1L0NJ

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 18
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0nJ00
1L0LJ 3CXHI 3CX5I 1BCCJ 3L74J 1BE3J 1EZVI 2FYUJ 4D6TJ 1P84I 1KYOI 2IBZI 3H1JJ 3CWBJ 3L71J 1SQPJ 3H1HJ 1SQQJ 1NTKJ 3L73J 1PP9J 1NTMJ 1NTZJ 5KLVJ 3H1LJ 1BGYJ 2BCCJ 3L70J 1SQBJ 4PD4I 1L0NJ 3H1IJ 3TGUJ 3H1KJ 3BCCJ 1NU1J 4U3FJ 1SQVJ 3L72J 3L75J 1SQXJ 1KB9I
chains in the Genus database with same CATH superfamily
5B66E 1RF0A 1IFIA 3CXHI 5AW5B 2FYUK 3VMZA 1LGHB 4IFDK 3V4WA 1NGMB 2P7JA 1J2JB 2MKVA 2R44A 2Z5HA 3A2AA 3EQ2A 1UIXA 2ZVOB 3MGNA 3W68A 4AQRD 2E76B 3G9RA 3M91A 1SQVG 1L4AC 2FXMA 1KD1Q 2E75B 5DJUB 4WB4A 3RL0B 2H8PD 3CMAP 2WSCJ 3GLMA 3EFGA 2KS1A 3LIEA 2O01J 4H0LD 1PP9D 2OYHA 1URQC 4DJGA 1CSBA 1K73Q 2YO2A 3O8ZA 4OVNF 1JB0J 1BGYD 2LKMA 4YPCA 2IBZD 3IN6A 3SFDC 4CPGA 3AE7C 4QMAA 1H88A 5CJ4A 2JO1A 2GA1A 4HKZH 3GHGB 1YHQP 1NTMG 4XE5B 2K9JB 3A0BH 4IOIH 2WSEH 1GK4A 1KFMA 2OTKE 1KILB 1H0TB 5APYA 1FDMA 4ZKPA 1KYOE 3ABVC 1OZHA 3WUTA 1YITP 1BCCE 3VYIA 1VQ6P 3TSIA 3H1HG 2N1TB 2J5UA 1UIIA 1CI6A 2M0BA 4WY4D 5APXA 1XTGB 3MIWA 4NPEA 1YTZI 4O9BA 1IFMA 1VF5D 3H1HD 3L72G 5K5GB 2IFNA 1M7LA 3A7OA 3VTPC 1ZP0C 1L0ND 3H1LJ 3H32B 4PJ0E 2PGDA 3V2NA 2OYIA 4PV1C 2B87B 1S3JA 2KSEA 3RBZA 4H13B 1YTZT 2A45G 2DW3A 3A0BE 4JPZB 5CCHD 1ZXGA 2KXPB 3CL3D 3P8CE 5KJ7D 3L75J 1KYOH 1VQLP 1KB9I 3E1RA 1AQTA 3TGUG 3V4QA 1NTKG 1QL2A 2FYUJ 2BASA 4N3YB 1KB9E 4PD4D 4JQ0D 3RK3B 3CX5E 5KLIB 5L8RJ 1PPJD 3B5NC 2G8YA 1GW3A 1NU1K 1KZUB 2HPCA 1LT9C 1TU3F 1DH3A 3L75D 4PJ0H 1RY3A 2M3BA 4U7JA 2H7HA 1YBKA 2QJYB 2P58A 1N86A 1NTMJ 1SQQK 2R5DA 3CX5D 5CJ0A 3SSUA 2A06E 5AVVB 2C9NY 1S1CX 2ZAEB 1RQUA 1M1JA 1NTKE 3CXHD 1S5LX 3GG2A 2FYNB 1SQBE 4W7YA 1OVUA 2OGUA 4XA4A 1Y8AA 1L0NJ 3MTUE 2E5YA 3H1IJ 1KMIZ 3H1KJ 1NU1J 4H0LC 3JSVC 1KILD 3AECC 5APTA 1AVYA 2J58A 4I2LC 1KB9H 2OYOA 1MUUA 1X0TA 5BU5A 3G4SP 1MFTA 3CX5H 1EDLA 1J1DB 2M8RA 2K37A 1VQ7P 1H8AA 3IFMA 1SQXG 5CCHA 3AE5C 3H1KE 5KKZB 2GUSA 1L0NE 2N9BA 2IBZI 3L72E 1IFDA 1EZVE 2ZFCA 5TJHA 5KLVK 1SQVK 3B5ND 2QEXP 1LTTC 3BCCG 2XU6A 1S5LH 1DEEG 3E1IA 1J1EC 4Z1MH 3CC2P 1AQ5A 2H89C 2M5AA 3TNUB 2Y0CA 2WVRA 4D6TG 1BCCD 2L91A 3C9IA 2I1JA 1FJKA 1KYOD 2E75D 3H32A 4K35A 4RO0A 1AFOA 1LTAC 2XV5A 3CLQA 1BGYJ 1LT1A 2E76D 2W6BA 5E79E 4OGQB 5BVZA 2ZYDA 3II6A 1SQBK 4HB1A 3CPWO 1FU1A 3AEDC 3MP7B 2E74C 2IX7C 2JP3A 2CPBA 1VQ8P 5C39A 1DEBA 2KI7B 1JCCA 1JY3P 1LWUC 1IFJA 1NAYA 1ZLLA 2YKPA 1M57D 3AE8C 2GUVA 2IBZE 2FBWC 3M0DA 3RK2B 2NPSC 1VQPP 1SQXJ 4D6TJ 1EXJA 1M1JC 3L74G 3L75G 1S5LE 3AEEC 3CWBE 3LW5H 3H1JD 4Y99C 1X9VA 1PP9E 4C7RA 1HUCA 1MZ9A 1PPJG 2FXOA 1SLQA 1W2EA 3AE1C 3HRNA 3NTNA 1A02J 4DZOA 1SQVE 3CWBJ 4H44D 2IYOA 3H1IG 3H1LE 1FE6A 3H1HJ 1LTJB 1IO4A 1X79B 3U59A 4XFJA 3NMDA 4WBAA 5E79H 3TGUD 1N7SB 2QE7H 3H1LD 5B5EH 2E75C 3PP5A 4R4MA 2ZXEB 4IL6H 1SQXK 1USDA 5GTHH 1CZQA 2N1TD 1NTZE 1NKNA 2UWJE 4L74A 4B86A 1IJDB 3U1CA 3IF4A 1A02F 1JY2N 4RKUJ 5H2FH 3JC22 5CCGC 2W6AA 3U1AA 1HJBA 4KJMA 4C7NA 2YIUB 3H1JG 3L73D 1IK9A 3FWNA 4HJGH 4IFFA 4RESB 3H25A 2IYPA 1MKMA 2KS1B 1OXZA 4L73A 5AVWB 2NPSD 3KDPB 2Y0EA 4GIFA 1LT9A 4ZMDA 3CX5I 1ZRTE 4DOJA 1KV4A 1ZR2A 2P1JA 2ZT9C 1RF1C 2ZJSE 3HD7D 3WMM0 2BCCG 5B5EE 1BE3D 2R32A 1NAFA 1SQPE 4IL6E 1DD4A 3IAOA 3RL0g 4U3FE 4OGQD 5GTHE 4C7NB 2OARA 1L0LK 3AE6C 2HLOA 3SFEC 1NWQA 1HBWA 2O01N 5H2FE 1KQGB 3L71D 3OJAB 5M1BA 1FAVA 1L2PA 1LP1B 3MHVA 2D2CB 1JY2O 2J59M 3M9QA 2FFDC 2IBZG 1PZQA 5KKZC 2I8DA 4BXLA 1BGYG 3BASA 3JCUE 1RE4C 1SQBJ 1EDIA 3I5CA 3TGUJ 5CCHC 2O3JA 2A45I 1URQD 1SQQG 3OW2O 1YIJP 1FZCC 1SFCA 2BEZF 1G2CB 4ASWA 1EXIA 3CCLP 1NHLA 5CBNA 3O6QB 4MN4C 3CCJP 1SQBD 1URQB 4I7ZB 1DIPA 1Q90D 2YKOA 2W6JH 5AW7B 1VQMP 2A06D 1Q86Q 1FZCA 3A0HH 4LC1A 1FZAA 1YI2P 1FC2C 3B5NB 1YYCA 1JY3O 1JEKA 4IL6X 1YJWP 1IK7A 3L75E 1G1JA 2FKWB 1NU1D 2XNXA 3EWKA 1NKZB 2KOGA 3JCUH 3KXDA 3M0AA 1GL2C 1MV8A 2KP8A 4EYYQ 1VF5C 1NO4A 1NTZK 5KLVJ 1IFNA 5KLVE 1KTMA 3AE3C 2K1AA 3LIDA 3M0DC 3Q5PA 1YJ9P 3D6YA 1HH0A 2JEEA 1N7LA 2JWAA 2R5BA 2XNDH 5TISE 1PFIA 1Q81Q 1EDJA 2QA4P 3Q5SA 3RK2D 2C0WA 3C1LA 2QJKC 3A0HE 5KJ7C 3RL0C 1PL5A 1SS1A 3KYQA 1BCCJ 3L74J 4L75A 4C46A 1DD3A 1EC5A 1KYOI 1P84I 4IFMA 4UB8E 3V2QA 2OYIB 2Q3EA 2M3EA 3L70E 3HTKB 3TF5A 1L0NG 2E5TA 3D70A 1JMBA 3L71E 2IFMA 2QJPC 1Q2NA 1QLED 3D71A 4U3FD 1L0LD 1MFZA 2AXCA 2KLVA 1SQPD 1SFCC 3B4SA 3HUSC 3QH9A 3Q5RA 1BE3E 1WRGA 4YXWH 3WU2E 1SQQE 3RK3E 4ZNCA 5TISH 3CD6P 1PV3A 3RBXA 1KILC 2OQQA 3CCUP 2YMKA 1ZRTD 3S4RA 1AVOA 3L37A 2V7QH 5AVXB 2QRXA 2B9BA 3IR9A 5CHXA 3BCCE 1K05A 1NH4A 2WPQA 2K9JA 2WWWA 3BCCJ 4U3FJ 5EFWB 4EIJA 3CCMP 2HPCB 2HODB 4UB8H 5AVRB 3S9OA 1E79H 3GHGA 3L35A 1ZMEC 1VQKP 3FXDA 3V5BA 2Q9IA 2WSEJ 1LNQA 1BE3J 3TDKA 2YNYA 1NTMK 3A3YB 1NTZD 4PV1B 2E43A 1GU5A 1URQA 2FXPA 2HFED 4H44C 4HYTB 3L71J 3WU2H 5GTIH 4H0LB 1N73B 4ZKUA 2H88C 3TGUE 2E76C 3M06A 1RE4A 1VDFA 3SWKA 2P2UA 1SQVD 1OVVA 2HODA 1GL2D 1WT6A 1FBMA 2A45H 2HYNA 3L74E 3Q3DA 1NTZJ 2WSCH 4NPDA 2K3RA 1VQNP 2JDIH 5AW6B 3CCQP 2NPSA 5KAFE 3H1JE 3VOPA 2B88A 5AW0B 2WTYA 3OA7A 5CCGA 1JO5A 2OTJP 3WUVA 1R5SA 2AEJA 1SQPG 2E74D 3B8EB 4H13C 1FZEA 3V6IA 1RE3A 2MJZA 1OMIA 1SQVJ 2KIKA 2G3AA 3WUUA 1EDKA 3GHGC 1GL2B 2KLUA 2KSJA 5AW1B 5GTIE 2IZ0A 4BRYB 2YO3A 1GU4A 2HG5D 3VMXA 1QL1A 2RMZA 2W8ZA 4WY4C 1EZVG 1BCCG 1T6AA 3HTKA 4D6TE 5CBOA 3L70G 2ZYAA 1SQQD 2YMYA 1FDIA 1T2KD 1FZGA 4AYCA 1LTJC 3GF7A 4JYCA 1LT9B 2Y9YA 2KK7A 2AEMA 1L4AB 5KAFH 3AE2C 5AVTB 5AVUB 1LJ2A 1SFCD 3H6PA 3L70D 3R4YA 2OYHC 3P32A 1EZVD 1LTBC 2WSFJ 1X8YA 4OH8B 3AE9C 5AW9B 3H1KD 2E42A 2Q3IA 2Q5UA 3PLNA 4TT3H 2BCCE 1YQ4C 2FYUD 1NJIQ 4LLHA 3CWBG 2YKQA 1JTHA 3HE4A 1N73A 2KB7P 4PD4H 2QG4A 3LW5J 3N4XA 1HGZA 2O1KA 4Y28J 3I55P 3CC4P 1KILE 2ZT9D 1S4XA 5APVA 3BRTB 2GM4A 1N7SA 3CCSP 3L72J 1OVRA 4EOTA 3Q1MA 4I6MC 2XZRA 2A06G 2D2CD 3V2RA 1YJNP 4YTPC 2ZXXA 3CXHE 3EFFK 5KLVD 3CCRP 2Y9ZA 2CPSA 1EQ7A 1DX7A 3F5HA 3Q2YA 1HF9A 3CI9A 1QVGO 3FWLA 1S9KE 1LTGC 4W80A 1SQPJ 1Y47A 1NU1E 2AXTE 3H1IE 1AJYA 3BVHA 1KORA 2QJYC 5KAIE 3PJSK 1PPJE 2AEFA 1M1JB 3BRVB 3P7KA 2Q6QA 1KB9D 4N6JA 4PD4E 1FJPA 4Y99B 3H1LG 1W2BO 2QM8A 3GMAA 4GT1A 2Z4EA 1QX8A 5AVQB 4GDOA 2C0XA 4PD4I 1S72P 2RKLA 2KUBA 1PIXA 1KFNA 3AEFC 1M1KQ 1ZN5A 2FY8A 2LXBA 3P8CD 2LXCB 4H13D 4R4LA 1N73C 1M90Q 1FZCB 1LWUB 3CXHH 1FZFA 5CMZA 3C8VA 3RK2C 2P67A 1JY2P 4N78E 1L0LJ 1D7MA 2BCCD 2FYUE 1PGOA 3UIAA 5KLVG 1JUNA 2AXTH 2IPPA 2N9YB 2QIWA 5APSA 2FFDB 2WSSH 2QSIA 4GODA 1L4AD 5KAIH 1N8RQ 2OYIC 2YIUC 3FX0A 3H1HE 1VL2A 1GTWA 3KQGA 1J1EB 1RH5B 5AVYB 2WMMA 1FOSE 1PP9J 3L73G 1HVVA 1LWUA 3CMEP 1H89A 2K88A 2FYUG 2WSFH 2XDJA 2NRGA 4AUWA 1GW4A 1NVOA 1SQXE 5KTBA 4D6TD 5KJ7A 1RF1B 1NTMD 2PRRA 4I7ZC 2R3SA 3NXSA 3RK3D 1SP4A 2E74B 3VP9A 4GOEA 1IC2A 1G1IA 1FS0E 3G71P 2Q7CA 2KNCA 1KN7A 1KC8Q 2ZVNB 2QJKB 3CC7P 3L73E 2IZ1A 1BGYE 3L36A 1PP9G 2NPSB 1OW7A 3RL0D 1LTJA 2WQYC 2D2CC 3M9BA 3VP8A 1EZVI 2FYNC 3M9HA 2QM7A 3R2PA 1K8AQ 1Q7YQ 3L4FA 1HGVA 2K9YA 3L74D 3P8MC 1KQSO 1RF1A 1QVFO 1U7MA 2R3CA 4KT0J 1X22A 1P84H 2QJPB 3ITKA 1K9MQ 1SQPK 2N1TC 1PGJA 3AEGC 1XTCC 1GL2A 3L73J 3PTZA 2M5AB 2L5GB 2WPSA 3TNUA 1N7SD 1VQOP 1J1DC 1FZBA 2KNCB 1NOHA 2ZYGA 1GMJA 3FGAD 3CCEP 1SVFA 1HWTC 1RF0C 4KHXA 3PH0A 2PAJA 1JM0A 3S1KA 3CWBD 1SQBG 1JNMA 5KLIC 1G2CA 3W67A 3RGUA 5APWA 3O6QA 3VMAA 3G6EP 3FXEA 1AA0A 2B89A 4JF7A 3HD7C 1LTSC 3BCCD 3B71A 3MUDC 1ZOYC 5BU8B 1Y9BA 3KZIE 1IFPA 1NTKJ 3E7KA 1FDOA 3PHLA 1CI6B 1P84E 2QVAA 1OIPA 3MZWB 1NTZG 1L0NK 1NTME 5DJTB 1GZLA 4OGQC 1BSHA 1SQXD 1T3JA 5AW4B 1NYHA 1T2KC 4H44B 3H1JJ 2FFDA 2Y0DA 1FOSF 1L0LE 2O01H 1N2DC 4BRYA 4UB6E 3L71G 1Z56A 1BSNA 3HUSA 1N7SC 1Q82Q 3VMYA 4OWFA 1KQFB 1ZW0A 2H43A 1USEA 5AW2B 2JJLA 1NTKK 4W7ZA 2NZ2A 1BE3G 3AE4C 3L72D 3USSA 2XKMA 2WZ7A 1QGKB 1CW5A 1PGQA 1JOCA 1L4AA 1ZV8A 2LR2A 2SPZA 4N78D 2KYVA 3KZIH 4PV1D 4WY4A 3HE5B 4WVZA 3NFQA 4U3FG 1RQVA 1M56D 1JTHB 3GF3A 1W5CE 2JWDA 3HE4B 2BEQD 4M3LA 1GK6A 3HD7A 4JBZA 3G3ZA 5AW3B 3TYYA 1BDCA 1AV1A 3HUSB 4L76A 1RE3C 1HTLC 3OAKA 3T97B 1K04A 1OW8A 4UB6H 3TK1A 3SWFA 1NTKD 1KQLA 3AEAC 1E5WA 2V4HA 1OWAA 3A5TA 2O1JA 5AVZB 2Z5IA 1HJ0A 1SQQJ 3B5NA 2KZJA 3H1ID 5APQA 2WT7B 3MUDA 4K3AA 4EDFA 1VQ9P 1S9KD 2OYHB 3V2PA 2N1TA 2YXRB 1R8EA 1BDDA 3BATA 1QEXA 4I1LA 2BCCJ 2KZIA 3L70J 1WMKA 2B87A 2I1KA 2ITAA 4GOFA 1R5LA 2P10A 2W90A 2JKVA 1GD2E 1IZNB 2PFXA 1NU1G 1YQ3C 4HH2A 3ZDMA 5APUA 1M8OB 4ASVA 1VQ5P 1VPCA 2JR8A 4DT0A 4TLFA 3KHUA 1L0LG 2WT7A 2IDBA 4EI2A 1ZR4A 2CK3H 2OTLP 3QWOC 1LP1A 4WWIA 3VN0A 3KPEA 1S2EA 2WPVB 2C9LY 2RH0A 3H1KG 2RN0A 1KILA 1H0TA 5B66H 2W27A 1PGPA 2WITA 3HE5A 1JMMA 2PP6A 4LGDE 3SWYA 1OFCX 4DCKA 1T3UA 3HD7B 1SFCB 1U57A 1VF5B 2Q1KA 3GW6A 2VRSA 1OX3A 3CCVP 4YXDC 3T97A 1T8ZA 2ZT9B 4JYBA 5AVSB 4RJTA 4WY4B 1VQ4P 3D6ZA 3RK3C 3K5BA 1P84D 2WPRA 1JCDA 2FYZA 3PRJA 2POHA 1U7JA 4NPFX 1OW6A 2HR3A 3AEBC 1GDTA 1RHZB 2W83C 2V7QJ 3I56P 3F89A 5CCGD 3N7NA 1LTIC 4GKGA 5AW8B 2YXQB 1JY3N 3MD0A 4A7PA 4BWNA
chains in the Genus database with same CATH topology
1L0LJ 3CXHI 3CX5I 1BCCJ 3L74J 1BE3J 1EZVI 2FYUJ 4D6TJ 1P84I 1KYOI 2IBZI 3H1JJ 3CWBJ 3L71J 1SQPJ 3H1HJ 1SQQJ 1NTKJ 3L73J 1PP9J 1NTMJ 1NTZJ 5KLVJ 3H1LJ 1BGYJ 2BCCJ 3L70J 1SQBJ 4PD4I 1L0NJ 3H1IJ 3TGUJ 3H1KJ 3BCCJ 1NU1J 4U3FJ 1SQVJ 3L72J 3L75J 1SQXJ 1KB9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L J;  3CXH I;  3CX5 I;  1BCC J;  3L74 J;  1BE3 J;  1EZV I;  2FYU J;  4D6T J;  1P84 I;  1KYO I;  2IBZ I;  3H1J J;  3CWB J;  3L71 J;  1SQP J;  3H1H J;  1SQQ J;  1NTK J;  3L73 J;  1PP9 J;  1NTM J;  1NTZ J;  5KLV J;  3H1L J;  1BGY J;  2BCC J;  3L70 J;  1SQB J;  4PD4 I;  1L0N J;  3H1I J;  3TGU J;  3H1K J;  3BCC J;  1NU1 J;  4U3F J;  1SQV J;  3L72 J;  3L75 J;  1SQX J;  1KB9 I; 
#chains in the Genus database with same CATH topology
 5B66 E;  1RF0 A;  1IFI A;  3CXH I;  5AW5 B;  2FYU K;  3VMZ A;  1LGH B;  4IFD K;  3V4W A;  1NGM B;  2P7J A;  1J2J B;  2MKV A;  2R44 A;  2Z5H A;  3A2A A;  3EQ2 A;  1UIX A;  2ZVO B;  3MGN A;  3W68 A;  4AQR D;  2E76 B;  3G9R A;  3M91 A;  1SQV G;  1L4A C;  2FXM A;  1KD1 Q;  2E75 B;  5DJU B;  4WB4 A;  3RL0 B;  2H8P D;  3CMA P;  2WSC J;  3GLM A;  3EFG A;  2KS1 A;  3LIE A;  2O01 J;  4H0L D;  1PP9 D;  2OYH A;  1URQ C;  4DJG A;  1CSB A;  1K73 Q;  2YO2 A;  3O8Z A;  4OVN F;  1JB0 J;  1BGY D;  2LKM A;  4YPC A;  2IBZ D;  3IN6 A;  3SFD C;  4CPG A;  3AE7 C;  4QMA A;  1H88 A;  5CJ4 A;  2JO1 A;  2GA1 A;  4HKZ H;  3GHG B;  1YHQ P;  1NTM G;  4XE5 B;  2K9J B;  3A0B H;  4IOI H;  2WSE H;  1GK4 A;  1KFM A;  2OTK E;  1KIL B;  1H0T B;  5APY A;  1FDM A;  4ZKP A;  1KYO E;  3ABV C;  1OZH A;  3WUT A;  1YIT P;  1BCC E;  3VYI A;  1VQ6 P;  3TSI A;  3H1H G;  2N1T B;  2J5U A;  1UII A;  1CI6 A;  2M0B A;  4WY4 D;  5APX A;  1XTG B;  3MIW A;  4NPE A;  1YTZ I;  4O9B A;  1IFM A;  1VF5 D;  3H1H D;  3L72 G;  5K5G B;  2IFN A;  1M7L A;  3A7O A;  3VTP C;  1ZP0 C;  1L0N D;  3H1L J;  3H32 B;  4PJ0 E;  2PGD A;  3V2N A;  2OYI A;  4PV1 C;  2B87 B;  1S3J A;  2KSE A;  3RBZ A;  4H13 B;  1YTZ T;  2A45 G;  2DW3 A;  3A0B E;  4JPZ B;  5CCH D;  1ZXG A;  2KXP B;  3CL3 D;  3P8C E;  5KJ7 D;  3L75 J;  1KYO H;  1VQL P;  1KB9 I;  3E1R A;  1AQT A;  3TGU G;  3V4Q A;  1NTK G;  1QL2 A;  2FYU J;  2BAS A;  4N3Y B;  1KB9 E;  4PD4 D;  4JQ0 D;  3RK3 B;  3CX5 E;  5KLI B;  5L8R J;  1PPJ D;  3B5N C;  2G8Y A;  1GW3 A;  1NU1 K;  1KZU B;  2HPC A;  1LT9 C;  1TU3 F;  1DH3 A;  3L75 D;  4PJ0 H;  1RY3 A;  2M3B A;  4U7J A;  2H7H A;  1YBK A;  2QJY B;  2P58 A;  1N86 A;  1NTM J;  1SQQ K;  2R5D A;  3CX5 D;  5CJ0 A;  3SSU A;  2A06 E;  5AVV B;  2C9N Y;  1S1C X;  2ZAE B;  1RQU A;  1M1J A;  1NTK E;  3CXH D;  1S5L X;  3GG2 A;  2FYN B;  1SQB E;  4W7Y A;  1OVU A;  2OGU A;  4XA4 A;  1Y8A A;  1L0N J;  3MTU E;  2E5Y A;  3H1I J;  1KMI Z;  3H1K J;  1NU1 J;  4H0L C;  3JSV C;  1KIL D;  3AEC C;  5APT A;  1AVY A;  2J58 A;  4I2L C;  1KB9 H;  2OYO A;  1MUU A;  1X0T A;  5BU5 A;  3G4S P;  1MFT A;  3CX5 H;  1EDL A;  1J1D B;  2M8R A;  2K37 A;  1VQ7 P;  1H8A A;  3IFM A;  1SQX G;  5CCH A;  3AE5 C;  3H1K E;  5KKZ B;  2GUS A;  1L0N E;  2N9B A;  2IBZ I;  3L72 E;  1IFD A;  1EZV E;  2ZFC A;  5TJH A;  5KLV K;  1SQV K;  3B5N D;  2QEX P;  1LTT C;  3BCC G;  2XU6 A;  1S5L H;  1DEE G;  3E1I A;  1J1E C;  4Z1M H;  3CC2 P;  1AQ5 A;  2H89 C;  2M5A A;  3TNU B;  2Y0C A;  2WVR A;  4D6T G;  1BCC D;  2L91 A;  3C9I A;  2I1J A;  1FJK A;  1KYO D;  2E75 D;  3H32 A;  4K35 A;  4RO0 A;  1AFO A;  1LTA C;  2XV5 A;  3CLQ A;  1BGY J;  1LT1 A;  2E76 D;  2W6B A;  5E79 E;  4OGQ B;  5BVZ A;  2ZYD A;  3II6 A;  1SQB K;  4HB1 A;  3CPW O;  1FU1 A;  3AED C;  3MP7 B;  2E74 C;  2IX7 C;  2JP3 A;  2CPB A;  1VQ8 P;  5C39 A;  1DEB A;  2KI7 B;  1JCC A;  1JY3 P;  1LWU C;  1IFJ A;  1NAY A;  1ZLL A;  2YKP A;  1M57 D;  3AE8 C;  2GUV A;  2IBZ E;  2FBW C;  3M0D A;  3RK2 B;  2NPS C;  1VQP P;  1SQX J;  4D6T J;  1EXJ A;  1M1J C;  3L74 G;  3L75 G;  1S5L E;  3AEE C;  3CWB E;  3LW5 H;  3H1J D;  4Y99 C;  1X9V A;  1PP9 E;  4C7R A;  1HUC A;  1MZ9 A;  1PPJ G;  2FXO A;  1SLQ A;  1W2E A;  3AE1 C;  3HRN A;  3NTN A;  1A02 J;  4DZO A;  1SQV E;  3CWB J;  4H44 D;  2IYO A;  3H1I G;  3H1L E;  1FE6 A;  3H1H J;  1LTJ B;  1IO4 A;  1X79 B;  3U59 A;  4XFJ A;  3NMD A;  4WBA A;  5E79 H;  3TGU D;  1N7S B;  2QE7 H;  3H1L D;  5B5E H;  2E75 C;  3PP5 A;  4R4M A;  2ZXE B;  4IL6 H;  1SQX K;  1USD A;  5GTH H;  1CZQ A;  2N1T D;  1NTZ E;  1NKN A;  2UWJ E;  4L74 A;  4B86 A;  1IJD B;  3U1C A;  3IF4 A;  1A02 F;  1JY2 N;  4RKU J;  5H2F H;  3JC2 2;  5CCG C;  2W6A A;  3U1A A;  1HJB A;  4KJM A;  4C7N A;  2YIU B;  3H1J G;  3L73 D;  1IK9 A;  3FWN A;  4HJG H;  4IFF A;  4RES B;  3H25 A;  2IYP A;  1MKM A;  2KS1 B;  1OXZ A;  4L73 A;  5AVW B;  2NPS D;  3KDP B;  2Y0E A;  4GIF A;  1LT9 A;  4ZMD A;  3CX5 I;  1ZRT E;  4DOJ A;  1KV4 A;  1ZR2 A;  2P1J A;  2ZT9 C;  1RF1 C;  2ZJS E;  3HD7 D;  3WMM 0;  2BCC G;  5B5E E;  1BE3 D;  2R32 A;  1NAF A;  1SQP E;  4IL6 E;  1DD4 A;  3IAO A;  3RL0 g;  4U3F E;  4OGQ D;  5GTH E;  4C7N B;  2OAR A;  1L0L K;  3AE6 C;  2HLO A;  3SFE C;  1NWQ A;  1HBW A;  2O01 N;  5H2F E;  1KQG B;  3L71 D;  3OJA B;  5M1B A;  1FAV A;  1L2P A;  1LP1 B;  3MHV A;  2D2C B;  1JY2 O;  2J59 M;  3M9Q A;  2FFD C;  2IBZ G;  1PZQ A;  5KKZ C;  2I8D A;  4BXL A;  1BGY G;  3BAS A;  3JCU E;  1RE4 C;  1SQB J;  1EDI A;  3I5C A;  3TGU J;  5CCH C;  2O3J A;  2A45 I;  1URQ D;  1SQQ G;  3OW2 O;  1YIJ P;  1FZC C;  1SFC A;  2BEZ F;  1G2C B;  4ASW A;  1EXI A;  3CCL P;  1NHL A;  5CBN A;  3O6Q B;  4MN4 C;  3CCJ P;  1SQB D;  1URQ B;  4I7Z B;  1DIP A;  1Q90 D;  2YKO A;  2W6J H;  5AW7 B;  1VQM P;  2A06 D;  1Q86 Q;  1FZC A;  3A0H H;  4LC1 A;  1FZA A;  1YI2 P;  1FC2 C;  3B5N B;  1YYC A;  1JY3 O;  1JEK A;  4IL6 X;  1YJW P;  1IK7 A;  3L75 E;  1G1J A;  2FKW B;  1NU1 D;  2XNX A;  3EWK A;  1NKZ B;  2KOG A;  3JCU H;  3KXD A;  3M0A A;  1GL2 C;  1MV8 A;  2KP8 A;  4EYY Q;  1VF5 C;  1NO4 A;  1NTZ K;  5KLV J;  1IFN A;  5KLV E;  1KTM A;  3AE3 C;  2K1A A;  3LID A;  3M0D C;  3Q5P A;  1YJ9 P;  3D6Y A;  1HH0 A;  2JEE A;  1N7L A;  2JWA A;  2R5B A;  2XND H;  5TIS E;  1PFI A;  1Q81 Q;  1EDJ A;  2QA4 P;  3Q5S A;  3RK2 D;  2C0W A;  3C1L A;  2QJK C;  3A0H E;  5KJ7 C;  3RL0 C;  1PL5 A;  1SS1 A;  3KYQ A;  1BCC J;  3L74 J;  4L75 A;  4C46 A;  1DD3 A;  1EC5 A;  1KYO I;  1P84 I;  4IFM A;  4UB8 E;  3V2Q A;  2OYI B;  2Q3E A;  2M3E A;  3L70 E;  3HTK B;  3TF5 A;  1L0N G;  2E5T A;  3D70 A;  1JMB A;  3L71 E;  2IFM A;  2QJP C;  1Q2N A;  1QLE D;  3D71 A;  4U3F D;  1L0L D;  1MFZ A;  2AXC A;  2KLV A;  1SQP D;  1SFC C;  3B4S A;  3HUS C;  3QH9 A;  3Q5R A;  1BE3 E;  1WRG A;  4YXW H;  3WU2 E;  1SQQ E;  3RK3 E;  4ZNC A;  5TIS H;  3CD6 P;  1PV3 A;  3RBX A;  1KIL C;  2OQQ A;  3CCU P;  2YMK A;  1ZRT D;  3S4R A;  1AVO A;  3L37 A;  2V7Q H;  5AVX B;  2QRX A;  2B9B A;  3IR9 A;  5CHX A;  3BCC E;  1K05 A;  1NH4 A;  2WPQ A;  2K9J A;  2WWW A;  3BCC J;  4U3F J;  5EFW B;  4EIJ A;  3CCM P;  2HPC B;  2HOD B;  4UB8 H;  5AVR B;  3S9O A;  1E79 H;  3GHG A;  3L35 A;  1ZME C;  1VQK P;  3FXD A;  3V5B A;  2Q9I A;  2WSE J;  1LNQ A;  1BE3 J;  3TDK A;  2YNY A;  1NTM K;  3A3Y B;  1NTZ D;  4PV1 B;  2E43 A;  1GU5 A;  1URQ A;  2FXP A;  2HFE D;  4H44 C;  4HYT B;  3L71 J;  3WU2 H;  5GTI H;  4H0L B;  1N73 B;  4ZKU A;  2H88 C;  3TGU E;  2E76 C;  3M06 A;  1RE4 A;  1VDF A;  3SWK A;  2P2U A;  1SQV D;  1OVV A;  2HOD A;  1GL2 D;  1WT6 A;  1FBM A;  2A45 H;  2HYN A;  3L74 E;  3Q3D A;  1NTZ J;  2WSC H;  4NPD A;  2K3R A;  1VQN P;  2JDI H;  5AW6 B;  3CCQ P;  2NPS A;  5KAF E;  3H1J E;  3VOP A;  2B88 A;  5AW0 B;  2WTY A;  3OA7 A;  5CCG A;  1JO5 A;  2OTJ P;  3WUV A;  1R5S A;  2AEJ A;  1SQP G;  2E74 D;  3B8E B;  4H13 C;  1FZE A;  3V6I A;  1RE3 A;  2MJZ A;  1OMI A;  1SQV J;  2KIK A;  2G3A A;  3WUU A;  1EDK A;  3GHG C;  1GL2 B;  2KLU A;  2KSJ A;  5AW1 B;  5GTI E;  2IZ0 A;  4BRY B;  2YO3 A;  1GU4 A;  2HG5 D;  3VMX A;  1QL1 A;  2RMZ A;  2W8Z A;  4WY4 C;  1EZV G;  1BCC G;  1T6A A;  3HTK A;  4D6T E;  5CBO A;  3L70 G;  2ZYA A;  1SQQ D;  2YMY A;  1FDI A;  1T2K D;  1FZG A;  4AYC A;  1LTJ C;  3GF7 A;  4JYC A;  1LT9 B;  2Y9Y A;  2KK7 A;  2AEM A;  1L4A B;  5KAF H;  3AE2 C;  5AVT B;  5AVU B;  1LJ2 A;  1SFC D;  3H6P A;  3L70 D;  3R4Y A;  2OYH C;  3P32 A;  1EZV D;  1LTB C;  2WSF J;  1X8Y A;  4OH8 B;  3AE9 C;  5AW9 B;  3H1K D;  2E42 A;  2Q3I A;  2Q5U A;  3PLN A;  4TT3 H;  2BCC E;  1YQ4 C;  2FYU D;  1NJI Q;  4LLH A;  3CWB G;  2YKQ A;  1JTH A;  3HE4 A;  1N73 A;  2KB7 P;  4PD4 H;  2QG4 A;  3LW5 J;  3N4X A;  1HGZ A;  2O1K A;  4Y28 J;  3I55 P;  3CC4 P;  1KIL E;  2ZT9 D;  1S4X A;  5APV A;  3BRT B;  2GM4 A;  1N7S A;  3CCS P;  3L72 J;  1OVR A;  4EOT A;  3Q1M A;  4I6M C;  2XZR A;  2A06 G;  2D2C D;  3V2R A;  1YJN P;  4YTP C;  2ZXX A;  3CXH E;  3EFF K;  5KLV D;  3CCR P;  2Y9Z A;  2CPS A;  1EQ7 A;  1DX7 A;  3F5H A;  3Q2Y A;  1HF9 A;  3CI9 A;  1QVG O;  3FWL A;  1S9K E;  1LTG C;  4W80 A;  1SQP J;  1Y47 A;  1NU1 E;  2AXT E;  3H1I E;  1AJY A;  3BVH A;  1KOR A;  2QJY C;  5KAI E;  3PJS K;  1PPJ E;  2AEF A;  1M1J B;  3BRV B;  3P7K A;  2Q6Q A;  1KB9 D;  4N6J A;  4PD4 E;  1FJP A;  4Y99 B;  3H1L G;  1W2B O;  2QM8 A;  3GMA A;  4GT1 A;  2Z4E A;  1QX8 A;  5AVQ B;  4GDO A;  2C0X A;  4PD4 I;  1S72 P;  2RKL A;  2KUB A;  1PIX A;  1KFN A;  3AEF C;  1M1K Q;  1ZN5 A;  2FY8 A;  2LXB A;  3P8C D;  2LXC B;  4H13 D;  4R4L A;  1N73 C;  1M90 Q;  1FZC B;  1LWU B;  3CXH H;  1FZF A;  5CMZ A;  3C8V A;  3RK2 C;  2P67 A;  1JY2 P;  4N78 E;  1L0L J;  1D7M A;  2BCC D;  2FYU E;  1PGO A;  3UIA A;  5KLV G;  1JUN A;  2AXT H;  2IPP A;  2N9Y B;  2QIW A;  5APS A;  2FFD B;  2WSS H;  2QSI A;  4GOD A;  1L4A D;  5KAI H;  1N8R Q;  2OYI C;  2YIU C;  3FX0 A;  3H1H E;  1VL2 A;  1GTW A;  3KQG A;  1J1E B;  1RH5 B;  5AVY B;  2WMM A;  1FOS E;  1PP9 J;  3L73 G;  1HVV A;  1LWU A;  3CME P;  1H89 A;  2K88 A;  2FYU G;  2WSF H;  2XDJ A;  2NRG A;  4AUW A;  1GW4 A;  1NVO A;  1SQX E;  5KTB A;  4D6T D;  5KJ7 A;  1RF1 B;  1NTM D;  2PRR A;  4I7Z C;  2R3S A;  3NXS A;  3RK3 D;  1SP4 A;  2E74 B;  3VP9 A;  4GOE A;  1IC2 A;  1G1I A;  1FS0 E;  3G71 P;  2Q7C A;  2KNC A;  1KN7 A;  1KC8 Q;  2ZVN B;  2QJK B;  3CC7 P;  3L73 E;  2IZ1 A;  1BGY E;  3L36 A;  1PP9 G;  2NPS B;  1OW7 A;  3RL0 D;  1LTJ A;  2WQY C;  2D2C C;  3M9B A;  3VP8 A;  1EZV I;  2FYN C;  3M9H A;  2QM7 A;  3R2P A;  1K8A Q;  1Q7Y Q;  3L4F A;  1HGV A;  2K9Y A;  3L74 D;  3P8M C;  1KQS O;  1RF1 A;  1QVF O;  1U7M A;  2R3C A;  4KT0 J;  1X22 A;  1P84 H;  2QJP B;  3ITK A;  1K9M Q;  1SQP K;  2N1T C;  1PGJ A;  3AEG C;  1XTC C;  1GL2 A;  3L73 J;  3PTZ A;  2M5A B;  2L5G B;  2WPS A;  3TNU A;  1N7S D;  1VQO P;  1J1D C;  1FZB A;  2KNC B;  1NOH A;  2ZYG A;  1GMJ A;  3FGA D;  3CCE P;  1SVF A;  1HWT C;  1RF0 C;  4KHX A;  3PH0 A;  2PAJ A;  1JM0 A;  3S1K A;  3CWB D;  1SQB G;  1JNM A;  5KLI C;  1G2C A;  3W67 A;  3RGU A;  5APW A;  3O6Q A;  3VMA A;  3G6E P;  3FXE A;  1AA0 A;  2B89 A;  4JF7 A;  3HD7 C;  1LTS C;  3BCC D;  3B71 A;  3MUD C;  1ZOY C;  5BU8 B;  1Y9B A;  3KZI E;  1IFP A;  1NTK J;  3E7K A;  1FDO A;  3PHL A;  1CI6 B;  1P84 E;  2QVA A;  1OIP A;  3MZW B;  1NTZ G;  1L0N K;  1NTM E;  5DJT B;  1GZL A;  4OGQ C;  1BSH A;  1SQX D;  1T3J A;  5AW4 B;  1NYH A;  1T2K C;  4H44 B;  3H1J J;  2FFD A;  2Y0D A;  1FOS F;  1L0L E;  2O01 H;  1N2D C;  4BRY A;  4UB6 E;  3L71 G;  1Z56 A;  1BSN A;  3HUS A;  1N7S C;  1Q82 Q;  3VMY A;  4OWF A;  1KQF B;  1ZW0 A;  2H43 A;  1USE A;  5AW2 B;  2JJL A;  1NTK K;  4W7Z A;  2NZ2 A;  1BE3 G;  3AE4 C;  3L72 D;  3USS A;  2XKM A;  2WZ7 A;  1QGK B;  1CW5 A;  1PGQ A;  1JOC A;  1L4A A;  1ZV8 A;  2LR2 A;  2SPZ A;  4N78 D;  2KYV A;  3KZI H;  4PV1 D;  4WY4 A;  3HE5 B;  4WVZ A;  3NFQ A;  4U3F G;  1RQV A;  1M56 D;  1JTH B;  3GF3 A;  1W5C E;  2JWD A;  3HE4 B;  2BEQ D;  4M3L A;  1GK6 A;  3HD7 A;  4JBZ A;  3G3Z A;  5AW3 B;  3TYY A;  1BDC A;  1AV1 A;  3HUS B;  4L76 A;  1RE3 C;  1HTL C;  3OAK A;  3T97 B;  1K04 A;  1OW8 A;  4UB6 H;  3TK1 A;  3SWF A;  1NTK D;  1KQL A;  3AEA C;  1E5W A;  2V4H A;  1OWA A;  3A5T A;  2O1J A;  5AVZ B;  2Z5I A;  1HJ0 A;  1SQQ J;  3B5N A;  2KZJ A;  3H1I D;  5APQ A;  2WT7 B;  3MUD A;  4K3A A;  4EDF A;  1VQ9 P;  1S9K D;  2OYH B;  3V2P A;  2N1T A;  2YXR B;  1R8E A;  1BDD A;  3BAT A;  1QEX A;  4I1L A;  2BCC J;  2KZI A;  3L70 J;  1WMK A;  2B87 A;  2I1K A;  2ITA A;  4GOF A;  1R5L A;  2P10 A;  2W90 A;  2JKV A;  1GD2 E;  1IZN B;  2PFX A;  1NU1 G;  1YQ3 C;  4HH2 A;  3ZDM A;  5APU A;  1M8O B;  4ASV A;  1VQ5 P;  1VPC A;  2JR8 A;  4DT0 A;  4TLF A;  3KHU A;  1L0L G;  2WT7 A;  2IDB A;  4EI2 A;  1ZR4 A;  2CK3 H;  2OTL P;  3QWO C;  1LP1 A;  4WWI A;  3VN0 A;  3KPE A;  1S2E A;  2WPV B;  2C9L Y;  2RH0 A;  3H1K G;  2RN0 A;  1KIL A;  1H0T A;  5B66 H;  2W27 A;  1PGP A;  2WIT A;  3HE5 A;  1JMM A;  2PP6 A;  4LGD E;  3SWY A;  1OFC X;  4DCK A;  1T3U A;  3HD7 B;  1SFC B;  1U57 A;  1VF5 B;  2Q1K A;  3GW6 A;  2VRS A;  1OX3 A;  3CCV P;  4YXD C;  3T97 A;  1T8Z A;  2ZT9 B;  4JYB A;  5AVS B;  4RJT A;  4WY4 B;  1VQ4 P;  3D6Z A;  3RK3 C;  3K5B A;  1P84 D;  2WPR A;  1JCD A;  2FYZ A;  3PRJ A;  2POH A;  1U7J A;  4NPF X;  1OW6 A;  2HR3 A;  3AEB C;  1GDT A;  1RHZ B;  2W83 C;  2V7Q J;  3I56 P;  3F89 A;  5CCG D;  3N7N A;  1LTI C;  4GKG A;  5AW8 B;  2YXQ B;  1JY3 N;  3MD0 A;  4A7P A;  4BWN A; 
#chains in the Genus database with same CATH homology
 1L0L J;  3CXH I;  3CX5 I;  1BCC J;  3L74 J;  1BE3 J;  1EZV I;  2FYU J;  4D6T J;  1P84 I;  1KYO I;  2IBZ I;  3H1J J;  3CWB J;  3L71 J;  1SQP J;  3H1H J;  1SQQ J;  1NTK J;  3L73 J;  1PP9 J;  1NTM J;  1NTZ J;  5KLV J;  3H1L J;  1BGY J;  2BCC J;  3L70 J;  1SQB J;  4PD4 I;  1L0N J;  3H1I J;  3TGU J;  3H1K J;  3BCC J;  1NU1 J;  4U3F J;  1SQV J;  3L72 J;  3L75 J;  1SQX J;  1KB9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...