1L0NK

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
49
structure length
49
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase
total genus 12
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l0nK00
1NTKK 4IFDK 1NU1K 1L0NK 1SQQK 2O01H 1L0LK 2LKMA 3LW5H 1SQXK 3G3ZA 5KLVK 2J59M 2WSFH 2WSEH 1NTZK 3M9QA 1SQVK 1SQPK 2WSCH 2FYUK 1SQBK 3CLQA 1NTMK 2OARA
chains in the Genus database with same CATH superfamily
3CCSP 5AVZB 2NPSA 1GL2C 3L35A 1VF5C 3U1CA 1X9VA 1VL2A 5KLIC 4EYYQ 1T2KC 1S5LE 1BE3E 1YQ3C 5KKZC 1G1JA 3H1LG 2OARA 2KP8A 2M3EA 2NPSB 1X0TA 1URQA 1EC5A 3BASA 1NTKJ 1NTMD 1FE6A 1NU1J 3N4XA 1U7JA 2YIUC 2I8DA 5KAIE 4N6JA 3RK3B 4YXDC 4IL6H 1IC2A 1SQPD 3HD7C 3NFQA 1BE3G 2JDIH 1FDOA 1SQBK 1BDCA 2QJPB 2KYVA 1OX3A 1RE4C 3MUDA 2LXCB 3ITKA 1U57A 1JY3P 2FXPA 1KZUB 1GL2B 1YJNP 1L0LJ 1M1JC 2WT7A 1MFTA 2OGUA 3Q5PA 2IYPA 1OW6A 1VF5B 3WU2E 1AFOA 1P84I 2R44A 1DIPA 4PD4H 3CX5E 5CCGC 3MHVA 4KJMA 5KKZB 2K3RA 2JP3A 1Y47A 3M9BA 1KQSO 1GD2E 5KLVJ 3B5NC 1FZGA 5APYA 2QIWA 2YIUB 3RK2D 1EDIA 1SQXE 3TGUJ 1FZBA 1RQUA 1BGYE 1YYCA 3TF5A 3VMZA 3LIEA 4NPDA 2IDBA 3BVHA 4XFJA 3V2NA 1WRGA 1WT6A 2HPCB 3CCEP 3HD7B 2ZT9C 2KOGA 1X8YA 2KLUA 1LTJC 3B4SA 1NGMB 3PH0A 4W80A 4Y99C 1N7LA 3S1KA 1YITP 4PD4D 3L71D 3RL0D 2A45H 1KILC 1SQXG 2I1JA 3VYIA 5APQA 1BGYG 3CCUP 2XDJA 4C7NA 2JEEA 2PGDA 3H1KD 1M1JB 3L73D 1PGQA 2HLOA 3H1IJ 2HR3A 2WTYA 2QM7A 2QVAA 5L8RJ 1RE3C 1J1EC 5CBNA 1KN7A 2OTKE 3BCCD 3CWBD 4UB8E 1EZVD 3E1IA 1VQ7P 3D70A 3C1LA 2IPPA 4IFDK 3TYYA 1SQVD 3AE9C 2Q3IA 2IFNA 2J5UA 3B5NB 3BRVB 2JKVA 3NXSA 1HTLC 1IK9A 4PV1D 1IFJA 3H32A 2DW3A 1NWQA 4LC1A 1LT9C 1IJDB 5KAFE 3KPEA 2XKMA 3F5HA 3TNUA 3L74E 1MFZA 2Y0DA 1LTJB 1W5CE 2P58A 1PGJA 5APWA 4Y99B 1FZCC 3AECC 1JB0J 1KILB 2FFDA 2K9JA 4L74A 1HJBA 2Q7CA 2C9LY 2FXOA 3CCQP 2H88C 2YNYA 1Y9BA 2A06D 3MD0A 1L0ND 3CMAP 3L74G 2W83C 3MZWB 2JJLA 2FFDB 3AE1C 1GDTA 2W90A 4JYCA 1HJ0A 3AE3C 4H13D 3S9OA 2W27A 1MUUA 4W7ZA 2BCCE 5CCHC 1RF1C 2N9BA 1JTHA 2PP6A 3T97B 2PFXA 2QJKC 1N8RQ 5CJ4A 4RO0A 1PPJD 1LT9B 4YPCA 1VQ9P 4RKUJ 2LKMA 4GOFA 5AW5B 5B66E 2WPVB 2FYNC 1JCCA 2RKLA 1T8ZA 2BCCG 1VQLP 5AW2B 1FZCB 2KS1B 4XA4A 1T6AA 3FXDA 5TISH 2OTJP 3M0DA 1KQGB 4CPGA 1ZP0C 3TSIA 3SWKA 2IYOA 2GUVA 1RF1A 1JY2N 2ZVNB 1PV3A 3LW5H 1ZXGA 1OWAA 1HF9A 4DT0A 1NTME 1N7SD 1R5LA 1JMMA 2KIKA 1LTTC 5AVSB 1NJIQ 2BASA 2Z5HA 5BU8B 1RF1B 1T3JA 1L4AC 4OGQC 4L76A 1QL2A 4UB6E 1ZRTE 1Q2NA 2H89C 2QJKB 2XU6A 3E1RA 1IFIA 4QMAA 1Z56A 3I56P 1SQPE 4U7JA 2K37A 3MGNA 4PJ0E 3WMM0 4LLHA 1S1CX 2J59M 3Q5SA 2YKQA 4JPZB 2V7QH 1NTMG 3H1KJ 1Q86Q 2K9YA 2FYNB 2IFMA 3L73J 2D2CD 2C9NY 1KORA 3HUSC 1G1IA 2QSIA 1LTAC 4IOIH 4ZKPA 2W6JH 1XTGB 2QE7H 3GHGA 1YQ4C 3BCCJ 3CWBJ 1MV8A 3A0HE 5AW3B 2YXQB 1FDMA 2KI7B 4WVZA 1SQPG 1M56D 1HUCA 3CXHE 4D6TD 5AW8B 1J1DC 2FYUE 1RY3A 4H44C 1YI2P 2IBZE 4DJGA 2OYHA 1MKMA 2ZJSE 1N7SA 1NYHA 2ZXEB 3HE4B 3PP5A 4U3FE 4A7PA 3KYQA 3JC22 3CMEP 1ZV8A 4AYCA 1KTMA 1OMIA 4IL6X 2P10A 1L4AB 4OGQB 4NPFX 1FJPA 3II6A 3RBXA 2WSFH 5H2FE 2ZYAA 3R2PA 1DH3A 1UIXA 2FYUG 1LWUA 3SFDC 3GF3A 1TU3F 3L4FA 1GZLA 4K3AA 1PGOA 1NAFA 4RJTA 3PLNA 4U3FG 4PD4E 2GUSA 5DJTB 1L0NJ 3L71E 2YO3A 1DEBA 3HUSB 2RN0A 3NMDA 1EZVI 5KTBA 3P8MC 3KZIE 3H1JE 4GODA 4H0LC 1SQBD 3QH9A 1FZAA 3OJAB 1GL2D 4I7ZB 1KFMA 3L73E 1VF5D 2B89A 3HTKB 1JMBA 3VMYA 1J1DB 5AVQB 2O3JA 1T2KD 1PGPA 4H44B 1NTZD 3L71G 3CCMP 1OVRA 3RL0g 3CCRP 1IFDA 3GW6A 1YJWP 2Q5UA 1SQVE 3H1JG 3V2QA 4IFMA 3VMXA 3L73G 2E75C 3KDPB 2CK3H 1DEEG 3AEFC 3I55P 1JNMA 1GW4A 5CJ0A 1M7LA 1RHZB 1USEA 3G9RA 1VQPP 1Y8AA 1NKZB 3L72D 1PP9E 1FZFA 3HD7D 5AVUB 1PIXA 2KSJA 2Y9ZA 5AW4B 1NHLA 1LTGC 4DOJA 1SQVG 2W8ZA 2HODB 5BU5A 2QEXP 2Q3EA 4N78D 2A45G 1RF0C 2R3CA 3H1HJ 3L75D 1GL2A 2K1AA 1PP9G 3FWNA 2AXTH 1KB9E 4DZOA 1BCCE 1ZLLA 5CCGD 3ZDMA 1KQLA 2KNCB 1KYOE 3JSVC 2YKOA 1NKNA 3W67A 1NTZK 2H43A 3B5ND 1FBMA 3M91A 3TK1A 1DX7A 2WPRA 2R5DA 2O01H 5KLIB 1L0NG 1U7MA 2E75B 3JCUE 1PPJE 4RESB 2IX7C 1BCCG 5AW0B 3LW5J 2HPCA 3HD7A 1VQ6P 4GKGA 5CMZA 2ZT9D 5AW9B 1VPCA 4D6TJ 4Z1MH 1P84E 2IZ0A 1OZHA 3P8CE 1N73C 2E43A 1SS1A 1NTKE 2XV5A 1KILD 1A02J 1RE4A 1NU1E 2YXRB 1PPJG 1M1KQ 1YHQP 3FWLA 1H89A 4N3YB 4R4LA 2V7QJ 2BEQD 3HE5B 3B8EB 1M1JA 4OWFA 1QL1A 5APUA 3GMAA 3L70J 5CCGA 5AVXB 1GW3A 1S72P 2WSEH 1FZEA 4L73A 3G6EP 3AE8C 5AVYB 3B71A 1M57D 1NTKG 2E5TA 1J2JB 1NU1G 1S5LH 3B5NA 3D71A 4L75A 1KD1Q 2RH0A 2B87B 4GDOA 5TISE 3CCLP 1L0LE 5KAIH 1YTZT 1SQBJ 1SQQK 2WPQA 4JQ0D 2R32A 1LTJA 5DJUB 3UIAA 5CBOA 1VQOP 3A7OA 4EOTA 3IFMA 2FYUK 3A0BE 1EQ7A 2N1TC 2WSFJ 1KILA 1NTZJ 1CW5A 5KLVE 1YBKA 5TJHA 2ZT9B 2P7JA 3OA7A 4R4MA 3IN6A 3CL3D 1L0LG 2P2UA 3SWFA 1BE3D 3TGUE 4D6TE 5AW7B 2ZXXA 4IFFA 4K35A 1RE3A 2W6BA 3C9IA 3WU2H 3L72J 3CX5H 4I6MC 1G2CA 1JY2O 5KLVG 3T97A 4ZMDA 5CCHD 3LIDA 1HGVA 1AQ5A 2P67A 5B5EH 3TGUG 4D6TG 3RK3E 3VN0A 2GA1A 1J1EB 3AEDC 2HG5D 1LT9A 2SPZA 4I1LA 1HVVA 1OW7A 1FS0E 1G2CB 2M8RA 1EDKA 3H1IE 3L75J 1QGKB 4BRYA 2FY8A 2AEJA 2LXBA 1H0TB 1LJ2A 1SVFA 3USSA 1AVOA 1LT1A 1ZW0A 1X22A 1FZCA 1IZNB 2KS1A 3D6YA 1QX8A 3V4WA 1H88A 2ITAA 1SQBE 1CZQA 2JO1A 3CX5D 4BRYB 5GTHE 2H8PD 1VQMP 3V6IA 1Q90D 3H1IG 3G4SP 1FJKA 1LP1B 5KJ7C 2OYIC 2K88A 1SFCC 3VOPA 1AQTA 1CI6B 3A2AA 4EIJA 1SQXD 1BGYD 5CCHA 1SQBG 1JUNA 5GTIH 1L4AD 3V4QA 4OGQD 3KQGA 1JY2P 3V2PA 1OFCX 1GK6A 2JWDA 3TDKA 3H1HD 2ZFCA 1HBWA 2G8YA 3A3YB 1AV1A 3CC2P 2QJYC 3MP7B 5KAFH 3GF7A 3H6PA 4BXLA 2YMKA 2E76C 2O01J 1OW8A 1KQFB 2B88A 5AVWB 2H7HA 2P1JA 3EFGA 2CPBA 3O6QB 2JR8A 3E7KA 3EQ2A 1YIJP 3NTNA 4C7RA 2WQYC 1VQ8P 2FBWC 2WITA 1S3JA 4JBZA 2L5GB 3O8ZA 2UWJE 2ZAEB 2XZRA 2NRGA 1KMIZ 2OYIB 4H44D 1SFCB 2RMZA 2WMMA 2YMYA 3HE4A 2R3SA 4AQRD 1E5WA 3H1LJ 2IBZI 2HFED 1SQXK 1L4AA 4IL6E 2O1JA 1KV4A 3L36A 1AJYA 3F89A 2WSEJ 3AE4C 1NU1K 4WY4C 3VMAA 1PFIA 1AVYA 1BE3J 3L70D 2QJYB 4EI2A 3Q1MA 3Q5RA 4BWNA 4GOEA 3HUSA 1UIIA 3AE7C 3GLMA 2E76B 5B66H 5K5GB 1HGZA 4WWIA 4KT0J 3ABVC 2E74C 2Y9YA 1E79H 4H0LD 4HYTB 4XE5B 3GG2A 2NPSC 3U1AA 2O01N 3HTKA 1ZN5A 1NH4A 1ZOYC 1KC8Q 5BVZA 3SWYA 1FAVA 2BCCD 1OVVA 2KZJA 4HKZH 1EDLA 1L0LK 3H1KE 3U59A 3RK3C 2C0XA 3FX0A 3SFEC 4WY4A 1EXJA 1URQC 3BCCE 3CWBE 2E75D 2KB7P 1EZVE 1VDFA 1WMKA 1S2EA 1NOHA 2N9YB 3AE6C 2WSSH 3BATA 3OW2O 4UB6H 2G3AA 4C46A 3HRNA 1GTWA 3IF4A 4WY4B 1RQVA 3PRJA 3M9QA 4HH2A 2WSCH 3H1KG 4HJGH 1LTSC 4PJ0H 2HODA 2POHA 2Z5IA 2KK7A 1YJ9P 1HWTC 4ZNCA 1GU4A 3BCCG 3CWBG 3CC7P 1EZVG 1Q82Q 1NAYA 2J58A 1K8AQ 3MUDC 1SQXJ 3M06A 2E74B 3AEAC 4JYBA 1BGYJ 3CLQA 3RBZA 3CCJP 5AW6B 2QRXA 3A0HH 2BEZF 1OXZA 2Q6QA 1IFNA 2KNCA 2V4HA 1KB9I 1S5LX 3CXHH 2Y0EA 2OYOA 2B9BA 1LTBC 4H0LB 1ZRTD 3L37A 2A06E 4JF7A 1L0NE 1KYOI 1USDA 1URQB 3AEGC 2W6AA 1JOCA 4WBAA 3CX5I 1JY3N 5E79H 5H2FH 1IFPA 5APSA 2A06G 1SQQD 2QG4A 2QA4P 1MZ9A 3CXHD 1S9KD 2VRSA 1RF0A 1JO5A 3CPWO 2FYUD 3HE5A 1SP4A 2WZ7A 4EDFA 2IBZD 5B5EE 3KZIH 1K9MQ 2WT7B 1OVUA 4U3FD 1K05A 3L74J 3V2RA 1NTMK 1Q7YQ 3AE2C 1H8AA 1R8EA 2AEFA 3D6ZA 2Z4EA 2B87A 1OIPA 2JWAA 3QWOC 3RK2C 4YXWH 1SQPK 5M1BA 3H1HE 3OAKA 4W7YA 4M3LA 2MKVA 1NO4A 2WWWA 1BSHA 3H1JD 2BCCJ 1BSNA 4NPEA 1N73A 2N1TD 3RL0C 1CSBA 3H1LD 1Q81Q 3EWKA 2FFDC 3H1HG 1QVGO 1RH5B 5GTIE 2ZYDA 2C0WA 4C7NB 1X79B 2M3BA 1N73B 1KB9H 2NZ2A 3M9HA 3IR9A 2XNXA 1K04A 1QEXA 2IZ1A 1KYOH 2KUBA 3Q3DA 2LR2A 3N7NA 1PP9D 1GK4A 3PTZA 3CC4P 3RK2B 3WUTA 4PV1C 1AA0A 2PRRA 2MJZA 3H32B 3AEEC 2KLVA 3JCUH 4HB1A 3L70E 1M90Q 1H0TA 3TNUB 1T3UA 2Q9IA 3MTUE 1NTMJ 2KZIA 3W68A 5AVTB 3M0AA 2N1TA 1KB9D 1IK7A 2AXCA 1BCCD 1P84H 3RL0B 1FOSE 2QM8A 3MIWA 2K9JB 3M0DC 1KYOD 2WSCJ 1SQPJ 3IAOA 1LP1A 3H25A 3AEBC 3L70G 2N1TB 5KJ7D 1SFCD 5AVRB 1VQ5P 1BDDA 1CI6A 1VQKP 1LNQA 2FKWB 1SQVK 4I2LC 1HH0A 3RGUA 4H13C 3Q2YA 3PJSK 3V5BA 5AVVB 3CI9A 3S4RA 1M8OB 1JTHB 1NTZE 5CHXA 1SQQJ 1LTIC 1JM0A 2L91A 4PV1B 1EDJA 1QVFO 1P84D 3P8CD 1GMJA 2FYUJ 4UB8H 2E5YA 1L2PA 1NTKD 2ZYGA 3VP9A 1NU1D 5APTA 3P7KA 1IFMA 2WPSA 1ZR2A 2E76D 4U3FJ 3L72E 1PZQA 1NTZG 4GT1A 1NVOA 3AE5C 1N2DC 2OQQA 3G71P 3GHGC 3O6QA 1L0NK 5AW1B 3A0BH 1ZMEC 2Q1KA 4N78E 1PL5A 5KJ7A 4TLFA 2OYIA 1SFCA 4ASWA 3L75E 3L72G 3BRTB 3P32A 2E42A 2AEMA 3L71J 4WB4A 2KXPB 2OYHC 1D7MA 1N7SC 4H13B 3WUUA 2FXMA 4MN4C 1L0LD 4ASVA 3H1JJ 2PAJA 3CXHI 3EFFK 3FGAD 5APVA 4OH8B 3VTPC 4WY4D 3L75G 1LWUC 5APXA 4LGDE 4DCKA 5KLVD 4I7ZC 1SQQE 2D2CC 3L74D 1NTKK 1K73Q 1SQVJ 2R5BA 3TGUD 1S9KE 3FXEA 4GIFA 1VQNP 1W2EA 1A02F 3CD6P 1W2BO 1DD4A 2CPSA 2AXTE 3A5TA 2E74D 3GHGB 4AUWA 2OTLP 2NPSD 2WVRA 1GU5A 1YTZI 2ZVOB 1PP9J 2YKPA 1KILE 1FDIA 1XTCC 1S4XA 1VQ4P 4PD4I 5GTHH 4ZKUA 2I1KA 1SQQG 1FU1A 2YO2A 3SSUA 3PHLA 4O9BA 5E79E 3C8VA 3RK3D 3K5BA 3KXDA 2OYHB 3R4YA 1N7SB 4Y28J 1URQD 1FOSF 2Y0CA 5C39A 1IO4A 3VP8A 2O1KA 2IBZG 4KHXA 2GM4A 3H1ID 1ZR4A 2M5AA 3CCVP 1FC2C 2KSEA 3I5CA 1R5SA 1BCCJ 1LGHB 1KFNA 2M0BA 1JEKA 3WUVA 2HYNA 1SLQA 1LWUB 4OVNF 1EXIA 4YTPC 1JCDA 4TT3H 2M5AB 1QLED 2D2CB 2FYZA 3G3ZA 3KHUA 5KLVK 3H1LE 2QJPC 1N86A 2A45I 1JY3O 1DD3A 5EFWB 2XNDH 4B86A
chains in the Genus database with same CATH topology
3VN0A 2IFMA 5AVZB 1H8AA 2NPSA 1J1EB 1GL2C 2C9NY 2HG5D 3HUSC 1LT9A 1G1IA 4I1LA 3L35A 1HVVA 1LTAC 4ZKPA 1G2CB 2M8RA 3U1CA 1XTGB 3GHGA 2Z4EA 1X9VA 1MV8A 5AW3B 3RK2C 1T2KC 1FDMA 1SQPK 1SVFA 1G1JA 2OARA 2KP8A 1HUCA 3OAKA 4W7YA 1FZCA 2NPSB 1URQA 3BASA 5AW8B 4M3LA 3V4WA 1NO4A 3N4XA 1H88A 1J1DC 2WWWA 1RY3A 1CZQA 4N6JA 2H8PD 2OYHA 1N7SA 3RK3B 2ZXEB 3HE4B 3PP5A 1N73A 3KYQA 1FJKA 2N1TD 1IC2A 3RL0C 1CSBA 3HD7C 1ZV8A 3NFQA 5KJ7C 4AYCA 2OYIC 1SFCC 3VOPA 2FFDC 1L4AB 1CI6B 3A2AA 4EIJA 1FJPA 2C0WA 3II6A 2WSFH 4C7NB 1X79B 3R2PA 1SQBK 1DH3A 5CCHA 2M3BA 1JUNA 1LWUA 2KYVA 1N73B 3L4FA 1L4AD 3V4QA 1RE4C 3MUDA 3KQGA 1GZLA 1JY2P 3V2PA 3M9HA 3IR9A 1NAFA 1JY3P 2XNXA 1KZUB 2GUSA 1GK6A 1GL2B 1M1JC 1DEBA 2YO3A 3HUSB 2WT7A 2ZFCA 3NMDA 1AFOA 1HBWA 5KTBA 3A3YB 3N7NA 5CCGC 3P8MC 1GK4A 3RK2B 3H6PA 1FZAA 3OJAB 1GL2D 1KFMA 2MJZA 3H32B 3M9BA 3HTKB 5AVWB 2H7HA 1GD2E 3VMYA 2KLVA 1FZGA 3B5NC 2P1JA 5APYA 1J1DB 3EFGA 5AVQB 3RK2D 3TNUB 2CPBA 1T2KD 1T3UA 2Q9IA 3MTUE 3EQ2A 1FZBA 1IFDA 1YYCA 3NTNA 4C7RA 5AVTB 3VMZA 3LIEA 3M0AA 2Q5UA 2N1TA 3BVHA 2WITA 3V2NA 1WRGA 3V2QA 1WT6A 2HPCB 3RL0B 3HD7B 2L5GB 3O8ZA 4IFMA 1FOSE 2KOGA 2XZRA 2QM8A 2OYIB 1SFCB 1X8YA 3VMXA 3KDPB 1LTJC 3MIWA 3M0DC 2YMYA 1JNMA 3HE4A 1GW4A 4W80A 5CJ0A 1M7LA 4AQRD 4Y99C 1E5WA 1N7LA 1NKZB 1FZFA 3RL0D 2N1TB 2HFED 3HD7D 5AVUB 1SQXK 2KSJA 2A45H 5KJ7D 1KILC 2I1JA 1L4AA 3VYIA 1SFCD 5AVRB 1CI6A 5APQA 5AW4B 1NHLA 1LTGC 2FKWB 2O1JA 3L36A 4DOJA 1SQVK 4I2LC 1HH0A 2XDJA 4C7NA 2JEEA 2HODB 3V5BA 1NU1K 1M1JB 5AVVB 5BU5A 3CI9A 4WY4C 2HLOA 4N78D 2WTYA 2QM7A 1JTHB 2A45G 1PFIA 5CHXA 1RE3C 1LTIC 1RF0C 2R3CA 1J1EC 1GL2A 3HUSA 3E1IA 4DZOA 1ZLLA 2IPPA 3P8CD 4IFDK 3TYYA 1HGZA 2Q3IA 5CCGD 2IFNA 3B5NB 3BRVB 1KQLA 3NXSA 3VP9A 1HTLC 1IK9A 4HYTB 5APTA 1IFJA 3H32A 4XE5B 2YKOA 1NKNA 3P7KA 1IFMA 2WPSA 1NWQA 4LC1A 2NPSC 3U1AA 1ZR2A 1LT9C 3HTKA 1ZN5A 1IJDB 1NTZK 1NH4A 3KPEA 2XKMA 4GT1A 5BVZA 2H43A 3SWYA 1FAVA 1FBMA 1N2DC 3B5ND 3GHGC 3TNUA 3M91A 3TK1A 1DX7A 2WPRA 2R5DA 1L0NK 5AW1B 2O01H 1MFZA 1L0LK 4RESB 1LTJB 2IX7C 5AW0B 3U59A 3RK3C 5APWA 2C0XA 4Y99B 1FZCC 4N78E 4WY4A 2HPCA 1URQC 3HD7A 4GKGA 5KJ7A 5CMZA 2OYIA 1SFCA 1KILB 5AW9B 2FFDA 1VPCA 1HJBA 2Q7CA 2KB7P 1VDFA 3BRTB 3P32A 2C9LY 2E42A 4WB4A 1NOHA 2OYHC 3P8CE 3BATA 1N7SC 2YNYA 1N73C 2E43A 2FXMA 3HRNA 3MD0A 4C46A 1GTWA 4WY4B 2XV5A 1KILD 2PAJA 1A02J 1RE4A 2JJLA 3M9QA 4HH2A 2WSCH 2FFDB 1LTSC 1GDTA 1H89A 2HODA 2POHA 4N3YB 2Z5IA 4JYCA 5APVA 3HE5B 3B8EB 1M1JA 2W27A 4OH8B 3VTPC 1HWTC 1MUUA 4W7ZA 1QL1A 5APUA 5CCHC 4WY4D 1RF1C 2N9BA 1LWUC 1GU4A 1JTHA 2PP6A 5APXA 4LGDE 5CCGA 2J58A 5AVXB 1GW3A 3M06A 2WSEH 1FZEA 4JYBA 5CJ4A 3CLQA 5AVYB 1NTKK 5AW6B 2R5BA 1LT9B 1S9KE 1J2JB 1OXZA 4GIFA 1IFNA 1W2EA 3B5NA 1A02F 2LKMA 5AW5B 2CPSA 3A5TA 3GHGB 1LTBC 1JCCA 4AUWA 1T8ZA 2NPSD 3L37A 1GU5A 4JF7A 1YTZI 5AW2B 1FZCB 2YKPA 1XTCC 4XA4A 1URQB 1YTZT 4ZKUA 1SQQK 2I1KA 2W6AA 2WPQA 1JOCA 1FU1A 2YO2A 2R32A 1LTJA 3M0DA 3UIAA 4O9BA 4WBAA 3RK3D 3A7OA 3TSIA 4EOTA 3IFMA 2OYHB 2FYUK 1N7SB 1EQ7A 2N1TC 1URQD 2GUVA 1RF1A 1FOSF 1JY2N 3VP8A 1IO4A 2O1KA 1KILA 1CW5A 1JY3N 4KHXA 2GM4A 2P7JA 3OA7A 1ZR4A 5APSA 3LW5H 3CL3D 2P2UA 3I5CA 3SWFA 1OWAA 5AW7B 1N7SD 1LGHB 1KFNA 1MZ9A 1JMMA 1LTTC 5AVSB 2HYNA 2BASA 1S9KD 1SLQA 2Z5HA 5BU8B 1LWUB 1RF1B 2VRSA 1T3JA 1L4AC 4IFFA 1RE3A 2W6BA 1QL2A 1JCDA 1RF0A 1JO5A 3C9IA 2XU6A 3HE5A 1SP4A 2WZ7A 1IFIA 1Z56A 4I6MC 2FYZA 3G3ZA 5KLVK 1G2CA 3MGNA 3WMM0 1JY2O 2WT7B 1N86A 4LLHA 3T97A 2A45I 1JY3O 3LIDA 5CCHD 2J59M 1HGVA 1AQ5A 2P67A 2YKQA 4B86A 3V2RA 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK K;  4IFD K;  1NU1 K;  1L0N K;  1SQQ K;  2O01 H;  1L0L K;  2LKM A;  3LW5 H;  1SQX K;  3G3Z A;  5KLV K;  2J59 M;  2WSF H;  2WSE H;  1NTZ K;  3M9Q A;  1SQV K;  1SQP K;  2WSC H;  2FYU K;  1SQB K;  3CLQ A;  1NTM K;  2OAR A; 
#chains in the Genus database with same CATH topology
 3CCS P;  5AVZ B;  2NPS A;  1GL2 C;  3L35 A;  1VF5 C;  3U1C A;  1X9V A;  1VL2 A;  5KLI C;  4EYY Q;  1T2K C;  1S5L E;  1BE3 E;  1YQ3 C;  5KKZ C;  1G1J A;  3H1L G;  2OAR A;  2KP8 A;  2M3E A;  2NPS B;  1X0T A;  1URQ A;  1EC5 A;  3BAS A;  1NTK J;  1NTM D;  1FE6 A;  1NU1 J;  3N4X A;  1U7J A;  2YIU C;  2I8D A;  5KAI E;  4N6J A;  3RK3 B;  4YXD C;  4IL6 H;  1IC2 A;  1SQP D;  3HD7 C;  3NFQ A;  1BE3 G;  2JDI H;  1FDO A;  1SQB K;  1BDC A;  2QJP B;  2KYV A;  1OX3 A;  1RE4 C;  3MUD A;  2LXC B;  3ITK A;  1U57 A;  1JY3 P;  2FXP A;  1KZU B;  1GL2 B;  1YJN P;  1L0L J;  1M1J C;  2WT7 A;  1MFT A;  2OGU A;  3Q5P A;  2IYP A;  1OW6 A;  1VF5 B;  3WU2 E;  1AFO A;  1P84 I;  2R44 A;  1DIP A;  4PD4 H;  3CX5 E;  5CCG C;  3MHV A;  4KJM A;  5KKZ B;  2K3R A;  2JP3 A;  1Y47 A;  3M9B A;  1KQS O;  1GD2 E;  5KLV J;  3B5N C;  1FZG A;  5APY A;  2QIW A;  2YIU B;  3RK2 D;  1EDI A;  1SQX E;  3TGU J;  1FZB A;  1RQU A;  1BGY E;  1YYC A;  3TF5 A;  3VMZ A;  3LIE A;  4NPD A;  2IDB A;  3BVH A;  4XFJ A;  3V2N A;  1WRG A;  1WT6 A;  2HPC B;  3CCE P;  3HD7 B;  2ZT9 C;  2KOG A;  1X8Y A;  2KLU A;  1LTJ C;  3B4S A;  1NGM B;  3PH0 A;  4W80 A;  4Y99 C;  1N7L A;  3S1K A;  1YIT P;  4PD4 D;  3L71 D;  3RL0 D;  2A45 H;  1KIL C;  1SQX G;  2I1J A;  3VYI A;  5APQ A;  1BGY G;  3CCU P;  2XDJ A;  4C7N A;  2JEE A;  2PGD A;  3H1K D;  1M1J B;  3L73 D;  1PGQ A;  2HLO A;  3H1I J;  2HR3 A;  2WTY A;  2QM7 A;  2QVA A;  5L8R J;  1RE3 C;  1J1E C;  5CBN A;  1KN7 A;  2OTK E;  3BCC D;  3CWB D;  4UB8 E;  1EZV D;  3E1I A;  1VQ7 P;  3D70 A;  3C1L A;  2IPP A;  4IFD K;  3TYY A;  1SQV D;  3AE9 C;  2Q3I A;  2IFN A;  2J5U A;  3B5N B;  3BRV B;  2JKV A;  3NXS A;  1HTL C;  1IK9 A;  4PV1 D;  1IFJ A;  3H32 A;  2DW3 A;  1NWQ A;  4LC1 A;  1LT9 C;  1IJD B;  5KAF E;  3KPE A;  2XKM A;  3F5H A;  3TNU A;  3L74 E;  1MFZ A;  2Y0D A;  1LTJ B;  1W5C E;  2P58 A;  1PGJ A;  5APW A;  4Y99 B;  1FZC C;  3AEC C;  1JB0 J;  1KIL B;  2FFD A;  2K9J A;  4L74 A;  1HJB A;  2Q7C A;  2C9L Y;  2FXO A;  3CCQ P;  2H88 C;  2YNY A;  1Y9B A;  2A06 D;  3MD0 A;  1L0N D;  3CMA P;  3L74 G;  2W83 C;  3MZW B;  2JJL A;  2FFD B;  3AE1 C;  1GDT A;  2W90 A;  4JYC A;  1HJ0 A;  3AE3 C;  4H13 D;  3S9O A;  2W27 A;  1MUU A;  4W7Z A;  2BCC E;  5CCH C;  1RF1 C;  2N9B A;  1JTH A;  2PP6 A;  3T97 B;  2PFX A;  2QJK C;  1N8R Q;  5CJ4 A;  4RO0 A;  1PPJ D;  1LT9 B;  4YPC A;  1VQ9 P;  4RKU J;  2LKM A;  4GOF A;  5AW5 B;  5B66 E;  2WPV B;  2FYN C;  1JCC A;  2RKL A;  1T8Z A;  2BCC G;  1VQL P;  5AW2 B;  1FZC B;  2KS1 B;  4XA4 A;  1T6A A;  3FXD A;  5TIS H;  2OTJ P;  3M0D A;  1KQG B;  4CPG A;  1ZP0 C;  3TSI A;  3SWK A;  2IYO A;  2GUV A;  1RF1 A;  1JY2 N;  2ZVN B;  1PV3 A;  3LW5 H;  1ZXG A;  1OWA A;  1HF9 A;  4DT0 A;  1NTM E;  1N7S D;  1R5L A;  1JMM A;  2KIK A;  1LTT C;  5AVS B;  1NJI Q;  2BAS A;  2Z5H A;  5BU8 B;  1RF1 B;  1T3J A;  1L4A C;  4OGQ C;  4L76 A;  1QL2 A;  4UB6 E;  1ZRT E;  1Q2N A;  2H89 C;  2QJK B;  2XU6 A;  3E1R A;  1IFI A;  4QMA A;  1Z56 A;  3I56 P;  1SQP E;  4U7J A;  2K37 A;  3MGN A;  4PJ0 E;  3WMM 0;  4LLH A;  1S1C X;  2J59 M;  3Q5S A;  2YKQ A;  4JPZ B;  2V7Q H;  1NTM G;  3H1K J;  1Q86 Q;  2K9Y A;  2FYN B;  2IFM A;  3L73 J;  2D2C D;  2C9N Y;  1KOR A;  3HUS C;  1G1I A;  2QSI A;  1LTA C;  4IOI H;  4ZKP A;  2W6J H;  1XTG B;  2QE7 H;  3GHG A;  1YQ4 C;  3BCC J;  3CWB J;  1MV8 A;  3A0H E;  5AW3 B;  2YXQ B;  1FDM A;  2KI7 B;  4WVZ A;  1SQP G;  1M56 D;  1HUC A;  3CXH E;  4D6T D;  5AW8 B;  1J1D C;  2FYU E;  1RY3 A;  4H44 C;  1YI2 P;  2IBZ E;  4DJG A;  2OYH A;  1MKM A;  2ZJS E;  1N7S A;  1NYH A;  2ZXE B;  3HE4 B;  3PP5 A;  4U3F E;  4A7P A;  3KYQ A;  3JC2 2;  3CME P;  1ZV8 A;  4AYC A;  1KTM A;  1OMI A;  4IL6 X;  2P10 A;  1L4A B;  4OGQ B;  4NPF X;  1FJP A;  3II6 A;  3RBX A;  2WSF H;  5H2F E;  2ZYA A;  3R2P A;  1DH3 A;  1UIX A;  2FYU G;  1LWU A;  3SFD C;  3GF3 A;  1TU3 F;  3L4F A;  1GZL A;  4K3A A;  1PGO A;  1NAF A;  4RJT A;  3PLN A;  4U3F G;  4PD4 E;  2GUS A;  5DJT B;  1L0N J;  3L71 E;  2YO3 A;  1DEB A;  3HUS B;  2RN0 A;  3NMD A;  1EZV I;  5KTB A;  3P8M C;  3KZI E;  3H1J E;  4GOD A;  4H0L C;  1SQB D;  3QH9 A;  1FZA A;  3OJA B;  1GL2 D;  4I7Z B;  1KFM A;  3L73 E;  1VF5 D;  2B89 A;  3HTK B;  1JMB A;  3VMY A;  1J1D B;  5AVQ B;  2O3J A;  1T2K D;  1PGP A;  4H44 B;  1NTZ D;  3L71 G;  3CCM P;  1OVR A;  3RL0 g;  3CCR P;  1IFD A;  3GW6 A;  1YJW P;  2Q5U A;  1SQV E;  3H1J G;  3V2Q A;  4IFM A;  3VMX A;  3L73 G;  2E75 C;  3KDP B;  2CK3 H;  1DEE G;  3AEF C;  3I55 P;  1JNM A;  1GW4 A;  5CJ0 A;  1M7L A;  1RHZ B;  1USE A;  3G9R A;  1VQP P;  1Y8A A;  1NKZ B;  3L72 D;  1PP9 E;  1FZF A;  3HD7 D;  5AVU B;  1PIX A;  2KSJ A;  2Y9Z A;  5AW4 B;  1NHL A;  1LTG C;  4DOJ A;  1SQV G;  2W8Z A;  2HOD B;  5BU5 A;  2QEX P;  2Q3E A;  4N78 D;  2A45 G;  1RF0 C;  2R3C A;  3H1H J;  3L75 D;  1GL2 A;  2K1A A;  1PP9 G;  3FWN A;  2AXT H;  1KB9 E;  4DZO A;  1BCC E;  1ZLL A;  5CCG D;  3ZDM A;  1KQL A;  2KNC B;  1KYO E;  3JSV C;  2YKO A;  1NKN A;  3W67 A;  1NTZ K;  2H43 A;  3B5N D;  1FBM A;  3M91 A;  3TK1 A;  1DX7 A;  2WPR A;  2R5D A;  2O01 H;  5KLI B;  1L0N G;  1U7M A;  2E75 B;  3JCU E;  1PPJ E;  4RES B;  2IX7 C;  1BCC G;  5AW0 B;  3LW5 J;  2HPC A;  3HD7 A;  1VQ6 P;  4GKG A;  5CMZ A;  2ZT9 D;  5AW9 B;  1VPC A;  4D6T J;  4Z1M H;  1P84 E;  2IZ0 A;  1OZH A;  3P8C E;  1N73 C;  2E43 A;  1SS1 A;  1NTK E;  2XV5 A;  1KIL D;  1A02 J;  1RE4 A;  1NU1 E;  2YXR B;  1PPJ G;  1M1K Q;  1YHQ P;  3FWL A;  1H89 A;  4N3Y B;  4R4L A;  2V7Q J;  2BEQ D;  3HE5 B;  3B8E B;  1M1J A;  4OWF A;  1QL1 A;  5APU A;  3GMA A;  3L70 J;  5CCG A;  5AVX B;  1GW3 A;  1S72 P;  2WSE H;  1FZE A;  4L73 A;  3G6E P;  3AE8 C;  5AVY B;  3B71 A;  1M57 D;  1NTK G;  2E5T A;  1J2J B;  1NU1 G;  1S5L H;  3B5N A;  3D71 A;  4L75 A;  1KD1 Q;  2RH0 A;  2B87 B;  4GDO A;  5TIS E;  3CCL P;  1L0L E;  5KAI H;  1YTZ T;  1SQB J;  1SQQ K;  2WPQ A;  4JQ0 D;  2R32 A;  1LTJ A;  5DJU B;  3UIA A;  5CBO A;  1VQO P;  3A7O A;  4EOT A;  3IFM A;  2FYU K;  3A0B E;  1EQ7 A;  2N1T C;  2WSF J;  1KIL A;  1NTZ J;  1CW5 A;  5KLV E;  1YBK A;  5TJH A;  2ZT9 B;  2P7J A;  3OA7 A;  4R4M A;  3IN6 A;  3CL3 D;  1L0L G;  2P2U A;  3SWF A;  1BE3 D;  3TGU E;  4D6T E;  5AW7 B;  2ZXX A;  4IFF A;  4K35 A;  1RE3 A;  2W6B A;  3C9I A;  3WU2 H;  3L72 J;  3CX5 H;  4I6M C;  1G2C A;  1JY2 O;  5KLV G;  3T97 A;  4ZMD A;  5CCH D;  3LID A;  1HGV A;  1AQ5 A;  2P67 A;  5B5E H;  3TGU G;  4D6T G;  3RK3 E;  3VN0 A;  2GA1 A;  1J1E B;  3AED C;  2HG5 D;  1LT9 A;  2SPZ A;  4I1L A;  1HVV A;  1OW7 A;  1FS0 E;  1G2C B;  2M8R A;  1EDK A;  3H1I E;  3L75 J;  1QGK B;  4BRY A;  2FY8 A;  2AEJ A;  2LXB A;  1H0T B;  1LJ2 A;  1SVF A;  3USS A;  1AVO A;  1LT1 A;  1ZW0 A;  1X22 A;  1FZC A;  1IZN B;  2KS1 A;  3D6Y A;  1QX8 A;  3V4W A;  1H88 A;  2ITA A;  1SQB E;  1CZQ A;  2JO1 A;  3CX5 D;  4BRY B;  5GTH E;  2H8P D;  1VQM P;  3V6I A;  1Q90 D;  3H1I G;  3G4S P;  1FJK A;  1LP1 B;  5KJ7 C;  2OYI C;  2K88 A;  1SFC C;  3VOP A;  1AQT A;  1CI6 B;  3A2A A;  4EIJ A;  1SQX D;  1BGY D;  5CCH A;  1SQB G;  1JUN A;  5GTI H;  1L4A D;  3V4Q A;  4OGQ D;  3KQG A;  1JY2 P;  3V2P A;  1OFC X;  1GK6 A;  2JWD A;  3TDK A;  3H1H D;  2ZFC A;  1HBW A;  2G8Y A;  3A3Y B;  1AV1 A;  3CC2 P;  2QJY C;  3MP7 B;  5KAF H;  3GF7 A;  3H6P A;  4BXL A;  2YMK A;  2E76 C;  2O01 J;  1OW8 A;  1KQF B;  2B88 A;  5AVW B;  2H7H A;  2P1J A;  3EFG A;  2CPB A;  3O6Q B;  2JR8 A;  3E7K A;  3EQ2 A;  1YIJ P;  3NTN A;  4C7R A;  2WQY C;  1VQ8 P;  2FBW C;  2WIT A;  1S3J A;  4JBZ A;  2L5G B;  3O8Z A;  2UWJ E;  2ZAE B;  2XZR A;  2NRG A;  1KMI Z;  2OYI B;  4H44 D;  1SFC B;  2RMZ A;  2WMM A;  2YMY A;  3HE4 A;  2R3S A;  4AQR D;  1E5W A;  3H1L J;  2IBZ I;  2HFE D;  1SQX K;  1L4A A;  4IL6 E;  2O1J A;  1KV4 A;  3L36 A;  1AJY A;  3F89 A;  2WSE J;  3AE4 C;  1NU1 K;  4WY4 C;  3VMA A;  1PFI A;  1AVY A;  1BE3 J;  3L70 D;  2QJY B;  4EI2 A;  3Q1M A;  3Q5R A;  4BWN A;  4GOE A;  3HUS A;  1UII A;  3AE7 C;  3GLM A;  2E76 B;  5B66 H;  5K5G B;  1HGZ A;  4WWI A;  4KT0 J;  3ABV C;  2E74 C;  2Y9Y A;  1E79 H;  4H0L D;  4HYT B;  4XE5 B;  3GG2 A;  2NPS C;  3U1A A;  2O01 N;  3HTK A;  1ZN5 A;  1NH4 A;  1ZOY C;  1KC8 Q;  5BVZ A;  3SWY A;  1FAV A;  2BCC D;  1OVV A;  2KZJ A;  4HKZ H;  1EDL A;  1L0L K;  3H1K E;  3U59 A;  3RK3 C;  2C0X A;  3FX0 A;  3SFE C;  4WY4 A;  1EXJ A;  1URQ C;  3BCC E;  3CWB E;  2E75 D;  2KB7 P;  1EZV E;  1VDF A;  1WMK A;  1S2E A;  1NOH A;  2N9Y B;  3AE6 C;  2WSS H;  3BAT A;  3OW2 O;  4UB6 H;  2G3A A;  4C46 A;  3HRN A;  1GTW A;  3IF4 A;  4WY4 B;  1RQV A;  3PRJ A;  3M9Q A;  4HH2 A;  2WSC H;  3H1K G;  4HJG H;  1LTS C;  4PJ0 H;  2HOD A;  2POH A;  2Z5I A;  2KK7 A;  1YJ9 P;  1HWT C;  4ZNC A;  1GU4 A;  3BCC G;  3CWB G;  3CC7 P;  1EZV G;  1Q82 Q;  1NAY A;  2J58 A;  1K8A Q;  3MUD C;  1SQX J;  3M06 A;  2E74 B;  3AEA C;  4JYB A;  1BGY J;  3CLQ A;  3RBZ A;  3CCJ P;  5AW6 B;  2QRX A;  3A0H H;  2BEZ F;  1OXZ A;  2Q6Q A;  1IFN A;  2KNC A;  2V4H A;  1KB9 I;  1S5L X;  3CXH H;  2Y0E A;  2OYO A;  2B9B A;  1LTB C;  4H0L B;  1ZRT D;  3L37 A;  2A06 E;  4JF7 A;  1L0N E;  1KYO I;  1USD A;  1URQ B;  3AEG C;  2W6A A;  1JOC A;  4WBA A;  3CX5 I;  1JY3 N;  5E79 H;  5H2F H;  1IFP A;  5APS A;  2A06 G;  1SQQ D;  2QG4 A;  2QA4 P;  1MZ9 A;  3CXH D;  1S9K D;  2VRS A;  1RF0 A;  1JO5 A;  3CPW O;  2FYU D;  3HE5 A;  1SP4 A;  2WZ7 A;  4EDF A;  2IBZ D;  5B5E E;  3KZI H;  1K9M Q;  2WT7 B;  1OVU A;  4U3F D;  1K05 A;  3L74 J;  3V2R A;  1NTM K;  1Q7Y Q;  3AE2 C;  1H8A A;  1R8E A;  2AEF A;  3D6Z A;  2Z4E A;  2B87 A;  1OIP A;  2JWA A;  3QWO C;  3RK2 C;  4YXW H;  1SQP K;  5M1B A;  3H1H E;  3OAK A;  4W7Y A;  4M3L A;  2MKV A;  1NO4 A;  2WWW A;  1BSH A;  3H1J D;  2BCC J;  1BSN A;  4NPE A;  1N73 A;  2N1T D;  3RL0 C;  1CSB A;  3H1L D;  1Q81 Q;  3EWK A;  2FFD C;  3H1H G;  1QVG O;  1RH5 B;  5GTI E;  2ZYD A;  2C0W A;  4C7N B;  1X79 B;  2M3B A;  1N73 B;  1KB9 H;  2NZ2 A;  3M9H A;  3IR9 A;  2XNX A;  1K04 A;  1QEX A;  2IZ1 A;  1KYO H;  2KUB A;  3Q3D A;  2LR2 A;  3N7N A;  1PP9 D;  1GK4 A;  3PTZ A;  3CC4 P;  3RK2 B;  3WUT A;  4PV1 C;  1AA0 A;  2PRR A;  2MJZ A;  3H32 B;  3AEE C;  2KLV A;  3JCU H;  4HB1 A;  3L70 E;  1M90 Q;  1H0T A;  3TNU B;  1T3U A;  2Q9I A;  3MTU E;  1NTM J;  2KZI A;  3W68 A;  5AVT B;  3M0A A;  2N1T A;  1KB9 D;  1IK7 A;  2AXC A;  1BCC D;  1P84 H;  3RL0 B;  1FOS E;  2QM8 A;  3MIW A;  2K9J B;  3M0D C;  1KYO D;  2WSC J;  1SQP J;  3IAO A;  1LP1 A;  3H25 A;  3AEB C;  3L70 G;  2N1T B;  5KJ7 D;  1SFC D;  5AVR B;  1VQ5 P;  1BDD A;  1CI6 A;  1VQK P;  1LNQ A;  2FKW B;  1SQV K;  4I2L C;  1HH0 A;  3RGU A;  4H13 C;  3Q2Y A;  3PJS K;  3V5B A;  5AVV B;  3CI9 A;  3S4R A;  1M8O B;  1JTH B;  1NTZ E;  5CHX A;  1SQQ J;  1LTI C;  1JM0 A;  2L91 A;  4PV1 B;  1EDJ A;  1QVF O;  1P84 D;  3P8C D;  1GMJ A;  2FYU J;  4UB8 H;  2E5Y A;  1L2P A;  1NTK D;  2ZYG A;  3VP9 A;  1NU1 D;  5APT A;  3P7K A;  1IFM A;  2WPS A;  1ZR2 A;  2E76 D;  4U3F J;  3L72 E;  1PZQ A;  1NTZ G;  4GT1 A;  1NVO A;  3AE5 C;  1N2D C;  2OQQ A;  3G71 P;  3GHG C;  3O6Q A;  1L0N K;  5AW1 B;  3A0B H;  1ZME C;  2Q1K A;  4N78 E;  1PL5 A;  5KJ7 A;  4TLF A;  2OYI A;  1SFC A;  4ASW A;  3L75 E;  3L72 G;  3BRT B;  3P32 A;  2E42 A;  2AEM A;  3L71 J;  4WB4 A;  2KXP B;  2OYH C;  1D7M A;  1N7S C;  4H13 B;  3WUU A;  2FXM A;  4MN4 C;  1L0L D;  4ASV A;  3H1J J;  2PAJ A;  3CXH I;  3EFF K;  3FGA D;  5APV A;  4OH8 B;  3VTP C;  4WY4 D;  3L75 G;  1LWU C;  5APX A;  4LGD E;  4DCK A;  5KLV D;  4I7Z C;  1SQQ E;  2D2C C;  3L74 D;  1NTK K;  1K73 Q;  1SQV J;  2R5B A;  3TGU D;  1S9K E;  3FXE A;  4GIF A;  1VQN P;  1W2E A;  1A02 F;  3CD6 P;  1W2B O;  1DD4 A;  2CPS A;  2AXT E;  3A5T A;  2E74 D;  3GHG B;  4AUW A;  2OTL P;  2NPS D;  2WVR A;  1GU5 A;  1YTZ I;  2ZVO B;  1PP9 J;  2YKP A;  1KIL E;  1FDI A;  1XTC C;  1S4X A;  1VQ4 P;  4PD4 I;  5GTH H;  4ZKU A;  2I1K A;  1SQQ G;  1FU1 A;  2YO2 A;  3SSU A;  3PHL A;  4O9B A;  5E79 E;  3C8V A;  3RK3 D;  3K5B A;  3KXD A;  2OYH B;  3R4Y A;  1N7S B;  4Y28 J;  1URQ D;  1FOS F;  2Y0C A;  5C39 A;  1IO4 A;  3VP8 A;  2O1K A;  2IBZ G;  4KHX A;  2GM4 A;  3H1I D;  1ZR4 A;  2M5A A;  3CCV P;  1FC2 C;  2KSE A;  3I5C A;  1R5S A;  1BCC J;  1LGH B;  1KFN A;  2M0B A;  1JEK A;  3WUV A;  2HYN A;  1SLQ A;  1LWU B;  4OVN F;  1EXI A;  4YTP C;  1JCD A;  4TT3 H;  2M5A B;  1QLE D;  2D2C B;  2FYZ A;  3G3Z A;  3KHU A;  5KLV K;  3H1L E;  2QJP C;  1N86 A;  2A45 I;  1JY3 O;  1DD3 A;  5EFW B;  2XND H;  4B86 A; 
#chains in the Genus database with same CATH homology
 3VN0 A;  2IFM A;  5AVZ B;  1H8A A;  2NPS A;  1J1E B;  1GL2 C;  2C9N Y;  2HG5 D;  3HUS C;  1LT9 A;  1G1I A;  4I1L A;  3L35 A;  1HVV A;  1LTA C;  4ZKP A;  1G2C B;  2M8R A;  3U1C A;  1XTG B;  3GHG A;  2Z4E A;  1X9V A;  1MV8 A;  5AW3 B;  3RK2 C;  1T2K C;  1FDM A;  1SQP K;  1SVF A;  1G1J A;  2OAR A;  2KP8 A;  1HUC A;  3OAK A;  4W7Y A;  1FZC A;  2NPS B;  1URQ A;  3BAS A;  5AW8 B;  4M3L A;  3V4W A;  1NO4 A;  3N4X A;  1H88 A;  1J1D C;  2WWW A;  1RY3 A;  1CZQ A;  4N6J A;  2H8P D;  2OYH A;  1N7S A;  3RK3 B;  2ZXE B;  3HE4 B;  3PP5 A;  1N73 A;  3KYQ A;  1FJK A;  2N1T D;  1IC2 A;  3RL0 C;  1CSB A;  3HD7 C;  1ZV8 A;  3NFQ A;  5KJ7 C;  4AYC A;  2OYI C;  1SFC C;  3VOP A;  2FFD C;  1L4A B;  1CI6 B;  3A2A A;  4EIJ A;  1FJP A;  2C0W A;  3II6 A;  2WSF H;  4C7N B;  1X79 B;  3R2P A;  1SQB K;  1DH3 A;  5CCH A;  2M3B A;  1JUN A;  1LWU A;  2KYV A;  1N73 B;  3L4F A;  1L4A D;  3V4Q A;  1RE4 C;  3MUD A;  3KQG A;  1GZL A;  1JY2 P;  3V2P A;  3M9H A;  3IR9 A;  1NAF A;  1JY3 P;  2XNX A;  1KZU B;  2GUS A;  1GK6 A;  1GL2 B;  1M1J C;  1DEB A;  2YO3 A;  3HUS B;  2WT7 A;  2ZFC A;  3NMD A;  1AFO A;  1HBW A;  5KTB A;  3A3Y B;  3N7N A;  5CCG C;  3P8M C;  1GK4 A;  3RK2 B;  3H6P A;  1FZA A;  3OJA B;  1GL2 D;  1KFM A;  2MJZ A;  3H32 B;  3M9B A;  3HTK B;  5AVW B;  2H7H A;  1GD2 E;  3VMY A;  2KLV A;  1FZG A;  3B5N C;  2P1J A;  5APY A;  1J1D B;  3EFG A;  5AVQ B;  3RK2 D;  3TNU B;  2CPB A;  1T2K D;  1T3U A;  2Q9I A;  3MTU E;  3EQ2 A;  1FZB A;  1IFD A;  1YYC A;  3NTN A;  4C7R A;  5AVT B;  3VMZ A;  3LIE A;  3M0A A;  2Q5U A;  2N1T A;  3BVH A;  2WIT A;  3V2N A;  1WRG A;  3V2Q A;  1WT6 A;  2HPC B;  3RL0 B;  3HD7 B;  2L5G B;  3O8Z A;  4IFM A;  1FOS E;  2KOG A;  2XZR A;  2QM8 A;  2OYI B;  1SFC B;  1X8Y A;  3VMX A;  3KDP B;  1LTJ C;  3MIW A;  3M0D C;  2YMY A;  1JNM A;  3HE4 A;  1GW4 A;  4W80 A;  5CJ0 A;  1M7L A;  4AQR D;  4Y99 C;  1E5W A;  1N7L A;  1NKZ B;  1FZF A;  3RL0 D;  2N1T B;  2HFE D;  3HD7 D;  5AVU B;  1SQX K;  2KSJ A;  2A45 H;  5KJ7 D;  1KIL C;  2I1J A;  1L4A A;  3VYI A;  1SFC D;  5AVR B;  1CI6 A;  5APQ A;  5AW4 B;  1NHL A;  1LTG C;  2FKW B;  2O1J A;  3L36 A;  4DOJ A;  1SQV K;  4I2L C;  1HH0 A;  2XDJ A;  4C7N A;  2JEE A;  2HOD B;  3V5B A;  1NU1 K;  1M1J B;  5AVV B;  5BU5 A;  3CI9 A;  4WY4 C;  2HLO A;  4N78 D;  2WTY A;  2QM7 A;  1JTH B;  2A45 G;  1PFI A;  5CHX A;  1RE3 C;  1LTI C;  1RF0 C;  2R3C A;  1J1E C;  1GL2 A;  3HUS A;  3E1I A;  4DZO A;  1ZLL A;  2IPP A;  3P8C D;  4IFD K;  3TYY A;  1HGZ A;  2Q3I A;  5CCG D;  2IFN A;  3B5N B;  3BRV B;  1KQL A;  3NXS A;  3VP9 A;  1HTL C;  1IK9 A;  4HYT B;  5APT A;  1IFJ A;  3H32 A;  4XE5 B;  2YKO A;  1NKN A;  3P7K A;  1IFM A;  2WPS A;  1NWQ A;  4LC1 A;  2NPS C;  3U1A A;  1ZR2 A;  1LT9 C;  3HTK A;  1ZN5 A;  1IJD B;  1NTZ K;  1NH4 A;  3KPE A;  2XKM A;  4GT1 A;  5BVZ A;  2H43 A;  3SWY A;  1FAV A;  1FBM A;  1N2D C;  3B5N D;  3GHG C;  3TNU A;  3M91 A;  3TK1 A;  1DX7 A;  2WPR A;  2R5D A;  1L0N K;  5AW1 B;  2O01 H;  1MFZ A;  1L0L K;  4RES B;  1LTJ B;  2IX7 C;  5AW0 B;  3U59 A;  3RK3 C;  5APW A;  2C0X A;  4Y99 B;  1FZC C;  4N78 E;  4WY4 A;  2HPC A;  1URQ C;  3HD7 A;  4GKG A;  5KJ7 A;  5CMZ A;  2OYI A;  1SFC A;  1KIL B;  5AW9 B;  2FFD A;  1VPC A;  1HJB A;  2Q7C A;  2KB7 P;  1VDF A;  3BRT B;  3P32 A;  2C9L Y;  2E42 A;  4WB4 A;  1NOH A;  2OYH C;  3P8C E;  3BAT A;  1N7S C;  2YNY A;  1N73 C;  2E43 A;  2FXM A;  3HRN A;  3MD0 A;  4C46 A;  1GTW A;  4WY4 B;  2XV5 A;  1KIL D;  2PAJ A;  1A02 J;  1RE4 A;  2JJL A;  3M9Q A;  4HH2 A;  2WSC H;  2FFD B;  1LTS C;  1GDT A;  1H89 A;  2HOD A;  2POH A;  4N3Y B;  2Z5I A;  4JYC A;  5APV A;  3HE5 B;  3B8E B;  1M1J A;  2W27 A;  4OH8 B;  3VTP C;  1HWT C;  1MUU A;  4W7Z A;  1QL1 A;  5APU A;  5CCH C;  4WY4 D;  1RF1 C;  2N9B A;  1LWU C;  1GU4 A;  1JTH A;  2PP6 A;  5APX A;  4LGD E;  5CCG A;  2J58 A;  5AVX B;  1GW3 A;  3M06 A;  2WSE H;  1FZE A;  4JYB A;  5CJ4 A;  3CLQ A;  5AVY B;  1NTK K;  5AW6 B;  2R5B A;  1LT9 B;  1S9K E;  1J2J B;  1OXZ A;  4GIF A;  1IFN A;  1W2E A;  3B5N A;  1A02 F;  2LKM A;  5AW5 B;  2CPS A;  3A5T A;  3GHG B;  1LTB C;  1JCC A;  4AUW A;  1T8Z A;  2NPS D;  3L37 A;  1GU5 A;  4JF7 A;  1YTZ I;  5AW2 B;  1FZC B;  2YKP A;  1XTC C;  4XA4 A;  1URQ B;  1YTZ T;  4ZKU A;  1SQQ K;  2I1K A;  2W6A A;  2WPQ A;  1JOC A;  1FU1 A;  2YO2 A;  2R32 A;  1LTJ A;  3M0D A;  3UIA A;  4O9B A;  4WBA A;  3RK3 D;  3A7O A;  3TSI A;  4EOT A;  3IFM A;  2OYH B;  2FYU K;  1N7S B;  1EQ7 A;  2N1T C;  1URQ D;  2GUV A;  1RF1 A;  1FOS F;  1JY2 N;  3VP8 A;  1IO4 A;  2O1K A;  1KIL A;  1CW5 A;  1JY3 N;  4KHX A;  2GM4 A;  2P7J A;  3OA7 A;  1ZR4 A;  5APS A;  3LW5 H;  3CL3 D;  2P2U A;  3I5C A;  3SWF A;  1OWA A;  5AW7 B;  1N7S D;  1LGH B;  1KFN A;  1MZ9 A;  1JMM A;  1LTT C;  5AVS B;  2HYN A;  2BAS A;  1S9K D;  1SLQ A;  2Z5H A;  5BU8 B;  1LWU B;  1RF1 B;  2VRS A;  1T3J A;  1L4A C;  4IFF A;  1RE3 A;  2W6B A;  1QL2 A;  1JCD A;  1RF0 A;  1JO5 A;  3C9I A;  2XU6 A;  3HE5 A;  1SP4 A;  2WZ7 A;  1IFI A;  1Z56 A;  4I6M C;  2FYZ A;  3G3Z A;  5KLV K;  1G2C A;  3MGN A;  3WMM 0;  1JY2 O;  2WT7 B;  1N86 A;  4LLH A;  3T97 A;  2A45 I;  1JY3 O;  3LID A;  5CCH D;  2J59 M;  1HGV A;  1AQ5 A;  2P67 A;  2YKQ A;  4B86 A;  3V2R A;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...