1L0NH

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 23
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1l0nH00
3L73H 3L75H 1SQXH 1KYOF 3L74H 3L71H 3CXHF 1NTMH 3L70H 1NTZH 3BCCH 1SQPH 1SQQH 1L0LH 4U3FH 1L0NH 1P84F 3TGUH 3H1JH 1PPJH 3H1HH 4PD4F 2IBZH 1BE3H 3CX5F 1BCCH 1NTKH 1PP9H 1KB9F 3L72H 3H1IH 1NU1H 2A06H 1SQVH 3H1KH 3H1LH 2FYUH 1EZVH 1BGYH 3CWBH 4D6TH 5KLVH 1SQBH 2BCCH
chains in the Genus database with same CATH superfamily
3QF7A 5L3FA 3MHSC 3RYHB 3A0BZ 1S5HC 2L6LA 3NR7A 3RVYA 4WF9V 1TUBA 3HKCA 3JD0A 4JF3A 1S72V 5JWPA 1VEWA 1EM1A 1Z5WA 4MVMA 2YICA 2QWQB 3AG2C 4W4KA 4WBNA 3IGAC 3P3PA 4ZHQA 2KQXA 1NR1A 4WFEA 1BMFG 1AR4A 3H1HH 1BT8A 3RYIB 3HR0A 2DOSA 1XREA 1LR1A 1YF2A 4KFMA 1XBLA 1SETA 3WB2A 2XTAA 2CUGA 3N2KB 2ETNA 4JTDB 2Q4PA 1SQPH 5B1OA 1FJGO 3CB2A 1QR8A 3DC5A 3OGCC 1M56C 4FJCC 4FIPC 2GBOA 4H37A 4JI5B 4DR4O 1NU1H 5EYPA 4K8XA 1H2NA 3N27A 4IHJA 3ZS8C 5JQGB 2QSAA 3OAAG 4MTGA 3TXQA 3T1HO 4K0KB 4J42A 2IJJA 1WA8A 2HHHO 1AR5A 1XMQO 2EIKC 4GUNA 2QM4A 4GKKO 1QU7A 4ZI7B 2WLIA 2L35A 2QA4V 4L8JA 2DQ0A 1SC5B 3CC7V 1YEWA 1AJQA 3AG3C 1DLBA 4X62O 5FNVB 3CHXA 2HJDA 3ZEDA 4LBEC 1Y66A 3L74H 3JATA 1Q6HA 3CXHF 2W0FC 4PI2A 4J10A 2ZD9A 1VMGA 4J7ZA 4DRXB 1GM9A 4DR2B 4DR2O 4YIOA 1VQLV 4YXWG 1VF6A 3STLC 2ZR2A 3Q4HA 2OTLV 2JEXA 5CA1A 4AILC 5DEDA 2B1GA 1OCOC 2WLKA 2EIMC 1Q82W 3HKCB 4DV6O 1X4TA 1OCZC 4DR5O 1K4CC 3N2GA 4U3FH 4PJ0Z 1SRYA 1GM8A 4O4JA 4YHHB 4EB6A 5ITZA 5LOVA 3BA9A 5K1PA 1R3LC 1YITV 1W0KG 3ZMTA 2B9ZA 2H3OA 3K59A 3ICXA 4FLUA 1NJIW 3K04A 4AI8A 5L3BA 4OPAA 4DR1O 2UXBB 1WB8A 1FFXB 3N2KA 4MW8A 3ZRVA 1YTFB 4K0KO 1M93A 3AG2B 4X1YB 3F5WC 3M7MX 3BY6A 2YUAA 3B8MA 1R6KA 2ZE5A 3LUTB 3U10A 4DV7B 4PA3A 2ZE7A 4JI5O 2ZDIC 1VIBA 2ZE8A 2YS8A 4PA7A 4I0XA 3HKBB 3GVMA 1XMOO 2HVJC 3JCUZ 1WJZA 2R9RB 4FFKA 2A79B 3CRAA 1Q5OA 3EHBB 3FD9A 4PV1B 3RYHA 3K08A 5LGUA 4R8CA 1ZAUA 1Y74A 3CCSV 2ZIMA 3BRCA 4FZ0A 3L73H 4K8ZA 3CYOA 2JGUA 4ZKIA 3SR2C 2FL4A 1P7BA 4X9QA 3W7WA 3OEHG 3UM7A 5FNVA 1RPRA 3OT7A 3J7AU 1V54C 4KUMA 3OTOB 1BE3H 3SGIA 1Q6IA 2GDSA 3ZMZA 3D3QA 4NR1A 2F95B 3X2QC 2P5OA 1QLEB 1N34B 5BZBA 1PD3A 4GZRB 3D8CA 3Q4HB 4HZ3A 2R9AA 4O4HB 3OTFA 4JI7B 3AEIA 4NTWA 1KUQA 2XAHA 1IBKO 4D7SA 5LMNO 3BVOA 3G71V 1URFA 4DV4O 4Q6GA 4O4JB 3K03A 4LFAB 3DSQA 5LXTB 2CTWA 3QO5A 3ZX6A 4TWKA 5H5NA 1GK9A 4BIUA 4ICGA 1RP3B 5L3GA 4LWSA 1EBOA 4FLXA 4IHJB 1P84F 2QM8A 3E86A 3K5MA 4LFCB 3QO7A 2LFSA 2EIMB 2IBZH 1WA8B 3RGBA 2A06H 1NH2B 4UV9A 1OCZB 4MT8A 5IJ9B 4LF6B 2RN9A 1PNKA 3C90A 4PDLA 3T1YO 4Z2WA 4LF4B 2QKAA 1HP8A 4U3JB 3WG7B 1B3QA 5DN6G 3HKDB 4X1KA 1JFFB 1CXZB 4B7KA 5BR8B 4DV3O 2Q68A 1K92A 2A0LA 4WFFA 3SJBC 4WFAV 5KAFZ 2N74A 3K9SA 2Q0AA 1F4MA 4J9ZB 5L3DA 2ILMA 3JATB 2Q69A 4DK0A 3THOA 3HB3B 4JI2O 2XAQA 4XDJA 1WP8A 2ZXWC 2AZ0A 4QIWF 5CA1B 3CCLV 4MSWC 4JGSA 3T1CA 3JASA 1W2BU 4GLXA 3CP1A 4YJ3A 5KX5B 1IXMA 1F4NA 2DWEC 4UB6Z 1Z2GA 3MAQA 3GWKC 2HVKC 3ZRSA 3K06A 5IDJA 2YC0A 3L70H 1XMQB 3B4SA 4HNAB 1K33A 2PYLA 1F51A 2E76B 4YY3O 3JARA 5CBGA 1Q81W 4O2AA 4TQFA 2N05A 1RSOA 1TVKA 2VRZA 5JH7A 1M56B 2NN4A 5LHHA 4DV0B 3K58A 4E4EA 4JASA 2YXHA 1SESA 2IJIA 1OCOB 5IT9N 1JOYA 4CH3A 5JJNB 4PDRA 4RUFA 1N34O 3OE7G 5HFLA 4DV1B 2WSSG 3P32A 1HWYA 2VWKA 3HKBA 1N8RW 2UUBB 2G38A 5BXZA 4PA9A 4TV9B 3UO2A 1XILA 1L8DA 3SPGA 2OCCB 5E1AC 3TETA 1WB7A 2X7RB 3VBBA 4P9PA 4J7JA 5KUMA 3HKEB 1TGOA 4QGPA 3VQVA 1G4YB 2F93B 1R3IC 4CS2A 5JVDA 4L87A 3ABMB 2BCCH 4CH5A 4EFBA 4R6ZA 2V4DA 2GTSA 4JZ2A 3JYCA 1XNRB 5JCOA 3U0ZA 4TQDA 2HFEC 3LSSA 2DYSC 2Q9LA 4JI4O 1NBMG 3BA8A 3GB7C 1JVMA 2F4VO 3MD0A 5LGNA 4J11A 3ABKC 2PI4A 5J2TB 4CS4A 1VQ8V 2BSKB 2QTOA 3E89A 3EVKA 1N33B 4P2ZA 2QWPB 2JEUA 1CPYA 2UXDO 5LXTA 1U96A 4ABMA 4LP8A 1K9MW 4NB5A 4AHCA 1Q6UA 3SPIA 1GMGA 4JI1B 1FD9A 1SA0A 3DC6A 5EBLC 4J9YB 1YTFD 2ZM6O 4KXRA 3F7VC 4ZOLA 1RFYA 1IBLB 5CA0B 1OZ0A 3OFNG 1NS1A 5IWAB 1JFFA 1XI1A 3SJAC 4B3SO 2KB1A 2EZOA 4NYKA 4I9WA 4TUYA 3K0DA 3ZHSA 1NZ6A 4IGGA 1NKDA 4DK1A 1XUQA 4B7EA 1NVPD 1Y76A 4LFAO 2PI5A 3A0HZ 1SQGA 5KHIA 2Q7GA 2WA3A 3HKEA 3JALA 5B5EZ 3QTCA 3ASOC 4MTOA 1FFTB 2QDOA 4F6RB 1CP9A 1HNXO 2WLNA 5IYZA 4DO2A 2BE3A 1L0LH 5JVDB 4DR5B 2RJZA 2Z5UA 2CH7B 1BSMA 2PGGA 2E5LO 5KUKA 3IAYA 1I94B 1NQTA 4I50A 2N04A 1XNQO 4B3SB 5LL6Y 2P06A 4NXNB 1EZVH 4FPPA 4MVRA 1R6TA 2EIJC 2QWRB 2UXNA 1I94O 4G27B 4DR3O 4DV3B 3JARB 5LYJA 1YI2V 1RSOB 1PPJH 4MW3A 3ETEA 4JAUA 4DR1B 2UXBO 1K7DA 4QNHB 5J2TA 1WLEA 1ENVA 2UXCB 5KHKA 5JH7B 3L72H 3F5TA 1FXHA 2UUCB 4KHPB 2JVDA 4IIJB 3ZHTA 3G6BA 3DGEA 3RN4A 2UXCO 4DV5O 4JI3O 2Q67A 1NTMH 3E8BA 1MSWD 2QR4A 2ZNIA 5FL7G 2P90A 4LNUB 3UKMA 4DV5B 2XAJA 3PN1A 1YCIA 1KC8W 3ABKB 3FB6C 3FX7A 1S5LZ 2A7WA 3CX5F 1BCCH 5IYDO 2YIAA 4WFGA 4QE7A 1R3KC 5EZYB 2QEXV 1FS0G 1I0HA 1PNLA 3B2EE 2YIDA 1Z5VA 1SQFA 1THZA 2IH3C 1EFRG 2M6YA 1DTOA 2W0XA 4I4TB 1B6QA 1AILA 4D7TA 4DUYO 5C93A 2Q6AA 3CMAV 1EN6A 3BHPA 1ZTEA 5KLVH 3FFQA 1WN7A 3RYCA 2IM9A 2E3CA 1Q90D 1KKCA 2UXXA 4B3TB 4C7UA 1DF4A 3JD3A 2Q0OC 1M1KW 3L9DA 3ML0A 1GN3A 4H0LB 3GWOA 3CCVV 3OUFA 2Z0AA 2FTKA 4JZGA 3U11A 4LH6A 4CH6A 5KA6A 2Q8VA 3IC7A 2D2CB 1K3EA 2PF4E 2RNBA 2ITCC 2JGDA 3TK1A 1GAXA 4GKJB 4PDVA 3KCXA 4LF4O 3ZBHA 4WBNB 3A2FA 4JI8O 2UU9B 3E22B 3OEEG 2X6CA 4GT1A 4ZBMA 1H2GA 3CXCU 4K3AA 1ZL8A 5FPOA 4MS2A 1K97A 3K57A 1KP3A 5LA6B 4FLWA 2PUSA 1AROP 4UCTA 3B09A 1J5EO 1HDJA 5H2FZ 1DGSA 3ASNC 4LR3A 2JIZG 1M90W 3LDEA 1KU9A 4BWAA 3ZRXA 4NXMO 5EK0A 1Y76B 1WPBA 1FJGB 1BHAA 4EKWA 5FPRA 1YZBA 3JALB 5KHGA 5C8YB 5A2QN 3ZMVA 5LP6A 2HLDG 1AB3A 2BTQB 4BW9A 2JS5A 1YJNV 1JR9A 1YVWA 3FYEB 1VP7A 3UT5A 5J9PC 1NVPB 1QLNA 3MDSA 4QPJA 2ITDC 3JAKB 4JYAO 1SQXH 1AP5A 5BMVA 1SS3A 5D5PA 3T2MA 1SQQH 4UB8Z 1YDXA 2CTRA 2P67A 5JJEB 3UCSC 1K8AW 1NR7A 2KG7A 2DWDC 1VQ9V 3G80A 4JI0O 3AK2A 4RQEA 4FM0A 4UVBA 3AG1B 3CD6V 3WG7C 4DW0A 2ADPA 4O4IA 1KYOF 2XASA 1G1XB 3CCUV 2DN9A 2ZQMA 4CC6A 4X64B 3CRMA 1TA8A 4DV2B 3ASOB 2X6AA 2OWOA 1NT2B 1UJWB 1QCEA 2YXLA 1S77D 4X20B 2M7WA 5B3SC 2EILB 2JGDB 4RWUA 4DV4B 1VQ5V 3AG4B 3OGIB 4FK5C 3EFFK 4UV8A 1ORQC 4AQYO 4YIPA 4JI8B 2JJ1G 1DK1A 4I55B 4JTCB 2C2AA 4R7CA 2X6BA 4J80A 1Q3EA 5JQGA 1IX9A 1KQSU 1QLEC 4PD4F 1XQ8A 2LO1A 4NXMB 1S76D 4B3RB 2LGQA 2EULA 1FFXA 4ZI7A 2JJ2G 5F2VO 1VQNV 4X1YA 3B77A 2AHZA 4B3MB 1M5IA 1KMIZ 1XL6A 2KKWA 2E74B 4UCUA 2CK3G 3AG3B 4NTXA 3WFVA 2IJHA 2YSUB 4U7NA 3RT3C 2YIBA 1UPGA 1J95A 4DRXA 4O4LA 5B1AC 5K1XA 4JI4B 4WFBV 5LP6B 2CAZC 4UFZA 3WB1A 3JD4A 4DW1A 2OTJV 1VQ6V 4FM2A 2VQFB 2VQFO 4QPKA 3UT5B 1B06A 2HKOA 4JV5B 2B1IA 2ATKC 1SZXA 2H8PC 3ETQA 2R9IA 4FMTA 3N2GB 3JSLA 2WLLB 3R65A 2YI8A 1MZEA 4OX9B 4YJ2A 2V7QG 5GONB 5LOVB 4W4LA 4CS3A 5LGTA 4B3TO 1L0NH 3B40A 2WA4A 1IZ3A 4X65B 1FAFA 2OCHA 1BHBA 1E1RG 1HNWO 1VQOV 1R3JC 5FLXN 4HBNA 1BZKA 4NKGB 3CE2A 3H1KH 5TISZ 2QTSA 3RYFB 1I7FA 3I56V 3P30A 3STZC 4OXSA 1BQZA 1OCRC 4GX1A 2P4KA 2Z3YA 4PA6A 1N32B 4Q20A 3OW2U 4N21A 3TGUH 3K9AA 4JPRA 3ZCCA 4AQYB 1QBZA 1U97A 1WPXA 1MOFA 4DV7O 2XAGA 4CC5A 4LFBO 4TV8B 5LHIA 1K34A 5C8YA 1FYJA 5GTIZ 1M9NA 3CCQV 4O2BB 4J7KA 1LNQA 1R73A 1EZJA 4H44B 4BR6A 1QVFU 3CRCA 4UUJC 3JAKA 2ZE6A 3AG4C 3ETGA 3RVZA 4LF7B 2IJKA 3HKDA 4X1KB 3AK1A 1PL0A 3H9VA 1SF9A 4FFBA 5H6RA 2LQTA 2EIJB 4DR3B 1GTOA 3BPZA 3AG7A 2OCCC 1Q86W 3SJQC 3K5NA 1Y67A 4NXNO 1I08A 4Z1VA 4ASUG 2ODMA 3ZN1A 1AR1B 1AVMA 1IBLO 4YJ3B 4UCSA 1H8HG 5A9GA 4JYBA 2CTQA 2OIEA 5GONA 2HEPA 2P7TC 5LP6C 5CA3A 4ZHQB 2OT5A 2YXYA 2XT9A 3SPHA 4HNAA 1BL8A 1FPOA 3OUSA 3AG1C 2VQEO 4N23A 2WLMA 2HP8A 4BIOA 4O2AB 3IC9A 3RYFA 1N36O 1HNZO 4MTFA 1LUWA 3OM3B 1HR0B 4DV0O 4LCUC 1S3JA 1KB9F 5KAIZ 2JK5C 1RM1B 5IWAO 1VF7A 3S3WA 2WLHA 2F23A 3ZMSA 1K4DC 5GTHZ 5CBFA 2LGWA 4PHZA 3L71H 2EJRA 5KMGA 4Z1MG 1NTZH 1XHXA 3PJSK 3FB5C 3CRRA 1SZTA 1WP7A 1HNXB 2B5UA 2YI9A 1OCRB 4LF5O 3J80N 2EIKB 2UUCO 3LDDA 1HNWB 1XNQB 1TUBB 2HR3A 2E5LB 3SYAA 2A9HA 3JD1A 1R1BA 5KX5A 2AZ2A 1OHHG 4IT5A 1AI6A 4PELA 2Y48A 4YJ2B 4WCEV 1IURA 3JAMN 3G4SV 3FB8C 4LC1A 2NLJC 2RDCA 2D3OW 1KKDA 3VQXA 4H33A 1XMOB 5KHJA 4DR7O 4A5UB 2QKSA 3APOA 1EN4A 1OCCC 2BOCC 4UCRA 2AHYA 5B1AB 3D3IA 1IXBA 1TVKB 1VARA 3E8GA 4CZZA 4DUZB 5D5QA 2QWNB 4WFHA 3ZHUA 2OYQA 1JA8A 1BS3A 2QM7A 4JI6O 3CCJV 1K5SA 1V55B 2PYJA 3UQ8A 4DR4B 4UCOA 4EB6B 1JMKC 3W7TA 4EEQA 1K5QA 1D2DA 3LSUA 1S5JA 4TV8A 2QE7G 4JI1O 3T1HB 4TV9A 1SKVA 3E83A 3G67A 3KZIZ 4PI0A 4OX9O 1IBMO 5IJ0A 4ZOLB 2WLIB 1VQ4V 2UXDB 4DR6O 4DUZO 1AI5A 2VS0A 4JI7O 2GTAA 4PDMA 4JTAB 1ZSPA 4DV6B 2WAMA 3A0RA 2RCVA 1PP9H 3TXSA 5KMGB 4TUYB 4GX2A 4LF9O 4FLZA 3BABA 4YY3B 1YIJV 3M8AA 3W7XA 1ZLZA 3R66A 2E75B 4HYOA 1PV0A 5JCOC 4BAYA 4FVMA 3OMIB 1E1QG 4X64O 1PM9A 3CJHA 4RO2A 1Y74B 2EINC 4P9OA 3FB7C 2MW2B 2IU3A 1XOUA 4F6RA 2LW7A 3D36A 4UVAA 1IVSA 4IL6Z 3I5DA 3CWBH 4LF8O 2CGOA 4R50A 3K5LA 1B04A 5B3SB 1ZX3A 3LSQA 4UCVA 2H94A 4LFCO 5LBQA 1D5AA 2DE0X 1H2LA 4OPHA 3I55V 3KCYA 4BIZA 1SA0B 4H13B 1NTKH 3JD2A 3K5OA 2CE4A 4LF6O 4D6TH 3ZJZA 2ZIOA 3ABLB 2BOBC 3CPWU 4B3RO 1LUVA 2HJFC 1SERA 2EX3A 5IE9A 3RW0A 2F66C 1US6A 4IIJA 1GRJA 3OR6C 4B3MO 3CEIA 4JI3B 2QWOB 1YSCA 4TT3G 3MHHC 1GKFA 1P49A 5DECA 1VF6C 4LWSB 4I5SA 4P30A 5B66Z 3LNMB 5B1NA 3FAVA 1Q8IA 3AK3A 5JJJB 4JYYA 4F4LA 5IJ0B 4FM1A 1RPOA 4I7ZB 3H1JH 2K9PA 3WB0A 1OV9A 2Y69C 1H2SB 2O57A 5EZYA 4XDKA 3WU2Z 3G6EV 3DXRA 4JYAB 4U3JA 5EBWC 1WAZA 4RQFA 1UFIA 5EIBD 5CB4B 2XAFA 2CH7A 1IBKB 1M4UA 4MVSA 1X59A 1L1FA 1QHTA 2FKXA 1TAEA 3SYPA 3ZHQA 4JAAA 1AP6A 3H01A 3KKYA 2P6JA 4JAVA 5IY5C 5LHGA 2JDIG 2K1EA 1W0JG 3LNNA 1K73W 4O4HA 3OMNB 2CTPA 4NTYA 2GSMB 3K79A 2Q73A 4JI0B 3JASB 5LMUO 4OGQB 3CCRV 1PKXA 3VQWA 3SYOA 3ABUA 2YIBD 2KSDA 1G8MA 3O65A 4PA4A 3E35A 2DJVA 2YEVB 2DW4A 4E2LA 4BW5A 4K35A 4J41A 3CSXA 3ZHRA 2DYRC 4LF5B 2GUZA 2PZSA 4KL1A 4KP4A 3IJ4A 3BAAA 1FXKC 1W59A 4MVZA 2ZINA 1JX9A 5IJ9A 3ETDA 5DM6V 3ZRWB 4DR7B 3RBZA 3EXAA 3H1IH 2AGAA 1E79G 2Y4UA 3FKSG 3J81N 4XBFA 1MMMA 2Y4TA 1XHZA 2EILC 1O9GA 4FLYA 1R6NA 4GCZA 1XDCA 3T4ZA 3RYCB 3NXSA 3RWRD 2XOKG 1Q43A 1AJNA 1VF5B 3C3TA 3W7SA 3CJHB 3SPJA 4JI6B 2QGNA 2RMKB 4TSFG 1NH2D 3OTOO 2UUAO 2BTQA 2AXTZ 2Q7EA 4U7OA 2ARHA 3CRQA 5HFMA 1AI4A 2WWWA 4GKKB 3TCUA 4NVPA 1N0JA 4QE9A 1MZFA 1P4RA 4DXWA 3OMAB 1JQ0A 1ZUQA 4DUYB 2Y0IA 2YDEA 2PTMA 3W7UA 5L3CA 2Y69B 1KD1W 1CEZA 2DYSB 4X1IA 2ZR3A 1H8EG 2IW5A 1G6UA 2ADQB 4MVOA 1N36B 3CC4V 3E8HA 4GYCB 2CGNA 5J2UA 2VQEB 2IU0A 1F23A 2V1DA 1ZL8B 2XHBA 2BSKA 3APQA 3A8TA 1GH6A 5H6QA 4LF7O 3IFXA 4HAMA 4XDLA 3RFRA 1VQMV 3VQYA 5L3EA 1T5EA 4X20A 3KG2A 1M57C 1JPXA 3OD4A 2Y0PA 3QVNA 1HNZB 3JSNA 1FXKA 1MABG 1I5XA 4DYLA 2ZM6B 3ZMUA 3FAVB 5LMUB 3BEHA 4RAIA 2CDYA 3VOUA 3CCMV 5CN0A 4LFBB 2MK3A 4KHPO 1BGYH 2UU9O 1D5NA 4X89A 3QG5A 5BY1A 2WLJA 3ZRWA 5CA0A 5EC1C 3DXRB 4GKJO 4B08A 5CB4A 3X2QB 3O9OA 3QO8A 1OJHA 3K0GA 1N33O 1ZWIC 1BQ0A 2DYRB 1PL4A 2JS3A 5BMVB 5GW7A 1YJWV 3JAWB 2F1MA 1QVGU 2ZNJA 4UVCA 2ZCEA 3P3NA 1QNMA 1H38A 2KG7B 4G28B 1JJ2U 2AW9A 2R72A 4YHHO 2Q5ZA 2FB5A 1RM1C 4O4LB 5EIBC 2HHHB 4O4IB 1AJPA 1GN6A 2LFRA 2QKCA 4GX0A 5IYZB 1Y6XA 1SQBH 3CC2V 1VQKV 1COWG 4I50B 1ROPA 2YEVA 4JV5O 1FXVA 1V55C 2W6JG 1MG1A 5BR8O 2WLLA 1AI7A 2GUZB 4CBCA 2F43G 2BTOA 2UUAB 2IH1C 2JRIA 1TUEB 4X1IB 5KA5A 4I55A 3ZN0A 4X62B 3E2EA 2UUBO 2RQ6A 2DMXA 3H1LH 2FYUH 3T4DA 1VQ7V 5B1BB 5J2UB 3L75H 3ZHVA 2GV9A 2NR5A 1HR0O 4X65O 4TOIA 3HPLC 3F7YC 5B1BC 4UXNA 1JJOA 3ABMC 1GM7A 3TJTA 2LP7A 1YHQV 2OIGA 4RUEA 2W6IG 4DV1O 3ABTA 3CCEV 1QR9A 4IYIA 1MSDA 1N4CA 2XNDG 1NI8A 2LW1A 1V9PA 5EYPB 3K3WA 5H9CA 3UO3A 2WPDG 1P7GA 3SYQA 4FZ1A 5IYBO 4X66O 1FKAO 2LJ2A 1GO3F 4LH7A 4MVQA 3FYIB 4JI2B 2EINB 1MA1A 1YXBA 2QJ1A 3CS5A 1IDSA 5IY5B 2DQ3A 3M99B 3DTUB 1GN4A 2EBOA 1XNRO 4FLVA 5IYCO 4MTXA 1Y4MA 4CH4A 2P4VA 5CBHA 2ZXWB 1I5YA 5AG2A 1DF5A 4FLTA 2R70A 2ZKOA 4LF8B 1QQCA 5LYJB 2F4VB 4FFBB 4X8AA 4I9QA 5KHHA 3SDLA 3RYIA 1J5EB 4X66B 5EC2C 1Q7YW 1HW7A 1N0NA 2NNUA 3B8NA 2X0LA 2HG5C 4DR6B 1KP2A 4G2KA 5CMUA 3T1YB 4EFEA 1SQVH 2ZT9B 3SYCA 1FXKB 1XEQA 4F6EA 5E79Z 4LNUA 3E8FA 1VQPV 1A32A 1H2KA 5ITZB 2VWJA 2EZPA 3CMEV 1H2MA 3E22A 1MNGA 3ZIAG 1N32O 3BFRA 3C3SA 3JCZA 4O2BA 1KECA 4GX5A 3SPCA 1F7YA 1IBMB 3SJCC 1KBHA 2PY5A 1OCCB 1PNMA 4I4TA 3QNEA 5LA6A 1V54B 2GHYA 4DV2O 1EN5A 3S3XA 3OR7C 1GN2A 3JAWA 2FMLA 3BCCH 5EBMC 4JYCA 2EJ7A 4ZIBA 2XUMA 4IYHA 3ASNB 1O9HA 3ABLC 3D36C 3LDCA 2Q7HA 2A3QA 2P22C 1XL4A 1M57B 1JCHA 1S0VA 1YJ9V 2ZDIA 4LF9B 4MVUA 4I0XB 5LMNB 4X88A 4QJFB 1WNSA
chains in the Genus database with same CATH topology
3L73H 3L75H 1SQXH 1KYOF 3L74H 3L71H 3CXHF 1NTMH 3L70H 1NTZH 3BCCH 1SQPH 1SQQH 1L0LH 4U3FH 1L0NH 1P84F 3TGUH 3H1JH 1PPJH 3H1HH 4PD4F 2IBZH 1BE3H 3CX5F 1BCCH 1NTKH 1PP9H 1KB9F 3L72H 3H1IH 1NU1H 2A06H 1SQVH 3H1KH 3H1LH 2FYUH 1EZVH 1BGYH 3CWBH 4D6TH 5KLVH 1SQBH 2BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L73 H;  3L75 H;  1SQX H;  1KYO F;  3L74 H;  3L71 H;  3CXH F;  1NTM H;  3L70 H;  1NTZ H;  3BCC H;  1SQP H;  1SQQ H;  1L0L H;  4U3F H;  1L0N H;  1P84 F;  3TGU H;  3H1J H;  1PPJ H;  3H1H H;  4PD4 F;  2IBZ H;  1BE3 H;  3CX5 F;  1BCC H;  1NTK H;  1PP9 H;  1KB9 F;  3L72 H;  3H1I H;  1NU1 H;  2A06 H;  1SQV H;  3H1K H;  3H1L H;  2FYU H;  1EZV H;  1BGY H;  3CWB H;  4D6T H;  5KLV H;  1SQB H;  2BCC H; 
#chains in the Genus database with same CATH topology
 3QF7 A;  5L3F A;  3MHS C;  3RYH B;  3A0B Z;  1S5H C;  2L6L A;  3NR7 A;  3RVY A;  4WF9 V;  1TUB A;  3HKC A;  3JD0 A;  4JF3 A;  1S72 V;  5JWP A;  1VEW A;  1EM1 A;  1Z5W A;  4MVM A;  2YIC A;  2QWQ B;  3AG2 C;  4W4K A;  4WBN A;  3IGA C;  3P3P A;  4ZHQ A;  2KQX A;  1NR1 A;  4WFE A;  1BMF G;  1AR4 A;  3H1H H;  1BT8 A;  3RYI B;  3HR0 A;  2DOS A;  1XRE A;  1LR1 A;  1YF2 A;  4KFM A;  1XBL A;  1SET A;  3WB2 A;  2XTA A;  2CUG A;  3N2K B;  2ETN A;  4JTD B;  2Q4P A;  1SQP H;  5B1O A;  1FJG O;  3CB2 A;  1QR8 A;  3DC5 A;  3OGC C;  1M56 C;  4FJC C;  4FIP C;  2GBO A;  4H37 A;  4JI5 B;  4DR4 O;  1NU1 H;  5EYP A;  4K8X A;  1H2N A;  3N27 A;  4IHJ A;  3ZS8 C;  5JQG B;  2QSA A;  3OAA G;  4MTG A;  3TXQ A;  3T1H O;  4K0K B;  4J42 A;  2IJJ A;  1WA8 A;  2HHH O;  1AR5 A;  1XMQ O;  2EIK C;  4GUN A;  2QM4 A;  4GKK O;  1QU7 A;  4ZI7 B;  2WLI A;  2L35 A;  2QA4 V;  4L8J A;  2DQ0 A;  1SC5 B;  3CC7 V;  1YEW A;  1AJQ A;  3AG3 C;  1DLB A;  4X62 O;  5FNV B;  3CHX A;  2HJD A;  3ZED A;  4LBE C;  1Y66 A;  3L74 H;  3JAT A;  1Q6H A;  3CXH F;  2W0F C;  4PI2 A;  4J10 A;  2ZD9 A;  1VMG A;  4J7Z A;  4DRX B;  1GM9 A;  4DR2 B;  4DR2 O;  4YIO A;  1VQL V;  4YXW G;  1VF6 A;  3STL C;  2ZR2 A;  3Q4H A;  2OTL V;  2JEX A;  5CA1 A;  4AIL C;  5DED A;  2B1G A;  1OCO C;  2WLK A;  2EIM C;  1Q82 W;  3HKC B;  4DV6 O;  1X4T A;  1OCZ C;  4DR5 O;  1K4C C;  3N2G A;  4U3F H;  4PJ0 Z;  1SRY A;  1GM8 A;  4O4J A;  4YHH B;  4EB6 A;  5ITZ A;  5LOV A;  3BA9 A;  5K1P A;  1R3L C;  1YIT V;  1W0K G;  3ZMT A;  2B9Z A;  2H3O A;  3K59 A;  3ICX A;  4FLU A;  1NJI W;  3K04 A;  4AI8 A;  5L3B A;  4OPA A;  4DR1 O;  2UXB B;  1WB8 A;  1FFX B;  3N2K A;  4MW8 A;  3ZRV A;  1YTF B;  4K0K O;  1M93 A;  3AG2 B;  4X1Y B;  3F5W C;  3M7M X;  3BY6 A;  2YUA A;  3B8M A;  1R6K A;  2ZE5 A;  3LUT B;  3U10 A;  4DV7 B;  4PA3 A;  2ZE7 A;  4JI5 O;  2ZDI C;  1VIB A;  2ZE8 A;  2YS8 A;  4PA7 A;  4I0X A;  3HKB B;  3GVM A;  1XMO O;  2HVJ C;  3JCU Z;  1WJZ A;  2R9R B;  4FFK A;  2A79 B;  3CRA A;  1Q5O A;  3EHB B;  3FD9 A;  4PV1 B;  3RYH A;  3K08 A;  5LGU A;  4R8C A;  1ZAU A;  1Y74 A;  3CCS V;  2ZIM A;  3BRC A;  4FZ0 A;  3L73 H;  4K8Z A;  3CYO A;  2JGU A;  4ZKI A;  3SR2 C;  2FL4 A;  1P7B A;  4X9Q A;  3W7W A;  3OEH G;  3UM7 A;  5FNV A;  1RPR A;  3OT7 A;  3J7A U;  1V54 C;  4KUM A;  3OTO B;  1BE3 H;  3SGI A;  1Q6I A;  2GDS A;  3ZMZ A;  3D3Q A;  4NR1 A;  2F95 B;  3X2Q C;  2P5O A;  1QLE B;  1N34 B;  5BZB A;  1PD3 A;  4GZR B;  3D8C A;  3Q4H B;  4HZ3 A;  2R9A A;  4O4H B;  3OTF A;  4JI7 B;  3AEI A;  4NTW A;  1KUQ A;  2XAH A;  1IBK O;  4D7S A;  5LMN O;  3BVO A;  3G71 V;  1URF A;  4DV4 O;  4Q6G A;  4O4J B;  3K03 A;  4LFA B;  3DSQ A;  5LXT B;  2CTW A;  3QO5 A;  3ZX6 A;  4TWK A;  5H5N A;  1GK9 A;  4BIU A;  4ICG A;  1RP3 B;  5L3G A;  4LWS A;  1EBO A;  4FLX A;  4IHJ B;  1P84 F;  2QM8 A;  3E86 A;  3K5M A;  4LFC B;  3QO7 A;  2LFS A;  2EIM B;  2IBZ H;  1WA8 B;  3RGB A;  2A06 H;  1NH2 B;  4UV9 A;  1OCZ B;  4MT8 A;  5IJ9 B;  4LF6 B;  2RN9 A;  1PNK A;  3C90 A;  4PDL A;  3T1Y O;  4Z2W A;  4LF4 B;  2QKA A;  1HP8 A;  4U3J B;  3WG7 B;  1B3Q A;  5DN6 G;  3HKD B;  4X1K A;  1JFF B;  1CXZ B;  4B7K A;  5BR8 B;  4DV3 O;  2Q68 A;  1K92 A;  2A0L A;  4WFF A;  3SJB C;  4WFA V;  5KAF Z;  2N74 A;  3K9S A;  2Q0A A;  1F4M A;  4J9Z B;  5L3D A;  2ILM A;  3JAT B;  2Q69 A;  4DK0 A;  3THO A;  3HB3 B;  4JI2 O;  2XAQ A;  4XDJ A;  1WP8 A;  2ZXW C;  2AZ0 A;  4QIW F;  5CA1 B;  3CCL V;  4MSW C;  4JGS A;  3T1C A;  3JAS A;  1W2B U;  4GLX A;  3CP1 A;  4YJ3 A;  5KX5 B;  1IXM A;  1F4N A;  2DWE C;  4UB6 Z;  1Z2G A;  3MAQ A;  3GWK C;  2HVK C;  3ZRS A;  3K06 A;  5IDJ A;  2YC0 A;  3L70 H;  1XMQ B;  3B4S A;  4HNA B;  1K33 A;  2PYL A;  1F51 A;  2E76 B;  4YY3 O;  3JAR A;  5CBG A;  1Q81 W;  4O2A A;  4TQF A;  2N05 A;  1RSO A;  1TVK A;  2VRZ A;  5JH7 A;  1M56 B;  2NN4 A;  5LHH A;  4DV0 B;  3K58 A;  4E4E A;  4JAS A;  2YXH A;  1SES A;  2IJI A;  1OCO B;  5IT9 N;  1JOY A;  4CH3 A;  5JJN B;  4PDR A;  4RUF A;  1N34 O;  3OE7 G;  5HFL A;  4DV1 B;  2WSS G;  3P32 A;  1HWY A;  2VWK A;  3HKB A;  1N8R W;  2UUB B;  2G38 A;  5BXZ A;  4PA9 A;  4TV9 B;  3UO2 A;  1XIL A;  1L8D A;  3SPG A;  2OCC B;  5E1A C;  3TET A;  1WB7 A;  2X7R B;  3VBB A;  4P9P A;  4J7J A;  5KUM A;  3HKE B;  1TGO A;  4QGP A;  3VQV A;  1G4Y B;  2F93 B;  1R3I C;  4CS2 A;  5JVD A;  4L87 A;  3ABM B;  2BCC H;  4CH5 A;  4EFB A;  4R6Z A;  2V4D A;  2GTS A;  4JZ2 A;  3JYC A;  1XNR B;  5JCO A;  3U0Z A;  4TQD A;  2HFE C;  3LSS A;  2DYS C;  2Q9L A;  4JI4 O;  1NBM G;  3BA8 A;  3GB7 C;  1JVM A;  2F4V O;  3MD0 A;  5LGN A;  4J11 A;  3ABK C;  2PI4 A;  5J2T B;  4CS4 A;  1VQ8 V;  2BSK B;  2QTO A;  3E89 A;  3EVK A;  1N33 B;  4P2Z A;  2QWP B;  2JEU A;  1CPY A;  2UXD O;  5LXT A;  1U96 A;  4ABM A;  4LP8 A;  1K9M W;  4NB5 A;  4AHC A;  1Q6U A;  3SPI A;  1GMG A;  4JI1 B;  1FD9 A;  1SA0 A;  3DC6 A;  5EBL C;  4J9Y B;  1YTF D;  2ZM6 O;  4KXR A;  3F7V C;  4ZOL A;  1RFY A;  1IBL B;  5CA0 B;  1OZ0 A;  3OFN G;  1NS1 A;  5IWA B;  1JFF A;  1XI1 A;  3SJA C;  4B3S O;  2KB1 A;  2EZO A;  4NYK A;  4I9W A;  4TUY A;  3K0D A;  3ZHS A;  1NZ6 A;  4IGG A;  1NKD A;  4DK1 A;  1XUQ A;  4B7E A;  1NVP D;  1Y76 A;  4LFA O;  2PI5 A;  3A0H Z;  1SQG A;  5KHI A;  2Q7G A;  2WA3 A;  3HKE A;  3JAL A;  5B5E Z;  3QTC A;  3ASO C;  4MTO A;  1FFT B;  2QDO A;  4F6R B;  1CP9 A;  1HNX O;  2WLN A;  5IYZ A;  4DO2 A;  2BE3 A;  1L0L H;  5JVD B;  4DR5 B;  2RJZ A;  2Z5U A;  2CH7 B;  1BSM A;  2PGG A;  2E5L O;  5KUK A;  3IAY A;  1I94 B;  1NQT A;  4I50 A;  2N04 A;  1XNQ O;  4B3S B;  5LL6 Y;  2P06 A;  4NXN B;  1EZV H;  4FPP A;  4MVR A;  1R6T A;  2EIJ C;  2QWR B;  2UXN A;  1I94 O;  4G27 B;  4DR3 O;  4DV3 B;  3JAR B;  5LYJ A;  1YI2 V;  1RSO B;  1PPJ H;  4MW3 A;  3ETE A;  4JAU A;  4DR1 B;  2UXB O;  1K7D A;  4QNH B;  5J2T A;  1WLE A;  1ENV A;  2UXC B;  5KHK A;  5JH7 B;  3L72 H;  3F5T A;  1FXH A;  2UUC B;  4KHP B;  2JVD A;  4IIJ B;  3ZHT A;  3G6B A;  3DGE A;  3RN4 A;  2UXC O;  4DV5 O;  4JI3 O;  2Q67 A;  1NTM H;  3E8B A;  1MSW D;  2QR4 A;  2ZNI A;  5FL7 G;  2P90 A;  4LNU B;  3UKM A;  4DV5 B;  2XAJ A;  3PN1 A;  1YCI A;  1KC8 W;  3ABK B;  3FB6 C;  3FX7 A;  1S5L Z;  2A7W A;  3CX5 F;  1BCC H;  5IYD O;  2YIA A;  4WFG A;  4QE7 A;  1R3K C;  5EZY B;  2QEX V;  1FS0 G;  1I0H A;  1PNL A;  3B2E E;  2YID A;  1Z5V A;  1SQF A;  1THZ A;  2IH3 C;  1EFR G;  2M6Y A;  1DTO A;  2W0X A;  4I4T B;  1B6Q A;  1AIL A;  4D7T A;  4DUY O;  5C93 A;  2Q6A A;  3CMA V;  1EN6 A;  3BHP A;  1ZTE A;  5KLV H;  3FFQ A;  1WN7 A;  3RYC A;  2IM9 A;  2E3C A;  1Q90 D;  1KKC A;  2UXX A;  4B3T B;  4C7U A;  1DF4 A;  3JD3 A;  2Q0O C;  1M1K W;  3L9D A;  3ML0 A;  1GN3 A;  4H0L B;  3GWO A;  3CCV V;  3OUF A;  2Z0A A;  2FTK A;  4JZG A;  3U11 A;  4LH6 A;  4CH6 A;  5KA6 A;  2Q8V A;  3IC7 A;  2D2C B;  1K3E A;  2PF4 E;  2RNB A;  2ITC C;  2JGD A;  3TK1 A;  1GAX A;  4GKJ B;  4PDV A;  3KCX A;  4LF4 O;  3ZBH A;  4WBN B;  3A2F A;  4JI8 O;  2UU9 B;  3E22 B;  3OEE G;  2X6C A;  4GT1 A;  4ZBM A;  1H2G A;  3CXC U;  4K3A A;  1ZL8 A;  5FPO A;  4MS2 A;  1K97 A;  3K57 A;  1KP3 A;  5LA6 B;  4FLW A;  2PUS A;  1ARO P;  4UCT A;  3B09 A;  1J5E O;  1HDJ A;  5H2F Z;  1DGS A;  3ASN C;  4LR3 A;  2JIZ G;  1M90 W;  3LDE A;  1KU9 A;  4BWA A;  3ZRX A;  4NXM O;  5EK0 A;  1Y76 B;  1WPB A;  1FJG B;  1BHA A;  4EKW A;  5FPR A;  1YZB A;  3JAL B;  5KHG A;  5C8Y B;  5A2Q N;  3ZMV A;  5LP6 A;  2HLD G;  1AB3 A;  2BTQ B;  4BW9 A;  2JS5 A;  1YJN V;  1JR9 A;  1YVW A;  3FYE B;  1VP7 A;  3UT5 A;  5J9P C;  1NVP B;  1QLN A;  3MDS A;  4QPJ A;  2ITD C;  3JAK B;  4JYA O;  1SQX H;  1AP5 A;  5BMV A;  1SS3 A;  5D5P A;  3T2M A;  1SQQ H;  4UB8 Z;  1YDX A;  2CTR A;  2P67 A;  5JJE B;  3UCS C;  1K8A W;  1NR7 A;  2KG7 A;  2DWD C;  1VQ9 V;  3G80 A;  4JI0 O;  3AK2 A;  4RQE A;  4FM0 A;  4UVB A;  3AG1 B;  3CD6 V;  3WG7 C;  4DW0 A;  2ADP A;  4O4I A;  1KYO F;  2XAS A;  1G1X B;  3CCU V;  2DN9 A;  2ZQM A;  4CC6 A;  4X64 B;  3CRM A;  1TA8 A;  4DV2 B;  3ASO B;  2X6A A;  2OWO A;  1NT2 B;  1UJW B;  1QCE A;  2YXL A;  1S77 D;  4X20 B;  2M7W A;  5B3S C;  2EIL B;  2JGD B;  4RWU A;  4DV4 B;  1VQ5 V;  3AG4 B;  3OGI B;  4FK5 C;  3EFF K;  4UV8 A;  1ORQ C;  4AQY O;  4YIP A;  4JI8 B;  2JJ1 G;  1DK1 A;  4I55 B;  4JTC B;  2C2A A;  4R7C A;  2X6B A;  4J80 A;  1Q3E A;  5JQG A;  1IX9 A;  1KQS U;  1QLE C;  4PD4 F;  1XQ8 A;  2LO1 A;  4NXM B;  1S76 D;  4B3R B;  2LGQ A;  2EUL A;  1FFX A;  4ZI7 A;  2JJ2 G;  5F2V O;  1VQN V;  4X1Y A;  3B77 A;  2AHZ A;  4B3M B;  1M5I A;  1KMI Z;  1XL6 A;  2KKW A;  2E74 B;  4UCU A;  2CK3 G;  3AG3 B;  4NTX A;  3WFV A;  2IJH A;  2YSU B;  4U7N A;  3RT3 C;  2YIB A;  1UPG A;  1J95 A;  4DRX A;  4O4L A;  5B1A C;  5K1X A;  4JI4 B;  4WFB V;  5LP6 B;  2CAZ C;  4UFZ A;  3WB1 A;  3JD4 A;  4DW1 A;  2OTJ V;  1VQ6 V;  4FM2 A;  2VQF B;  2VQF O;  4QPK A;  3UT5 B;  1B06 A;  2HKO A;  4JV5 B;  2B1I A;  2ATK C;  1SZX A;  2H8P C;  3ETQ A;  2R9I A;  4FMT A;  3N2G B;  3JSL A;  2WLL B;  3R65 A;  2YI8 A;  1MZE A;  4OX9 B;  4YJ2 A;  2V7Q G;  5GON B;  5LOV B;  4W4L A;  4CS3 A;  5LGT A;  4B3T O;  1L0N H;  3B40 A;  2WA4 A;  1IZ3 A;  4X65 B;  1FAF A;  2OCH A;  1BHB A;  1E1R G;  1HNW O;  1VQO V;  1R3J C;  5FLX N;  4HBN A;  1BZK A;  4NKG B;  3CE2 A;  3H1K H;  5TIS Z;  2QTS A;  3RYF B;  1I7F A;  3I56 V;  3P30 A;  3STZ C;  4OXS A;  1BQZ A;  1OCR C;  4GX1 A;  2P4K A;  2Z3Y A;  4PA6 A;  1N32 B;  4Q20 A;  3OW2 U;  4N21 A;  3TGU H;  3K9A A;  4JPR A;  3ZCC A;  4AQY B;  1QBZ A;  1U97 A;  1WPX A;  1MOF A;  4DV7 O;  2XAG A;  4CC5 A;  4LFB O;  4TV8 B;  5LHI A;  1K34 A;  5C8Y A;  1FYJ A;  5GTI Z;  1M9N A;  3CCQ V;  4O2B B;  4J7K A;  1LNQ A;  1R73 A;  1EZJ A;  4H44 B;  4BR6 A;  1QVF U;  3CRC A;  4UUJ C;  3JAK A;  2ZE6 A;  3AG4 C;  3ETG A;  3RVZ A;  4LF7 B;  2IJK A;  3HKD A;  4X1K B;  3AK1 A;  1PL0 A;  3H9V A;  1SF9 A;  4FFB A;  5H6R A;  2LQT A;  2EIJ B;  4DR3 B;  1GTO A;  3BPZ A;  3AG7 A;  2OCC C;  1Q86 W;  3SJQ C;  3K5N A;  1Y67 A;  4NXN O;  1I08 A;  4Z1V A;  4ASU G;  2ODM A;  3ZN1 A;  1AR1 B;  1AVM A;  1IBL O;  4YJ3 B;  4UCS A;  1H8H G;  5A9G A;  4JYB A;  2CTQ A;  2OIE A;  5GON A;  2HEP A;  2P7T C;  5LP6 C;  5CA3 A;  4ZHQ B;  2OT5 A;  2YXY A;  2XT9 A;  3SPH A;  4HNA A;  1BL8 A;  1FPO A;  3OUS A;  3AG1 C;  2VQE O;  4N23 A;  2WLM A;  2HP8 A;  4BIO A;  4O2A B;  3IC9 A;  3RYF A;  1N36 O;  1HNZ O;  4MTF A;  1LUW A;  3OM3 B;  1HR0 B;  4DV0 O;  4LCU C;  1S3J A;  1KB9 F;  5KAI Z;  2JK5 C;  1RM1 B;  5IWA O;  1VF7 A;  3S3W A;  2WLH A;  2F23 A;  3ZMS A;  1K4D C;  5GTH Z;  5CBF A;  2LGW A;  4PHZ A;  3L71 H;  2EJR A;  5KMG A;  4Z1M G;  1NTZ H;  1XHX A;  3PJS K;  3FB5 C;  3CRR A;  1SZT A;  1WP7 A;  1HNX B;  2B5U A;  2YI9 A;  1OCR B;  4LF5 O;  3J80 N;  2EIK B;  2UUC O;  3LDD A;  1HNW B;  1XNQ B;  1TUB B;  2HR3 A;  2E5L B;  3SYA A;  2A9H A;  3JD1 A;  1R1B A;  5KX5 A;  2AZ2 A;  1OHH G;  4IT5 A;  1AI6 A;  4PEL A;  2Y48 A;  4YJ2 B;  4WCE V;  1IUR A;  3JAM N;  3G4S V;  3FB8 C;  4LC1 A;  2NLJ C;  2RDC A;  2D3O W;  1KKD A;  3VQX A;  4H33 A;  1XMO B;  5KHJ A;  4DR7 O;  4A5U B;  2QKS A;  3APO A;  1EN4 A;  1OCC C;  2BOC C;  4UCR A;  2AHY A;  5B1A B;  3D3I A;  1IXB A;  1TVK B;  1VAR A;  3E8G A;  4CZZ A;  4DUZ B;  5D5Q A;  2QWN B;  4WFH A;  3ZHU A;  2OYQ A;  1JA8 A;  1BS3 A;  2QM7 A;  4JI6 O;  3CCJ V;  1K5S A;  1V55 B;  2PYJ A;  3UQ8 A;  4DR4 B;  4UCO A;  4EB6 B;  1JMK C;  3W7T A;  4EEQ A;  1K5Q A;  1D2D A;  3LSU A;  1S5J A;  4TV8 A;  2QE7 G;  4JI1 O;  3T1H B;  4TV9 A;  1SKV A;  3E83 A;  3G67 A;  3KZI Z;  4PI0 A;  4OX9 O;  1IBM O;  5IJ0 A;  4ZOL B;  2WLI B;  1VQ4 V;  2UXD B;  4DR6 O;  4DUZ O;  1AI5 A;  2VS0 A;  4JI7 O;  2GTA A;  4PDM A;  4JTA B;  1ZSP A;  4DV6 B;  2WAM A;  3A0R A;  2RCV A;  1PP9 H;  3TXS A;  5KMG B;  4TUY B;  4GX2 A;  4LF9 O;  4FLZ A;  3BAB A;  4YY3 B;  1YIJ V;  3M8A A;  3W7X A;  1ZLZ A;  3R66 A;  2E75 B;  4HYO A;  1PV0 A;  5JCO C;  4BAY A;  4FVM A;  3OMI B;  1E1Q G;  4X64 O;  1PM9 A;  3CJH A;  4RO2 A;  1Y74 B;  2EIN C;  4P9O A;  3FB7 C;  2MW2 B;  2IU3 A;  1XOU A;  4F6R A;  2LW7 A;  3D36 A;  4UVA A;  1IVS A;  4IL6 Z;  3I5D A;  3CWB H;  4LF8 O;  2CGO A;  4R50 A;  3K5L A;  1B04 A;  5B3S B;  1ZX3 A;  3LSQ A;  4UCV A;  2H94 A;  4LFC O;  5LBQ A;  1D5A A;  2DE0 X;  1H2L A;  4OPH A;  3I55 V;  3KCY A;  4BIZ A;  1SA0 B;  4H13 B;  1NTK H;  3JD2 A;  3K5O A;  2CE4 A;  4LF6 O;  4D6T H;  3ZJZ A;  2ZIO A;  3ABL B;  2BOB C;  3CPW U;  4B3R O;  1LUV A;  2HJF C;  1SER A;  2EX3 A;  5IE9 A;  3RW0 A;  2F66 C;  1US6 A;  4IIJ A;  1GRJ A;  3OR6 C;  4B3M O;  3CEI A;  4JI3 B;  2QWO B;  1YSC A;  4TT3 G;  3MHH C;  1GKF A;  1P49 A;  5DEC A;  1VF6 C;  4LWS B;  4I5S A;  4P30 A;  5B66 Z;  3LNM B;  5B1N A;  3FAV A;  1Q8I A;  3AK3 A;  5JJJ B;  4JYY A;  4F4L A;  5IJ0 B;  4FM1 A;  1RPO A;  4I7Z B;  3H1J H;  2K9P A;  3WB0 A;  1OV9 A;  2Y69 C;  1H2S B;  2O57 A;  5EZY A;  4XDK A;  3WU2 Z;  3G6E V;  3DXR A;  4JYA B;  4U3J A;  5EBW C;  1WAZ A;  4RQF A;  1UFI A;  5EIB D;  5CB4 B;  2XAF A;  2CH7 A;  1IBK B;  1M4U A;  4MVS A;  1X59 A;  1L1F A;  1QHT A;  2FKX A;  1TAE A;  3SYP A;  3ZHQ A;  4JAA A;  1AP6 A;  3H01 A;  3KKY A;  2P6J A;  4JAV A;  5IY5 C;  5LHG A;  2JDI G;  2K1E A;  1W0J G;  3LNN A;  1K73 W;  4O4H A;  3OMN B;  2CTP A;  4NTY A;  2GSM B;  3K79 A;  2Q73 A;  4JI0 B;  3JAS B;  5LMU O;  4OGQ B;  3CCR V;  1PKX A;  3VQW A;  3SYO A;  3ABU A;  2YIB D;  2KSD A;  1G8M A;  3O65 A;  4PA4 A;  3E35 A;  2DJV A;  2YEV B;  2DW4 A;  4E2L A;  4BW5 A;  4K35 A;  4J41 A;  3CSX A;  3ZHR A;  2DYR C;  4LF5 B;  2GUZ A;  2PZS A;  4KL1 A;  4KP4 A;  3IJ4 A;  3BAA A;  1FXK C;  1W59 A;  4MVZ A;  2ZIN A;  1JX9 A;  5IJ9 A;  3ETD A;  5DM6 V;  3ZRW B;  4DR7 B;  3RBZ A;  3EXA A;  3H1I H;  2AGA A;  1E79 G;  2Y4U A;  3FKS G;  3J81 N;  4XBF A;  1MMM A;  2Y4T A;  1XHZ A;  2EIL C;  1O9G A;  4FLY A;  1R6N A;  4GCZ A;  1XDC A;  3T4Z A;  3RYC B;  3NXS A;  3RWR D;  2XOK G;  1Q43 A;  1AJN A;  1VF5 B;  3C3T A;  3W7S A;  3CJH B;  3SPJ A;  4JI6 B;  2QGN A;  2RMK B;  4TSF G;  1NH2 D;  3OTO O;  2UUA O;  2BTQ A;  2AXT Z;  2Q7E A;  4U7O A;  2ARH A;  3CRQ A;  5HFM A;  1AI4 A;  2WWW A;  4GKK B;  3TCU A;  4NVP A;  1N0J A;  4QE9 A;  1MZF A;  1P4R A;  4DXW A;  3OMA B;  1JQ0 A;  1ZUQ A;  4DUY B;  2Y0I A;  2YDE A;  2PTM A;  3W7U A;  5L3C A;  2Y69 B;  1KD1 W;  1CEZ A;  2DYS B;  4X1I A;  2ZR3 A;  1H8E G;  2IW5 A;  1G6U A;  2ADQ B;  4MVO A;  1N36 B;  3CC4 V;  3E8H A;  4GYC B;  2CGN A;  5J2U A;  2VQE B;  2IU0 A;  1F23 A;  2V1D A;  1ZL8 B;  2XHB A;  2BSK A;  3APQ A;  3A8T A;  1GH6 A;  5H6Q A;  4LF7 O;  3IFX A;  4HAM A;  4XDL A;  3RFR A;  1VQM V;  3VQY A;  5L3E A;  1T5E A;  4X20 A;  3KG2 A;  1M57 C;  1JPX A;  3OD4 A;  2Y0P A;  3QVN A;  1HNZ B;  3JSN A;  1FXK A;  1MAB G;  1I5X A;  4DYL A;  2ZM6 B;  3ZMU A;  3FAV B;  5LMU B;  3BEH A;  4RAI A;  2CDY A;  3VOU A;  3CCM V;  5CN0 A;  4LFB B;  2MK3 A;  4KHP O;  1BGY H;  2UU9 O;  1D5N A;  4X89 A;  3QG5 A;  5BY1 A;  2WLJ A;  3ZRW A;  5CA0 A;  5EC1 C;  3DXR B;  4GKJ O;  4B08 A;  5CB4 A;  3X2Q B;  3O9O A;  3QO8 A;  1OJH A;  3K0G A;  1N33 O;  1ZWI C;  1BQ0 A;  2DYR B;  1PL4 A;  2JS3 A;  5BMV B;  5GW7 A;  1YJW V;  3JAW B;  2F1M A;  1QVG U;  2ZNJ A;  4UVC A;  2ZCE A;  3P3N A;  1QNM A;  1H38 A;  2KG7 B;  4G28 B;  1JJ2 U;  2AW9 A;  2R72 A;  4YHH O;  2Q5Z A;  2FB5 A;  1RM1 C;  4O4L B;  5EIB C;  2HHH B;  4O4I B;  1AJP A;  1GN6 A;  2LFR A;  2QKC A;  4GX0 A;  5IYZ B;  1Y6X A;  1SQB H;  3CC2 V;  1VQK V;  1COW G;  4I50 B;  1ROP A;  2YEV A;  4JV5 O;  1FXV A;  1V55 C;  2W6J G;  1MG1 A;  5BR8 O;  2WLL A;  1AI7 A;  2GUZ B;  4CBC A;  2F43 G;  2BTO A;  2UUA B;  2IH1 C;  2JRI A;  1TUE B;  4X1I B;  5KA5 A;  4I55 A;  3ZN0 A;  4X62 B;  3E2E A;  2UUB O;  2RQ6 A;  2DMX A;  3H1L H;  2FYU H;  3T4D A;  1VQ7 V;  5B1B B;  5J2U B;  3L75 H;  3ZHV A;  2GV9 A;  2NR5 A;  1HR0 O;  4X65 O;  4TOI A;  3HPL C;  3F7Y C;  5B1B C;  4UXN A;  1JJO A;  3ABM C;  1GM7 A;  3TJT A;  2LP7 A;  1YHQ V;  2OIG A;  4RUE A;  2W6I G;  4DV1 O;  3ABT A;  3CCE V;  1QR9 A;  4IYI A;  1MSD A;  1N4C A;  2XND G;  1NI8 A;  2LW1 A;  1V9P A;  5EYP B;  3K3W A;  5H9C A;  3UO3 A;  2WPD G;  1P7G A;  3SYQ A;  4FZ1 A;  5IYB O;  4X66 O;  1FKA O;  2LJ2 A;  1GO3 F;  4LH7 A;  4MVQ A;  3FYI B;  4JI2 B;  2EIN B;  1MA1 A;  1YXB A;  2QJ1 A;  3CS5 A;  1IDS A;  5IY5 B;  2DQ3 A;  3M99 B;  3DTU B;  1GN4 A;  2EBO A;  1XNR O;  4FLV A;  5IYC O;  4MTX A;  1Y4M A;  4CH4 A;  2P4V A;  5CBH A;  2ZXW B;  1I5Y A;  5AG2 A;  1DF5 A;  4FLT A;  2R70 A;  2ZKO A;  4LF8 B;  1QQC A;  5LYJ B;  2F4V B;  4FFB B;  4X8A A;  4I9Q A;  5KHH A;  3SDL A;  3RYI A;  1J5E B;  4X66 B;  5EC2 C;  1Q7Y W;  1HW7 A;  1N0N A;  2NNU A;  3B8N A;  2X0L A;  2HG5 C;  4DR6 B;  1KP2 A;  4G2K A;  5CMU A;  3T1Y B;  4EFE A;  1SQV H;  2ZT9 B;  3SYC A;  1FXK B;  1XEQ A;  4F6E A;  5E79 Z;  4LNU A;  3E8F A;  1VQP V;  1A32 A;  1H2K A;  5ITZ B;  2VWJ A;  2EZP A;  3CME V;  1H2M A;  3E22 A;  1MNG A;  3ZIA G;  1N32 O;  3BFR A;  3C3S A;  3JCZ A;  4O2B A;  1KEC A;  4GX5 A;  3SPC A;  1F7Y A;  1IBM B;  3SJC C;  1KBH A;  2PY5 A;  1OCC B;  1PNM A;  4I4T A;  3QNE A;  5LA6 A;  1V54 B;  2GHY A;  4DV2 O;  1EN5 A;  3S3X A;  3OR7 C;  1GN2 A;  3JAW A;  2FML A;  3BCC H;  5EBM C;  4JYC A;  2EJ7 A;  4ZIB A;  2XUM A;  4IYH A;  3ASN B;  1O9H A;  3ABL C;  3D36 C;  3LDC A;  2Q7H A;  2A3Q A;  2P22 C;  1XL4 A;  1M57 B;  1JCH A;  1S0V A;  1YJ9 V;  2ZDI A;  4LF9 B;  4MVU A;  4I0X B;  5LMN B;  4X88 A;  4QJF B;  1WNS A; 
#chains in the Genus database with same CATH homology
 3L73 H;  3L75 H;  1SQX H;  1KYO F;  3L74 H;  3L71 H;  3CXH F;  1NTM H;  3L70 H;  1NTZ H;  3BCC H;  1SQP H;  1SQQ H;  1L0L H;  4U3F H;  1L0N H;  1P84 F;  3TGU H;  3H1J H;  1PPJ H;  3H1H H;  4PD4 F;  2IBZ H;  1BE3 H;  3CX5 F;  1BCC H;  1NTK H;  1PP9 H;  1KB9 F;  3L72 H;  3H1I H;  1NU1 H;  2A06 H;  1SQV H;  3H1K H;  3H1L H;  2FYU H;  1EZV H;  1BGY H;  3CWB H;  4D6T H;  5KLV H;  1SQB H;  2BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...