1KILB 3VTPC 2HODB 2JR8A 1LGHB 1O7GA 3IFMA 1MZ9A 2KOGA 4NBCD 1YI2P 2IZ1A 2AEFA 2WZ7A 1RH5B 5AVWB 3V2PA 4NBDD 1A02F 1GL2D 1JCCA 4AIVA 1JY2P 1K9MQ 1IFMA 1SQVK 1YTZI 3HD7C 5APSA 1FZBA 3KYQA 5APWA 2W83C 2FYUK 1H0TB 1N73A 2D2CD 1L0LK 1QLED 1VQPP 1NYHA 4EIJA 2WSFJ 2WPSA 1S5LH 2K9YA 3CX5H 1N7SD 1VQNP 2IBZI 1GDTA 1GD2E 4W80A 2DE6D 3NMDA 4NPDA 1VQLP 4M3LA 2ZT9D 1D7MA 1FDIA 2W90A 1N7SC 2NVEA 3E1RA 1NTKG 3CL3D 4QCKA 2A45G 1JB0J 2XKMA 3A0BE 3CPWO 1JEKA 3JCUE 4YTPC 1NTZD 2ZT9C 1YIJP 3P32A 2ZAEB 5B5EE 3SWKA 1EXIA 1JM0A 3RK3E 1LTJC 1EDKA 1ZV8A 1DIPA 3GL0A 1SQBK 2OYIA 1GL2B 2BASA 3VMAA 1LT9B 1FZCA 4LGDE 3KQGA 2KXPB 5H2FE 3E1IA 3GL2A 1KQSO 4UB8H 2QJYB 4QDFB 5GTIE 1NO4A 1SQXD 3GHGC 3NXSA 2Q5UA 2D2CB 1HTLC 2B87B 3Q5SA 4OVNF 1SQXJ 3MIWA 1JMBA 1VQKP 1N7SB 1LTSC 4I6MC 3SWFA 3H32B 5TJHA 3A0HH 1SQXE 2G8YA 2ZT9B 1N86A 2BMOA 2PFXA 2E76C 1HWTC 1ZLLA 2PP6A 2G3AA 1BGYD 2PRRA 3AECC 2V7QJ 1LTJB 2OARA 1YHQP 3C9IA 4ZKPA 2O01H 4NPFX 2P58A 3NTNA 2BCCG 1USDA 2BCCJ 1R8EA 4QUPA 1BGYJ 1PIXA 3MUDA 2K3RA 3PLNA 4BWNA 2OQQA 2BCCE 2O3JA 5KKZB 1M90Q 1FOSE 1NTMK 1KYOH 1BGYE 1O7PA 1DX7A 3M0DA 3WUUA 1WRGA 1XTCC 3D70A 3V2QA 2FY8A 1J1DB 1FZGA 4HKZH 2HPCB 2WMMA 1NYKA 4QURA 5CHXA 2HMMA 3FGAD 1VQ6P 1FC2C 5TISH 1GU5A 2C0XA 2KZJA 3AE2C 2YFIA 1NGMB 2E5YA 3AE4C 2QPZA 3VN0A 4IFFA 1R5SA 3OJAB 2B9BA 3KZIH 1OVRA 3GHGA 2NWFA 1CW5A 4N6JA 3AEBC 3CX5I 3N7NA 3VCPA 1O7WA 4W7YA 1YJ9P 1SJGA 1RIEA 4HM5A 2ZVOB 1RE3A 2OYHC 2Q3EA 2GUVA 3H1LG 5B66H 3TDKA 2Y0DA 1CZQA 3HTKB 3VP9A 1JY3O 1BCCD 1YTZT 1S2EA 5KAIE 1EDLA 2PGDA 3N4XA 2AXTE 3USSA 4HM7A 3EFGA 1OZHA 2M3EA 5L8RJ 2NPSA 3BVHA 1NH4A 2ZVNB 1SQQK 4AQRD 3GCEA 1OIPA 1ZXGA 5APXA 1E5WA 3B4SA 5KLIB 2ZYGA 3TYYA 4PD4H 2OTJP 2E42A 1JTHB 1KORA 4UB6H 4NBED 3H25A 2K88A 5DJUB 1SQPD 5CJ4A 1EZVI 2BMQA 2XNDH 1FDOA 1NTZK 2W6BA 1GW3A 3H1KG 2JZAA 4WBAA 3CCSP 1PGJA 1UIXA 3H1KJ 4IFDK 3TK1A 1PP9G 3CI9A 2OYHB 1LJ2A 1SQPJ 2XDJA 2FXPA 2OTKE 3H1KE 1N2DC 1N8RQ 1SQPE 3VOPA 3B5ND 3R4YA 1FE6A 1OWAA 1GTWA 4XA4A 5DJTB 3M9BA 3L74D 2AEJA 3GW6A 3H1IG 3I56P 1SQXK 2J58A 1PGOA 1L2PA 5CCGD 1J1EC 5AW0B 2ZYAA 2Y9YA 1TU3F 4C7NB 3U1CA 2HMKA 3TNUA 3L74G 3WUTA 3L74J 3I55P 5KLVD 3C8VA 5GTHH 1P84H 3LW5H 5CCGC 4U3FD 1RE4C 1HGZA 3F89A 1YQ4C 3CCUP 3L74E 4KT0J 3V6IA 3TGUG 1L0NK 3VMGD 4JF7A 5KLVJ 2N9YB 2YIUC 3BRTB 4JQ0D 3CLQA 4U3FJ 2J5UA 1EC5A 2L5GB 1ZR4A 3HUSC 1BDDA 3L37A 1JNMA 5KLVE 3U59A 2E4PA 5KJ7C 4U3FE 3OA7A 2IBZD 3L72D 2OTLP 3L73G 3D6ZA 3HE5A 1VQ5P 1YQ3C 2JO6A 4RJTA 1VQOP 4YXWH 2HR3A 1KILC 4DCKA 3GKEA 3L72G 1NU1D 1JM1A 3Q3DA 3L72J 4LC1A 1J1EB 1HJ0A 3B5NB 2IFMA 3AEFC 2QA4P 3B8EB 2QJPB 3OAKA 4AUWA 2ZXEB 1O7NA 4D6TG 2IBZE 3L72E 1T2KC 1QVFO 1IFIA 4U7JA 5CJ0A 1NU1J 2VRSA 2ZYDA
chains in the Genus database with same CATH topology
2NUKA 4NB8D 4HM4A 2BMOA 2DE6D 2ZYLA 3VMID 2XSHA 2ZT9D 3L73E 1L0NE 1NTME 4HKVA 3AZCA 4HM6A 4QUQA 3L75E 1BCCE 4NBFD 1NU1E 1PP9E 4HM0A 4HM7A 1P84E 2CKFA 1SQBE 5CXMA 2NVEA 2QJYC 3EQQA 2HMOA 2HMKA 2Q3WA 4QCKA 2E74D 2B1XA 1O7HA 2E75D 2HMLA 2QJKC 3GTEA 3GB4A 2NUMA 5AEWA 3GZYA 3H1JE 4QUPA 4QDFA 1KYOE 3H1HE 1NTZE 2A06E 2HMNA 4AAYB 3GCEA 1VM9A 3DQYA 3L71E 4PD4E 2GBXA 4P1CH 1EG9A 1PPJE 2HMJA 3L74E 4OGQD 4D6TE 2GBWA 2NVGA 2BCCE 1Q90C 1O7GA 2YFLA 2QJPC 2YVJB 4NBCD 3VMGD 2YFJA 1BGYE 3H1LE 1O7PA 4P1BH 2YIUC 3GL0A 4HM8A 3H1IE 2XRXA 2E4QA 4PV1D 2I7FA 4HJLA 4EMJB 4NB9D 4NBED 1ULJA 4NBDD 2DE7D 4NBAD 1EZVE 1BE3E 3BCCE 1G8JB 3FOUA 4NBBD 5KLVE 1NYKA 4QDCA 2E4PA 4QURA 3GOBA 3CWBE 1WQLA 2BMQA 2HMMA 4AIVA 3CXHE 1NTKE 4U3FE 4HM1A 3GZXA 3GL2A 2E76D 4HM2A 3GTSA 4NBHD 3C0DA 4QDFB 2JZAA 1SQVE 3EN1A 1VF5D 2YFIA 1G8KB 2JO6A 1UUVA 2XSOA 5AEUA 2FYUE 1RFSA 5BOKA 2QPZA 1ZRTE 3GKEA 3N0QA 4NBGD 1UUWA 1JM1A 3TGUE 1L0LE 2FYNC 3H1KE 1NDOA 3VMHD 3CX5E 2NWFA 2D2CD 1KB9E 1VCKA 4H13D 1SQPE 5HL4A 2DE5D 2XR8A 5KLIC 3VCPA 5KKZC 1ULIA 3VCAA 1O7WA 4QDDA 1FQTA 1O7MA 1SJGA 1O7NA 1RIEA 4HM5A 3L70E 4HM3A 2IBZE 3L72E 2NVFA 1SQQE 3D89A 2B24A 4H0LD 4H44D 2BMRA 1SQXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUK A;  4NB8 D;  4HM4 A;  2BMO A;  2DE6 D;  2ZYL A;  3VMI D;  2XSH A;  2ZT9 D;  3L73 E;  1L0N E;  1NTM E;  4HKV A;  3AZC A;  4HM6 A;  4QUQ A;  3L75 E;  1BCC E;  4NBF D;  1NU1 E;  1PP9 E;  4HM0 A;  4HM7 A;  1P84 E;  2CKF A;  1SQB E;  5CXM A;  2NVE A;  2QJY C;  3EQQ A;  2HMO A;  2HMK A;  2Q3W A;  4QCK A;  2E74 D;  2B1X A;  1O7H A;  2E75 D;  2HML A;  2QJK C;  3GTE A;  3GB4 A;  2NUM A;  5AEW A;  3GZY A;  3H1J E;  4QUP A;  4QDF A;  1KYO E;  3H1H E;  1NTZ E;  2A06 E;  2HMN A;  4AAY B;  3GCE A;  1VM9 A;  3DQY A;  3L71 E;  4PD4 E;  2GBX A;  4P1C H;  1EG9 A;  1PPJ E;  2HMJ A;  3L74 E;  4OGQ D;  4D6T E;  2GBW A;  2NVG A;  2BCC E;  1Q90 C;  1O7G A;  2YFL A;  2QJP C;  2YVJ B;  4NBC D;  3VMG D;  2YFJ A;  1BGY E;  3H1L E;  1O7P A;  4P1B H;  2YIU C;  3GL0 A;  4HM8 A;  3H1I E;  2XRX A;  2E4Q A;  4PV1 D;  2I7F A;  4HJL A;  4EMJ B;  4NB9 D;  4NBE D;  1ULJ A;  4NBD D;  2DE7 D;  4NBA D;  1EZV E;  1BE3 E;  3BCC E;  1G8J B;  3FOU A;  4NBB D;  5KLV E;  1NYK A;  4QDC A;  2E4P A;  4QUR A;  3GOB A;  3CWB E;  1WQL A;  2BMQ A;  2HMM A;  4AIV A;  3CXH E;  1NTK E;  4U3F E;  4HM1 A;  3GZX A;  3GL2 A;  2E76 D;  4HM2 A;  3GTS A;  4NBH D;  3C0D A;  4QDF B;  2JZA A;  1SQV E;  3EN1 A;  1VF5 D;  2YFI A;  1G8K B;  2JO6 A;  1UUV A;  2XSO A;  5AEU A;  2FYU E;  1RFS A;  5BOK A;  2QPZ A;  1ZRT E;  3GKE A;  3N0Q A;  4NBG D;  1UUW A;  1JM1 A;  3TGU E;  1L0L E;  2FYN C;  3H1K E;  1NDO A;  3VMH D;  3CX5 E;  2NWF A;  2D2C D;  1KB9 E;  1VCK A;  4H13 D;  1SQP E;  5HL4 A;  2DE5 D;  2XR8 A;  5KLI C;  3VCP A;  5KKZ C;  1ULI A;  3VCA A;  1O7W A;  4QDD A;  1FQT A;  1O7M A;  1SJG A;  1O7N A;  1RIE A;  4HM5 A;  3L70 E;  4HM3 A;  2IBZ E;  3L72 E;  2NVF A;  1SQQ E;  3D89 A;  2B24 A;  4H0L D;  4H44 D;  2BMR A;  1SQX E; 
#chains in the Genus database with same CATH topology
 4EYY Q;  4RKU J;  5BU5 A;  3D6Y A;  1NU1 E;  3U1A A;  1PPJ G;  1KQG B;  2E75 D;  3MGN A;  4HH2 A;  1HUC A;  3GZY A;  3HUS B;  4PJ0 E;  1MKM A;  3BAS A;  3CMA P;  1PPJ E;  5KAF E;  2FXM A;  4OGQ D;  1IFD A;  2KS1 A;  1HGV A;  1YBK A;  2E75 C;  1U7J A;  1M1J A;  1RE4 A;  1W2B O;  2XRX A;  1HF9 A;  4EOT A;  1PZQ A;  3C1L A;  1KQL A;  5AVS B;  1SS1 A;  2DE7 D;  1Q86 Q;  4NBB D;  2IPP A;  4BRY B;  1CI6 A;  1G2C A;  2ITA A;  1LTA C;  1QL2 A;  3BAT A;  1Y9B A;  4GOD A;  2H43 A;  2QIW A;  2YO3 A;  5KJ7 A;  1DEB A;  3RBX A;  1VQ8 P;  1T3U A;  1GZL A;  1FOS F;  2K9J B;  1UII A;  3CCQ P;  1N7L A;  4NPE A;  2QRX A;  1KIL A;  4KHX A;  1S72 P;  3RK2 D;  1KZU B;  1RF0 C;  4GDO A;  2GA1 A;  1LTI C;  5BVZ A;  3GF3 A;  4QMA A;  2HOD A;  1GL2 C;  4NB8 D;  1URQ A;  3G3Z A;  1KFN A;  1YJW P;  1LT9 C;  2YMY A;  3CCJ P;  3RK2 C;  2M8R A;  5AW3 B;  3BCC G;  1H8A A;  2KUB A;  4GKG A;  1MFT A;  5CXM A;  3QWO C;  2E75 B;  2N1T D;  2QJY C;  2FKW B;  2B88 A;  1T6A A;  5CCH D;  1P84 I;  2QVA A;  1PGQ A;  1FJK A;  1VQ4 P;  2P10 A;  1X79 B;  3WU2 H;  3EWK A;  3M9H A;  1NTK D;  3RK3 D;  4OGQ B;  2D2C C;  1EG9 A;  2N1T C;  2GM4 A;  2GBW A;  3O6Q B;  3QH9 A;  3M0A A;  2YVJ B;  2YFJ A;  3EFF K;  1K8A Q;  1JY3 P;  2M3B A;  1NTK J;  2XZR A;  1H0T A;  1KMI Z;  3RK3 C;  2E4Q A;  4TT3 H;  3CX5 D;  1FBM A;  1SQQ G;  5E79 H;  1JY2 N;  3CC4 P;  3AE9 C;  1NTK E;  1G1J A;  2IZ0 A;  1OMI A;  2KLV A;  1NKZ B;  4O9B A;  4WY4 D;  2L91 A;  2RN0 A;  3CCR P;  4DOJ A;  2GUS A;  1S5L E;  3GF7 A;  4B86 A;  4RO0 A;  1SLQ A;  3CX5 E;  3RK2 B;  2LXB A;  4WY4 C;  2CPB A;  3H1H G;  2AEM A;  5KKZ C;  5AW2 B;  4GOF A;  2OYO A;  2QE7 H;  3D89 A;  4N78 D;  1E79 H;  2NUK A;  2KLU A;  1J1D C;  3KXD A;  1RF0 A;  2XSH A;  2N1T B;  2JEE A;  2WPQ A;  2C9N Y;  2I1K A;  1GL2 A;  3HD7 A;  1LT9 A;  2HMO A;  3RK3 B;  1BSN A;  3RGU A;  4QDF A;  4N78 E;  2BCC D;  1RQV A;  1T8Z A;  3TSI A;  1EZV G;  2JWD A;  1ZP0 C;  1Y47 A;  4IL6 X;  2KNC B;  1YIT P;  2YKQ A;  2B87 A;  2Q3I A;  3MD0 A;  3IF4 A;  4UB8 E;  3M91 A;  1IO4 A;  1EZV E;  1N7S A;  2IYO A;  1WQL A;  2I1J A;  1FJP A;  4Y99 B;  3H32 A;  2W8Z A;  3MHV A;  4WY4 B;  1L0N G;  2YXR B;  2WT7 B;  3MP7 B;  1W5C E;  2R3C A;  3W68 A;  4RES B;  5K5G B;  1S4X A;  2H89 C;  3L75 D;  1LTJ A;  4NBG D;  3T97 B;  3V4W A;  3VMH D;  1JUN A;  3A0H E;  4GIF A;  2POH A;  3AE6 C;  2A06 G;  5KLI C;  3G4S P;  5CBN A;  1PGP A;  3VCA A;  1O7M A;  2K1A A;  2Q6Q A;  4HM3 A;  3L75 G;  2O01 J;  2NVF A;  1Z56 A;  3L75 J;  1KYO D;  3E7K A;  2CK3 H;  1SFC D;  1X22 A;  4W7Z A;  1GK6 A;  3LID A;  2QSI A;  2Y0E A;  2H88 C;  5AW5 B;  3KDP B;  3H1L D;  3L75 E;  2E43 A;  1T3J A;  2SPZ A;  3AE8 C;  1X8Y A;  2LR2 A;  3L71 G;  2WSE H;  3Q2Y A;  2HPC A;  2R3S A;  1SFC C;  3L71 J;  1O7H A;  2HML A;  1IK7 A;  1IJD B;  5AEW A;  1IK9 A;  2KSE A;  3H1L J;  1KYO E;  2FFD B;  3K5B A;  2JP3 A;  2R5D A;  2WPV B;  1H89 A;  3S1K A;  3DQY A;  3L71 E;  1IFN A;  4Y28 J;  1NAF A;  2KIK A;  2Y9Z A;  5AVZ B;  2O1J A;  3H1L E;  4YPC A;  1LWU C;  1ZRT D;  2R5B A;  2Y0C A;  2W6A A;  1K04 A;  3IAO A;  5TIS E;  1LP1 B;  1KB9 D;  1X9V A;  1L4A D;  1HVV A;  1KD1 Q;  1K73 Q;  2M5A B;  3HTK A;  5BU8 B;  1ZN5 A;  1VF5 D;  3KZI E;  2QJK B;  1NKN A;  3H1K D;  1JCD A;  1ZRT E;  3UIA A;  2P2U A;  1RHZ B;  1PP9 D;  3BRV B;  4EI2 A;  1KB9 E;  2XR8 A;  5B66 E;  1ULI A;  3II6 A;  2QG4 A;  3JC2 2;  1SFC B;  2QEX P;  4H0L D;  2DW3 A;  1KV4 A;  1PP9 J;  4PD4 D;  1KC8 Q;  1PFI A;  3AE3 C;  1NWQ A;  2J59 M;  2C9L Y;  3VMI D;  4HKV A;  4HM6 A;  1YYC A;  2H7H A;  1BE3 G;  1JTH A;  3H1I D;  1PP9 E;  3CME P;  1QVG O;  3CWB G;  3LIE A;  1LWU B;  5AW1 B;  3EQ2 A;  1Q7Y Q;  3KPE A;  3ITK A;  1SQV G;  5AVU B;  1M57 D;  4AAY B;  3H1I J;  2FYU G;  4PD4 E;  4K35 A;  3WMM 0;  2FYU J;  2OYH A;  2C0W A;  3B5N C;  3CC2 P;  2ZFC A;  1L0L G;  1Y8A A;  2QJP C;  1L0L J;  4I2L C;  3AED C;  4HM8 A;  3H1I E;  2P67 A;  3TGU D;  4PV1 D;  4YXD C;  1L4A B;  1FAV A;  2I7F A;  2R44 A;  3FOU A;  4QDC A;  1NAY A;  2JKV A;  3AEE C;  3L70 D;  1VF5 B;  3TGU J;  4PV1 C;  1IFJ A;  1RQU A;  3CXH H;  4IL6 H;  4TLF A;  1AVO A;  3L73 D;  1HJB A;  3L70 G;  5APQ A;  3TGU E;  3L70 J;  3RL0 g;  1P84 D;  3H1J G;  4H13 D;  2HFE D;  4H0L B;  1KFM A;  1FZE A;  3L70 E;  3L73 J;  3TF5 A;  1SQB G;  1JOC A;  2MJZ A;  3LW5 J;  1SQB J;  4D6T D;  4H13 C;  2YKO A;  3L73 E;  3HE4 B;  1RF1 B;  3A3Y B;  4QUQ A;  2RMZ A;  4HB1 A;  3SWY A;  2WSC H;  3D71 A;  5GTH E;  1P84 E;  4WVZ A;  1SQB E;  1URQ D;  2B1X A;  1EDJ A;  4D6T J;  3GB4 A;  3ABV C;  3L35 A;  1OFC X;  1PPJ D;  4HJG H;  1ZW0 A;  1NJI Q;  1VQ7 P;  1AFO A;  2JDI H;  4D6T E;  2NVG A;  1DEE G;  2YFL A;  2KYV A;  4PV1 B;  3GLM A;  2HYN A;  1N73 C;  3GG2 A;  1DD3 A;  4BXL A;  3B5N A;  4HJL A;  4AYC A;  2MKV A;  3CCV P;  5APU A;  1K05 A;  3A5T A;  1HH0 A;  4IOI H;  2WPR A;  4A7P A;  3W67 A;  3I5C A;  2KSJ A;  3C0D A;  3WUV A;  1FU1 A;  2KK7 A;  5CCG A;  1NTM D;  3V2R A;  4H13 B;  4OGQ C;  1OVV A;  2JWA A;  4XFJ A;  1AQT A;  4ASW A;  3HUS A;  1BSH A;  1NTM G;  4CPG A;  1NTM J;  2ZJS E;  3FWL A;  2IYP A;  1S9K D;  2B89 A;  2W27 A;  1NTM E;  2OGU A;  1G1I A;  2OYI C;  1AA0 A;  1URQ B;  2Z5I A;  1FZC C;  2WSF H;  2CKF A;  1Q90 D;  1SQP K;  1N73 B;  3VMY A;  4BRY A;  1HBW A;  3BCC D;  3G9R A;  1OX3 A;  4IFM A;  3HD7 D;  2JJL A;  3M06 A;  3A0B H;  1S9K E;  3JCU H;  2HMJ A;  2FYZ A;  3SFE C;  1Q90 C;  3VP8 A;  1Q82 Q;  4JBZ A;  3AE7 C;  3BCC J;  3L36 A;  2K9J A;  5B5E H;  4P1B H;  2UWJ E;  2A45 H;  5CMZ A;  1M1K Q;  3CC7 P;  2YMK A;  1ZR2 A;  4KJM A;  5M1B A;  1QX8 A;  2LXC B;  3BCC E;  4Z1M H;  3GZX A;  4ZNC A;  5AW7 B;  1SQQ D;  3CXH I;  5CCH C;  4N3Y B;  2KZI A;  5H2F H;  4JYB A;  5AEU A;  3GMA A;  5GTI H;  1H88 A;  1UUW A;  2WTY A;  3NFQ A;  1SQQ J;  4DJG A;  2OYI B;  1VCK A;  3IN6 A;  5KLV K;  1FZC B;  1M56 D;  3MUD C;  1SQQ E;  1LT1 A;  2NRG A;  3H1H D;  3O6Q A;  1SVF A;  1R5L A;  1S3J A;  4ASV A;  2ZYL A;  2BEQ D;  2IDB A;  3M0D C;  4WWI A;  3AZC A;  1S1C X;  1OXZ A;  4Y99 C;  1AJY A;  1M7L A;  3WU2 E;  1NTZ G;  1OVU A;  3H1H J;  1NTZ J;  3CCM P;  1GMJ A;  1VL2 A;  2QM7 A;  2E74 D;  3PRJ A;  4EDF A;  2NUM A;  3HD7 B;  4ZKU A;  1MUU A;  1MFZ A;  4C7R A;  1OW8 A;  1ZOY C;  1W2E A;  5AVX B;  3H1H E;  1NTZ E;  2WIT A;  3Q1M A;  1WT6 A;  1QGK B;  1IZN B;  1JY3 N;  2LKM A;  2V7Q H;  3AEA C;  4GOE A;  2P1J A;  4OH8 B;  2Q9I A;  2E74 C;  2KP8 A;  3G6E P;  2KB7 P;  5E79 E;  3AEG C;  1NU1 K;  3O8Z A;  4L74 A;  1EZV D;  1SP4 A;  5AW8 B;  4EMJ B;  2YKP A;  2XV5 A;  3CD6 P;  1RE3 C;  3GOB A;  1SQX G;  2FXO A;  4HM1 A;  2IX7 C;  2E76 D;  3RBZ A;  3PP5 A;  1DH3 A;  2NPS D;  3EN1 A;  1PL5 A;  1VPC A;  2QM8 A;  2N1T A;  1RFS A;  1L0N D;  5CCH A;  1EQ7 A;  3AE1 C;  1JO5 A;  3A2A A;  2FFD C;  1NDO A;  3L4F A;  2NPS C;  3VMX A;  3CCE P;  4L73 A;  1U57 A;  2YNY A;  2O01 N;  4I7Z C;  1L0N J;  2AXC A;  3AE5 C;  2A06 D;  1BGY G;  2O1K A;  1A02 J;  3PH0 A;  5AW6 B;  2WWW A;  2KNC A;  3Q5R A;  1L0N E;  5AVR B;  3OW2 O;  3KHU A;  2Q7C A;  2WQY C;  3SFD C;  2E74 B;  2N9B A;  3EQQ A;  2RKL A;  3GHG B;  1JY2 O;  5KAI H;  2QJK C;  2AXT H;  1J2J B;  4WY4 A;  2W6J H;  4WB4 A;  3L71 D;  5CBO A;  2WT7 A;  1VDF A;  2A06 E;  2Q1K A;  5AW9 B;  2CPS A;  2A45 I;  3Q5P A;  3VMZ A;  1USE A;  4HYT B;  3IR9 A;  3G71 P;  1NVO A;  3T97 A;  1MV8 A;  1GU4 A;  1AVY A;  3M9Q A;  2IFN A;  4ZMD A;  4NB9 D;  1G8J B;  3H6P A;  2E76 B;  1PV3 A;  2NPS B;  2E5T A;  3HRN A;  2P7J A;  3GTS A;  4NBH D;  4I7Z B;  2FBW C;  3CCL P;  1KB9 H;  5EFW B;  4JYC A;  1UUV A;  2XSO A;  1KQF B;  3S4R A;  2WSS H;  3B71 A;  3FXE A;  3PJS K;  5APT A;  1GK4 A;  4R4M A;  1YJN P;  1EXJ A;  1ZME C;  4QDD A;  1FQT A;  1NTK K;  2WSE J;  1BCC G;  2FFD A;  1KTM A;  1BCC J;  1NOH A;  4R4L A;  2BMR A;  1L4A C;  2XU6 A;  4L75 A;  4JPZ B;  5KTB A;  1BCC E;  4NBF D;  4C46 A;  1VF5 C;  2Z4E A;  2H8P D;  3VYI A;  3F5H A;  2HLO A;  1LP1 A;  3RL0 D;  1BE3 D;  3FWN A;  4I1L A;  3CWB D;  4GT1 A;  2RH0 A;  2M5A A;  3V2N A;  2NZ2 A;  4P1C H;  2GBX A;  2V4H A;  1SQV D;  1QL1 A;  3RL0 C;  1LNQ A;  1BE3 J;  3PHL A;  2FYU D;  4H0L C;  1VQM P;  3R2P A;  1SQP G;  3CWB J;  1KN7 A;  1L0L D;  4L76 A;  1WMK A;  1FS0 E;  1LTG C;  1SQV J;  1BE3 E;  3TNU B;  2K37 A;  3CWB E;  1SFC A;  2HG5 D;  1S5L X;  1RF1 C;  4HM2 A;  4UB6 E;  5APY A;  1Q81 Q;  3P7K A;  1SQV E;  5AVY B;  3P8M C;  1OW7 A;  3ZDM A;  2YO2 A;  3P8C D;  2FYU E;  2I8D A;  4XE5 B;  3N0Q A;  1X0T A;  1L0L E;  2FYN C;  3SSU A;  4DT0 A;  3MTU E;  1LWU A;  2ZXX A;  1JMM A;  1AV1 A;  3PTZ A;  5C39 A;  5AW4 B;  2YXQ B;  4DZO A;  1FZF A;  3H1J D;  1Q2N A;  2M0B A;  4H44 D;  1BDC A;  1AQ5 A;  1NHL A;  4K3A A;  4HM4 A;  3HE5 B;  1M1J C;  3P8C E;  3JSV C;  4C7N A;  1DD4 A;  1KYO I;  2BEZ F;  3V4Q A;  1SQB D;  5KLV G;  5KJ7 D;  1L4A A;  3RL0 B;  4HM0 A;  3H1J J;  1IFP A;  1RY3 A;  3FX0 A;  4H44 C;  4U3F G;  2Q3W A;  1GW4 A;  4LLH A;  2XNX A;  4MN4 C;  3CXH D;  3H1J E;  1KIL D;  3V5B A;  2HMN A;  1LTT C;  1QEX A;  1VM9 A;  3S9O A;  1VQ9 P;  3A7O A;  4PJ0 H;  1U7M A;  1EDI A;  1FDM A;  5KAF H;  1T2K D;  1ULJ A;  2IBZ G;  4NBA D;  2KI7 B;  2FYN B;  3CXH E;  2WVR A;  1KIL E;  4IL6 E;  1URQ C;  1KB9 I;  3FXD A;  1IC2 A;  1CSB A;  5AVV B;  1G8K B;  1NU1 G;  3HE4 A;  1RF1 A;  2KS1 B;  5BOK A;  1LTB C;  1M1J B;  1M8O B;  5HL4 A;  2DE5 D;  2WSC J;  1CI6 B;  4H44 B;  5AVQ B;  1G2C B;  2YIU B;  5APV A;  2B24 A;  2R32 A;  4OWF A;  1FZA A;  3MZW B;  2Z5H A;  1OW6 A;  4PD4 I;  2PAJ A;  5AVT B;  2JO1 A;  1XTG B;  3GTE A;  1KIL B;  3VTP C;  2HOD B;  2JR8 A;  1LGH B;  1O7G A;  3IFM A;  1MZ9 A;  2KOG A;  4NBC D;  1YI2 P;  2IZ1 A;  2AEF A;  2WZ7 A;  1RH5 B;  5AVW B;  3V2P A;  4NBD D;  1A02 F;  1GL2 D;  1JCC A;  4AIV A;  1JY2 P;  1K9M Q;  1IFM A;  1SQV K;  1YTZ I;  3HD7 C;  5APS A;  1FZB A;  3KYQ A;  5APW A;  2W83 C;  2FYU K;  1H0T B;  1N73 A;  2D2C D;  1L0L K;  1QLE D;  1VQP P;  1NYH A;  4EIJ A;  2WSF J;  2WPS A;  1S5L H;  2K9Y A;  3CX5 H;  1N7S D;  1VQN P;  2IBZ I;  1GDT A;  1GD2 E;  4W80 A;  2DE6 D;  3NMD A;  4NPD A;  1VQL P;  4M3L A;  2ZT9 D;  1D7M A;  1FDI A;  2W90 A;  1N7S C;  2NVE A;  3E1R A;  1NTK G;  3CL3 D;  4QCK A;  2A45 G;  1JB0 J;  2XKM A;  3A0B E;  3CPW O;  1JEK A;  3JCU E;  4YTP C;  1NTZ D;  2ZT9 C;  1YIJ P;  3P32 A;  2ZAE B;  5B5E E;  3SWK A;  1EXI A;  1JM0 A;  3RK3 E;  1LTJ C;  1EDK A;  1ZV8 A;  1DIP A;  3GL0 A;  1SQB K;  2OYI A;  1GL2 B;  2BAS A;  3VMA A;  1LT9 B;  1FZC A;  4LGD E;  3KQG A;  2KXP B;  5H2F E;  3E1I A;  3GL2 A;  1KQS O;  4UB8 H;  2QJY B;  4QDF B;  5GTI E;  1NO4 A;  1SQX D;  3GHG C;  3NXS A;  2Q5U A;  2D2C B;  1HTL C;  2B87 B;  3Q5S A;  4OVN F;  1SQX J;  3MIW A;  1JMB A;  1VQK P;  1N7S B;  1LTS C;  4I6M C;  3SWF A;  3H32 B;  5TJH A;  3A0H H;  1SQX E;  2G8Y A;  2ZT9 B;  1N86 A;  2BMO A;  2PFX A;  2E76 C;  1HWT C;  1ZLL A;  2PP6 A;  2G3A A;  1BGY D;  2PRR A;  3AEC C;  2V7Q J;  1LTJ B;  2OAR A;  1YHQ P;  3C9I A;  4ZKP A;  2O01 H;  4NPF X;  2P58 A;  3NTN A;  2BCC G;  1USD A;  2BCC J;  1R8E A;  4QUP A;  1BGY J;  1PIX A;  3MUD A;  2K3R A;  3PLN A;  4BWN A;  2OQQ A;  2BCC E;  2O3J A;  5KKZ B;  1M90 Q;  1FOS E;  1NTM K;  1KYO H;  1BGY E;  1O7P A;  1DX7 A;  3M0D A;  3WUU A;  1WRG A;  1XTC C;  3D70 A;  3V2Q A;  2FY8 A;  1J1D B;  1FZG A;  4HKZ H;  2HPC B;  2WMM A;  1NYK A;  4QUR A;  5CHX A;  2HMM A;  3FGA D;  1VQ6 P;  1FC2 C;  5TIS H;  1GU5 A;  2C0X A;  2KZJ A;  3AE2 C;  2YFI A;  1NGM B;  2E5Y A;  3AE4 C;  2QPZ A;  3VN0 A;  4IFF A;  1R5S A;  3OJA B;  2B9B A;  3KZI H;  1OVR A;  3GHG A;  2NWF A;  1CW5 A;  4N6J A;  3AEB C;  3CX5 I;  3N7N A;  3VCP A;  1O7W A;  4W7Y A;  1YJ9 P;  1SJG A;  1RIE A;  4HM5 A;  2ZVO B;  1RE3 A;  2OYH C;  2Q3E A;  2GUV A;  3H1L G;  5B66 H;  3TDK A;  2Y0D A;  1CZQ A;  3HTK B;  3VP9 A;  1JY3 O;  1BCC D;  1YTZ T;  1S2E A;  5KAI E;  1EDL A;  2PGD A;  3N4X A;  2AXT E;  3USS A;  4HM7 A;  3EFG A;  1OZH A;  2M3E A;  5L8R J;  2NPS A;  3BVH A;  1NH4 A;  2ZVN B;  1SQQ K;  4AQR D;  3GCE A;  1OIP A;  1ZXG A;  5APX A;  1E5W A;  3B4S A;  5KLI B;  2ZYG A;  3TYY A;  4PD4 H;  2OTJ P;  2E42 A;  1JTH B;  1KOR A;  4UB6 H;  4NBE D;  3H25 A;  2K88 A;  5DJU B;  1SQP D;  5CJ4 A;  1EZV I;  2BMQ A;  2XND H;  1FDO A;  1NTZ K;  2W6B A;  1GW3 A;  3H1K G;  2JZA A;  4WBA A;  3CCS P;  1PGJ A;  1UIX A;  3H1K J;  4IFD K;  3TK1 A;  1PP9 G;  3CI9 A;  2OYH B;  1LJ2 A;  1SQP J;  2XDJ A;  2FXP A;  2OTK E;  3H1K E;  1N2D C;  1N8R Q;  1SQP E;  3VOP A;  3B5N D;  3R4Y A;  1FE6 A;  1OWA A;  1GTW A;  4XA4 A;  5DJT B;  3M9B A;  3L74 D;  2AEJ A;  3GW6 A;  3H1I G;  3I56 P;  1SQX K;  2J58 A;  1PGO A;  1L2P A;  5CCG D;  1J1E C;  5AW0 B;  2ZYA A;  2Y9Y A;  1TU3 F;  4C7N B;  3U1C A;  2HMK A;  3TNU A;  3L74 G;  3WUT A;  3L74 J;  3I55 P;  5KLV D;  3C8V A;  5GTH H;  1P84 H;  3LW5 H;  5CCG C;  4U3F D;  1RE4 C;  1HGZ A;  3F89 A;  1YQ4 C;  3CCU P;  3L74 E;  4KT0 J;  3V6I A;  3TGU G;  1L0N K;  3VMG D;  4JF7 A;  5KLV J;  2N9Y B;  2YIU C;  3BRT B;  4JQ0 D;  3CLQ A;  4U3F J;  2J5U A;  1EC5 A;  2L5G B;  1ZR4 A;  3HUS C;  1BDD A;  3L37 A;  1JNM A;  5KLV E;  3U59 A;  2E4P A;  5KJ7 C;  4U3F E;  3OA7 A;  2IBZ D;  3L72 D;  2OTL P;  3L73 G;  3D6Z A;  3HE5 A;  1VQ5 P;  1YQ3 C;  2JO6 A;  4RJT A;  1VQO P;  4YXW H;  2HR3 A;  1KIL C;  4DCK A;  3GKE A;  3L72 G;  1NU1 D;  1JM1 A;  3Q3D A;  3L72 J;  4LC1 A;  1J1E B;  1HJ0 A;  3B5N B;  2IFM A;  3AEF C;  2QA4 P;  3B8E B;  2QJP B;  3OAK A;  4AUW A;  2ZXE B;  1O7N A;  4D6T G;  2IBZ E;  3L72 E;  1T2K C;  1QVF O;  1IFI A;  4U7J A;  5CJ0 A;  1NU1 J;  2VRS A;  2ZYD A; 
#chains in the Genus database with same CATH homology
 2NUK A;  4NB8 D;  4HM4 A;  2BMO A;  2DE6 D;  2ZYL A;  3VMI D;  2XSH A;  2ZT9 D;  3L73 E;  1L0N E;  1NTM E;  4HKV A;  3AZC A;  4HM6 A;  4QUQ A;  3L75 E;  1BCC E;  4NBF D;  1NU1 E;  1PP9 E;  4HM0 A;  4HM7 A;  1P84 E;  2CKF A;  1SQB E;  5CXM A;  2NVE A;  2QJY C;  3EQQ A;  2HMO A;  2HMK A;  2Q3W A;  4QCK A;  2E74 D;  2B1X A;  1O7H A;  2E75 D;  2HML A;  2QJK C;  3GTE A;  3GB4 A;  2NUM A;  5AEW A;  3GZY A;  3H1J E;  4QUP A;  4QDF A;  1KYO E;  3H1H E;  1NTZ E;  2A06 E;  2HMN A;  4AAY B;  3GCE A;  1VM9 A;  3DQY A;  3L71 E;  4PD4 E;  2GBX A;  4P1C H;  1EG9 A;  1PPJ E;  2HMJ A;  3L74 E;  4OGQ D;  4D6T E;  2GBW A;  2NVG A;  2BCC E;  1Q90 C;  1O7G A;  2YFL A;  2QJP C;  2YVJ B;  4NBC D;  3VMG D;  2YFJ A;  1BGY E;  3H1L E;  1O7P A;  4P1B H;  2YIU C;  3GL0 A;  4HM8 A;  3H1I E;  2XRX A;  2E4Q A;  4PV1 D;  2I7F A;  4HJL A;  4EMJ B;  4NB9 D;  4NBE D;  1ULJ A;  4NBD D;  2DE7 D;  4NBA D;  1EZV E;  1BE3 E;  3BCC E;  1G8J B;  3FOU A;  4NBB D;  5KLV E;  1NYK A;  4QDC A;  2E4P A;  4QUR A;  3GOB A;  3CWB E;  1WQL A;  2BMQ A;  2HMM A;  4AIV A;  3CXH E;  1NTK E;  4U3F E;  4HM1 A;  3GZX A;  3GL2 A;  2E76 D;  4HM2 A;  3GTS A;  4NBH D;  3C0D A;  4QDF B;  2JZA A;  1SQV E;  3EN1 A;  1VF5 D;  2YFI A;  1G8K B;  2JO6 A;  1UUV A;  2XSO A;  5AEU A;  2FYU E;  1RFS A;  5BOK A;  2QPZ A;  1ZRT E;  3GKE A;  3N0Q A;  4NBG D;  1UUW A;  1JM1 A;  3TGU E;  1L0L E;  2FYN C;  3H1K E;  1NDO A;  3VMH D;  3CX5 E;  2NWF A;  2D2C D;  1KB9 E;  1VCK A;  4H13 D;  1SQP E;  5HL4 A;  2DE5 D;  2XR8 A;  5KLI C;  3VCP A;  5KKZ C;  1ULI A;  3VCA A;  1O7W A;  4QDD A;  1FQT A;  1O7M A;  1SJG A;  1O7N A;  1RIE A;  4HM5 A;  3L70 E;  4HM3 A;  2IBZ E;  3L72 E;  2NVF A;  1SQQ E;  3D89 A;  2B24 A;  4H0L D;  4H44 D;  2BMR A;  1SQX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...