1L0NK

Native structure of bovine mitochondrial cytochrome bc1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
49
structure length
49
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVSATDSRLILDWVPTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 12
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l0nK00
5KLVK 2O01H 1SQXK 2OARA 2WSCH 2WSEH 1NTKK 3LW5H 2WSFH 3G3ZA 4IFDK 1SQVK 1L0LK 1SQQK 3CLQA 3M9QA 1NTZK 1SQPK 2J59M 1SQBK 1NU1K 1NTMK 2FYUK 2LKMA 1L0NK
chains in the Genus database with same CATH superfamily
1HUCA 1IFPA 3I5CA 3M0DC 3UIAA 5AW1B 1NTME 3GW6A 1FZCB 3V2RA 2W6BA 1NAYA 4U3FG 5H2FH 2R44A 1LP1B 4I6MC 4W7ZA 3CD6P 1K8AQ 4H13D 1S4XA 1D7MA 3EFGA 3N7NA 1SQPG 3FX0A 1JO5A 3HE5B 1SQPJ 2H43A 1KQLA 1LTTC 1N7LA 3V6IA 3RL0D 1HGVA 1HTLC 2QJPB 4KJMA 1FZCC 1PL5A 1NH4A 1YYCA 5AW4B 3H1HE 3Q5RA 2B87B 1L4AA 4IL6H 2OQQA 1G1IA 3H32B 3MZWB 3WUVA 5AW3B 3KHUA 1L4AC 5BU8B 1L0LD 2H88C 1JUNA 2AXCA 2IYOA 2YMYA 1NTKG 4XA4A 4EYYQ 3AE5C 2Y9YA 3WMM0 2E74D 2Z5HA 4UB6H 2OYHA 5APWA 1SQXD 2RH0A 1JNMA 1NKNA 2ZVOB 2FBWC 2Y0EA 1LT9C 3AEGC 4Y28J 3VYIA 1LTIC 1EZVD 1KORA 4YTPC 3S1KA 3CXHI 3ABVC 3I56P 1N8RQ 2HPCB 1IFJA 3A0HH 3RL0C 3U1AA 2B87A 5AW0B 2W6JH 1J1EC 1HWTC 1TU3F 4AQRD 1FDIA 2R32A 3TNUA 3M06A 3M0DA 1N7SC 2A06E 3L75E 2FXOA 1L0LG 3JCUH 1H8AA 1LTGC 3H25A 3KZIE 1KYOE 1BE3D 1RE3C 5GTIH 1MZ9A 1IJDB 2G3AA 1SVFA 1IK7A 1USDA 1J1EB 2D2CB 2IX7C 2ZYGA 3JC22 1SQPE 3VMZA 2JWDA 1IK9A 1VQPP 3MIWA 3CXHD 3AEEC 1S72P 1L0NJ 1EZVG 1OFCX 1SFCC 1YHQP 1NTMK 3H1JE 2ZJSE 1S5LE 2C0WA 3MUDA 3MUDC 3L74J 3HD7B 2C9LY 1VQNP 1BCCJ 3I55P 3AE7C 1OXZA 1URQD 1BCCG 3CWBJ 3L4FA 2WQYC 5KLVD 1IFIA 1LTSC 4WBAA 1VQLP 1FBMA 3B8EB 3RGUA 4WB4A 4L75A 1M1JB 2O3JA 1VQ5P 1RE3A 1SP4A 3AE3C 2WSFJ 3EQ2A 2N1TC 1S5LX 3A0BH 1CSBA 2H7HA 1KB9I 1VL2A 5APQA 3CL3D 1NTZD 4GDOA 3L73J 2ZXEB 3BCCE 4GKGA 2KOGA 2RMZA 3L71G 3SFEC 1KFNA 2WSEJ 5KKZB 3BVHA 2H89C 2UWJE 3HTKB 5GTHH 3IR9A 1L0LE 1GL2D 1W2BO 5AVRB 2FYNC 4ASWA 2B89A 1YJWP 1M1JC 1N73A 4XFJA 1LTBC 4DJGA 1T2KC 2N1TB 1JY3O 3LW5J 4XE5B 5KLVG 1LT9A 2W27A 2CPSA 2P58A 1NU1D 3AEBC 1LNQA 1PV3A 3GMAA 3M9BA 2N1TD 4PD4H 1LT9B 3CXHH 3H1IJ 3PP5A 1NO4A 2E5YA 2N1TA 3H1JD 5B66E 1NYHA 5CJ0A 1VQ8P 5AVWB 2LXBA 3VMXA 3L75J 1LP1A 2JO1A 1NTKJ 3HTKA 1GU5A 1A02F 1Y9BA 5E79H 4C7RA 1PP9D 2GA1A 2M3EA 1FJPA 4PV1B 2BCCJ 2FYUG 3M9HA 3TK1A 1EXIA 1FZBA 1UIXA 2OTKE 4EDFA 1DX7A 1EQ7A 2WWWA 3D6ZA 2JR8A 4W7YA 4DOJA 1SFCA 1SQPK 2SPZA 1NTMG 1VQOP 1T3JA 2ZT9B 4D6TE 1H89A 1N2DC 2IBZE 5AW9B 2D2CC 5CBNA 1GTWA 2WT7A 1Q82Q 5AW2B 3B4SA 3HRNA 3H1JG 1K9MQ 1NGMB 2OTLP 2YKQA 1NVOA 1X0TA 2ZT9D 4GOFA 4JPZB 2Y0DA 4PJ0H 2QVAA 2BEZF 4PV1C 2LKMA 2J58A 3A2AA 1N7SA 3HD7C 3NTNA 1KV4A 2AEMA 3BCCD 4R4LA 2R3CA 1SQVD 3SWYA 5AVSB 2E75D 1LJ2A 2V4HA 2NPSD 3H6PA 3P8CE 3H1KE 3TDKA 3L70J 4D6TJ 1ZN5A 2A06G 2E75B 4TLFA 4IFDK 1KZUB 5KAIE 2XKMA 2W8ZA 2AXTH 4JYBA 5AVYB 1BDDA 2M3BA 1L0LK 4TT3H 3CCVP 5KKZC 3A5TA 1KFMA 1H88A 3CWBG 2O01N 2YKOA 3RK2D 1CI6A 3KPEA 1SS1A 2XZRA 5TISE 2FYNB 3MD0A 3TSIA 4JBZA 1RQUA 4BXLA 4RJTA 3OW2O 2GUSA 4N78D 1VQKP 2E75C 3BRVB 5APVA 1ZRTE 1JOCA 1WRGA 1JY2N 1QX8A 2G8YA 2YXQB 3G71P 1KYOD 3CCUP 2FFDA 5AVTB 2Q9IA 1PPJG 1L4AD 3H1IE 3CCEP 3L37A 1BGYJ 5CCGA 4IOIH 1PGPA 2E74C 5C39A 1KQSO 1IFDA 1RE4C 4HYTB 3VP8A 2OYIB 1U7MA 1QL1A 2YIUC 3KDPB 3IF4A 1SQQG 1SQQJ 3MP7B 2Z4EA 4ZMDA 2K37A 3HE5A 5APYA 1KILC 1LTJA 1NJIQ 3CC7P 4U3FE 1OIPA 5CHXA 1AJYA 3H1HJ 1NTZK 1SQBJ 1VF5D 3SSUA 4JF7A 2ZT9C 4WWIA 2E74B 1EZVE 2RN0A 1URQB 3G6EP 1KILE 2B9BA 3Q3DA 2XU6A 1YTZI 2BCCG 1MUUA 1SLQA 2FYUJ 1T3UA 3NMDA 4HKZH 5B5EH 3Q5PA 3O6QB 2FYUK 1T2KD 1KILB 3H1KJ 2KLUA 2ITAA 2Q6QA 3FXEA 2Q3EA 3L74E 4EOTA 1ZMEC 4EI2A 2KNCB 2KYVA 5KAFH 1L0NE 2JEEA 1GK6A 2V7QJ 4U3FJ 3VTPC 2H8PD 3AEFC 3P7KA 1LWUA 2JP3A 2N9BA 1FJKA 1T6AA 1FDMA 2ZVNB 3VP9A 3FXDA 4WY4A 2WITA 3N4XA 5AVUB 5AVZB 2KS1B 3S9OA 2QEXP 5KJ7C 1JTHA 2YNYA 1SQQE 2O1KA 5M1BA 3H1LD 1BE3E 1HH0A 5CJ4A 1KILA 1H0TB 1Q90D 1BSNA 2KUBA 4I7ZB 4WVZA 2QG4A 4HJGH 1FZGA 4RO0A 1XTGB 1S9KD 3V2QA 1LTAC 2A45I 2M5AB 4PV1D 2O01H 2K1AA 3GF3A 1GL2C 1SQXK 1YQ4C 3JSVC 3OA7A 4UB8E 2WSEH 1X79B 2FXPA 2YXRB 4GODA 4B86A 1S2EA 2KLVA 4OGQC 1KILD 1FC2C 1HGZA 2J5UA 1BE3G 2E5TA 2KB7P 2YIUB 3HE4B 2HLOA 4I7ZC 2WTYA 1QLED 1NTZE 4IFFA 3L71J 3TGUG 3A3YB 5AW8B 5GTHE 1QEXA 3CCRP 3GF7A 3Q2YA 3SWFA 1GL2B 1DD3A 2MKVA 1L0LJ 4C46A 4Y99C 2W90A 4GIFA 1URQC 2Y9ZA 3KZIH 2BCCE 4AUWA 1M8OB 3K5BA 2FYUE 3MHVA 4C7NA 1HVVA 4PD4E 2QM8A 3GHGA 4L74A 3VOPA 2OYIC 3C8VA 1PGJA 2K9JB 2E43A 2K3RA 2HODA 3RBZA 4BRYB 1KYOH 5GTIE 2FYZA 5KAIH 1X22A 1L0NK 1NTMD 4IFMA 2GUVA 5APTA 1FZFA 2IBZG 1X8YA 1GD2E 2P7JA 2WZ7A 1NKZB 3AE8C 1JCCA 2WSCH 3T97B 1OWAA 3USSA 3HE4A 3PH0A 2ZAEB 1VQ6P 1IO4A 1MKMA 1K04A 1FDOA 3LIEA 1P84I 3SWKA 5AW6B 5AW7B 1QGKB 4Z1MH 3HD7D 1Y8AA 1RF0C 1BE3J 2NPSC 2P10A 2QE7H 3L35A 1JY3N 3L72J 4M3LA 3V4WA 5BU5A 1SQQK 2M5AA 2P1JA 4W80A 1G2CA 5AW5B 1L0ND 3V5BA 1MV8A 1FE6A 2HG5D 2PFXA 1J2JB 3HUSA 3L74D 3W67A 1BDCA 1P84E 1BCCD 1KMIZ 3V2NA 2CPBA 3RK2C 5KLVJ 1SQXE 2C9NY 1Q2NA 1VQ4P 2ZYAA 4BWNA 2PRRA 1KB9D 3L70E 4OGQD 1YTZT 2V7QH 2LXCB 3AE6C 3B5NA 1LWUB 3B5ND 5CCHD 1R8EA 3C1LA 3L72E 1M1KQ 5DJTB 5CCHA 4OGQB 1EC5A 3M91A 2I8DA 3CC2P 2WSFH 1U57A 3RK2B 2KNCA 1G2CB 5K5GB 2R5DA 4UB6E 2XDJA 1AA0A 2IYPA 3FGAD 2PP6A 3L74G 4YPCA 4HB1A 1CZQA 1R5SA 1BSHA 2PGDA 3L73E 4Y99B 3MGNA 2KZJA 1QL2A 1ZW0A 2ZYDA 3W68A 1SQPD 1NU1J 5TISH 4QMAA 1BGYE 2WVRA 2GM4A 3H1ID 1JY3P 1NU1K 2HYNA 3H1JJ 1E5WA 4JQ0D 3EWKA 3IFMA 3TGUJ 2E42A 3S4RA 1YI2P 1IZNB 3A0BE 3L75D 3CMEP 1WMKA 3JCUE 2A06D 1VF5C 2FY8A 2K9JA 1VQ7P 5AVXB 5DJUB 4ASVA 4I1LA 1RF1A 1ZOYC 2OARA 4DCKA 4H0LC 4PJ0E 2BCCD 3P8MC 1P84H 1SQXJ 4U7JA 2OYIA 1FZEA 1SQXG 2IPPA 3C9IA 1GK4A 3P8CD 4ZKPA 2AEJA 3AE1C 3QH9A 2C0XA 3TGUD 2WMMA 3CPWO 2NPSB 3B5NB 4DT0A 1SQVK 1KB9E 1LGHB 3O8ZA 5APUA 1RQVA 2FFDB 5TJHA 1QVGO 1ZR4A 2K9YA 3M9QA 1AV1A 1M7LA 1S1CX 1Q7YQ 2HFED 2FKWB 3NXSA 1P84D 4GT1A 1OZHA 2I1JA 3HUSB 3L75G 4I2LC 3VMYA 3Q5SA 2Q7CA 1PGOA 1EXJA 1FOSE 1MFZA 4LGDE 1NWQA 1DEBA 2IFNA 3BCCJ 1IFMA 1AVOA 3A7OA 4H0LD 2Y0CA 3B5NC 5KTBA 1EDJA 4WY4C 5KAFE 4PD4I 3VMAA 3CMAP 1Q81Q 1M57D 3Q1MA 2R5BA 1PIXA 4H44C 1LWUC 1IC2A 1M90Q 1YBKA 1L2PA 3A0HE 4D6TD 1CW5A 5H2FE 3TYYA 1DH3A 5KLVE 2WPQA 1T8ZA 4ZNCA 3LW5H 1J1DC 2BASA 2PAJA 3AECC 5AVQB 3CWBD 1VPCA 2KS1A 5L8RJ 3RBXA 3T97A 1RF1C 1OW8A 2NRGA 4WY4B 4YXDC 4H13B 2R3SA 3BATA 2IFMA 2HR3A 2NPSA 1RF0A 1PZQA 2XV5A 4A7PA 1FU1A 1ZP0C 4WY4D 1DIPA 1FS0E 1SQBG 3AEAC 1NU1E 2KSEA 3PRJA 2QRXA 4GOEA 4IL6E 1JMBA 2K88A 3WU2H 1NTZJ 1PGQA 1PPJD 1SQBK 1J1DB 1NTZG 2IBZI 2M0BA 2YO3A 3L73D 5APXA 3TGUE 1YITP 1A02J 1RF1B 2QJYC 3LIDA 3MTUE 1S5LH 1KB9H 4CPGA 4D6TG 1KD1Q 1EDIA 4H13C 4UB8H 1W5CE 2KXPB 4NPDA 3CC4P 1VQMP 1VF5B 3V4QA 1EDLA 2KIKA 1GW4A 3IAOA 2N9YB 3GHGC 1OX3A 3AEDC 3BASA 3IN6A 4H0LB 4OWFA 3RK3E 4RKUJ 1NU1G 2L5GB 2RKLA 2MJZA 1KQGB 5CCHC 1SFCD 1SQVE 1U7JA 1GU4A 1HF9A 2QA4P 3CX5I 1JEKA 3H1HD 5CCGC 1SQBD 2WPVB 2IBZD 2FXMA 2Q1KA 3EFFK 2YMKA 1JY2P 3KQGA 1OVUA 3L73G 2FFDC 2VRSA 1NTKD 2A45H 2JKVA 2KZIA 2L91A 1OVVA 1ZLLA 3SFDC 1PP9J 1S9KE 1Q86Q 1PP9G 2CK3H 2IZ1A 2NZ2A 5AVVB 3D70A 3HUSC 3CI9A 2YO2A 2IZ0A 1N73B 1JMMA 1FAVA 3CXHE 3CWBE 3D6YA 4DZOA 1W2EA 1NOHA 2KP8A 2YKPA 1S3JA 3CX5E 3E7KA 3L70G 3NFQA 4H44D 2WSSH 4RESB 1GZLA 2KSJA 5B66H 3KYQA 1FOSF 5KLVK 3PTZA 5E79E 1ZRTD 2D2CD 4H44B 4OVNF 5CCGD 1VQ9P 1KTMA 3H1HG 3VN0A 3U59A 1NTKK 1M1JA 1N73C 1JM0A 3U1CA 1HJBA 4ZKUA 1AQ5A 5KJ7A 3RK3B 3V2PA 1QVFO 1AVYA 1E79H 3BCCG 1SQVJ 2W6AA 3AE4C 4NPFX 5KJ7D 1SQVG 1FZAA 4AYCA 4EIJA 3D71A 3CCSP 3HD7A 3H1LG 2E76C 4JYCA 4HH2A 3RK3D 3H1LJ 4PD4D 3GG2A 1SQBE 1JB0J 3O6QA 1KQFB 3KXDA 2O1JA 1BGYG 3L70D 4OH8B 1ZR2A 1AFOA 4KHXA 1G1JA 2J59M 4N6JA 1JCDA 1LT1A 1BCCE 1NHLA 3G9RA 1URQA 3F5HA 1XTCC 2QJYB 2B88A 3OJAB 2JWAA 3L36A 1X9VA 2DW3A 5CMZA 2WPSA 3AE2C 5BVZA 2QJKC 1YIJP 2ZXXA 2WSCJ 1LTJB 4BRYA 1M56D 1EDKA 2HODB 1DD4A 4L73A 1YJNP 1GMJA 5APSA 3GHGB 3R4YA 3TNUB 1VDFA 2E76D 1Y47A 2WT7B 1PPJE 1RH5B 3H1IG 2Q3IA 3L71D 3CX5H 4IL6X 5EFWB 2M8RA 2ZFCA 1IFNA 5CBOA 2KK7A 4KT0J 1WT6A 1BGYD 2HPCA 3FWNA 1GL2A 2AXTE 3CCJP 2QIWA 3CCMP 1RHZB 2OYHB 1ZXGA 3L72G 1KYOI 1PP9E 2QJPC 3H1LE 4R4MA 2LR2A 3AE9C 1SQQD 3QWOC 2Z5IA 3R2PA 3WUUA 1K73Q 2QSIA 3CX5D 3P32A 3ZDMA 3CCQP 4N78E 1RE4A 1OW7A 2IDBA 4YXWH 1YJ9P 3H32A 3CCLP 1NTMJ 1L4AB 3F89A 1EZVI 1Z56A 1CI6B 1OMIA 2OGUA 1K05A 4K35A 3ITKA 1MFTA 1HBWA 2XNXA 3G4SP 2OYHC 1NTKE 3E1RA 3RL0g 3PHLA 2FYUD 3E1IA 2O01J 2JJLA 4LC1A 4LLHA 1NAFA 3L71E 1GW3A 2AEFA 2OYOA 4MN4C 3WU2E 1H0TA 2I1KA 3PLNA 2WPRA 1OVRA 3H1KD 2P67A 1JTHB 3L72D 1YQ3C 1JY2O 3BRTB 3RK3C 3RL0B 4C7NB 2BEQD 2QM7A 3G3ZA 4K3AA 1L0NG 1RY3A 1FZCA 3PJSK 5KLIC 2E76B 4U3FD 1N7SB 3B71A 1AQTA 4N3YB 3CLQA 4L76A 3TF5A 3OAKA 1KC8Q 1ZV8A 1DEEG 1R5LA 2A45G 1UIIA 4NPEA 4O9BA 1GDTA 1N7SD 3WUTA 2JDIH 2OTJP 1N86A 2KI7B 1OW6A 1USEA 2POHA 2Q5UA 3II6A 5B5EE 3FWLA 3GLMA 1PFIA 1KN7A 1HJ0A 1SFCB 2W83C 2P2UA 2QJKB 2XNDH 5KLIB 3H1KG 1LTJC 3M0AA
chains in the Genus database with same CATH topology
1HUCA 3I5CA 3M0DC 3UIAA 5AW1B 1FZCB 3V2RA 2W6BA 4I6MC 4W7ZA 3EFGA 3N7NA 1JO5A 3HE5B 2H43A 1KQLA 1LTTC 1N7LA 3RL0D 1HGVA 1HTLC 1FZCC 1NH4A 1YYCA 5AW4B 1L4AA 1G1IA 3H32B 5AW3B 1L4AC 1LTJC 5BU8B 1JUNA 2YMYA 4XA4A 3WMM0 2Z5HA 2OYHA 5APWA 1JNMA 1NKNA 3VYIA 1LT9C 1LTIC 2HPCB 1IFJA 3U1AA 3RL0C 5AW0B 1J1EC 1HWTC 4AQRD 2R32A 3TNUA 3M06A 3M0DA 1N7SC 1H8AA 1LTGC 1RE3C 1MZ9A 1IJDB 1SVFA 2IX7C 3U1CA 1J1EB 1PFIA 3VMZA 1IK9A 1GDTA 3MIWA 1SFCC 1NTMK 2C0WA 3MUDA 3HD7B 1OXZA 1URQD 3L4FA 1IFIA 1LTSC 4WBAA 1FBMA 3B8EB 4WB4A 1M1JB 1RE3A 1SP4A 3EQ2A 2N1TC 1CSBA 2H7HA 5APQA 3CL3D 5APTA 2ZXEB 4GKGA 2KOGA 1KFNA 3BVHA 3HTKB 3IR9A 1GL2D 5AVRB 1N73A 1M1JC 1LTBC 1T2KC 2N1TB 1JY3O 4XE5B 1LT9A 2W27A 2CPSA 3M9BA 2N1TD 1LT9B 3PP5A 1NO4A 2N1TA 5CJ0A 5AVWB 3VMXA 3HTKA 1GU5A 1A02F 4C7RA 1FJPA 3TK1A 3M9HA 1FZBA 1DX7A 1EQ7A 2WWWA 4W7YA 4DOJA 1SFCA 1SQPK 1T3JA 1H89A 1N2DC 5AW9B 1GTWA 2WT7A 5AW2B 3HRNA 2YKQA 2LKMA 2J58A 3A2AA 3HD7C 3NTNA 1N7SA 2R3CA 3SWYA 5AVSB 2NPSD 3H6PA 3P8CE 1ZN5A 4IFDK 1KZUB 2XKMA 4JYBA 5AVYB 2M3BA 1L0LK 3A5TA 1KFMA 1H88A 2YKOA 3RK2D 1CI6A 3KPEA 2XZRA 3TSIA 3MD0A 2GUSA 4N78D 3BRVB 5APVA 1JOCA 1WRGA 1JY2N 2FFDA 5AVTB 2Q9IA 1L4AD 3L37A 5CCGA 1IFDA 1RE4C 4HYTB 3VP8A 2OYIB 1QL1A 3KDPB 2Z4EA 3HE5A 5APYA 1KILC 1LTJA 5CHXA 1NTZK 4JF7A 1URQB 2XU6A 1YTZI 1MUUA 1SLQA 3NMDA 1T3UA 2FYUK 1T2KD 1KILB 4EOTA 2KYVA 2JEEA 1GK6A 2H8PD 3P7KA 1LWUA 2N9BA 1FJKA 1FDMA 3VP9A 4WY4A 2WITA 3N4XA 5AVUB 5AVZB 5KJ7C 1JTHA 2YNYA 2O1KA 5CJ4A 1HH0A 1FZGA 1XTGB 1S9KD 3V2QA 1LTAC 2A45I 2O01H 1GL2C 1SQXK 3OA7A 2WSEH 1X79B 4B86A 2OYIC 2KLVA 1KILD 3HE4B 1HGZA 2KB7P 2HLOA 2WTYA 4IFFA 3A3YB 5AW8B 3SWFA 1GL2B 4C46A 4Y99C 4GIFA 1URQC 4AUWA 4C7NA 1HVVA 2QM8A 3GHGA 3VOPA 2E43A 2HODA 2FYZA 1L0NK 4IFMA 2GUVA 1FZFA 1X8YA 1GD2E 2P7JA 2WZ7A 1NKZB 1JCCA 2WSCH 1OWAA 3HE4A 1IO4A 3LIEA 5AW6B 5AW7B 3HD7D 4M3LA 1RF0C 2NPSC 3V4WA 2C9LY 3L35A 1JY3N 5BU5A 1SQQK 2P1JA 4W80A 1G2CA 5AW5B 3V5BA 1MV8A 2HG5D 1J2JB 3HUSA 3V2NA 2CPBA 3RK2C 2C9NY 1YTZT 3B5NA 1LWUB 3B5ND 5CCHD 5CCHA 3M91A 2WSFH 3RK2B 1G2CB 2R5DA 2XDJA 2PP6A 1CZQA 4Y99B 3MGNA 1QL2A 2GM4A 1JY3P 1NU1K 2HYNA 2E42A 1E5WA 3IFMA 5AVXB 4I1LA 1RF1A 2OARA 3P8MC 2OYIA 1FZEA 2IPPA 3C9IA 1GK4A 3P8CD 4ZKPA 2C0XA 2NPSB 3B5NB 1SQVK 1LGHB 3O8ZA 5APUA 2FFDB 1ZR4A 3M9QA 1M7LA 2HFED 2FKWB 3NXSA 4GT1A 2I1JA 3HUSB 4I2LC 3VMYA 1FOSE 2Q7CA 1MFZA 4LGDE 1NWQA 1DEBA 2IFNA 5KTBA 1IFMA 3A7OA 3B5NC 4WY4C 2R5BA 1LWUC 1IC2A 1CW5A 3TYYA 1DH3A 2WPQA 1T8ZA 3LW5H 1J1DC 2BASA 2PAJA 5AVQB 3VTPC 1VPCA 3T97A 1RF1C 4WY4B 3BATA 2IFMA 2NPSA 1RF0A 2XV5A 1FU1A 4WY4D 4C7NB 1SQBK 3M0AA 1J1DB 5APXA 1A02J 2YO3A 1RF1B 3LIDA 3MTUE 3V4QA 1GW4A 3GHGC 3BASA 2L5GB 2MJZA 5CCHC 1SFCD 1GU4A 5CCGC 2FXMA 1JY2P 3KQGA 2FFDC 2VRSA 2A45H 1ZLLA 1S9KE 5AVVB 3HUSC 3CI9A 2YO2A 1N73B 1JMMA 1FAVA 4DZOA 1W2EA 1NOHA 2KP8A 2YKPA 3NFQA 4RESB 1GZLA 2KSJA 1FOSF 3KYQA 5KLVK 5CCGD 3VN0A 3U59A 1NTKK 1M1JA 1N73C 1HJBA 4ZKUA 1AQ5A 5KJ7A 3RK3B 3V2PA 2W6AA 5KJ7D 4AYCA 4EIJA 1FZAA 3HD7A 4JYCA 4HH2A 3RK3D 1ZR2A 1AFOA 4OH8B 2O1JA 4KHXA 1G1JA 2J59M 4N6JA 1JCDA 1NHLA 1URQA 1XTCC 3OJAB 3L36A 1X9VA 5CMZA 2WPSA 5BVZA 1LTJB 2HODB 5APSA 3GHGB 3TNUB 1VDFA 2WT7B 2Q3IA 2M8RA 2ZFCA 1IFNA 1WT6A 2HPCA 1GL2A 2OYHB 3R2PA 2Z5IA 3P32A 4N78E 1RE4A 3H32A 1L4AB 1Z56A 1CI6B 1HBWA 2XNXA 2OYHC 3E1IA 2JJLA 4LC1A 4LLHA 1NAFA 1GW3A 2I1KA 2WPRA 2P67A 1JTHB 3RL0B 3RK3C 1JY2O 3BRTB 2QM7A 3G3ZA 1RY3A 1FZCA 1N7SB 4N3YB 3CLQA 3OAKA 1ZV8A 2A45G 4O9BA 1N7SD 1N86A 2Q5UA 2POHA 3II6A 1SFCB 2P2UA 1KILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV K;  2O01 H;  1SQX K;  2OAR A;  2WSC H;  2WSE H;  1NTK K;  3LW5 H;  2WSF H;  3G3Z A;  4IFD K;  1SQV K;  1L0L K;  1SQQ K;  3CLQ A;  3M9Q A;  1NTZ K;  1SQP K;  2J59 M;  1SQB K;  1NU1 K;  1NTM K;  2FYU K;  2LKM A;  1L0N K; 
#chains in the Genus database with same CATH topology
 1HUC A;  1IFP A;  3I5C A;  3M0D C;  3UIA A;  5AW1 B;  1NTM E;  3GW6 A;  1FZC B;  3V2R A;  2W6B A;  1NAY A;  4U3F G;  5H2F H;  2R44 A;  1LP1 B;  4I6M C;  4W7Z A;  3CD6 P;  1K8A Q;  4H13 D;  1S4X A;  1D7M A;  3EFG A;  3N7N A;  1SQP G;  3FX0 A;  1JO5 A;  3HE5 B;  1SQP J;  2H43 A;  1KQL A;  1LTT C;  1N7L A;  3V6I A;  3RL0 D;  1HGV A;  1HTL C;  2QJP B;  4KJM A;  1FZC C;  1PL5 A;  1NH4 A;  1YYC A;  5AW4 B;  3H1H E;  3Q5R A;  2B87 B;  1L4A A;  4IL6 H;  2OQQ A;  1G1I A;  3H32 B;  3MZW B;  3WUV A;  5AW3 B;  3KHU A;  1L4A C;  5BU8 B;  1L0L D;  2H88 C;  1JUN A;  2AXC A;  2IYO A;  2YMY A;  1NTK G;  4XA4 A;  4EYY Q;  3AE5 C;  2Y9Y A;  3WMM 0;  2E74 D;  2Z5H A;  4UB6 H;  2OYH A;  5APW A;  1SQX D;  2RH0 A;  1JNM A;  1NKN A;  2ZVO B;  2FBW C;  2Y0E A;  1LT9 C;  3AEG C;  4Y28 J;  3VYI A;  1LTI C;  1EZV D;  1KOR A;  4YTP C;  3S1K A;  3CXH I;  3ABV C;  3I56 P;  1N8R Q;  2HPC B;  1IFJ A;  3A0H H;  3RL0 C;  3U1A A;  2B87 A;  5AW0 B;  2W6J H;  1J1E C;  1HWT C;  1TU3 F;  4AQR D;  1FDI A;  2R32 A;  3TNU A;  3M06 A;  3M0D A;  1N7S C;  2A06 E;  3L75 E;  2FXO A;  1L0L G;  3JCU H;  1H8A A;  1LTG C;  3H25 A;  3KZI E;  1KYO E;  1BE3 D;  1RE3 C;  5GTI H;  1MZ9 A;  1IJD B;  2G3A A;  1SVF A;  1IK7 A;  1USD A;  1J1E B;  2D2C B;  2IX7 C;  2ZYG A;  3JC2 2;  1SQP E;  3VMZ A;  2JWD A;  1IK9 A;  1VQP P;  3MIW A;  3CXH D;  3AEE C;  1S72 P;  1L0N J;  1EZV G;  1OFC X;  1SFC C;  1YHQ P;  1NTM K;  3H1J E;  2ZJS E;  1S5L E;  2C0W A;  3MUD A;  3MUD C;  3L74 J;  3HD7 B;  2C9L Y;  1VQN P;  1BCC J;  3I55 P;  3AE7 C;  1OXZ A;  1URQ D;  1BCC G;  3CWB J;  3L4F A;  2WQY C;  5KLV D;  1IFI A;  1LTS C;  4WBA A;  1VQL P;  1FBM A;  3B8E B;  3RGU A;  4WB4 A;  4L75 A;  1M1J B;  2O3J A;  1VQ5 P;  1RE3 A;  1SP4 A;  3AE3 C;  2WSF J;  3EQ2 A;  2N1T C;  1S5L X;  3A0B H;  1CSB A;  2H7H A;  1KB9 I;  1VL2 A;  5APQ A;  3CL3 D;  1NTZ D;  4GDO A;  3L73 J;  2ZXE B;  3BCC E;  4GKG A;  2KOG A;  2RMZ A;  3L71 G;  3SFE C;  1KFN A;  2WSE J;  5KKZ B;  3BVH A;  2H89 C;  2UWJ E;  3HTK B;  5GTH H;  3IR9 A;  1L0L E;  1GL2 D;  1W2B O;  5AVR B;  2FYN C;  4ASW A;  2B89 A;  1YJW P;  1M1J C;  1N73 A;  4XFJ A;  1LTB C;  4DJG A;  1T2K C;  2N1T B;  1JY3 O;  3LW5 J;  4XE5 B;  5KLV G;  1LT9 A;  2W27 A;  2CPS A;  2P58 A;  1NU1 D;  3AEB C;  1LNQ A;  1PV3 A;  3GMA A;  3M9B A;  2N1T D;  4PD4 H;  1LT9 B;  3CXH H;  3H1I J;  3PP5 A;  1NO4 A;  2E5Y A;  2N1T A;  3H1J D;  5B66 E;  1NYH A;  5CJ0 A;  1VQ8 P;  5AVW B;  2LXB A;  3VMX A;  3L75 J;  1LP1 A;  2JO1 A;  1NTK J;  3HTK A;  1GU5 A;  1A02 F;  1Y9B A;  5E79 H;  4C7R A;  1PP9 D;  2GA1 A;  2M3E A;  1FJP A;  4PV1 B;  2BCC J;  2FYU G;  3M9H A;  3TK1 A;  1EXI A;  1FZB A;  1UIX A;  2OTK E;  4EDF A;  1DX7 A;  1EQ7 A;  2WWW A;  3D6Z A;  2JR8 A;  4W7Y A;  4DOJ A;  1SFC A;  1SQP K;  2SPZ A;  1NTM G;  1VQO P;  1T3J A;  2ZT9 B;  4D6T E;  1H89 A;  1N2D C;  2IBZ E;  5AW9 B;  2D2C C;  5CBN A;  1GTW A;  2WT7 A;  1Q82 Q;  5AW2 B;  3B4S A;  3HRN A;  3H1J G;  1K9M Q;  1NGM B;  2OTL P;  2YKQ A;  1NVO A;  1X0T A;  2ZT9 D;  4GOF A;  4JPZ B;  2Y0D A;  4PJ0 H;  2QVA A;  2BEZ F;  4PV1 C;  2LKM A;  2J58 A;  3A2A A;  1N7S A;  3HD7 C;  3NTN A;  1KV4 A;  2AEM A;  3BCC D;  4R4L A;  2R3C A;  1SQV D;  3SWY A;  5AVS B;  2E75 D;  1LJ2 A;  2V4H A;  2NPS D;  3H6P A;  3P8C E;  3H1K E;  3TDK A;  3L70 J;  4D6T J;  1ZN5 A;  2A06 G;  2E75 B;  4TLF A;  4IFD K;  1KZU B;  5KAI E;  2XKM A;  2W8Z A;  2AXT H;  4JYB A;  5AVY B;  1BDD A;  2M3B A;  1L0L K;  4TT3 H;  3CCV P;  5KKZ C;  3A5T A;  1KFM A;  1H88 A;  3CWB G;  2O01 N;  2YKO A;  3RK2 D;  1CI6 A;  3KPE A;  1SS1 A;  2XZR A;  5TIS E;  2FYN B;  3MD0 A;  3TSI A;  4JBZ A;  1RQU A;  4BXL A;  4RJT A;  3OW2 O;  2GUS A;  4N78 D;  1VQK P;  2E75 C;  3BRV B;  5APV A;  1ZRT E;  1JOC A;  1WRG A;  1JY2 N;  1QX8 A;  2G8Y A;  2YXQ B;  3G71 P;  1KYO D;  3CCU P;  2FFD A;  5AVT B;  2Q9I A;  1PPJ G;  1L4A D;  3H1I E;  3CCE P;  3L37 A;  1BGY J;  5CCG A;  4IOI H;  1PGP A;  2E74 C;  5C39 A;  1KQS O;  1IFD A;  1RE4 C;  4HYT B;  3VP8 A;  2OYI B;  1U7M A;  1QL1 A;  2YIU C;  3KDP B;  3IF4 A;  1SQQ G;  1SQQ J;  3MP7 B;  2Z4E A;  4ZMD A;  2K37 A;  3HE5 A;  5APY A;  1KIL C;  1LTJ A;  1NJI Q;  3CC7 P;  4U3F E;  1OIP A;  5CHX A;  1AJY A;  3H1H J;  1NTZ K;  1SQB J;  1VF5 D;  3SSU A;  4JF7 A;  2ZT9 C;  4WWI A;  2E74 B;  1EZV E;  2RN0 A;  1URQ B;  3G6E P;  1KIL E;  2B9B A;  3Q3D A;  2XU6 A;  1YTZ I;  2BCC G;  1MUU A;  1SLQ A;  2FYU J;  1T3U A;  3NMD A;  4HKZ H;  5B5E H;  3Q5P A;  3O6Q B;  2FYU K;  1T2K D;  1KIL B;  3H1K J;  2KLU A;  2ITA A;  2Q6Q A;  3FXE A;  2Q3E A;  3L74 E;  4EOT A;  1ZME C;  4EI2 A;  2KNC B;  2KYV A;  5KAF H;  1L0N E;  2JEE A;  1GK6 A;  2V7Q J;  4U3F J;  3VTP C;  2H8P D;  3AEF C;  3P7K A;  1LWU A;  2JP3 A;  2N9B A;  1FJK A;  1T6A A;  1FDM A;  2ZVN B;  3VP9 A;  3FXD A;  4WY4 A;  2WIT A;  3N4X A;  5AVU B;  5AVZ B;  2KS1 B;  3S9O A;  2QEX P;  5KJ7 C;  1JTH A;  2YNY A;  1SQQ E;  2O1K A;  5M1B A;  3H1L D;  1BE3 E;  1HH0 A;  5CJ4 A;  1KIL A;  1H0T B;  1Q90 D;  1BSN A;  2KUB A;  4I7Z B;  4WVZ A;  2QG4 A;  4HJG H;  1FZG A;  4RO0 A;  1XTG B;  1S9K D;  3V2Q A;  1LTA C;  2A45 I;  2M5A B;  4PV1 D;  2O01 H;  2K1A A;  3GF3 A;  1GL2 C;  1SQX K;  1YQ4 C;  3JSV C;  3OA7 A;  4UB8 E;  2WSE H;  1X79 B;  2FXP A;  2YXR B;  4GOD A;  4B86 A;  1S2E A;  2KLV A;  4OGQ C;  1KIL D;  1FC2 C;  1HGZ A;  2J5U A;  1BE3 G;  2E5T A;  2KB7 P;  2YIU B;  3HE4 B;  2HLO A;  4I7Z C;  2WTY A;  1QLE D;  1NTZ E;  4IFF A;  3L71 J;  3TGU G;  3A3Y B;  5AW8 B;  5GTH E;  1QEX A;  3CCR P;  3GF7 A;  3Q2Y A;  3SWF A;  1GL2 B;  1DD3 A;  2MKV A;  1L0L J;  4C46 A;  4Y99 C;  2W90 A;  4GIF A;  1URQ C;  2Y9Z A;  3KZI H;  2BCC E;  4AUW A;  1M8O B;  3K5B A;  2FYU E;  3MHV A;  4C7N A;  1HVV A;  4PD4 E;  2QM8 A;  3GHG A;  4L74 A;  3VOP A;  2OYI C;  3C8V A;  1PGJ A;  2K9J B;  2E43 A;  2K3R A;  2HOD A;  3RBZ A;  4BRY B;  1KYO H;  5GTI E;  2FYZ A;  5KAI H;  1X22 A;  1L0N K;  1NTM D;  4IFM A;  2GUV A;  5APT A;  1FZF A;  2IBZ G;  1X8Y A;  1GD2 E;  2P7J A;  2WZ7 A;  1NKZ B;  3AE8 C;  1JCC A;  2WSC H;  3T97 B;  1OWA A;  3USS A;  3HE4 A;  3PH0 A;  2ZAE B;  1VQ6 P;  1IO4 A;  1MKM A;  1K04 A;  1FDO A;  3LIE A;  1P84 I;  3SWK A;  5AW6 B;  5AW7 B;  1QGK B;  4Z1M H;  3HD7 D;  1Y8A A;  1RF0 C;  1BE3 J;  2NPS C;  2P10 A;  2QE7 H;  3L35 A;  1JY3 N;  3L72 J;  4M3L A;  3V4W A;  5BU5 A;  1SQQ K;  2M5A A;  2P1J A;  4W80 A;  1G2C A;  5AW5 B;  1L0N D;  3V5B A;  1MV8 A;  1FE6 A;  2HG5 D;  2PFX A;  1J2J B;  3HUS A;  3L74 D;  3W67 A;  1BDC A;  1P84 E;  1BCC D;  1KMI Z;  3V2N A;  2CPB A;  3RK2 C;  5KLV J;  1SQX E;  2C9N Y;  1Q2N A;  1VQ4 P;  2ZYA A;  4BWN A;  2PRR A;  1KB9 D;  3L70 E;  4OGQ D;  1YTZ T;  2V7Q H;  2LXC B;  3AE6 C;  3B5N A;  1LWU B;  3B5N D;  5CCH D;  1R8E A;  3C1L A;  3L72 E;  1M1K Q;  5DJT B;  5CCH A;  4OGQ B;  1EC5 A;  3M91 A;  2I8D A;  3CC2 P;  2WSF H;  1U57 A;  3RK2 B;  2KNC A;  1G2C B;  5K5G B;  2R5D A;  4UB6 E;  2XDJ A;  1AA0 A;  2IYP A;  3FGA D;  2PP6 A;  3L74 G;  4YPC A;  4HB1 A;  1CZQ A;  1R5S A;  1BSH A;  2PGD A;  3L73 E;  4Y99 B;  3MGN A;  2KZJ A;  1QL2 A;  1ZW0 A;  2ZYD A;  3W68 A;  1SQP D;  1NU1 J;  5TIS H;  4QMA A;  1BGY E;  2WVR A;  2GM4 A;  3H1I D;  1JY3 P;  1NU1 K;  2HYN A;  3H1J J;  1E5W A;  4JQ0 D;  3EWK A;  3IFM A;  3TGU J;  2E42 A;  3S4R A;  1YI2 P;  1IZN B;  3A0B E;  3L75 D;  3CME P;  1WMK A;  3JCU E;  2A06 D;  1VF5 C;  2FY8 A;  2K9J A;  1VQ7 P;  5AVX B;  5DJU B;  4ASV A;  4I1L A;  1RF1 A;  1ZOY C;  2OAR A;  4DCK A;  4H0L C;  4PJ0 E;  2BCC D;  3P8M C;  1P84 H;  1SQX J;  4U7J A;  2OYI A;  1FZE A;  1SQX G;  2IPP A;  3C9I A;  1GK4 A;  3P8C D;  4ZKP A;  2AEJ A;  3AE1 C;  3QH9 A;  2C0X A;  3TGU D;  2WMM A;  3CPW O;  2NPS B;  3B5N B;  4DT0 A;  1SQV K;  1KB9 E;  1LGH B;  3O8Z A;  5APU A;  1RQV A;  2FFD B;  5TJH A;  1QVG O;  1ZR4 A;  2K9Y A;  3M9Q A;  1AV1 A;  1M7L A;  1S1C X;  1Q7Y Q;  2HFE D;  2FKW B;  3NXS A;  1P84 D;  4GT1 A;  1OZH A;  2I1J A;  3HUS B;  3L75 G;  4I2L C;  3VMY A;  3Q5S A;  2Q7C A;  1PGO A;  1EXJ A;  1FOS E;  1MFZ A;  4LGD E;  1NWQ A;  1DEB A;  2IFN A;  3BCC J;  1IFM A;  1AVO A;  3A7O A;  4H0L D;  2Y0C A;  3B5N C;  5KTB A;  1EDJ A;  4WY4 C;  5KAF E;  4PD4 I;  3VMA A;  3CMA P;  1Q81 Q;  1M57 D;  3Q1M A;  2R5B A;  1PIX A;  4H44 C;  1LWU C;  1IC2 A;  1M90 Q;  1YBK A;  1L2P A;  3A0H E;  4D6T D;  1CW5 A;  5H2F E;  3TYY A;  1DH3 A;  5KLV E;  2WPQ A;  1T8Z A;  4ZNC A;  3LW5 H;  1J1D C;  2BAS A;  2PAJ A;  3AEC C;  5AVQ B;  3CWB D;  1VPC A;  2KS1 A;  5L8R J;  3RBX A;  3T97 A;  1RF1 C;  1OW8 A;  2NRG A;  4WY4 B;  4YXD C;  4H13 B;  2R3S A;  3BAT A;  2IFM A;  2HR3 A;  2NPS A;  1RF0 A;  1PZQ A;  2XV5 A;  4A7P A;  1FU1 A;  1ZP0 C;  4WY4 D;  1DIP A;  1FS0 E;  1SQB G;  3AEA C;  1NU1 E;  2KSE A;  3PRJ A;  2QRX A;  4GOE A;  4IL6 E;  1JMB A;  2K88 A;  3WU2 H;  1NTZ J;  1PGQ A;  1PPJ D;  1SQB K;  1J1D B;  1NTZ G;  2IBZ I;  2M0B A;  2YO3 A;  3L73 D;  5APX A;  3TGU E;  1YIT P;  1A02 J;  1RF1 B;  2QJY C;  3LID A;  3MTU E;  1S5L H;  1KB9 H;  4CPG A;  4D6T G;  1KD1 Q;  1EDI A;  4H13 C;  4UB8 H;  1W5C E;  2KXP B;  4NPD A;  3CC4 P;  1VQM P;  1VF5 B;  3V4Q A;  1EDL A;  2KIK A;  1GW4 A;  3IAO A;  2N9Y B;  3GHG C;  1OX3 A;  3AED C;  3BAS A;  3IN6 A;  4H0L B;  4OWF A;  3RK3 E;  4RKU J;  1NU1 G;  2L5G B;  2RKL A;  2MJZ A;  1KQG B;  5CCH C;  1SFC D;  1SQV E;  1U7J A;  1GU4 A;  1HF9 A;  2QA4 P;  3CX5 I;  1JEK A;  3H1H D;  5CCG C;  1SQB D;  2WPV B;  2IBZ D;  2FXM A;  2Q1K A;  3EFF K;  2YMK A;  1JY2 P;  3KQG A;  1OVU A;  3L73 G;  2FFD C;  2VRS A;  1NTK D;  2A45 H;  2JKV A;  2KZI A;  2L91 A;  1OVV A;  1ZLL A;  3SFD C;  1PP9 J;  1S9K E;  1Q86 Q;  1PP9 G;  2CK3 H;  2IZ1 A;  2NZ2 A;  5AVV B;  3D70 A;  3HUS C;  3CI9 A;  2YO2 A;  2IZ0 A;  1N73 B;  1JMM A;  1FAV A;  3CXH E;  3CWB E;  3D6Y A;  4DZO A;  1W2E A;  1NOH A;  2KP8 A;  2YKP A;  1S3J A;  3CX5 E;  3E7K A;  3L70 G;  3NFQ A;  4H44 D;  2WSS H;  4RES B;  1GZL A;  2KSJ A;  5B66 H;  3KYQ A;  1FOS F;  5KLV K;  3PTZ A;  5E79 E;  1ZRT D;  2D2C D;  4H44 B;  4OVN F;  5CCG D;  1VQ9 P;  1KTM A;  3H1H G;  3VN0 A;  3U59 A;  1NTK K;  1M1J A;  1N73 C;  1JM0 A;  3U1C A;  1HJB A;  4ZKU A;  1AQ5 A;  5KJ7 A;  3RK3 B;  3V2P A;  1QVF O;  1AVY A;  1E79 H;  3BCC G;  1SQV J;  2W6A A;  3AE4 C;  4NPF X;  5KJ7 D;  1SQV G;  1FZA A;  4AYC A;  4EIJ A;  3D71 A;  3CCS P;  3HD7 A;  3H1L G;  2E76 C;  4JYC A;  4HH2 A;  3RK3 D;  3H1L J;  4PD4 D;  3GG2 A;  1SQB E;  1JB0 J;  3O6Q A;  1KQF B;  3KXD A;  2O1J A;  1BGY G;  3L70 D;  4OH8 B;  1ZR2 A;  1AFO A;  4KHX A;  1G1J A;  2J59 M;  4N6J A;  1JCD A;  1LT1 A;  1BCC E;  1NHL A;  3G9R A;  1URQ A;  3F5H A;  1XTC C;  2QJY B;  2B88 A;  3OJA B;  2JWA A;  3L36 A;  1X9V A;  2DW3 A;  5CMZ A;  2WPS A;  3AE2 C;  5BVZ A;  2QJK C;  1YIJ P;  2ZXX A;  2WSC J;  1LTJ B;  4BRY A;  1M56 D;  1EDK A;  2HOD B;  1DD4 A;  4L73 A;  1YJN P;  1GMJ A;  5APS A;  3GHG B;  3R4Y A;  3TNU B;  1VDF A;  2E76 D;  1Y47 A;  2WT7 B;  1PPJ E;  1RH5 B;  3H1I G;  2Q3I A;  3L71 D;  3CX5 H;  4IL6 X;  5EFW B;  2M8R A;  2ZFC A;  1IFN A;  5CBO A;  2KK7 A;  4KT0 J;  1WT6 A;  1BGY D;  2HPC A;  3FWN A;  1GL2 A;  2AXT E;  3CCJ P;  2QIW A;  3CCM P;  1RHZ B;  2OYH B;  1ZXG A;  3L72 G;  1KYO I;  1PP9 E;  2QJP C;  3H1L E;  4R4M A;  2LR2 A;  3AE9 C;  1SQQ D;  3QWO C;  2Z5I A;  3R2P A;  3WUU A;  1K73 Q;  2QSI A;  3CX5 D;  3P32 A;  3ZDM A;  3CCQ P;  4N78 E;  1RE4 A;  1OW7 A;  2IDB A;  4YXW H;  1YJ9 P;  3H32 A;  3CCL P;  1NTM J;  1L4A B;  3F89 A;  1EZV I;  1Z56 A;  1CI6 B;  1OMI A;  2OGU A;  1K05 A;  4K35 A;  3ITK A;  1MFT A;  1HBW A;  2XNX A;  3G4S P;  2OYH C;  1NTK E;  3E1R A;  3RL0 g;  3PHL A;  2FYU D;  3E1I A;  2O01 J;  2JJL A;  4LC1 A;  4LLH A;  1NAF A;  3L71 E;  1GW3 A;  2AEF A;  2OYO A;  4MN4 C;  3WU2 E;  1H0T A;  2I1K A;  3PLN A;  2WPR A;  1OVR A;  3H1K D;  2P67 A;  1JTH B;  3L72 D;  1YQ3 C;  1JY2 O;  3BRT B;  3RK3 C;  3RL0 B;  4C7N B;  2BEQ D;  2QM7 A;  3G3Z A;  4K3A A;  1L0N G;  1RY3 A;  1FZC A;  3PJS K;  5KLI C;  2E76 B;  4U3F D;  1N7S B;  3B71 A;  1AQT A;  4N3Y B;  3CLQ A;  4L76 A;  3TF5 A;  3OAK A;  1KC8 Q;  1ZV8 A;  1DEE G;  1R5L A;  2A45 G;  1UII A;  4NPE A;  4O9B A;  1GDT A;  1N7S D;  3WUT A;  2JDI H;  2OTJ P;  1N86 A;  2KI7 B;  1OW6 A;  1USE A;  2POH A;  2Q5U A;  3II6 A;  5B5E E;  3FWL A;  3GLM A;  1PFI A;  1KN7 A;  1HJ0 A;  1SFC B;  2W83 C;  2P2U A;  2QJK B;  2XND H;  5KLI B;  3H1K G;  1LTJ C;  3M0A A; 
#chains in the Genus database with same CATH homology
 1HUC A;  3I5C A;  3M0D C;  3UIA A;  5AW1 B;  1FZC B;  3V2R A;  2W6B A;  4I6M C;  4W7Z A;  3EFG A;  3N7N A;  1JO5 A;  3HE5 B;  2H43 A;  1KQL A;  1LTT C;  1N7L A;  3RL0 D;  1HGV A;  1HTL C;  1FZC C;  1NH4 A;  1YYC A;  5AW4 B;  1L4A A;  1G1I A;  3H32 B;  5AW3 B;  1L4A C;  1LTJ C;  5BU8 B;  1JUN A;  2YMY A;  4XA4 A;  3WMM 0;  2Z5H A;  2OYH A;  5APW A;  1JNM A;  1NKN A;  3VYI A;  1LT9 C;  1LTI C;  2HPC B;  1IFJ A;  3U1A A;  3RL0 C;  5AW0 B;  1J1E C;  1HWT C;  4AQR D;  2R32 A;  3TNU A;  3M06 A;  3M0D A;  1N7S C;  1H8A A;  1LTG C;  1RE3 C;  1MZ9 A;  1IJD B;  1SVF A;  2IX7 C;  3U1C A;  1J1E B;  1PFI A;  3VMZ A;  1IK9 A;  1GDT A;  3MIW A;  1SFC C;  1NTM K;  2C0W A;  3MUD A;  3HD7 B;  1OXZ A;  1URQ D;  3L4F A;  1IFI A;  1LTS C;  4WBA A;  1FBM A;  3B8E B;  4WB4 A;  1M1J B;  1RE3 A;  1SP4 A;  3EQ2 A;  2N1T C;  1CSB A;  2H7H A;  5APQ A;  3CL3 D;  5APT A;  2ZXE B;  4GKG A;  2KOG A;  1KFN A;  3BVH A;  3HTK B;  3IR9 A;  1GL2 D;  5AVR B;  1N73 A;  1M1J C;  1LTB C;  1T2K C;  2N1T B;  1JY3 O;  4XE5 B;  1LT9 A;  2W27 A;  2CPS A;  3M9B A;  2N1T D;  1LT9 B;  3PP5 A;  1NO4 A;  2N1T A;  5CJ0 A;  5AVW B;  3VMX A;  3HTK A;  1GU5 A;  1A02 F;  4C7R A;  1FJP A;  3TK1 A;  3M9H A;  1FZB A;  1DX7 A;  1EQ7 A;  2WWW A;  4W7Y A;  4DOJ A;  1SFC A;  1SQP K;  1T3J A;  1H89 A;  1N2D C;  5AW9 B;  1GTW A;  2WT7 A;  5AW2 B;  3HRN A;  2YKQ A;  2LKM A;  2J58 A;  3A2A A;  3HD7 C;  3NTN A;  1N7S A;  2R3C A;  3SWY A;  5AVS B;  2NPS D;  3H6P A;  3P8C E;  1ZN5 A;  4IFD K;  1KZU B;  2XKM A;  4JYB A;  5AVY B;  2M3B A;  1L0L K;  3A5T A;  1KFM A;  1H88 A;  2YKO A;  3RK2 D;  1CI6 A;  3KPE A;  2XZR A;  3TSI A;  3MD0 A;  2GUS A;  4N78 D;  3BRV B;  5APV A;  1JOC A;  1WRG A;  1JY2 N;  2FFD A;  5AVT B;  2Q9I A;  1L4A D;  3L37 A;  5CCG A;  1IFD A;  1RE4 C;  4HYT B;  3VP8 A;  2OYI B;  1QL1 A;  3KDP B;  2Z4E A;  3HE5 A;  5APY A;  1KIL C;  1LTJ A;  5CHX A;  1NTZ K;  4JF7 A;  1URQ B;  2XU6 A;  1YTZ I;  1MUU A;  1SLQ A;  3NMD A;  1T3U A;  2FYU K;  1T2K D;  1KIL B;  4EOT A;  2KYV A;  2JEE A;  1GK6 A;  2H8P D;  3P7K A;  1LWU A;  2N9B A;  1FJK A;  1FDM A;  3VP9 A;  4WY4 A;  2WIT A;  3N4X A;  5AVU B;  5AVZ B;  5KJ7 C;  1JTH A;  2YNY A;  2O1K A;  5CJ4 A;  1HH0 A;  1FZG A;  1XTG B;  1S9K D;  3V2Q A;  1LTA C;  2A45 I;  2O01 H;  1GL2 C;  1SQX K;  3OA7 A;  2WSE H;  1X79 B;  4B86 A;  2OYI C;  2KLV A;  1KIL D;  3HE4 B;  1HGZ A;  2KB7 P;  2HLO A;  2WTY A;  4IFF A;  3A3Y B;  5AW8 B;  3SWF A;  1GL2 B;  4C46 A;  4Y99 C;  4GIF A;  1URQ C;  4AUW A;  4C7N A;  1HVV A;  2QM8 A;  3GHG A;  3VOP A;  2E43 A;  2HOD A;  2FYZ A;  1L0N K;  4IFM A;  2GUV A;  1FZF A;  1X8Y A;  1GD2 E;  2P7J A;  2WZ7 A;  1NKZ B;  1JCC A;  2WSC H;  1OWA A;  3HE4 A;  1IO4 A;  3LIE A;  5AW6 B;  5AW7 B;  3HD7 D;  4M3L A;  1RF0 C;  2NPS C;  3V4W A;  2C9L Y;  3L35 A;  1JY3 N;  5BU5 A;  1SQQ K;  2P1J A;  4W80 A;  1G2C A;  5AW5 B;  3V5B A;  1MV8 A;  2HG5 D;  1J2J B;  3HUS A;  3V2N A;  2CPB A;  3RK2 C;  2C9N Y;  1YTZ T;  3B5N A;  1LWU B;  3B5N D;  5CCH D;  5CCH A;  3M91 A;  2WSF H;  3RK2 B;  1G2C B;  2R5D A;  2XDJ A;  2PP6 A;  1CZQ A;  4Y99 B;  3MGN A;  1QL2 A;  2GM4 A;  1JY3 P;  1NU1 K;  2HYN A;  2E42 A;  1E5W A;  3IFM A;  5AVX B;  4I1L A;  1RF1 A;  2OAR A;  3P8M C;  2OYI A;  1FZE A;  2IPP A;  3C9I A;  1GK4 A;  3P8C D;  4ZKP A;  2C0X A;  2NPS B;  3B5N B;  1SQV K;  1LGH B;  3O8Z A;  5APU A;  2FFD B;  1ZR4 A;  3M9Q A;  1M7L A;  2HFE D;  2FKW B;  3NXS A;  4GT1 A;  2I1J A;  3HUS B;  4I2L C;  3VMY A;  1FOS E;  2Q7C A;  1MFZ A;  4LGD E;  1NWQ A;  1DEB A;  2IFN A;  5KTB A;  1IFM A;  3A7O A;  3B5N C;  4WY4 C;  2R5B A;  1LWU C;  1IC2 A;  1CW5 A;  3TYY A;  1DH3 A;  2WPQ A;  1T8Z A;  3LW5 H;  1J1D C;  2BAS A;  2PAJ A;  5AVQ B;  3VTP C;  1VPC A;  3T97 A;  1RF1 C;  4WY4 B;  3BAT A;  2IFM A;  2NPS A;  1RF0 A;  2XV5 A;  1FU1 A;  4WY4 D;  4C7N B;  1SQB K;  3M0A A;  1J1D B;  5APX A;  1A02 J;  2YO3 A;  1RF1 B;  3LID A;  3MTU E;  3V4Q A;  1GW4 A;  3GHG C;  3BAS A;  2L5G B;  2MJZ A;  5CCH C;  1SFC D;  1GU4 A;  5CCG C;  2FXM A;  1JY2 P;  3KQG A;  2FFD C;  2VRS A;  2A45 H;  1ZLL A;  1S9K E;  5AVV B;  3HUS C;  3CI9 A;  2YO2 A;  1N73 B;  1JMM A;  1FAV A;  4DZO A;  1W2E A;  1NOH A;  2KP8 A;  2YKP A;  3NFQ A;  4RES B;  1GZL A;  2KSJ A;  1FOS F;  3KYQ A;  5KLV K;  5CCG D;  3VN0 A;  3U59 A;  1NTK K;  1M1J A;  1N73 C;  1HJB A;  4ZKU A;  1AQ5 A;  5KJ7 A;  3RK3 B;  3V2P A;  2W6A A;  5KJ7 D;  4AYC A;  4EIJ A;  1FZA A;  3HD7 A;  4JYC A;  4HH2 A;  3RK3 D;  1ZR2 A;  1AFO A;  4OH8 B;  2O1J A;  4KHX A;  1G1J A;  2J59 M;  4N6J A;  1JCD A;  1NHL A;  1URQ A;  1XTC C;  3OJA B;  3L36 A;  1X9V A;  5CMZ A;  2WPS A;  5BVZ A;  1LTJ B;  2HOD B;  5APS A;  3GHG B;  3TNU B;  1VDF A;  2WT7 B;  2Q3I A;  2M8R A;  2ZFC A;  1IFN A;  1WT6 A;  2HPC A;  1GL2 A;  2OYH B;  3R2P A;  2Z5I A;  3P32 A;  4N78 E;  1RE4 A;  3H32 A;  1L4A B;  1Z56 A;  1CI6 B;  1HBW A;  2XNX A;  2OYH C;  3E1I A;  2JJL A;  4LC1 A;  4LLH A;  1NAF A;  1GW3 A;  2I1K A;  2WPR A;  2P67 A;  1JTH B;  3RL0 B;  3RK3 C;  1JY2 O;  3BRT B;  2QM7 A;  3G3Z A;  1RY3 A;  1FZC A;  1N7S B;  4N3Y B;  3CLQ A;  3OAK A;  1ZV8 A;  2A45 G;  4O9B A;  1N7S D;  1N86 A;  2Q5U A;  2POH A;  3II6 A;  1SFC B;  2P2U A;  1KIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...