1L0NK

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
49
structure length
49
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 12
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l0nK00
4IFDK 1SQPK 1SQQK 3CLQA 1SQVK 2WSEH 2J59M 1L0LK 1NTMK 1SQBK 2WSFH 1NTZK 5KLVK 2WSCH 3M9QA 2O01H 3G3ZA 1SQXK 2LKMA 2FYUK 1NTKK 2OARA 1NU1K 1L0NK 3LW5H
chains in the Genus database with same CATH superfamily
2H43A 1BGYJ 1BCCE 2ZT9B 4WVZA 1K8AQ 1KN7A 1RHZB 3AE4C 1JCDA 1U57A 3PP5A 1HTLC 2W90A 2C0XA 2GUVA 2IBZD 1KYOE 2WSEH 3C9IA 1ZLLA 3V4WA 1RF1A 3GW6A 3II6A 1T2KC 1VQOP 1OXZA 1S9KD 2WSFH 4BRYA 1XTCC 1SQXJ 3VMAA 2OYHC 2M5AB 2KS1A 1X9VA 1NOHA 3KZIH 3PJSK 2WSSH 3V2PA 4ZMDA 1URQA 3H25A 2B89A 2NZ2A 1M57D 1EZVE 1SQQD 1L2PA 1NKZB 1SFCC 3TDKA 2D2CB 3GG2A 1VQPP 5AVSB 1SQXK 1GTWA 1PGPA 2K9JB 1SQXG 3CI9A 3AE1C 4OGQB 2FBWC 3F89A 4L76A 4PD4D 2OARA 2PRRA 3TNUB 1NHLA 1VPCA 1Y47A 4R4MA 1YJ9P 3O6QA 2BEQD 1ZXGA 2KZIA 1VQLP 4R4LA 1GW4A 1BSHA 1IC2A 1PPJG 2ZT9D 3FXDA 1S5LH 2XNDH 4HKZH 1HH0A 3V5BA 1AJYA 4HB1A 5C39A 3AE2C 1ZMEC 1SP4A 1NTMG 1KILE 3RK3B 3CCUP 2H89C 1NU1J 4IL6X 1X22A 3HD7C 3P8CD 3MP7B 2QRXA 1KFNA 3CWBE 2C9LY 2B9BA 4UB8E 1J1DB 1JMBA 4L74A 1BE3E 1FZEA 1LTTC 1X79B 1L0ND 4U3FG 4WY4A 3MTUE 4YPCA 1N8RQ 4NPFX 1CI6B 1NWQA 2KSJA 2C0WA 2YIUC 3L74J 3H1KJ 3I5CA 1AVOA 3KPEA 5CCGD 1ZV8A 2A45H 4ZKPA 1NTMJ 1SS1A 1KMIZ 2E74D 3JCUH 2WQYC 3M06A 3CX5H 2N1TB 3BATA 1NTKK 2FXOA 2QJKB 3CL3D 1KILB 3CCEP 5AVZB 1LWUB 1BCCG 1SQQJ 3KDPB 5KJ7D 2M3BA 4OVNF 5AW3B 3OA7A 1SQVE 2KNCB 5APTA 1FDMA 3AEFC 1PFIA 4OWFA 2E76D 1FZBA 1NTME 1LTIC 1RF0C 2QIWA 1N73A 4GOEA 2IDBA 2QM7A 3AEDC 3P8MC 3EFGA 1S72P 1OW8A 2W6AA 2KP8A 3HE4A 3BCCJ 5TISE 1URQD 1VF5B 1SQQG 1BGYG 3NXSA 4C7RA 3G4SP 1ZR4A 1BDCA 3L73D 1LGHB 1RH5B 3AEEC 2KIKA 1JCCA 1SQXE 2OTKE 2W83C 3RBZA 4PJ0E 3W67A 4AYCA 1L0NE 1YBKA 2I1JA 4MN4C 1KC8Q 1SLQA 1KQSO 2PFXA 1L0LG 1QL1A 1FZCA 2E42A 1AVYA 1BGYD 2O3JA 2WWWA 3AE3C 1N86A 1SQBJ 3CWBD 1P84I 1MV8A 2E74B 2G3AA 2N1TC 4IOIH 4JF7A 1YIJP 3CCVP 3QH9A 1VQ5P 1FAVA 1OVUA 3H1IJ 1JM0A 1CI6A 2HODB 3L36A 3S4RA 4W80A 3IAOA 3KHUA 1SQVJ 1FDIA 1LTJB 2SPZA 1WT6A 2AEMA 3MUDC 5KKZC 1L0NG 2O01N 2YO2A 4GDOA 1N7SC 1GL2B 5APSA 5AVXB 2QEXP 1SQVK 3CCMP 2OYIB 1QVFO 1SQPE 2N9YB 3BCCD 3H1IE 2E5YA 3BRTB 1LP1B 1W2EA 2RN0A 1NTKD 2ZFCA 3H1HD 5AW9B 1VQ7P 2E43A 1T6AA 3HE5B 2A06G 1H0TA 4WB4A 3WUUA 3A0BE 4BXLA 5BU5A 2IBZI 3IN6A 3JCUE 3UIAA 4D6TJ 3SWKA 3C8VA 2YMYA 2ZXXA 3CX5E 5KJ7A 3D6YA 1H0TB 2A06D 2IYOA 4D6TG 3HUSC 4K3AA 1L4AC 2IBZE 4H13D 3CCSP 2IFMA 3FX0A 2UWJE 2L91A 4OGQC 3CX5I 4N78D 2VRSA 1ZP0C 2AXTE 5E79H 4PV1D 4TLFA 3RK3D 2YXRB 4NPEA 3VOPA 1UIIA 1G1IA 1FZAA 3FXEA 2WVRA 1M8OB 2K9JA 2L5GB 3E7KA 3GHGA 3L71E 1KYOI 2IPPA 5AW7B 3WMM0 3HE4B 3U1AA 1AV1A 1EC5A 5AW5B 2P1JA 3OJAB 4JBZA 1HGVA 2FFDB 3Q3DA 1YTZI 1RE4C 1PGOA 2XKMA 1J1EC 4LLHA 4OGQD 2Q3IA 3HD7B 5GTHH 3G6EP 2OYHA 2H7HA 4I2LC 3MHVA 3GF3A 1JY3O 3H32B 4XE5B 3LW5J 1EQ7A 3T97B 3GHGC 4A7PA 5B66H 1EZVI 1FE6A 1PP9D 2WT7A 1RF1C 2WPQA 2K37A 3K5BA 2J5UA 1AQ5A 2YKQA 3ITKA 3S9OA 3CXHH 1L0LJ 2O01H 1NVOA 2CPSA 4H13B 2Y9ZA 4GOFA 2NPSA 1PPJE 2J58A 3L72J 2V4HA 3VMXA 4EOTA 1NTZD 5L8RJ 1Z56A 3VYIA 1QLED 1DX7A 2IZ1A 5TJHA 5CHXA 2W6JH 1G2CA 1JTHA 2NPSC 1PP9E 3EFFK 2XZRA 5CCGC 2WSEJ 1URQB 3A2AA 1S9KE 1IFNA 3L73J 2R5BA 1VQMP 3L70D 1LTAC 1YYCA 2KLUA 2QJKC 5DJTB 3RL0D 5B5EH 1NGMB 1J1EB 1YQ4C 2O01J 3PRJA 2Q7CA 2QA4P 5AVRB 3CC2P 3GLMA 3EQ2A 3F5HA 1R5SA 5CBNA 3TYYA 1QGKB 1BCCJ 3ZDMA 3Q2YA 1N73B 2JEEA 2P67A 1BSNA 2BCCJ 2M3EA 1RE4A 5APQA 1YITP 1GK6A 5KLVK 1IO4A 2FYUJ 1RY3A 1U7JA 2P58A 1N7LA 1FC2C 4RESB 5AW8B 2FXPA 4NPDA 1K73Q 1RQUA 3HTKB 1RF0A 2N1TA 2H88C 3H1KG 1M1JA 1M1JC 1PV3A 1L4AD 3KQGA 4H13C 4KJMA 1LWUA 1G2CB 1JTHB 1YQ3C 3CXHE 3LIDA 1KQFB 1JMMA 3MIWA 1NTZJ 3H1HE 1MUUA 3RK3C 2YXQB 1GDTA 3L70E 1FJKA 1VQKP 3CC7P 1KV4A 1LTBC 2BCCE 3H1IG 3TSIA 4Z1MH 1A02J 2NPSD 1L4AA 2B88A 3LIEA 2KZJA 1PP9J 4LGDE 2WPVB 1MFTA 5EFWB 4C7NA 1YJNP 1K04A 1NU1G 1DH3A 3G9RA 4B86A 1H88A 5KKZB 2WPSA 5H2FH 2QJYC 2XNXA 1GW3A 4AQRD 3QWOC 5BVZA 1GL2C 2J59M 5AVVB 2Y0EA 2OTLP 4N78E 3KXDA 1NU1D 3FWNA 3MZWB 1RE3A 1RE3C 2KOGA 2LR2A 1JY3N 3AEAC 1S4XA 5CJ4A 1ZW0A 3Q5SA 3M91A 1GL2A 1K9MQ 2OYHB 5E79E 3CX5D 1KILD 1M56D 1LTSC 1VQ9P 4EIJA 3NFQA 3Q1MA 1RF1B 3TGUD 1GL2D 5APYA 2LXBA 1BE3J 3B71A 3R2PA 3CCRP 3C1LA 2WZ7A 2Z5HA 5CJ0A 2H8PD 1EDIA 5AW1B 2NPSB 2W6BA 5APWA 3TGUG 3HD7D 5KLVG 1N7SD 2P10A 4RO0A 3HUSB 2QG4A 4HJGH 5B5EE 2PGDA 3L73E 1VF5C 3W68A 2O1JA 2Q1KA 3HTKA 3V6IA 5CBOA 3D70A 3PLNA 1NTKJ 3D71A 3H1JD 2GUSA 1PPJD 2HR3A 2XV5A 3HD7A 3L74G 1IJDB 1SQVG 1DEEG 3H32A 1OVVA 1L0LK 1E5WA 5AW4B 4QMAA 1RQVA 5GTIE 3H1JG 1FZFA 2R5DA 3GMAA 1ZN5A 4GKGA 1VF5D 1NAFA 2MKVA 5KAFH 1LWUC 1SQBG 1HBWA 4BWNA 1OW7A 2RH0A 1KB9I 1ZRTD 3L71G 1EDKA 1S3JA 3H1ID 2YO3A 3RBXA 3HUSA 5AVWB 3RK2C 1NO4A 3CCLP 1FJPA 1KILA 1SQBD 3A7OA 4CPGA 2OGUA 5AVTB 4KHXA 1FZCB 2B87A 5AVQB 1M7LA 2IBZG 2FY8A 4U7JA 5H2FE 2IFNA 4U3FE 2E76C 2FYUD 3CCQP 1KD1Q 3IR9A 3MD0A 4WY4D 1ZR2A 1OMIA 1SQQK 2OQQA 1KZUB 5K5GB 3L74E 1N7SA 4H44B 3EWKA 3B5NA 3T97A 2KI7B 3H1JJ 2LXCB 3L35A 2CPBA 1MKMA 2YKPA 1JEKA 4PV1B 1YI2P 2FKWB 3AE5C 1SQPG 1NAYA 1NH4A 2HPCB 2CK3H 5TISH 1EXIA 1N7SB 1NTZK 1PIXA 1KILC 2KK7A 2P2UA 1M1KQ 1NTKE 1WMKA 4IFFA 3NTNA 1SQPD 3BCCE 1JOCA 2XU6A 3GHGB 2D2CC 1BE3D 2QJPB 1EZVG 2AXCA 1NTMD 4AUWA 1NYHA 5CCHC 1Q90D 1OWAA 1KFMA 1S1CX 3L74D 4IFDK 4WY4B 2I1KA 2Q6QA 1AFOA 2FYZA 1L0LE 1URQC 3AEGC 2Q3EA 5KAIE 1GZLA 2Z4EA 1D7MA 1L0NJ 3CLQA 1T8ZA 4W7YA 1G1JA 4WWIA 5GTIH 2Q9IA 2KYVA 4RKUJ 3PHLA 1JNMA 4I1LA 4PJ0H 2G8YA 3AE6C 3L71D 3IFMA 2RMZA 1E79H 3AECC 3H1LE 1PGJA 1SQQE 1AA0A 3L4FA 1ZRTE 2N9BA 2POHA 3B5ND 1GMJA 2R32A 2GA1A 3N4XA 3CXHI 4M3LA 3H1HG 2YKOA 2KNCA 3A0BH 4RJTA 3D6ZA 2QM8A 1HF9A 3G3ZA 2M8RA 2OTJP 3BRVB 1VQNP 2Y0CA 2HODA 4N3YB 1KTMA 3VN0A 2JR8A 2I8DA 2AEFA 1K05A 4KT0J 3CXHD 3IF4A 1VL2A 2WT7B 3Q5RA 1VQ6P 5AW6B 2WITA 4PD4H 2YMKA 1YHQP 3SFEC 1DD4A 1X8YA 1BCCD 3AE9C 1HGZA 4ASWA 4DJGA 1NJIQ 1S5LX 2A45G 1OFCX 1P84D 3M0DA 1IFPA 1SQBE 2NRGA 2OYOA 3L37A 3A5TA 2IYPA 1L4AB 3CWBG 4C7NB 4XA4A 1LT9B 4IL6H 3B5NB 3CD6P 3M0DC 1BE3G 4YTPC 5APUA 1T2KD 3CC4P 3AE7C 3L72E 4N6JA 5BU8B 4PV1C 3CMAP 2ZT9C 3P8CE 1ZOYC 1IFDA 4HYTB 5APVA 3L72D 1Q7YQ 2HYNA 1IK7A 1S5LE 1L0LD 1HJ0A 2RKLA 2K9YA 3LW5H 3RL0C 4U3FJ 2QVAA 1IZNB 2HLOA 3A3YB 4EYYQ 3L72G 1Q2NA 2IX7C 1LTJC 3SWYA 1LJ2A 2KB7P 4GODA 1CZQA 4DT0A 4PD4E 3V2RA 5GTHE 1FU1A 4JYBA 3VTPC 4JPZB 2HG5D 2GM4A 3RGUA 3GF7A 5CCGA 1AQTA 1NTMK 3AE8C 3L75E 4PD4I 3RK2B 3M9HA 2E74C 3SWFA 2WSFJ 4H0LB 4HH2A 1KB9E 2E75B 4XFJA 1USEA 1UIXA 1XTGB 2E75C 3P32A 1FOSE 5CCHD 3WUTA 4I6MC 4YXDC 2R3CA 2K88A 4H44D 1J2JB 5AW0B 1JO5A 1QEXA 3H1JE 1NU1E 2FYUK 3TGUJ 2FYNC 3I56P 1FS0E 1NU1K 2FYUE 1L0NK 1EDJA 3CCJP 1N2DC 2PP6A 3H1LD 1Y8AA 3KYQA 4JYCA 4D6TD 1H8AA 4I7ZC 1QX8A 1R5LA 1IK9A 2KUBA 4WBAA 2ZVNB 1HUCA 3H1KE 2AEJA 2D2CD 3ABVC 3H1LG 1KB9D 3L73G 4GT1A 4IFMA 4LC1A 4DCKA 4TT3H 2Q5UA 4H44C 3TGUE 2ZYAA 2KXPB 4IL6E 4Y99C 3CMEP 1VQ8P 2OYIA 1LT1A 3BVHA 2YNYA 1W5CE 1GK4A 1MZ9A 5CMZA 3O8ZA 1Q86Q 4H0LC 1N73C 2E75D 1NTZG 2WSCH 2JJLA 2W8ZA 3B5NC 2KSEA 2FFDA 1KB9H 2YIUB 3M9BA 4Y28J 2ZJSE 4DOJA 1R8EA 2IZ0A 1SFCA 1EDLA 2JP3A 5KJ7C 2QJPC 2Y9YA 2WSCJ 2LKMA 2V7QJ 3L75J 3TF5A 1FOSF 1FZCC 3SSUA 3U1CA 2JKVA 1HVVA 3CWBJ 2QJYB 2DW3A 1BDDA 3PH0A 3RK2D 3CPWO 4UB6E 4H0LD 3M0AA 2W27A 2M0BA 1P84H 2Z5IA 1BGYE 3BCCG 2BCCD 1OX3A 1NTKG 4ASVA 1GU5A 3Q5PA 1SQPK 3B8EB 3P7KA 2JWAA 4ZKUA 4BRYB 5KTBA 1T3UA 2HPCA 5KLVD 3H6PA 3MUDA 4K35A 1LTGC 3G71P 5KLVJ 2K1AA 3B4SA 2BCCG 3BASA 2OYIC 1JY2O 2XDJA 1SQBK 3L70G 5AVUB 5AVYB 3RK3E 2WPRA 1LP1A 2E76B 3N7NA 2JDIH 3RL0g 1JUNA 1Q82Q 3L70J 1LT9C 5M1BA 1PZQA 3I55P 5B66E 1W2BO 2R3SA 3JSVC 5KAFE 1CSBA 1KORA 1OVRA 1DD3A 1OZHA 1WRGA 2AXTH 4EDFA 4ZNCA 2E5TA 5KLIC 5DJUB 3L75D 1GU4A 1IFJA 4JQ0D 1USDA 1SFCD 3JC22 1MFZA 3H1KD 1JY3P 1NKNA 3V2QA 2KLVA 2QE7H 1FZGA 4OH8B 5AW2B 3L75G 3OW2O 3L71J 5KLIB 4D6TE 3FGAD 4L75A 1OIPA 1JY2P 1X0TA 1QVGO 1PP9G 3U59A 2ITAA 1YTZT 1EXJA 3USSA 1CW5A 4Y99B 3TK1A 2ZVOB 2A06E 3V4QA 2C9NY 1Y9BA 1KQLA 1JB0J 1IFMA 1JY2N 1SVFA 2JWDA 3O6QB 1OW6A 1LTJA 3NMDA 3A0HH 4GIFA 3VMYA 3H1LJ 2O1KA 2P7JA 3KZIE 3TNUA 3VP9A 3WU2H 4I7ZB 3PTZA 1KQGB 1Q81Q 1M90Q 1U7MA 2ZYDA 2ZXEB 4UB6H 5APXA 2QSIA 1A02F 2ZAEB 3MGNA 1FDOA 1SQPJ 3E1RA 2FFDC 3AEBC 1P84E 2FYNB 4C46A 2ZYGA 4L73A 2N1TD 4O9BA 4WY4C 5CCHA 2WTYA 1SFCB 3HE5A 1DIPA 1SQXD 2BEZF 1EZVD 1VQ4P 1KYOH 1T3JA 2M5AA 2V7QH 3SFDC 2BASA 2FXMA 3S1KA 1NTZE 3H1HJ 3HRNA 3V2NA 1LT9A 1HJBA 5KAIH 1J1DC 1PGQA 2A45I 3E1IA 3VP8A 2PAJA 1YJWP 1PL5A 1VDFA 4UB8H 1KYOD 2HFED 1QL2A 2K3RA 1SQVD 3WUVA 1HWTC 1DEBA 1TU3F 2B87B 2JO1A 3M9QA 4EI2A 1H89A 5KLVE 4U3FD 3OAKA 4W7ZA 2R44A 1FBMA 2WMMA 3A0HE 1IFIA 3WU2E 1LNQA 1M1JB 2Y0DA 3R4YA 3RL0B 2FYUG 2KS1B 2MJZA 4DZOA 1GD2E 1S2EA 3VMZA 4YXWH 3FWLA
chains in the Genus database with same CATH topology
2H43A 3PP5A 1JCDA 1HTLC 2C0XA 2GUVA 3C9IA 2WSEH 1ZLLA 3V4WA 1RF1A 3II6A 1T2KC 1OXZA 1S9KD 2WSFH 1XTCC 2OYHC 1X9VA 1NOHA 3V2PA 1URQA 1NKZB 1SFCC 5AVSB 1SQXK 1GTWA 3CI9A 2OARA 3TNUB 1NHLA 1VPCA 1GW4A 1IC2A 1HH0A 3V5BA 1SP4A 3RK3B 3HD7C 3P8CD 2C9LY 1KFNA 1J1DB 1FZEA 1LTTC 1X79B 4WY4A 3MTUE 1CI6B 1NWQA 2KSJA 2C0WA 5CCGD 3I5CA 3KPEA 1ZV8A 2A45H 4ZKPA 3M06A 2N1TB 3BATA 1NTKK 3CL3D 1KILB 5AVZB 1LWUB 5KJ7D 3KDPB 2M3BA 5AW3B 3OA7A 5APTA 1FZBA 1RF0C 1LTIC 1N73A 2QM7A 3P8MC 3EFGA 2W6AA 2KP8A 3HE4A 1URQD 1ZR4A 3NXSA 4C7RA 1LGHB 1RF1B 1JCCA 4AYCA 2I1JA 1FDMA 1SLQA 2E42A 1QL1A 2WWWA 4I6MC 1N86A 4JF7A 1MV8A 2N1TC 1FAVA 1CI6A 2HODB 3L36A 4W80A 1LTJB 1WT6A 2YO2A 1N7SC 1GL2B 5APSA 5AVXB 1SQVK 2OYIB 3BRTB 1W2EA 2ZFCA 5AW9B 2E43A 3HE5B 4WB4A 5BU5A 3UIAA 2YMYA 5KJ7A 3HUSC 1L4AC 2IFMA 4N78D 3RK3D 2VRSA 1H88A 1G1IA 1FZAA 1FZCC 3GHGA 2L5GB 3WMM0 2IPPA 5AW7B 3HE4B 3U1AA 5AW5B 2P1JA 3OJAB 1HGVA 2FFDB 1YTZI 1RE4C 2XKMA 4LLHA 1J1EC 1PFIA 2OYHA 2Q3IA 3HD7B 2H7HA 4I2LC 1JY3O 3H32B 4XE5B 1EQ7A 3GHGC 2WT7A 1RF1C 2WPQA 1AQ5A 2YKQA 2O01H 2CPSA 2NPSA 2J58A 3VMXA 4EOTA 1Z56A 1DX7A 5CHXA 1G2CA 1JTHA 2NPSC 2XZRA 5CCGC 3A2AA 1URQB 1S9KE 1IFNA 2R5BA 1LTAC 1YYCA 3RL0D 1J1EB 2Q7CA 5AVRB 3EQ2A 3TYYA 1N73B 2JEEA 2P67A 5APQA 1RE4A 1GK6A 5KLVK 1IO4A 1RY3A 1N7LA 4RESB 5AW8B 3HTKB 1RF0A 2N1TA 5AVYB 1M1JA 1M1JC 1FZCA 1L4AD 3KQGA 1LWUA 1G2CB 1JTHB 3VOPA 3VYIA 3LIDA 1JMMA 3MIWA 1GDTA 3RK3C 1MUUA 1FJKA 1LTBC 1A02J 3TSIA 2NPSD 1L4AA 3LIEA 4LGDE 4C7NA 3U1CA 1DH3A 4B86A 2WPSA 2XNXA 1GW3A 4AQRD 5BVZA 1GL2C 2J59M 5AVVB 4N78E 1N73C 1RE3A 1RE3C 2KOGA 1JY3N 3M91A 1GL2A 2OYHB 1KILD 1LTSC 4EIJA 3NFQA 1GL2D 5APYA 3R2PA 2WZ7A 2Z5HA 5CJ0A 2H8PD 5AW1B 2NPSB 2W6BA 5APWA 3HD7D 1N7SD 3HUSB 2O1JA 3HTKA 2GUSA 2XV5A 3HD7A 1IJDB 3H32A 1L0LK 1E5WA 5AW4B 1FZFA 2R5DA 1ZN5A 4GKGA 1NAFA 1LWUC 1HBWA 3RK2C 2YO3A 3HUSA 5AVWB 1NO4A 1FJPA 1KILA 3A7OA 5AVTB 4KHXA 1FZCB 5AVQB 1M7LA 2IFNA 3IR9A 3MD0A 4WY4D 1ZR2A 1SQQK 1KZUB 1N7SA 3B5NA 3T97A 3L35A 2CPBA 2YKPA 2FKWB 1NH4A 2HPCB 1N7SB 1NTZK 1KILC 2P2UA 4IFFA 3NTNA 1JOCA 2XU6A 3GHGB 4AUWA 5CCHC 1OWAA 1KFMA 4IFDK 4WY4B 2I1KA 1AFOA 2FYZA 1URQC 1GZLA 2Z4EA 3CLQA 1T8ZA 4W7YA 1G1JA 2Q9IA 2KYVA 1JNMA 4I1LA 3IFMA 3L4FA 3N4XA 3B5ND 2N9BA 2POHA 2R32A 4M3LA 2YKOA 2QM8A 3G3ZA 2M8RA 3BRVB 2HODA 4N3YB 3VN0A 2WT7B 5AW6B 2WITA 1X8YA 1HGZA 2A45G 3M0DA 3L37A 3A5TA 1L4AB 4C7NB 4XA4A 1LT9B 3B5NB 3M0DC 5APUA 1T2KD 4N6JA 5BU8B 3P8CE 1IFDA 4HYTB 5APVA 2HYNA 3LW5H 3RL0C 2HLOA 3A3YB 2IX7C 1LTJC 3SWYA 2KB7P 1CZQA 3V2RA 1FU1A 4JYBA 3VTPC 2HG5D 2GM4A 5CCGA 1NTMK 3RK2B 3M9HA 3SWFA 4HH2A 1XTGB 3P32A 1FOSE 5CCHD 2R3CA 5AW0B 1J2JB 1JO5A 2FYUK 1NU1K 1L0NK 1N2DC 2PP6A 3KYQA 4JYCA 1H8AA 1IK9A 4WBAA 1HUCA 4IFMA 4GT1A 4LC1A 2Q5UA 4Y99C 2OYIA 3BVHA 2YNYA 1GK4A 1MZ9A 5CMZA 3O8ZA 2WSCH 3B5NC 2JJLA 2FFDA 4DOJA 3M9BA 1SFCA 5KJ7C 2LKMA 1FOSF 1HVVA 3RK2D 3M0AA 2W27A 2Z5IA 1GU5A 1SQPK 3B8EB 3P7KA 4ZKUA 5KTBA 1T3UA 2HPCA 3H6PA 3MUDA 1LTGC 3BASA 2OYIC 1JY2O 2XDJA 1SQBK 5AVUB 2WPRA 3N7NA 1JUNA 1LT9C 1CSBA 1WRGA 1GU4A 1IFJA 1SFCD 1MFZA 1JY3P 1NKNA 3V2QA 2KLVA 1FZGA 4OH8B 5AW2B 1JY2P 3U59A 1YTZT 1CW5A 4Y99B 3TK1A 3V4QA 2C9NY 1KQLA 1IFMA 1JY2N 1SVFA 3NMDA 1LTJA 4GIFA 3VMYA 5CJ4A 3TNUA 2O1KA 2P7JA 3VP9A 2ZXEB 5APXA 1A02F 3MGNA 2FFDC 4C46A 5CCHA 4O9BA 2N1TD 4WY4C 2WTYA 1SFCB 3HE5A 1T3JA 2BASA 2FXMA 3HRNA 1HJBA 3V2NA 1LT9A 1J1DC 2A45I 3E1IA 3VP8A 2PAJA 1VDFA 2HFED 1QL2A 1HWTC 1DEBA 1H89A 3M9QA 3OAKA 4W7ZA 1FBMA 1IFIA 1M1JB 3RL0B 4DZOA 2MJZA 1GD2E 3VMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD K;  1SQP K;  1SQQ K;  3CLQ A;  1SQV K;  2WSE H;  2J59 M;  1L0L K;  1NTM K;  1SQB K;  2WSF H;  1NTZ K;  5KLV K;  2WSC H;  3M9Q A;  2O01 H;  3G3Z A;  1SQX K;  2LKM A;  2FYU K;  1NTK K;  2OAR A;  1NU1 K;  1L0N K;  3LW5 H; 
#chains in the Genus database with same CATH topology
 2H43 A;  1BGY J;  1BCC E;  2ZT9 B;  4WVZ A;  1K8A Q;  1KN7 A;  1RHZ B;  3AE4 C;  1JCD A;  1U57 A;  3PP5 A;  1HTL C;  2W90 A;  2C0X A;  2GUV A;  2IBZ D;  1KYO E;  2WSE H;  3C9I A;  1ZLL A;  3V4W A;  1RF1 A;  3GW6 A;  3II6 A;  1T2K C;  1VQO P;  1OXZ A;  1S9K D;  2WSF H;  4BRY A;  1XTC C;  1SQX J;  3VMA A;  2OYH C;  2M5A B;  2KS1 A;  1X9V A;  1NOH A;  3KZI H;  3PJS K;  2WSS H;  3V2P A;  4ZMD A;  1URQ A;  3H25 A;  2B89 A;  2NZ2 A;  1M57 D;  1EZV E;  1SQQ D;  1L2P A;  1NKZ B;  1SFC C;  3TDK A;  2D2C B;  3GG2 A;  1VQP P;  5AVS B;  1SQX K;  1GTW A;  1PGP A;  2K9J B;  1SQX G;  3CI9 A;  3AE1 C;  4OGQ B;  2FBW C;  3F89 A;  4L76 A;  4PD4 D;  2OAR A;  2PRR A;  3TNU B;  1NHL A;  1VPC A;  1Y47 A;  4R4M A;  1YJ9 P;  3O6Q A;  2BEQ D;  1ZXG A;  2KZI A;  1VQL P;  4R4L A;  1GW4 A;  1BSH A;  1IC2 A;  1PPJ G;  2ZT9 D;  3FXD A;  1S5L H;  2XND H;  4HKZ H;  1HH0 A;  3V5B A;  1AJY A;  4HB1 A;  5C39 A;  3AE2 C;  1ZME C;  1SP4 A;  1NTM G;  1KIL E;  3RK3 B;  3CCU P;  2H89 C;  1NU1 J;  4IL6 X;  1X22 A;  3HD7 C;  3P8C D;  3MP7 B;  2QRX A;  1KFN A;  3CWB E;  2C9L Y;  2B9B A;  4UB8 E;  1J1D B;  1JMB A;  4L74 A;  1BE3 E;  1FZE A;  1LTT C;  1X79 B;  1L0N D;  4U3F G;  4WY4 A;  3MTU E;  4YPC A;  1N8R Q;  4NPF X;  1CI6 B;  1NWQ A;  2KSJ A;  2C0W A;  2YIU C;  3L74 J;  3H1K J;  3I5C A;  1AVO A;  3KPE A;  5CCG D;  1ZV8 A;  2A45 H;  4ZKP A;  1NTM J;  1SS1 A;  1KMI Z;  2E74 D;  3JCU H;  2WQY C;  3M06 A;  3CX5 H;  2N1T B;  3BAT A;  1NTK K;  2FXO A;  2QJK B;  3CL3 D;  1KIL B;  3CCE P;  5AVZ B;  1LWU B;  1BCC G;  1SQQ J;  3KDP B;  5KJ7 D;  2M3B A;  4OVN F;  5AW3 B;  3OA7 A;  1SQV E;  2KNC B;  5APT A;  1FDM A;  3AEF C;  1PFI A;  4OWF A;  2E76 D;  1FZB A;  1NTM E;  1LTI C;  1RF0 C;  2QIW A;  1N73 A;  4GOE A;  2IDB A;  2QM7 A;  3AED C;  3P8M C;  3EFG A;  1S72 P;  1OW8 A;  2W6A A;  2KP8 A;  3HE4 A;  3BCC J;  5TIS E;  1URQ D;  1VF5 B;  1SQQ G;  1BGY G;  3NXS A;  4C7R A;  3G4S P;  1ZR4 A;  1BDC A;  3L73 D;  1LGH B;  1RH5 B;  3AEE C;  2KIK A;  1JCC A;  1SQX E;  2OTK E;  2W83 C;  3RBZ A;  4PJ0 E;  3W67 A;  4AYC A;  1L0N E;  1YBK A;  2I1J A;  4MN4 C;  1KC8 Q;  1SLQ A;  1KQS O;  2PFX A;  1L0L G;  1QL1 A;  1FZC A;  2E42 A;  1AVY A;  1BGY D;  2O3J A;  2WWW A;  3AE3 C;  1N86 A;  1SQB J;  3CWB D;  1P84 I;  1MV8 A;  2E74 B;  2G3A A;  2N1T C;  4IOI H;  4JF7 A;  1YIJ P;  3CCV P;  3QH9 A;  1VQ5 P;  1FAV A;  1OVU A;  3H1I J;  1JM0 A;  1CI6 A;  2HOD B;  3L36 A;  3S4R A;  4W80 A;  3IAO A;  3KHU A;  1SQV J;  1FDI A;  1LTJ B;  2SPZ A;  1WT6 A;  2AEM A;  3MUD C;  5KKZ C;  1L0N G;  2O01 N;  2YO2 A;  4GDO A;  1N7S C;  1GL2 B;  5APS A;  5AVX B;  2QEX P;  1SQV K;  3CCM P;  2OYI B;  1QVF O;  1SQP E;  2N9Y B;  3BCC D;  3H1I E;  2E5Y A;  3BRT B;  1LP1 B;  1W2E A;  2RN0 A;  1NTK D;  2ZFC A;  3H1H D;  5AW9 B;  1VQ7 P;  2E43 A;  1T6A A;  3HE5 B;  2A06 G;  1H0T A;  4WB4 A;  3WUU A;  3A0B E;  4BXL A;  5BU5 A;  2IBZ I;  3IN6 A;  3JCU E;  3UIA A;  4D6T J;  3SWK A;  3C8V A;  2YMY A;  2ZXX A;  3CX5 E;  5KJ7 A;  3D6Y A;  1H0T B;  2A06 D;  2IYO A;  4D6T G;  3HUS C;  4K3A A;  1L4A C;  2IBZ E;  4H13 D;  3CCS P;  2IFM A;  3FX0 A;  2UWJ E;  2L91 A;  4OGQ C;  3CX5 I;  4N78 D;  2VRS A;  1ZP0 C;  2AXT E;  5E79 H;  4PV1 D;  4TLF A;  3RK3 D;  2YXR B;  4NPE A;  3VOP A;  1UII A;  1G1I A;  1FZA A;  3FXE A;  2WVR A;  1M8O B;  2K9J A;  2L5G B;  3E7K A;  3GHG A;  3L71 E;  1KYO I;  2IPP A;  5AW7 B;  3WMM 0;  3HE4 B;  3U1A A;  1AV1 A;  1EC5 A;  5AW5 B;  2P1J A;  3OJA B;  4JBZ A;  1HGV A;  2FFD B;  3Q3D A;  1YTZ I;  1RE4 C;  1PGO A;  2XKM A;  1J1E C;  4LLH A;  4OGQ D;  2Q3I A;  3HD7 B;  5GTH H;  3G6E P;  2OYH A;  2H7H A;  4I2L C;  3MHV A;  3GF3 A;  1JY3 O;  3H32 B;  4XE5 B;  3LW5 J;  1EQ7 A;  3T97 B;  3GHG C;  4A7P A;  5B66 H;  1EZV I;  1FE6 A;  1PP9 D;  2WT7 A;  1RF1 C;  2WPQ A;  2K37 A;  3K5B A;  2J5U A;  1AQ5 A;  2YKQ A;  3ITK A;  3S9O A;  3CXH H;  1L0L J;  2O01 H;  1NVO A;  2CPS A;  4H13 B;  2Y9Z A;  4GOF A;  2NPS A;  1PPJ E;  2J58 A;  3L72 J;  2V4H A;  3VMX A;  4EOT A;  1NTZ D;  5L8R J;  1Z56 A;  3VYI A;  1QLE D;  1DX7 A;  2IZ1 A;  5TJH A;  5CHX A;  2W6J H;  1G2C A;  1JTH A;  2NPS C;  1PP9 E;  3EFF K;  2XZR A;  5CCG C;  2WSE J;  1URQ B;  3A2A A;  1S9K E;  1IFN A;  3L73 J;  2R5B A;  1VQM P;  3L70 D;  1LTA C;  1YYC A;  2KLU A;  2QJK C;  5DJT B;  3RL0 D;  5B5E H;  1NGM B;  1J1E B;  1YQ4 C;  2O01 J;  3PRJ A;  2Q7C A;  2QA4 P;  5AVR B;  3CC2 P;  3GLM A;  3EQ2 A;  3F5H A;  1R5S A;  5CBN A;  3TYY A;  1QGK B;  1BCC J;  3ZDM A;  3Q2Y A;  1N73 B;  2JEE A;  2P67 A;  1BSN A;  2BCC J;  2M3E A;  1RE4 A;  5APQ A;  1YIT P;  1GK6 A;  5KLV K;  1IO4 A;  2FYU J;  1RY3 A;  1U7J A;  2P58 A;  1N7L A;  1FC2 C;  4RES B;  5AW8 B;  2FXP A;  4NPD A;  1K73 Q;  1RQU A;  3HTK B;  1RF0 A;  2N1T A;  2H88 C;  3H1K G;  1M1J A;  1M1J C;  1PV3 A;  1L4A D;  3KQG A;  4H13 C;  4KJM A;  1LWU A;  1G2C B;  1JTH B;  1YQ3 C;  3CXH E;  3LID A;  1KQF B;  1JMM A;  3MIW A;  1NTZ J;  3H1H E;  1MUU A;  3RK3 C;  2YXQ B;  1GDT A;  3L70 E;  1FJK A;  1VQK P;  3CC7 P;  1KV4 A;  1LTB C;  2BCC E;  3H1I G;  3TSI A;  4Z1M H;  1A02 J;  2NPS D;  1L4A A;  2B88 A;  3LIE A;  2KZJ A;  1PP9 J;  4LGD E;  2WPV B;  1MFT A;  5EFW B;  4C7N A;  1YJN P;  1K04 A;  1NU1 G;  1DH3 A;  3G9R A;  4B86 A;  1H88 A;  5KKZ B;  2WPS A;  5H2F H;  2QJY C;  2XNX A;  1GW3 A;  4AQR D;  3QWO C;  5BVZ A;  1GL2 C;  2J59 M;  5AVV B;  2Y0E A;  2OTL P;  4N78 E;  3KXD A;  1NU1 D;  3FWN A;  3MZW B;  1RE3 A;  1RE3 C;  2KOG A;  2LR2 A;  1JY3 N;  3AEA C;  1S4X A;  5CJ4 A;  1ZW0 A;  3Q5S A;  3M91 A;  1GL2 A;  1K9M Q;  2OYH B;  5E79 E;  3CX5 D;  1KIL D;  1M56 D;  1LTS C;  1VQ9 P;  4EIJ A;  3NFQ A;  3Q1M A;  1RF1 B;  3TGU D;  1GL2 D;  5APY A;  2LXB A;  1BE3 J;  3B71 A;  3R2P A;  3CCR P;  3C1L A;  2WZ7 A;  2Z5H A;  5CJ0 A;  2H8P D;  1EDI A;  5AW1 B;  2NPS B;  2W6B A;  5APW A;  3TGU G;  3HD7 D;  5KLV G;  1N7S D;  2P10 A;  4RO0 A;  3HUS B;  2QG4 A;  4HJG H;  5B5E E;  2PGD A;  3L73 E;  1VF5 C;  3W68 A;  2O1J A;  2Q1K A;  3HTK A;  3V6I A;  5CBO A;  3D70 A;  3PLN A;  1NTK J;  3D71 A;  3H1J D;  2GUS A;  1PPJ D;  2HR3 A;  2XV5 A;  3HD7 A;  3L74 G;  1IJD B;  1SQV G;  1DEE G;  3H32 A;  1OVV A;  1L0L K;  1E5W A;  5AW4 B;  4QMA A;  1RQV A;  5GTI E;  3H1J G;  1FZF A;  2R5D A;  3GMA A;  1ZN5 A;  4GKG A;  1VF5 D;  1NAF A;  2MKV A;  5KAF H;  1LWU C;  1SQB G;  1HBW A;  4BWN A;  1OW7 A;  2RH0 A;  1KB9 I;  1ZRT D;  3L71 G;  1EDK A;  1S3J A;  3H1I D;  2YO3 A;  3RBX A;  3HUS A;  5AVW B;  3RK2 C;  1NO4 A;  3CCL P;  1FJP A;  1KIL A;  1SQB D;  3A7O A;  4CPG A;  2OGU A;  5AVT B;  4KHX A;  1FZC B;  2B87 A;  5AVQ B;  1M7L A;  2IBZ G;  2FY8 A;  4U7J A;  5H2F E;  2IFN A;  4U3F E;  2E76 C;  2FYU D;  3CCQ P;  1KD1 Q;  3IR9 A;  3MD0 A;  4WY4 D;  1ZR2 A;  1OMI A;  1SQQ K;  2OQQ A;  1KZU B;  5K5G B;  3L74 E;  1N7S A;  4H44 B;  3EWK A;  3B5N A;  3T97 A;  2KI7 B;  3H1J J;  2LXC B;  3L35 A;  2CPB A;  1MKM A;  2YKP A;  1JEK A;  4PV1 B;  1YI2 P;  2FKW B;  3AE5 C;  1SQP G;  1NAY A;  1NH4 A;  2HPC B;  2CK3 H;  5TIS H;  1EXI A;  1N7S B;  1NTZ K;  1PIX A;  1KIL C;  2KK7 A;  2P2U A;  1M1K Q;  1NTK E;  1WMK A;  4IFF A;  3NTN A;  1SQP D;  3BCC E;  1JOC A;  2XU6 A;  3GHG B;  2D2C C;  1BE3 D;  2QJP B;  1EZV G;  2AXC A;  1NTM D;  4AUW A;  1NYH A;  5CCH C;  1Q90 D;  1OWA A;  1KFM A;  1S1C X;  3L74 D;  4IFD K;  4WY4 B;  2I1K A;  2Q6Q A;  1AFO A;  2FYZ A;  1L0L E;  1URQ C;  3AEG C;  2Q3E A;  5KAI E;  1GZL A;  2Z4E A;  1D7M A;  1L0N J;  3CLQ A;  1T8Z A;  4W7Y A;  1G1J A;  4WWI A;  5GTI H;  2Q9I A;  2KYV A;  4RKU J;  3PHL A;  1JNM A;  4I1L A;  4PJ0 H;  2G8Y A;  3AE6 C;  3L71 D;  3IFM A;  2RMZ A;  1E79 H;  3AEC C;  3H1L E;  1PGJ A;  1SQQ E;  1AA0 A;  3L4F A;  1ZRT E;  2N9B A;  2POH A;  3B5N D;  1GMJ A;  2R32 A;  2GA1 A;  3N4X A;  3CXH I;  4M3L A;  3H1H G;  2YKO A;  2KNC A;  3A0B H;  4RJT A;  3D6Z A;  2QM8 A;  1HF9 A;  3G3Z A;  2M8R A;  2OTJ P;  3BRV B;  1VQN P;  2Y0C A;  2HOD A;  4N3Y B;  1KTM A;  3VN0 A;  2JR8 A;  2I8D A;  2AEF A;  1K05 A;  4KT0 J;  3CXH D;  3IF4 A;  1VL2 A;  2WT7 B;  3Q5R A;  1VQ6 P;  5AW6 B;  2WIT A;  4PD4 H;  2YMK A;  1YHQ P;  3SFE C;  1DD4 A;  1X8Y A;  1BCC D;  3AE9 C;  1HGZ A;  4ASW A;  4DJG A;  1NJI Q;  1S5L X;  2A45 G;  1OFC X;  1P84 D;  3M0D A;  1IFP A;  1SQB E;  2NRG A;  2OYO A;  3L37 A;  3A5T A;  2IYP A;  1L4A B;  3CWB G;  4C7N B;  4XA4 A;  1LT9 B;  4IL6 H;  3B5N B;  3CD6 P;  3M0D C;  1BE3 G;  4YTP C;  5APU A;  1T2K D;  3CC4 P;  3AE7 C;  3L72 E;  4N6J A;  5BU8 B;  4PV1 C;  3CMA P;  2ZT9 C;  3P8C E;  1ZOY C;  1IFD A;  4HYT B;  5APV A;  3L72 D;  1Q7Y Q;  2HYN A;  1IK7 A;  1S5L E;  1L0L D;  1HJ0 A;  2RKL A;  2K9Y A;  3LW5 H;  3RL0 C;  4U3F J;  2QVA A;  1IZN B;  2HLO A;  3A3Y B;  4EYY Q;  3L72 G;  1Q2N A;  2IX7 C;  1LTJ C;  3SWY A;  1LJ2 A;  2KB7 P;  4GOD A;  1CZQ A;  4DT0 A;  4PD4 E;  3V2R A;  5GTH E;  1FU1 A;  4JYB A;  3VTP C;  4JPZ B;  2HG5 D;  2GM4 A;  3RGU A;  3GF7 A;  5CCG A;  1AQT A;  1NTM K;  3AE8 C;  3L75 E;  4PD4 I;  3RK2 B;  3M9H A;  2E74 C;  3SWF A;  2WSF J;  4H0L B;  4HH2 A;  1KB9 E;  2E75 B;  4XFJ A;  1USE A;  1UIX A;  1XTG B;  2E75 C;  3P32 A;  1FOS E;  5CCH D;  3WUT A;  4I6M C;  4YXD C;  2R3C A;  2K88 A;  4H44 D;  1J2J B;  5AW0 B;  1JO5 A;  1QEX A;  3H1J E;  1NU1 E;  2FYU K;  3TGU J;  2FYN C;  3I56 P;  1FS0 E;  1NU1 K;  2FYU E;  1L0N K;  1EDJ A;  3CCJ P;  1N2D C;  2PP6 A;  3H1L D;  1Y8A A;  3KYQ A;  4JYC A;  4D6T D;  1H8A A;  4I7Z C;  1QX8 A;  1R5L A;  1IK9 A;  2KUB A;  4WBA A;  2ZVN B;  1HUC A;  3H1K E;  2AEJ A;  2D2C D;  3ABV C;  3H1L G;  1KB9 D;  3L73 G;  4GT1 A;  4IFM A;  4LC1 A;  4DCK A;  4TT3 H;  2Q5U A;  4H44 C;  3TGU E;  2ZYA A;  2KXP B;  4IL6 E;  4Y99 C;  3CME P;  1VQ8 P;  2OYI A;  1LT1 A;  3BVH A;  2YNY A;  1W5C E;  1GK4 A;  1MZ9 A;  5CMZ A;  3O8Z A;  1Q86 Q;  4H0L C;  1N73 C;  2E75 D;  1NTZ G;  2WSC H;  2JJL A;  2W8Z A;  3B5N C;  2KSE A;  2FFD A;  1KB9 H;  2YIU B;  3M9B A;  4Y28 J;  2ZJS E;  4DOJ A;  1R8E A;  2IZ0 A;  1SFC A;  1EDL A;  2JP3 A;  5KJ7 C;  2QJP C;  2Y9Y A;  2WSC J;  2LKM A;  2V7Q J;  3L75 J;  3TF5 A;  1FOS F;  1FZC C;  3SSU A;  3U1C A;  2JKV A;  1HVV A;  3CWB J;  2QJY B;  2DW3 A;  1BDD A;  3PH0 A;  3RK2 D;  3CPW O;  4UB6 E;  4H0L D;  3M0A A;  2W27 A;  2M0B A;  1P84 H;  2Z5I A;  1BGY E;  3BCC G;  2BCC D;  1OX3 A;  1NTK G;  4ASV A;  1GU5 A;  3Q5P A;  1SQP K;  3B8E B;  3P7K A;  2JWA A;  4ZKU A;  4BRY B;  5KTB A;  1T3U A;  2HPC A;  5KLV D;  3H6P A;  3MUD A;  4K35 A;  1LTG C;  3G71 P;  5KLV J;  2K1A A;  3B4S A;  2BCC G;  3BAS A;  2OYI C;  1JY2 O;  2XDJ A;  1SQB K;  3L70 G;  5AVU B;  5AVY B;  3RK3 E;  2WPR A;  1LP1 A;  2E76 B;  3N7N A;  2JDI H;  3RL0 g;  1JUN A;  1Q82 Q;  3L70 J;  1LT9 C;  5M1B A;  1PZQ A;  3I55 P;  5B66 E;  1W2B O;  2R3S A;  3JSV C;  5KAF E;  1CSB A;  1KOR A;  1OVR A;  1DD3 A;  1OZH A;  1WRG A;  2AXT H;  4EDF A;  4ZNC A;  2E5T A;  5KLI C;  5DJU B;  3L75 D;  1GU4 A;  1IFJ A;  4JQ0 D;  1USD A;  1SFC D;  3JC2 2;  1MFZ A;  3H1K D;  1JY3 P;  1NKN A;  3V2Q A;  2KLV A;  2QE7 H;  1FZG A;  4OH8 B;  5AW2 B;  3L75 G;  3OW2 O;  3L71 J;  5KLI B;  4D6T E;  3FGA D;  4L75 A;  1OIP A;  1JY2 P;  1X0T A;  1QVG O;  1PP9 G;  3U59 A;  2ITA A;  1YTZ T;  1EXJ A;  3USS A;  1CW5 A;  4Y99 B;  3TK1 A;  2ZVO B;  2A06 E;  3V4Q A;  2C9N Y;  1Y9B A;  1KQL A;  1JB0 J;  1IFM A;  1JY2 N;  1SVF A;  2JWD A;  3O6Q B;  1OW6 A;  1LTJ A;  3NMD A;  3A0H H;  4GIF A;  3VMY A;  3H1L J;  2O1K A;  2P7J A;  3KZI E;  3TNU A;  3VP9 A;  3WU2 H;  4I7Z B;  3PTZ A;  1KQG B;  1Q81 Q;  1M90 Q;  1U7M A;  2ZYD A;  2ZXE B;  4UB6 H;  5APX A;  2QSI A;  1A02 F;  2ZAE B;  3MGN A;  1FDO A;  1SQP J;  3E1R A;  2FFD C;  3AEB C;  1P84 E;  2FYN B;  4C46 A;  2ZYG A;  4L73 A;  2N1T D;  4O9B A;  4WY4 C;  5CCH A;  2WTY A;  1SFC B;  3HE5 A;  1DIP A;  1SQX D;  2BEZ F;  1EZV D;  1VQ4 P;  1KYO H;  1T3J A;  2M5A A;  2V7Q H;  3SFD C;  2BAS A;  2FXM A;  3S1K A;  1NTZ E;  3H1H J;  3HRN A;  3V2N A;  1LT9 A;  1HJB A;  5KAI H;  1J1D C;  1PGQ A;  2A45 I;  3E1I A;  3VP8 A;  2PAJ A;  1YJW P;  1PL5 A;  1VDF A;  4UB8 H;  1KYO D;  2HFE D;  1QL2 A;  2K3R A;  1SQV D;  3WUV A;  1HWT C;  1DEB A;  1TU3 F;  2B87 B;  2JO1 A;  3M9Q A;  4EI2 A;  1H89 A;  5KLV E;  4U3F D;  3OAK A;  4W7Z A;  2R44 A;  1FBM A;  2WMM A;  3A0H E;  1IFI A;  3WU2 E;  1LNQ A;  1M1J B;  2Y0D A;  3R4Y A;  3RL0 B;  2FYU G;  2KS1 B;  2MJZ A;  4DZO A;  1GD2 E;  1S2E A;  3VMZ A;  4YXW H;  3FWL A; 
#chains in the Genus database with same CATH homology
 2H43 A;  3PP5 A;  1JCD A;  1HTL C;  2C0X A;  2GUV A;  3C9I A;  2WSE H;  1ZLL A;  3V4W A;  1RF1 A;  3II6 A;  1T2K C;  1OXZ A;  1S9K D;  2WSF H;  1XTC C;  2OYH C;  1X9V A;  1NOH A;  3V2P A;  1URQ A;  1NKZ B;  1SFC C;  5AVS B;  1SQX K;  1GTW A;  3CI9 A;  2OAR A;  3TNU B;  1NHL A;  1VPC A;  1GW4 A;  1IC2 A;  1HH0 A;  3V5B A;  1SP4 A;  3RK3 B;  3HD7 C;  3P8C D;  2C9L Y;  1KFN A;  1J1D B;  1FZE A;  1LTT C;  1X79 B;  4WY4 A;  3MTU E;  1CI6 B;  1NWQ A;  2KSJ A;  2C0W A;  5CCG D;  3I5C A;  3KPE A;  1ZV8 A;  2A45 H;  4ZKP A;  3M06 A;  2N1T B;  3BAT A;  1NTK K;  3CL3 D;  1KIL B;  5AVZ B;  1LWU B;  5KJ7 D;  3KDP B;  2M3B A;  5AW3 B;  3OA7 A;  5APT A;  1FZB A;  1RF0 C;  1LTI C;  1N73 A;  2QM7 A;  3P8M C;  3EFG A;  2W6A A;  2KP8 A;  3HE4 A;  1URQ D;  1ZR4 A;  3NXS A;  4C7R A;  1LGH B;  1RF1 B;  1JCC A;  4AYC A;  2I1J A;  1FDM A;  1SLQ A;  2E42 A;  1QL1 A;  2WWW A;  4I6M C;  1N86 A;  4JF7 A;  1MV8 A;  2N1T C;  1FAV A;  1CI6 A;  2HOD B;  3L36 A;  4W80 A;  1LTJ B;  1WT6 A;  2YO2 A;  1N7S C;  1GL2 B;  5APS A;  5AVX B;  1SQV K;  2OYI B;  3BRT B;  1W2E A;  2ZFC A;  5AW9 B;  2E43 A;  3HE5 B;  4WB4 A;  5BU5 A;  3UIA A;  2YMY A;  5KJ7 A;  3HUS C;  1L4A C;  2IFM A;  4N78 D;  3RK3 D;  2VRS A;  1H88 A;  1G1I A;  1FZA A;  1FZC C;  3GHG A;  2L5G B;  3WMM 0;  2IPP A;  5AW7 B;  3HE4 B;  3U1A A;  5AW5 B;  2P1J A;  3OJA B;  1HGV A;  2FFD B;  1YTZ I;  1RE4 C;  2XKM A;  4LLH A;  1J1E C;  1PFI A;  2OYH A;  2Q3I A;  3HD7 B;  2H7H A;  4I2L C;  1JY3 O;  3H32 B;  4XE5 B;  1EQ7 A;  3GHG C;  2WT7 A;  1RF1 C;  2WPQ A;  1AQ5 A;  2YKQ A;  2O01 H;  2CPS A;  2NPS A;  2J58 A;  3VMX A;  4EOT A;  1Z56 A;  1DX7 A;  5CHX A;  1G2C A;  1JTH A;  2NPS C;  2XZR A;  5CCG C;  3A2A A;  1URQ B;  1S9K E;  1IFN A;  2R5B A;  1LTA C;  1YYC A;  3RL0 D;  1J1E B;  2Q7C A;  5AVR B;  3EQ2 A;  3TYY A;  1N73 B;  2JEE A;  2P67 A;  5APQ A;  1RE4 A;  1GK6 A;  5KLV K;  1IO4 A;  1RY3 A;  1N7L A;  4RES B;  5AW8 B;  3HTK B;  1RF0 A;  2N1T A;  5AVY B;  1M1J A;  1M1J C;  1FZC A;  1L4A D;  3KQG A;  1LWU A;  1G2C B;  1JTH B;  3VOP A;  3VYI A;  3LID A;  1JMM A;  3MIW A;  1GDT A;  3RK3 C;  1MUU A;  1FJK A;  1LTB C;  1A02 J;  3TSI A;  2NPS D;  1L4A A;  3LIE A;  4LGD E;  4C7N A;  3U1C A;  1DH3 A;  4B86 A;  2WPS A;  2XNX A;  1GW3 A;  4AQR D;  5BVZ A;  1GL2 C;  2J59 M;  5AVV B;  4N78 E;  1N73 C;  1RE3 A;  1RE3 C;  2KOG A;  1JY3 N;  3M91 A;  1GL2 A;  2OYH B;  1KIL D;  1LTS C;  4EIJ A;  3NFQ A;  1GL2 D;  5APY A;  3R2P A;  2WZ7 A;  2Z5H A;  5CJ0 A;  2H8P D;  5AW1 B;  2NPS B;  2W6B A;  5APW A;  3HD7 D;  1N7S D;  3HUS B;  2O1J A;  3HTK A;  2GUS A;  2XV5 A;  3HD7 A;  1IJD B;  3H32 A;  1L0L K;  1E5W A;  5AW4 B;  1FZF A;  2R5D A;  1ZN5 A;  4GKG A;  1NAF A;  1LWU C;  1HBW A;  3RK2 C;  2YO3 A;  3HUS A;  5AVW B;  1NO4 A;  1FJP A;  1KIL A;  3A7O A;  5AVT B;  4KHX A;  1FZC B;  5AVQ B;  1M7L A;  2IFN A;  3IR9 A;  3MD0 A;  4WY4 D;  1ZR2 A;  1SQQ K;  1KZU B;  1N7S A;  3B5N A;  3T97 A;  3L35 A;  2CPB A;  2YKP A;  2FKW B;  1NH4 A;  2HPC B;  1N7S B;  1NTZ K;  1KIL C;  2P2U A;  4IFF A;  3NTN A;  1JOC A;  2XU6 A;  3GHG B;  4AUW A;  5CCH C;  1OWA A;  1KFM A;  4IFD K;  4WY4 B;  2I1K A;  1AFO A;  2FYZ A;  1URQ C;  1GZL A;  2Z4E A;  3CLQ A;  1T8Z A;  4W7Y A;  1G1J A;  2Q9I A;  2KYV A;  1JNM A;  4I1L A;  3IFM A;  3L4F A;  3N4X A;  3B5N D;  2N9B A;  2POH A;  2R32 A;  4M3L A;  2YKO A;  2QM8 A;  3G3Z A;  2M8R A;  3BRV B;  2HOD A;  4N3Y B;  3VN0 A;  2WT7 B;  5AW6 B;  2WIT A;  1X8Y A;  1HGZ A;  2A45 G;  3M0D A;  3L37 A;  3A5T A;  1L4A B;  4C7N B;  4XA4 A;  1LT9 B;  3B5N B;  3M0D C;  5APU A;  1T2K D;  4N6J A;  5BU8 B;  3P8C E;  1IFD A;  4HYT B;  5APV A;  2HYN A;  3LW5 H;  3RL0 C;  2HLO A;  3A3Y B;  2IX7 C;  1LTJ C;  3SWY A;  2KB7 P;  1CZQ A;  3V2R A;  1FU1 A;  4JYB A;  3VTP C;  2HG5 D;  2GM4 A;  5CCG A;  1NTM K;  3RK2 B;  3M9H A;  3SWF A;  4HH2 A;  1XTG B;  3P32 A;  1FOS E;  5CCH D;  2R3C A;  5AW0 B;  1J2J B;  1JO5 A;  2FYU K;  1NU1 K;  1L0N K;  1N2D C;  2PP6 A;  3KYQ A;  4JYC A;  1H8A A;  1IK9 A;  4WBA A;  1HUC A;  4IFM A;  4GT1 A;  4LC1 A;  2Q5U A;  4Y99 C;  2OYI A;  3BVH A;  2YNY A;  1GK4 A;  1MZ9 A;  5CMZ A;  3O8Z A;  2WSC H;  3B5N C;  2JJL A;  2FFD A;  4DOJ A;  3M9B A;  1SFC A;  5KJ7 C;  2LKM A;  1FOS F;  1HVV A;  3RK2 D;  3M0A A;  2W27 A;  2Z5I A;  1GU5 A;  1SQP K;  3B8E B;  3P7K A;  4ZKU A;  5KTB A;  1T3U A;  2HPC A;  3H6P A;  3MUD A;  1LTG C;  3BAS A;  2OYI C;  1JY2 O;  2XDJ A;  1SQB K;  5AVU B;  2WPR A;  3N7N A;  1JUN A;  1LT9 C;  1CSB A;  1WRG A;  1GU4 A;  1IFJ A;  1SFC D;  1MFZ A;  1JY3 P;  1NKN A;  3V2Q A;  2KLV A;  1FZG A;  4OH8 B;  5AW2 B;  1JY2 P;  3U59 A;  1YTZ T;  1CW5 A;  4Y99 B;  3TK1 A;  3V4Q A;  2C9N Y;  1KQL A;  1IFM A;  1JY2 N;  1SVF A;  3NMD A;  1LTJ A;  4GIF A;  3VMY A;  5CJ4 A;  3TNU A;  2O1K A;  2P7J A;  3VP9 A;  2ZXE B;  5APX A;  1A02 F;  3MGN A;  2FFD C;  4C46 A;  5CCH A;  4O9B A;  2N1T D;  4WY4 C;  2WTY A;  1SFC B;  3HE5 A;  1T3J A;  2BAS A;  2FXM A;  3HRN A;  1HJB A;  3V2N A;  1LT9 A;  1J1D C;  2A45 I;  3E1I A;  3VP8 A;  2PAJ A;  1VDF A;  2HFE D;  1QL2 A;  1HWT C;  1DEB A;  1H89 A;  3M9Q A;  3OAK A;  4W7Z A;  1FBM A;  1IFI A;  1M1J B;  3RL0 B;  4DZO A;  2MJZ A;  1GD2 E;  3VMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...