1L0NJ

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0nJ00
3H1JJ 1SQXJ 3TGUJ 1L0NJ 1SQBJ 1KB9I 4D6TJ 3L71J 4PD4I 2BCCJ 1NTKJ 1KYOI 3L70J 1P84I 3L73J 1NU1J 3H1IJ 1SQVJ 3CX5I 1NTZJ 3L72J 3L74J 3H1KJ 5KLVJ 3H1LJ 1L0LJ 1BCCJ 2IBZI 1SQPJ 3H1HJ 1SQQJ 4U3FJ 1BGYJ 1BE3J 1PP9J 3BCCJ 3CXHI 3CWBJ 1EZVI 1NTMJ 3L75J 2FYUJ
chains in the Genus database with same CATH superfamily
1NKNA 2B87B 2FYNB 5APXA 3TGUG 1Q7YQ 1QL1A 3TGUE 1FBMA 1N7SD 1L4AD 2W8ZA 5KLVJ 4MN4C 3V6IA 2ZT9D 3EFGA 2NZ2A 1ZW0A 3PRJA 3CL3D 1SQBJ 1LWUA 1L0NK 3CXHE 1RQUA 3I5CA 3L70J 3CCSP 5AVTB 1N2DC 1LT1A 1YITP 3VP8A 2FYZA 3VP9A 2O01J 2QJPB 2M3BA 1JMBA 4ASWA 3CPWO 4H13D 3O6QB 3TSIA 1SFCB 1YJ9P 2P67A 1DEBA 2QM8A 1RF0C 3E1RA 2MKVA 4U7JA 3P7KA 2NRGA 2KS1A 4UB8H 2AEMA 1ZV8A 1OVRA 1QX8A 2HODB 5CCHC 4WWIA 2WSFH 1KILD 1OWAA 4KJMA 4I6MC 5CBOA 2JDIH 5B5EH 5BVZA 1BE3G 2IYOA 4AQRD 4H44D 2JR8A 1VQOP 1MZ9A 4I7ZB 1FZBA 1CW5A 3GHGB 1QGKB 3FXEA 3AE6C 2WWWA 5AW6B 2HLOA 3HE4A 1SQQK 1FE6A 2JWDA 3A0HE 1LP1A 4R4LA 3R4YA 3W67A 5KJ7D 1W2BO 2E5YA 2M5AB 1T2KD 3LIDA 3Q3DA 1IFJA 1VQPP 1DEEG 1SQPJ 2B87A 1L0LE 4PJ0E 2WMMA 1WMKA 4R4MA 1X9VA 1L4AB 3L37A 1NTZJ 2ZT9B 3H1LJ 3MZWB 3CC4P 1L0LK 3FWLA 3ZDMA 4ZMDA 4GIFA 1PP9D 2JKVA 2ZXEB 2WPQA 1K73Q 1VL2A 4TLFA 3L74J 1ZR2A 2H8PD 1KFNA 4BXLA 4L75A 4RESB 2J59M 3AEAC 1SFCA 3RK2B 1UIIA 4H13B 4JPZB 3KXDA 2YO3A 3M06A 2FFDC 3B4SA 5EFWB 1HGVA 1PP9G 2A06G 1PP9E 4WY4D 3GF3A 4H0LC 3B71A 3H32B 3C8VA 1KZUB 1N7LA 3WUUA 1LTBC 2V7QH 3H1HJ 2LXCB 2P58A 2OARA 1GDTA 1KB9I 3JSVC 3GHGA 3CCVP 4BRYB 1P84H 1P84I 2P10A 3L73J 3KPEA 1LT9C 5BU5A 4JYBA 1YTZT 4K3AA 5AVUB 1PPJG 4CPGA 2QIWA 3CCLP 2K1AA 2FY8A 1N7SC 5AW5B 4C7RA 5GTIE 3I55P 4UB6E 4WVZA 1KYOD 3C1LA 3IAOA 1M7LA 4ASVA 1S4XA 3G4SP 3LW5J 1L4AA 1M56D 2KLVA 2O1JA 2OQQA 1WT6A 3BCCD 1OX3A 4C7NA 2R5BA 1T8ZA 2P2UA 1NKZB 1FZCB 1M57D 3G9RA 3GLMA 2BCCE 1BCCJ 3AECC 3F5HA 3KDPB 1OVVA 1J1DC 5CCHD 1KMIZ 2Y9ZA 3M9BA 4NPEA 2N1TC 2FXMA 4GOEA 1S9KD 2IYPA 1JMMA 3OA7A 2IBZI 5H2FE 3TNUB 1SP4A 1BGYJ 1M1JC 2QJKB 3BCCE 3P32A 2ZYDA 3MGNA 2KSJA 1KILC 4D6TD 3SWYA 2E76C 2QA4P 3MTUE 3W68A 3GG2A 2BEZF 4QMAA 1YQ4C 1QVFO 3H32A 3PP5A 2M3EA 1YQ3C 1RE4A 4H44C 1KQGB 1RE3C 2CK3H 1NTMD 2FYUE 2Y9YA 1S5LH 3KQGA 1JY3O 2KK7A 3IF4A 1U7JA 4L76A 3H1HG 3TK1A 3HD7D 4BRYA 1OMIA 2WSCJ 4Y28J 4IFMA 1L0NJ 2FYUK 5KJ7C 1H0TB 3T97B 3VMZA 5GTIH 3ABVC 3L75D 4D6TG 1JY3P 3M91A 4UB6H 1T2KC 4D6TE 1LWUB 3N4XA 5AW9B 3CCUP 1JUNA 2YMYA 1AJYA 2C9LY 3OAKA 4OWFA 1FDIA 2KI7B 2HR3A 3IFMA 2AEJA 5AVZB 2E74C 1N73C 2E75D 3HUSC 1NTME 4HKZH 1IFDA 3N7NA 4Y99C 2OYHC 1T3UA 2WVRA 4ZKUA 1K8AQ 1Q2NA 1HH0A 1FDMA 3HE5B 3CI9A 4DJGA 2L91A 1NTMK 5TISH 1CSBA 3WU2E 4OGQD 1FZCA 2Q6QA 2YNYA 3L75G 3L75E 2OTLP 1KYOH 2QSIA 3RGUA 5H2FH 3A5TA 3L71D 5KKZC 2O3JA 2YO2A 3H25A 2SPZA 1FOSE 1DD3A 2YXQB 1DIPA 5APYA 4H0LD 3TNUA 2QJYC 3B8EB 2Z4EA 1NU1D 3BRTB 1SQQJ 1GTWA 2RN0A 4WY4C 3L71E 1RQVA 1SQVG 1D7MA 1JY2N 3B5NC 1GK6A 2KSEA 3VYIA 4N6JA 1IO4A 2IZ1A 4U3FD 2WQYC 1J1EC 1H8AA 2B89A 2Q3IA 1BSHA 2IFNA 2KYVA 1IFMA 1NU1G 1IJDB 1L0LJ 1NU1E 3V2QA 1YHQP 1IK9A 1H0TA 3T97A 2GUVA 3PLNA 1GW3A 3VN0A 2E42A 1VQMP 2N9BA 1BDCA 3H1IJ 1FS0E 3L72J 3SWFA 1MUUA 2Z5HA 1UIXA 3PJSK 3WU2H 2BASA 3VOPA 4U3FG 3BATA 4K35A 4U3FE 1BE3D 2XNXA 3AE7C 4KHXA 2C9NY 2KZIA 2N1TD 3HE5A 2ZYGA 1KQFB 2R44A 3IR9A 3CCEP 1ZOYC 3AE9C 2ZJSE 2HYNA 3A2AA 1RF0A 2AXTH 4PV1B 4HJGH 2WPSA 4JYCA 1E5WA 1KB9D 2FFDB 3H1KJ 1NTKD 2E76D 3G71P 1HWTC 5AVXB 1P84D 3P8MC 1ZRTD 1NYHA 5CCHA 2GM4A 3Q5PA 1S2EA 1EXJA 2P7JA 1BE3E 3CWBD 4H0LB 3NMDA 2H7HA 1A02F 1JB0J 1AVYA 5KLIC 1KFMA 4DCKA 3VMAA 1R8EA 2C0XA 5KAIH 5CCGD 2XV5A 1FZFA 3H1JJ 3PTZA 3H6PA 2WSEJ 1K05A 2HPCB 2QRXA 1IFPA 1KILE 1H89A 1SQBD 2LXBA 1KB9E 1LT9B 1OVUA 1G2CB 1NTKG 4LLHA 1NTKE 1P84E 1ZRTE 1YI2P 5KTBA 1H88A 5APQA 3HD7C 3AE5C 3CWBG 3A0BE 3CWBE 2D2CD 1RF1C 3FGAD 1N7SB 2E74D 2RKLA 4AUWA 4C7NB 3NXSA 4GDOA 5KLVG 1TU3F 2LR2A 5M1BA 5AW2B 2FBWC 2K3RA 3P8CD 2P1JA 3CLQA 1IK7A 2IBZD 2E75C 2A06D 2BCCJ 1SQBG 1FAVA 3Q5SA 3L70G 2NPSC 3H1IG 5AVVB 1XTGB 3I56P 2YKQA 2QG4A 2PGDA 1VQ8P 4ZNCA 4OGQC 3G3ZA 5CBNA 2QM7A 4NPDA 4O9BA 2YKPA 3FXDA 1FU1A 5B66H 2W83C 2XKMA 4RO0A 5AW1B 1FZEA 4W7YA 2I1JA 3P8CE 3BRVB 2IBZG 1PPJD 2IBZE 2A06E 4GKGA 3M0DC 1KQSO 1MFZA 1EDLA 1KILB 2FFDA 2Q9IA 2E76B 3K5BA 1RH5B 2ZVOB 1PL5A 3M9QA 3B5ND 2FYUJ 3O8ZA 3GMAA 4L74A 3ITKA 2ZVNB 4YTPC 4H44B 5GTHH 1KB9H 1NGMB 1LNQA 4HB1A 2HFED 4I7ZC 1K9MQ 2A45I 1W5CE 1S5LE 4EIJA 1YBKA 1NTZD 3A0BH 2PFXA 4IL6H 2HPCA 3BASA 1PPJE 2OTJP 1YIJP 1KV4A 1LT9A 3H1JG 1G2CA 1Q86Q 4DT0A 3M0AA 1G1JA 2QE7H 1KD1Q 2O1KA 2WZ7A 3SSUA 1JNMA 2V4HA 3AE4C 5AW0B 1JCCA 3L74D 4A7PA 1NTMJ 1SQPG 1N7SA 1GU4A 1RHZB 1SQXJ 1MKMA 2E74B 1N73B 3HUSB 1AQTA 1Q82Q 3MUDC 1FJKA 3RL0g 4Y99B 1ZP0C 1GK4A 3OJAB 2OYHB 2L5GB 2KOGA 1NTZG 2CPSA 1NTZE 3H1LG 4DOJA 5AW4B 1URQC 1PGPA 1Y8AA 2O01H 1EDIA 1Q81Q 1AA0A 1EZVG 3RL0C 2Q1KA 3GF7A 1RY3A 2XNDH 1DH3A 5TISE 4IFDK 1DX7A 2R32A 1KYOE 2M8RA 3L74G 4OVNF 1OW8A 2RH0A 1OIPA 3PHLA 2OTKE 3RK2C 2N1TA 3H1HD 1M8OB 4YPCA 3GW6A 1PGJA 2FXOA 3AEBC 1M1JA 3UIAA 1A02J 1PV3A 3V4WA 3MD0A 1S1CX 3QH9A 1PGQA 2JJLA 1KILA 1LTJC 1VQLP 2GA1A 4WY4B 3L71J 4PD4I 2I8DA 4JBZA 2K9JA 3AE1C 3FX0A 1S9KE 1Y47A 5CCGC 3F89A 1KTMA 5APSA 3B5NB 1LTAC 2YIUB 1G1IA 1RE3A 3S1KA 3H1HE 3TGUJ 4YXDC 3E1IA 1J1EB 1HBWA 2IZ0A 1ZR4A 2Y0DA 2XU6A 4C46A 1QVGO 3CC2P 3L73G 2Z5IA 1PFIA 5AVRB 5KJ7A 3CCMP 2WITA 1BCCD 2WTYA 2R3CA 3U59A 3U1CA 2W6AA 2D2CC 1MFTA 2XZRA 2Y0EA 1L2PA 1W2EA 2H89C 3AE2C 2AXCA 3BVHA 2NPSD 2MJZA 4W80A 2O01N 2IPPA 1GL2C 2KZJA 1N73A 3HUSA 1EZVI 1PIXA 1BSNA 1OW6A 1VPCA 1BGYD 1SQXG 2OYHA 3AE8C 1LTSC 3D70A 3SWKA 1SQVD 1BCCG 1VF5C 1BCCE 2M0BA 1U7MA 1KN7A 1LJ2A 2JP3A 4OH8B 2AXTE 1IFNA 2POHA 1NOHA 2E43A 3MP7B 5AW3B 4EDFA 5K5GB 3RK3C 1BGYG 3MHVA 1Z56A 1BGYE 1JO5A 1AFOA 2KP8A 3V2PA 4Z1MH 1LTTC 1EC5A 5KLIB 1L0ND 4JF7A 2I1KA 1HF9A 5C39A 2QEXP 2OYIC 3Q5RA 2ZYAA 4WY4A 1SQVE 3L4FA 5AVQB 4IOIH 1JTHB 1PZQA 1Y9BA 4HH2A 5KAIE 3C9IA 1JY2O 1R5LA 3V5BA 2K37A 1SQVK 3B5NA 1FZAA 3SFEC 1JY2P 3KYQA 2W6BA 5CJ0A 4I2LC 1T6AA 3HD7B 3E7KA 1SS1A 3NFQA 1RF1B 4M3LA 1ZXGA 1L0NG 3VTPC 4EI2A 3AE3C 1L0NE 1KQLA 3CX5H 3CX5I 1LWUC 1NU1K 4XE5B 5KAFH 1LTIC 3RBXA 3LW5H 2CPBA 1URQD 2E75B 1EDKA 1IZNB 3RL0D 2PP6A 2FKWB 3EFFK 1IC2A 2HG5D 1HVVA 2NPSB 3AEFC 4RKUJ 4OGQB 5CHXA 1SQQD 2B9BA 3RK2D 3R2PA 3KZIE 2KLUA 1SVFA 2W27A 1FOSF 5B66E 1PP9J 3G6EP 1GZLA 2AEFA 3VMXA 2WT7A 4LC1A 1Q90D 3U1AA 3JC22 1SLQA 3A7OA 1QLED 2JWAA 5KLVD 1L0LD 1GD2E 3TYYA 1SQQG 1NJIQ 1SQQE 4IFFA 2J58A 3RBZA 1FZGA 2WPRA 1QL2A 5GTHE 1GU5A 2KIKA 1FC2C 1JTHA 1M90Q 3L70D 1NAFA 3H1ID 1GMJA 2A45G 3L72D 1JM0A 2WSCH 1USDA 2VRSA 3Q1MA 1CI6B 2ZAEB 2FYNC 4IL6E 2IX7C 4XFJA 3II6A 1NTKK 1AQ5A 1NVOA 1X79B 3V2RA 3TF5A 3HD7A 5CMZA 3HRNA 2K9YA 1L0LG 1GL2D 3CXHH 3CXHI 1RF1A 2PAJA 3SFDC 5KLVE 5BU8B 1HGZA 4RJTA 1JOCA 1EDJA 4B86A 1PGOA 3WUTA 1YJNP 2KUBA 1SQBE 3JCUE 2H43A 1JEKA 1U57A 2YKOA 3L70E 5KLVK 3L72G 2Y0CA 3H1IE 3L72E 1URQB 2YMKA 3H1KD 3NTNA 1VF5D 3KZIH 1J1DB 2QJPC 3WMM0 3M9HA 3RL0B 1SQBK 2NPSA 3CMAP 1SFCC 3WUVA 2N1TB 3FWNA 4PD4D 5E79E 3HTKB 1X22A 2K88A 3BCCJ 1M1JB 3O6QA 1OZHA 3S9OA 3USSA 3RK3D 4PV1C 3TDKA 1E79H 2WSSH 3H1JD 1BDDA 4I1LA 2K9JB 2HODA 1YTZI 3H1KG 1T3JA 3H1KE 3M0DA 2Q5UA 1N86A 1LTJB 1VQNP 1SQPD 1VQ5P 4NPFX 2B88A 3GHGC 2A45H 4PD4E 2XDJA 3A0HH 1NH4A 3CCJP 3H1LD 3RK3E 2J5UA 4D6TJ 2UWJE 3EQ2A 2H88C 5DJTB 1EZVD 3H1JE 1VQ9P 1X8YA 3L36A 2BEQD 4WBAA 2BCCD 2ZFCA 1ZN5A 4PJ0H 1CI6A 1HJ0A 4JQ0D 1QEXA 1VQ7P 1KC8Q 2M5AA 4EOTA 1NHLA 1SQPE 2D2CB 3JCUH 3MIWA 1L4AC 4W7ZA 2ZT9C 1GL2B 4LGDE 1FJPA 1OW7A 1SQPK 3MUDA 3H1LE 5AW8B 3L75J 1USEA 2WPVB 2GUSA 4GOFA 1YJWP 1EZVE 2R3SA 5E79H 3AEDC 1EQ7A 1OFCX 2BCCG 3CC7P 1AVOA 1NTZK 1URQA 5KKZB 1VF5B 5AVSB 3L74E 3IN6A 1VQ6P 4EYYQ 2ITAA 2JEEA 4H13C 1WRGA 2FYUD 4YXWH 1N8RQ 1NO4A 2WSFJ 3HTKA 2KNCB 2QJYB 2IFMA 3V2NA 3L73D 4WB4A 3PH0A 2N9YB 1CZQA 3RK3B 3BCCG 1DD4A 2KXPB 2PRRA 1R5SA 3AEGC 1EXIA 4PD4H 3OW2O 1SQVJ 1RE4C 4GT1A 2OYOA 1VDFA 2OYIB 3D71A 3QWOC 1LTJA 4KT0J 4ZKPA 1XTCC 3CX5D 1HJBA 2QVAA 1GW4A 2G3AA 2WSEH 2C0WA 1ZMEC 2FYUG 5AW7B 3CCQP 4BWNA 5TJHA 5CCGA 1JY3N 1SQXD 2W90A 1NU1J 3CMEP 1OXZA 2R5DA 1J2JB 1AV1A 1LGHB 4TT3H 3Q2YA 4L73A 3D6YA 3L73E 1NWQA 1M1KQ 4IL6X 4XA4A 2Q3EA 2YXRB 4AYCA 2ZXXA 2E5TA 2RMZA 3CX5E 3VMYA 4U3FJ 1YYCA 1HUCA 1K04A 5KAFE 5APTA 1NTMG 3EWKA 4N78D 1SQXE 1GL2A 4DZOA 2W6JH 1FZCC 1SFCD 1FDOA 4HYTB 2G8YA 1NAYA 1LTGC 2OGUA 2KS1B 1IFIA 2IDBA 1SQXK 1MV8A 3CCRP 3A3YB 4PV1D 5APUA 1JCDA 1KYOI 2Q7CA 3V4QA 5L8RJ 1S3JA 2WT7B 5AVWB 2DW3A 1KORA 2LKMA 3LIEA 1BE3J 3S4RA 5APWA 1S72P 2QJKC 4UB8E 1VQKP 4N78E 2KNCA 3TGUD 2KB7P 3L35A 1X0TA 2V7QJ 5APVA 3D6ZA 3CD6P 2FXPA 3KHUA 5B5EE 3HE4B 4N3YB 1HTLC 3AEEC 3CXHD 2OYIA 1NTKJ 4GODA 1LP1B 3L71G 5DJUB 1S5LX 1ZLLA 1VQ4P 2JO1A 2YIUC 3CWBJ 5CJ4A 5AVYB
chains in the Genus database with same CATH topology
3H1JJ 1SQXJ 3TGUJ 1L0NJ 1SQBJ 1KB9I 4D6TJ 3L71J 4PD4I 2BCCJ 1NTKJ 1KYOI 3L70J 1P84I 3L73J 1NU1J 3H1IJ 1SQVJ 3CX5I 1NTZJ 3L72J 3L74J 3H1KJ 5KLVJ 3H1LJ 1L0LJ 1BCCJ 2IBZI 1SQPJ 3H1HJ 1SQQJ 4U3FJ 1BGYJ 1BE3J 1PP9J 3BCCJ 3CXHI 3CWBJ 1EZVI 1NTMJ 3L75J 2FYUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J J;  1SQX J;  3TGU J;  1L0N J;  1SQB J;  1KB9 I;  4D6T J;  3L71 J;  4PD4 I;  2BCC J;  1NTK J;  1KYO I;  3L70 J;  1P84 I;  3L73 J;  1NU1 J;  3H1I J;  1SQV J;  3CX5 I;  1NTZ J;  3L72 J;  3L74 J;  3H1K J;  5KLV J;  3H1L J;  1L0L J;  1BCC J;  2IBZ I;  1SQP J;  3H1H J;  1SQQ J;  4U3F J;  1BGY J;  1BE3 J;  1PP9 J;  3BCC J;  3CXH I;  3CWB J;  1EZV I;  1NTM J;  3L75 J;  2FYU J; 
#chains in the Genus database with same CATH topology
 1NKN A;  2B87 B;  2FYN B;  5APX A;  3TGU G;  1Q7Y Q;  1QL1 A;  3TGU E;  1FBM A;  1N7S D;  1L4A D;  2W8Z A;  5KLV J;  4MN4 C;  3V6I A;  2ZT9 D;  3EFG A;  2NZ2 A;  1ZW0 A;  3PRJ A;  3CL3 D;  1SQB J;  1LWU A;  1L0N K;  3CXH E;  1RQU A;  3I5C A;  3L70 J;  3CCS P;  5AVT B;  1N2D C;  1LT1 A;  1YIT P;  3VP8 A;  2FYZ A;  3VP9 A;  2O01 J;  2QJP B;  2M3B A;  1JMB A;  4ASW A;  3CPW O;  4H13 D;  3O6Q B;  3TSI A;  1SFC B;  1YJ9 P;  2P67 A;  1DEB A;  2QM8 A;  1RF0 C;  3E1R A;  2MKV A;  4U7J A;  3P7K A;  2NRG A;  2KS1 A;  4UB8 H;  2AEM A;  1ZV8 A;  1OVR A;  1QX8 A;  2HOD B;  5CCH C;  4WWI A;  2WSF H;  1KIL D;  1OWA A;  4KJM A;  4I6M C;  5CBO A;  2JDI H;  5B5E H;  5BVZ A;  1BE3 G;  2IYO A;  4AQR D;  4H44 D;  2JR8 A;  1VQO P;  1MZ9 A;  4I7Z B;  1FZB A;  1CW5 A;  3GHG B;  1QGK B;  3FXE A;  3AE6 C;  2WWW A;  5AW6 B;  2HLO A;  3HE4 A;  1SQQ K;  1FE6 A;  2JWD A;  3A0H E;  1LP1 A;  4R4L A;  3R4Y A;  3W67 A;  5KJ7 D;  1W2B O;  2E5Y A;  2M5A B;  1T2K D;  3LID A;  3Q3D A;  1IFJ A;  1VQP P;  1DEE G;  1SQP J;  2B87 A;  1L0L E;  4PJ0 E;  2WMM A;  1WMK A;  4R4M A;  1X9V A;  1L4A B;  3L37 A;  1NTZ J;  2ZT9 B;  3H1L J;  3MZW B;  3CC4 P;  1L0L K;  3FWL A;  3ZDM A;  4ZMD A;  4GIF A;  1PP9 D;  2JKV A;  2ZXE B;  2WPQ A;  1K73 Q;  1VL2 A;  4TLF A;  3L74 J;  1ZR2 A;  2H8P D;  1KFN A;  4BXL A;  4L75 A;  4RES B;  2J59 M;  3AEA C;  1SFC A;  3RK2 B;  1UII A;  4H13 B;  4JPZ B;  3KXD A;  2YO3 A;  3M06 A;  2FFD C;  3B4S A;  5EFW B;  1HGV A;  1PP9 G;  2A06 G;  1PP9 E;  4WY4 D;  3GF3 A;  4H0L C;  3B71 A;  3H32 B;  3C8V A;  1KZU B;  1N7L A;  3WUU A;  1LTB C;  2V7Q H;  3H1H J;  2LXC B;  2P58 A;  2OAR A;  1GDT A;  1KB9 I;  3JSV C;  3GHG A;  3CCV P;  4BRY B;  1P84 H;  1P84 I;  2P10 A;  3L73 J;  3KPE A;  1LT9 C;  5BU5 A;  4JYB A;  1YTZ T;  4K3A A;  5AVU B;  1PPJ G;  4CPG A;  2QIW A;  3CCL P;  2K1A A;  2FY8 A;  1N7S C;  5AW5 B;  4C7R A;  5GTI E;  3I55 P;  4UB6 E;  4WVZ A;  1KYO D;  3C1L A;  3IAO A;  1M7L A;  4ASV A;  1S4X A;  3G4S P;  3LW5 J;  1L4A A;  1M56 D;  2KLV A;  2O1J A;  2OQQ A;  1WT6 A;  3BCC D;  1OX3 A;  4C7N A;  2R5B A;  1T8Z A;  2P2U A;  1NKZ B;  1FZC B;  1M57 D;  3G9R A;  3GLM A;  2BCC E;  1BCC J;  3AEC C;  3F5H A;  3KDP B;  1OVV A;  1J1D C;  5CCH D;  1KMI Z;  2Y9Z A;  3M9B A;  4NPE A;  2N1T C;  2FXM A;  4GOE A;  1S9K D;  2IYP A;  1JMM A;  3OA7 A;  2IBZ I;  5H2F E;  3TNU B;  1SP4 A;  1BGY J;  1M1J C;  2QJK B;  3BCC E;  3P32 A;  2ZYD A;  3MGN A;  2KSJ A;  1KIL C;  4D6T D;  3SWY A;  2E76 C;  2QA4 P;  3MTU E;  3W68 A;  3GG2 A;  2BEZ F;  4QMA A;  1YQ4 C;  1QVF O;  3H32 A;  3PP5 A;  2M3E A;  1YQ3 C;  1RE4 A;  4H44 C;  1KQG B;  1RE3 C;  2CK3 H;  1NTM D;  2FYU E;  2Y9Y A;  1S5L H;  3KQG A;  1JY3 O;  2KK7 A;  3IF4 A;  1U7J A;  4L76 A;  3H1H G;  3TK1 A;  3HD7 D;  4BRY A;  1OMI A;  2WSC J;  4Y28 J;  4IFM A;  1L0N J;  2FYU K;  5KJ7 C;  1H0T B;  3T97 B;  3VMZ A;  5GTI H;  3ABV C;  3L75 D;  4D6T G;  1JY3 P;  3M91 A;  4UB6 H;  1T2K C;  4D6T E;  1LWU B;  3N4X A;  5AW9 B;  3CCU P;  1JUN A;  2YMY A;  1AJY A;  2C9L Y;  3OAK A;  4OWF A;  1FDI A;  2KI7 B;  2HR3 A;  3IFM A;  2AEJ A;  5AVZ B;  2E74 C;  1N73 C;  2E75 D;  3HUS C;  1NTM E;  4HKZ H;  1IFD A;  3N7N A;  4Y99 C;  2OYH C;  1T3U A;  2WVR A;  4ZKU A;  1K8A Q;  1Q2N A;  1HH0 A;  1FDM A;  3HE5 B;  3CI9 A;  4DJG A;  2L91 A;  1NTM K;  5TIS H;  1CSB A;  3WU2 E;  4OGQ D;  1FZC A;  2Q6Q A;  2YNY A;  3L75 G;  3L75 E;  2OTL P;  1KYO H;  2QSI A;  3RGU A;  5H2F H;  3A5T A;  3L71 D;  5KKZ C;  2O3J A;  2YO2 A;  3H25 A;  2SPZ A;  1FOS E;  1DD3 A;  2YXQ B;  1DIP A;  5APY A;  4H0L D;  3TNU A;  2QJY C;  3B8E B;  2Z4E A;  1NU1 D;  3BRT B;  1SQQ J;  1GTW A;  2RN0 A;  4WY4 C;  3L71 E;  1RQV A;  1SQV G;  1D7M A;  1JY2 N;  3B5N C;  1GK6 A;  2KSE A;  3VYI A;  4N6J A;  1IO4 A;  2IZ1 A;  4U3F D;  2WQY C;  1J1E C;  1H8A A;  2B89 A;  2Q3I A;  1BSH A;  2IFN A;  2KYV A;  1IFM A;  1NU1 G;  1IJD B;  1L0L J;  1NU1 E;  3V2Q A;  1YHQ P;  1IK9 A;  1H0T A;  3T97 A;  2GUV A;  3PLN A;  1GW3 A;  3VN0 A;  2E42 A;  1VQM P;  2N9B A;  1BDC A;  3H1I J;  1FS0 E;  3L72 J;  3SWF A;  1MUU A;  2Z5H A;  1UIX A;  3PJS K;  3WU2 H;  2BAS A;  3VOP A;  4U3F G;  3BAT A;  4K35 A;  4U3F E;  1BE3 D;  2XNX A;  3AE7 C;  4KHX A;  2C9N Y;  2KZI A;  2N1T D;  3HE5 A;  2ZYG A;  1KQF B;  2R44 A;  3IR9 A;  3CCE P;  1ZOY C;  3AE9 C;  2ZJS E;  2HYN A;  3A2A A;  1RF0 A;  2AXT H;  4PV1 B;  4HJG H;  2WPS A;  4JYC A;  1E5W A;  1KB9 D;  2FFD B;  3H1K J;  1NTK D;  2E76 D;  3G71 P;  1HWT C;  5AVX B;  1P84 D;  3P8M C;  1ZRT D;  1NYH A;  5CCH A;  2GM4 A;  3Q5P A;  1S2E A;  1EXJ A;  2P7J A;  1BE3 E;  3CWB D;  4H0L B;  3NMD A;  2H7H A;  1A02 F;  1JB0 J;  1AVY A;  5KLI C;  1KFM A;  4DCK A;  3VMA A;  1R8E A;  2C0X A;  5KAI H;  5CCG D;  2XV5 A;  1FZF A;  3H1J J;  3PTZ A;  3H6P A;  2WSE J;  1K05 A;  2HPC B;  2QRX A;  1IFP A;  1KIL E;  1H89 A;  1SQB D;  2LXB A;  1KB9 E;  1LT9 B;  1OVU A;  1G2C B;  1NTK G;  4LLH A;  1NTK E;  1P84 E;  1ZRT E;  1YI2 P;  5KTB A;  1H88 A;  5APQ A;  3HD7 C;  3AE5 C;  3CWB G;  3A0B E;  3CWB E;  2D2C D;  1RF1 C;  3FGA D;  1N7S B;  2E74 D;  2RKL A;  4AUW A;  4C7N B;  3NXS A;  4GDO A;  5KLV G;  1TU3 F;  2LR2 A;  5M1B A;  5AW2 B;  2FBW C;  2K3R A;  3P8C D;  2P1J A;  3CLQ A;  1IK7 A;  2IBZ D;  2E75 C;  2A06 D;  2BCC J;  1SQB G;  1FAV A;  3Q5S A;  3L70 G;  2NPS C;  3H1I G;  5AVV B;  1XTG B;  3I56 P;  2YKQ A;  2QG4 A;  2PGD A;  1VQ8 P;  4ZNC A;  4OGQ C;  3G3Z A;  5CBN A;  2QM7 A;  4NPD A;  4O9B A;  2YKP A;  3FXD A;  1FU1 A;  5B66 H;  2W83 C;  2XKM A;  4RO0 A;  5AW1 B;  1FZE A;  4W7Y A;  2I1J A;  3P8C E;  3BRV B;  2IBZ G;  1PPJ D;  2IBZ E;  2A06 E;  4GKG A;  3M0D C;  1KQS O;  1MFZ A;  1EDL A;  1KIL B;  2FFD A;  2Q9I A;  2E76 B;  3K5B A;  1RH5 B;  2ZVO B;  1PL5 A;  3M9Q A;  3B5N D;  2FYU J;  3O8Z A;  3GMA A;  4L74 A;  3ITK A;  2ZVN B;  4YTP C;  4H44 B;  5GTH H;  1KB9 H;  1NGM B;  1LNQ A;  4HB1 A;  2HFE D;  4I7Z C;  1K9M Q;  2A45 I;  1W5C E;  1S5L E;  4EIJ A;  1YBK A;  1NTZ D;  3A0B H;  2PFX A;  4IL6 H;  2HPC A;  3BAS A;  1PPJ E;  2OTJ P;  1YIJ P;  1KV4 A;  1LT9 A;  3H1J G;  1G2C A;  1Q86 Q;  4DT0 A;  3M0A A;  1G1J A;  2QE7 H;  1KD1 Q;  2O1K A;  2WZ7 A;  3SSU A;  1JNM A;  2V4H A;  3AE4 C;  5AW0 B;  1JCC A;  3L74 D;  4A7P A;  1NTM J;  1SQP G;  1N7S A;  1GU4 A;  1RHZ B;  1SQX J;  1MKM A;  2E74 B;  1N73 B;  3HUS B;  1AQT A;  1Q82 Q;  3MUD C;  1FJK A;  3RL0 g;  4Y99 B;  1ZP0 C;  1GK4 A;  3OJA B;  2OYH B;  2L5G B;  2KOG A;  1NTZ G;  2CPS A;  1NTZ E;  3H1L G;  4DOJ A;  5AW4 B;  1URQ C;  1PGP A;  1Y8A A;  2O01 H;  1EDI A;  1Q81 Q;  1AA0 A;  1EZV G;  3RL0 C;  2Q1K A;  3GF7 A;  1RY3 A;  2XND H;  1DH3 A;  5TIS E;  4IFD K;  1DX7 A;  2R32 A;  1KYO E;  2M8R A;  3L74 G;  4OVN F;  1OW8 A;  2RH0 A;  1OIP A;  3PHL A;  2OTK E;  3RK2 C;  2N1T A;  3H1H D;  1M8O B;  4YPC A;  3GW6 A;  1PGJ A;  2FXO A;  3AEB C;  1M1J A;  3UIA A;  1A02 J;  1PV3 A;  3V4W A;  3MD0 A;  1S1C X;  3QH9 A;  1PGQ A;  2JJL A;  1KIL A;  1LTJ C;  1VQL P;  2GA1 A;  4WY4 B;  3L71 J;  4PD4 I;  2I8D A;  4JBZ A;  2K9J A;  3AE1 C;  3FX0 A;  1S9K E;  1Y47 A;  5CCG C;  3F89 A;  1KTM A;  5APS A;  3B5N B;  1LTA C;  2YIU B;  1G1I A;  1RE3 A;  3S1K A;  3H1H E;  3TGU J;  4YXD C;  3E1I A;  1J1E B;  1HBW A;  2IZ0 A;  1ZR4 A;  2Y0D A;  2XU6 A;  4C46 A;  1QVG O;  3CC2 P;  3L73 G;  2Z5I A;  1PFI A;  5AVR B;  5KJ7 A;  3CCM P;  2WIT A;  1BCC D;  2WTY A;  2R3C A;  3U59 A;  3U1C A;  2W6A A;  2D2C C;  1MFT A;  2XZR A;  2Y0E A;  1L2P A;  1W2E A;  2H89 C;  3AE2 C;  2AXC A;  3BVH A;  2NPS D;  2MJZ A;  4W80 A;  2O01 N;  2IPP A;  1GL2 C;  2KZJ A;  1N73 A;  3HUS A;  1EZV I;  1PIX A;  1BSN A;  1OW6 A;  1VPC A;  1BGY D;  1SQX G;  2OYH A;  3AE8 C;  1LTS C;  3D70 A;  3SWK A;  1SQV D;  1BCC G;  1VF5 C;  1BCC E;  2M0B A;  1U7M A;  1KN7 A;  1LJ2 A;  2JP3 A;  4OH8 B;  2AXT E;  1IFN A;  2POH A;  1NOH A;  2E43 A;  3MP7 B;  5AW3 B;  4EDF A;  5K5G B;  3RK3 C;  1BGY G;  3MHV A;  1Z56 A;  1BGY E;  1JO5 A;  1AFO A;  2KP8 A;  3V2P A;  4Z1M H;  1LTT C;  1EC5 A;  5KLI B;  1L0N D;  4JF7 A;  2I1K A;  1HF9 A;  5C39 A;  2QEX P;  2OYI C;  3Q5R A;  2ZYA A;  4WY4 A;  1SQV E;  3L4F A;  5AVQ B;  4IOI H;  1JTH B;  1PZQ A;  1Y9B A;  4HH2 A;  5KAI E;  3C9I A;  1JY2 O;  1R5L A;  3V5B A;  2K37 A;  1SQV K;  3B5N A;  1FZA A;  3SFE C;  1JY2 P;  3KYQ A;  2W6B A;  5CJ0 A;  4I2L C;  1T6A A;  3HD7 B;  3E7K A;  1SS1 A;  3NFQ A;  1RF1 B;  4M3L A;  1ZXG A;  1L0N G;  3VTP C;  4EI2 A;  3AE3 C;  1L0N E;  1KQL A;  3CX5 H;  3CX5 I;  1LWU C;  1NU1 K;  4XE5 B;  5KAF H;  1LTI C;  3RBX A;  3LW5 H;  2CPB A;  1URQ D;  2E75 B;  1EDK A;  1IZN B;  3RL0 D;  2PP6 A;  2FKW B;  3EFF K;  1IC2 A;  2HG5 D;  1HVV A;  2NPS B;  3AEF C;  4RKU J;  4OGQ B;  5CHX A;  1SQQ D;  2B9B A;  3RK2 D;  3R2P A;  3KZI E;  2KLU A;  1SVF A;  2W27 A;  1FOS F;  5B66 E;  1PP9 J;  3G6E P;  1GZL A;  2AEF A;  3VMX A;  2WT7 A;  4LC1 A;  1Q90 D;  3U1A A;  3JC2 2;  1SLQ A;  3A7O A;  1QLE D;  2JWA A;  5KLV D;  1L0L D;  1GD2 E;  3TYY A;  1SQQ G;  1NJI Q;  1SQQ E;  4IFF A;  2J58 A;  3RBZ A;  1FZG A;  2WPR A;  1QL2 A;  5GTH E;  1GU5 A;  2KIK A;  1FC2 C;  1JTH A;  1M90 Q;  3L70 D;  1NAF A;  3H1I D;  1GMJ A;  2A45 G;  3L72 D;  1JM0 A;  2WSC H;  1USD A;  2VRS A;  3Q1M A;  1CI6 B;  2ZAE B;  2FYN C;  4IL6 E;  2IX7 C;  4XFJ A;  3II6 A;  1NTK K;  1AQ5 A;  1NVO A;  1X79 B;  3V2R A;  3TF5 A;  3HD7 A;  5CMZ A;  3HRN A;  2K9Y A;  1L0L G;  1GL2 D;  3CXH H;  3CXH I;  1RF1 A;  2PAJ A;  3SFD C;  5KLV E;  5BU8 B;  1HGZ A;  4RJT A;  1JOC A;  1EDJ A;  4B86 A;  1PGO A;  3WUT A;  1YJN P;  2KUB A;  1SQB E;  3JCU E;  2H43 A;  1JEK A;  1U57 A;  2YKO A;  3L70 E;  5KLV K;  3L72 G;  2Y0C A;  3H1I E;  3L72 E;  1URQ B;  2YMK A;  3H1K D;  3NTN A;  1VF5 D;  3KZI H;  1J1D B;  2QJP C;  3WMM 0;  3M9H A;  3RL0 B;  1SQB K;  2NPS A;  3CMA P;  1SFC C;  3WUV A;  2N1T B;  3FWN A;  4PD4 D;  5E79 E;  3HTK B;  1X22 A;  2K88 A;  3BCC J;  1M1J B;  3O6Q A;  1OZH A;  3S9O A;  3USS A;  3RK3 D;  4PV1 C;  3TDK A;  1E79 H;  2WSS H;  3H1J D;  1BDD A;  4I1L A;  2K9J B;  2HOD A;  1YTZ I;  3H1K G;  1T3J A;  3H1K E;  3M0D A;  2Q5U A;  1N86 A;  1LTJ B;  1VQN P;  1SQP D;  1VQ5 P;  4NPF X;  2B88 A;  3GHG C;  2A45 H;  4PD4 E;  2XDJ A;  3A0H H;  1NH4 A;  3CCJ P;  3H1L D;  3RK3 E;  2J5U A;  4D6T J;  2UWJ E;  3EQ2 A;  2H88 C;  5DJT B;  1EZV D;  3H1J E;  1VQ9 P;  1X8Y A;  3L36 A;  2BEQ D;  4WBA A;  2BCC D;  2ZFC A;  1ZN5 A;  4PJ0 H;  1CI6 A;  1HJ0 A;  4JQ0 D;  1QEX A;  1VQ7 P;  1KC8 Q;  2M5A A;  4EOT A;  1NHL A;  1SQP E;  2D2C B;  3JCU H;  3MIW A;  1L4A C;  4W7Z A;  2ZT9 C;  1GL2 B;  4LGD E;  1FJP A;  1OW7 A;  1SQP K;  3MUD A;  3H1L E;  5AW8 B;  3L75 J;  1USE A;  2WPV B;  2GUS A;  4GOF A;  1YJW P;  1EZV E;  2R3S A;  5E79 H;  3AED C;  1EQ7 A;  1OFC X;  2BCC G;  3CC7 P;  1AVO A;  1NTZ K;  1URQ A;  5KKZ B;  1VF5 B;  5AVS B;  3L74 E;  3IN6 A;  1VQ6 P;  4EYY Q;  2ITA A;  2JEE A;  4H13 C;  1WRG A;  2FYU D;  4YXW H;  1N8R Q;  1NO4 A;  2WSF J;  3HTK A;  2KNC B;  2QJY B;  2IFM A;  3V2N A;  3L73 D;  4WB4 A;  3PH0 A;  2N9Y B;  1CZQ A;  3RK3 B;  3BCC G;  1DD4 A;  2KXP B;  2PRR A;  1R5S A;  3AEG C;  1EXI A;  4PD4 H;  3OW2 O;  1SQV J;  1RE4 C;  4GT1 A;  2OYO A;  1VDF A;  2OYI B;  3D71 A;  3QWO C;  1LTJ A;  4KT0 J;  4ZKP A;  1XTC C;  3CX5 D;  1HJB A;  2QVA A;  1GW4 A;  2G3A A;  2WSE H;  2C0W A;  1ZME C;  2FYU G;  5AW7 B;  3CCQ P;  4BWN A;  5TJH A;  5CCG A;  1JY3 N;  1SQX D;  2W90 A;  1NU1 J;  3CME P;  1OXZ A;  2R5D A;  1J2J B;  1AV1 A;  1LGH B;  4TT3 H;  3Q2Y A;  4L73 A;  3D6Y A;  3L73 E;  1NWQ A;  1M1K Q;  4IL6 X;  4XA4 A;  2Q3E A;  2YXR B;  4AYC A;  2ZXX A;  2E5T A;  2RMZ A;  3CX5 E;  3VMY A;  4U3F J;  1YYC A;  1HUC A;  1K04 A;  5KAF E;  5APT A;  1NTM G;  3EWK A;  4N78 D;  1SQX E;  1GL2 A;  4DZO A;  2W6J H;  1FZC C;  1SFC D;  1FDO A;  4HYT B;  2G8Y A;  1NAY A;  1LTG C;  2OGU A;  2KS1 B;  1IFI A;  2IDB A;  1SQX K;  1MV8 A;  3CCR P;  3A3Y B;  4PV1 D;  5APU A;  1JCD A;  1KYO I;  2Q7C A;  3V4Q A;  5L8R J;  1S3J A;  2WT7 B;  5AVW B;  2DW3 A;  1KOR A;  2LKM A;  3LIE A;  1BE3 J;  3S4R A;  5APW A;  1S72 P;  2QJK C;  4UB8 E;  1VQK P;  4N78 E;  2KNC A;  3TGU D;  2KB7 P;  3L35 A;  1X0T A;  2V7Q J;  5APV A;  3D6Z A;  3CD6 P;  2FXP A;  3KHU A;  5B5E E;  3HE4 B;  4N3Y B;  1HTL C;  3AEE C;  3CXH D;  2OYI A;  1NTK J;  4GOD A;  1LP1 B;  3L71 G;  5DJU B;  1S5L X;  1ZLL A;  1VQ4 P;  2JO1 A;  2YIU C;  3CWB J;  5CJ4 A;  5AVY B; 
#chains in the Genus database with same CATH homology
 3H1J J;  1SQX J;  3TGU J;  1L0N J;  1SQB J;  1KB9 I;  4D6T J;  3L71 J;  4PD4 I;  2BCC J;  1NTK J;  1KYO I;  3L70 J;  1P84 I;  3L73 J;  1NU1 J;  3H1I J;  1SQV J;  3CX5 I;  1NTZ J;  3L72 J;  3L74 J;  3H1K J;  5KLV J;  3H1L J;  1L0L J;  1BCC J;  2IBZ I;  1SQP J;  3H1H J;  1SQQ J;  4U3F J;  1BGY J;  1BE3 J;  1PP9 J;  3BCC J;  3CXH I;  3CWB J;  1EZV I;  1NTM J;  3L75 J;  2FYU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...