1L0ZA

The structure of porcine pancreatic elastase complexed with xenon and bromide, cryoprotected with dry paraffin oil
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Xenon derivatization of halide-soaked protein crystals.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l0zA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l0zA01
4WMFA 2BDBA 1MKXH 2B7DH 2ZPSA 1O2JA 1PYTD 2RCEA 4ABFA 1W12U 1DFPA 1AWHB 1OYQA 3T28A 2V3OH 1OP8A 4Z0KA 3BF6H 1BTPA 1MZDA 2GKVE 5L2YH 4WJG2 3N7OA 4X1PU 1Q2WA 1F0RA 1GMHF 1TONA 1IAUA 1GHVH 1JRSA 3IWMA 3SGAE 4MVNA 4UD9H 1LVMA 4O9VA 4LXBH 4NFFA 4TWWA 1TQ7B 1C5TA 1G3CA 1GVKB 4THNH 5ETXA 4JCNA 4YT6H 4FVBA 3UR9A 4UFEH 2AGIX 1AVWA 1TNJA 3PMBB 3MU5A 1AN1E 1O3KA 4BXSA 1BTHH 1GJDB 1NFUA 3FANA 1C2FA 1BT7A 1UTKA 5J4QA 2OC8A 3UFAA 1W2KH 3TH2H 1O3EA 4CBOA 2FOEA 3ZVFA 5B6OA 1SR5C 3T29A 2ZCHP 4GHTA 1GMCG 4INLA 5ABWA 1T8LA 1GDQA 2R3YA 4I8KA 5E0JA 4DCDA 2TGAA 2P3FH 4TY7A 1C5RA 3FP8E 3OY6U 1GBEA 3ZZ6A 2AH4X 4IBLH 4OGYA 3GDVA 3SU6A 3E3TA 1T4VH 2NU2E 3ENSB 2Z9LA 3LGIA 2ZI2H 4ABJA 2R9PA 4NWLA 1JXPA 1Z8IB 4MPWA 1GHYH 4AN7A 2BQ7B 3RC4A 2A4RA 1YBWA 3MH4A 1DLEA 4H42U 4ISIH 1YM0A 4Y10E 3ZZDA 4AFSA 2AGEX 1Z1IA 1Y3UA 3KCGH 5FX5A 3SJIA 4B74A 1MTNC 3IITA 2BDIA 1EZXC 2BLWA 1DWBH 2B9LA 3RC6A 1CGJE 3BIUH 2Z9JA 1CT2E 3WY8A 1DWEH 2ZCLP 3M7QA 5C1YA 4DY7B 1C9TA 3MI4A 1LHEH 1TGNA 1CGIE 3ZVCA 2BVSH 1DM4B 2VWNA 4WWYA 1ESBA 3F9FA 4MNYA 1ELFA 4NA8A 1B7XB 4CR9A 1Z7KA 3Q3XA 1C1UH 3ZZ4A 4AG2A 2QY0B 3BTTE 2ZTZA 1PQAA 2Y7XA 3E90B 1L4DA 1O30A 4ISHH 2VH6A 1G3DA 1O3DA 1WU1A 1AZZA 2J34A 1J17T 4B2AA 1ZPBA 1XUFA 5SGAE 1XM1A 2ZNKH 3VGCC 4IS5A 1GI9B 1A0JA 3U8TH 3EQ0H 2Z9KA 3BEIB 4AGJA 1V2PT 2VINA 1GCTB 1K21H 1UK4A 1TPOA 3SNCA 3P8GA 3PLKA 4KGAA 1Y3VA 1EB2A 2G4UA 3Q3KA 3RXCA 3TNTA 4JZ1A 5EU8A 2ZDVH 1KXCA 3PO1B 1A0HB 3A86A 1P2JA 5T6FA 2ZDKA 6CHAB 1SGQE 4B2BA 1W7XH 3FP6E 3ZZCA 3TJVA 1G2MA 1DWDH 1TPAE 1TA2A 2V35A 3A7VA 3ZVEA 1PJPA 3MNXA 1P11E 1HJ8A 1C2MA 1L1JA 4SGBE 1DWCH 3SV7A 5FBEA 1A5IA 1PQ5A 1MQ5A 2BD2A 2R2MB 2A7JA 3QZQA 3TIUA 1AKSA 3GDUA 1FLEE 1GG6B 1XXFA 2G5NA 4ZHLU 1NRQH 2BZ6H 2PLXA 4FUDA 4I7YH 1VITG 5GCHG 1Z8GA 1E0FD 1O2PA 2VJ1A 3QWCH 2CHAC 1VITH 4B71A 1O3OA 1BTZA 1MZAA 1QGFA 3SJ9A 2PKAB 3SQHE 3EAJA 1O2GH 1OWJA 2BLQA 1GBAA 3GY6A 3VXEH 2SGAA 1BBRK 3SJOA 1MCVA 3BG4C 1GBFA 1GBJA 1O31A 2FYRA 1J14A 3VB4A 2ZGJA 2J2UA 1BRBE 3HATH 3TVJB 3K65B 1TA6A 2UUFB 2ZFSA 4XBCA 4FUEA 1SBWA 1W8BH 3UR6A 1CA8B 2STBE 5DP9A 4WY3A 1QCPA 2FIRH 1H9IE 1UO6A 1G3EA 3SHCH 7KMEH 4Y8XA 5FAHA 3NZIA 4X1NU 4DJZB 3URCA 2B5TB 1O36A 3S7HB 4X1QU 5ESBA 7GCHG 4FUCA 1N8OC 1GWAA 4A6LA 3SNDA 3LC5A 1YCPM 4A5TS 1V2UT 1WYKA 2AGGX 1ZHMA 3H7OA 2O9QA 3CP7A 3Q77A 4CBNA 3SGQE 3D65E 1WUNH 1K1IA 1V2JT 1F0SA 4HZHA 1QJ7B 3BTWE 1J15A 3AW1A 2FZZA 2CJIA 1EASA 1RIWB 2Q6GA 3TITA 1BHXB 2J4IA 3SI4H 3UY9A 1DANH 1KXDA 3HK3B 4K69A 1W11U 3U1IB 3AW0A 2WPHS 1CHGA 2GDDA 3DHKH 1LCYA 1O38A 1BTYA 2PUQH 2ZCKP 4X2XA 5EQQA 1GHAF 1HCGA 5C5OA 1QFKH 1UVSH 3ODFA 3A84A 2B8OH 3FP7E 1DVAH 2B0FA 3F9GA 2ZEBA 1A1RA 1N1LA 1O2ZA 3ZV8A 2BB4A 4B76A 5C20A 2D26C 4FUHA 5GDSH 1BITA 4I8GA 2ZU2A 1MTUA 1WSSH 2C8YB 2FOAA 2BOKA 3VB5A 3A7YA 3DA9B 1THRH 4Y7BA 2ZU1A 1C2EA 1WAYB 1GBHA 4HGCA 1C1QA 3LIWA 1CHOG 1C4V2 5K0HA 2QCYA 3HKJB 5C1UA 1W14U 2O8MA 1HIAB 1C2JA 1QRXA 1TOCB 2Z3EA 3TH4H 1NU9A 2PKAA 1QJ1B 1LPKB 2PFEA 2HNTF 2ZO3H 4D9QA 1YPLH 1FQ3A 1YKTA 2VWMA 1QB6A 2XNIA 4MG3A 2ZG0H 4X0WU 4A1TA 5LH8A 5L30H 1GMDG 5FPTA 1YPGH 1DY8A 1KIGH 4ISLA 3VB7A 1VCPA 2Q6DA 1YCPK 1SGIB 2W7UA 2ZFRH 1NESE 2UUJB 4JMYA 5A0BA 4AGKA 1GBBA 1UTLM 4Y6DA 1BZXE 3B23B 3FZZA 3QZRA 1TYNA 1P10A 1UCYK 2C8XB 3A82A 4K3JA 1CT0E 1ZTKA 2BD7A 2HNTE 2F91A 2ZFTA 4UE7H 4CR5A 1ELVA 3PWBA 4IMQA 1RRKA 5I25A 1CGHA 5E0GA 1HAVB 1LHCH 4ABHA 1DOJA 1DY9A 1IQIA 1OWHA 1NRRH 1FY8E 3O8BA 4INKA 4FUFA 3A8DA 1EAXA 1S6FA 1MD7A 3M7UA 4LK4A 5FCRA 4DURA 1BTUA 2JKHA 3SUFA 3U8OH 1YPJH 1OWEA 4R0IA 1GDNA 3GCHC 4NSVA 3F9HA 1MTNB 1OP0A 1GMHG 2BVXH 2JH6D 4BTTB 2PWXA 2AS9A 3RXHA 3HGNA 4Y79A 2KAIB 2VIVA 4GPGA 3SBKA 4K1EA 1SGFA 1S0QA 1NC6A 5JBCS 2ZECA 2IJOB 1V2ST 2GV6A 2GX4A 3KGPA 1TNIA 3RU4E 4J1YA 2H9HA 2GZ7A 2ZGBH 3A88A 5FBIA 1HLTH 3BIVH 1LTOA 2OINA 3IG6B 3S69A 2FO9A 1NU7B 2QAAA 1AU8A 4MQAA 2F9BH 2QC2A 1YP9A 3BG8A 4AFZA 3P6ZB 1QQ4A 3BTGE 4R8TB 1C5UA 1QA0A 1GJ7B 3Q3YA 1KXBA 1TRYA 3B8JA 4NIYA 3TNSA 2BVRH 1P2OA 1SFQB 3VGCB 2WYGA 2BDYA 3MOCA 1TBQH 1LKBA 3OTJE 3P17H 1AVXA 1O35A 2HALA 2BY6X 3KHVA 1P2IA 3EA9A 3U98H 2BY8X 4ESTE 1K1PA 1TRNA 1SB1H 4BANB 3NK8A 1HIAA 1IQLA 1G36A 1SGDE 2EC9H 1B0EA 1K1JA 2ZDLA 4CRAA 2H6MA 1G9IE 2Y5HA 4RN6A 1ZMLA 1KY9A 4ZKRU 8KME2 1HAIH 4AYYB 2FOHA 1P8VC 2AIQA 2FI5E 3M5MA 4AFUA 3ZZ3A 2VH0A 2XCFA 5C2ZA 1ELGA 3GYLB 3UNSA 5DG6A 2Z9GA 3MNSA 1DUAA 1LPGB 1GI0A 2TRMA 3TU7H 3OY5U 1VJ9U 1DXPA 1L0ZA 2CGAA 1GJAB 3LGWA 1C5XB 2WYJA 3HPTB 3MFJA 1THSH 3UREA 1HAOH 9LPRA 2CHAB 1HAVA 3UQOA 1H8IH 3ATIA 9ESTA 1JMOH 2A7CA 3QTOH 3RXTA 2VIOA 3P92A 4TY6A 1ZRBA 1O2YA 4FU9A 4YT7H 1RTLA 1B0FA 4BXWA 5TCAA 1WV7H 3BTQE 1FAKH 1ZSJA 4YOGA 1QL8A 5C3NA 2P16A 1HNEE 4ZKNU 1GJ5H 3RXDA 1XVMA 2BOHB 1KDQB 2VVVA 3LC3A 4GSOA 3CS0A 1RTFB 4DGJA 1W3CA 1KXAA 2KAIA 1FUJA 5E0HA 5EQRA 1C5QA 1MAYA 2H9EH 3M35A 1BMLA 3MU0A 2D2DA 1SQAA 3MNCA 3SUDA 4ABGA 1BCUH 2GV7A 2G81E 1T8MA 3QDZB 2QXGA 5DK1A 1H9LB 1C2DA 1SLXB 3I29A 1ETTH 1V2MT 3KEEA 3AVZA 1N8OB 4OS4A 3RMMH 1QHRB 1XUHA 1TX8A 4JYUH 1DPOA 1ZHRA 4X8TH 1TGTA 3M37A 3RXKA 4O3TA 1YPHC 4DG4A 3RXGA 2ZTYA 2QXJA 1SOTA 3GCTF 4K8BA 4I8JA 4FVDA 1M9UA 1YC0A 4BAHB 2QA9E 4GCHF 4O3UA 1LO6A 2EEKA 1HAHH 4IGDA 5TCCA 1T8NA 4UEHH 3DUXH 4XDEA 2AMDA 3R0FA 1EXFA 1HJAB 1CBWB 1K2I1 2ANYA 3NUMA 4ZKOU 1C5PA 1E34B 1N6XA 5DP8A 3GDSA 4E05H 1CU1A 2AMQA 4IC6A 3PLBA 1RGQA 1PPGE 2SGFE 1O3AA 1E36B 1BQYA 4U01A 4K1SA 5JYIA 1BMNH 1FY5A 4X1SU 1H1BA 1W0YH 3QTVH 1MKWK 2J9NA 4HTCH 1FMGA 1C1NA 1QQUA 2EI8A 2TBSA 4AX9H 2SGQE 7ESTE 3T26A 2F9NA 5BRRE 5HM9A 1GI1A 3SV9A 1S6HA 2P93A 1ANBA 1SGEE 1XMNB 2H5DA 3RXOA 4YOIA 3PMHB 3UOUA 1T4UH 1ZLRA 1D3QB 5GJ4B 1SHHB 3A80A 2ZQ1A 2ANMH 1P2QA 2ZFPH 4BAMB 4A1XA 3UNQA 1YLDA 2FS9A 1NRNH 2QF3A 1XUIA 2YNAA 1SGYE 1FIZA 3EE0B 1Z6JH 2BY7X 2VIDA 2GCHG 2BXTH 5CMXH 2FLBH 1Y8TA 2OC1A 5T6GA 2FYQA 2Z7FE 5FCKA 2D1JA 1OWDA 5T3HA 3S0NA 1KDQA 1ESAA 4A7IB 2A1DB 2F9VA 3HK6B 1AKSB 1O33A 1WTHD 3RUOA 1O3PB 1ZJDA 2HVXA 3RMLH 3RXAA 2GT7A 4JYVH 1P05A 1QL9A 3SO3A 2BLOA 3DFJA 2PR3A 1VR1H 2ZFQH 5GWZA 4NIVA 3NXPA 3SOSA 2OTVA 1F5LA 1GHAG 1ELCA 3C27B 3ATKA 5DGJA 4X8SH 4Q2KA 3KN2A 4MLFB 4TYDA 2K1QA 3ZVBA 3RMNH 1TB6H 3U8RH 3ATLA 2BDAA 1WQVH 3GCHB 1V2RT 1UVOA 4JZIA 4D8NA 2ZKSA 2Y6TA 3O8CA 1PPCE 2IPHA 3MNBA 3M7TA 4MPVA 1ZHPA 4IC5A 1DT2A 2YNBA 4OS2A 1MU6B 1F2SE 2ZU4A 2FPZA 1GJ9B 4PROA 3UIRA 3BTHE 1AY6H 1O3BA 1GJ8B 3BTKE 5DKMA 2TGTA 1C1MA 1QL7A 1QIXB 3RXVA 1RXPA 1MTWA 3H5CB 2Z9IA 1S0RA 3ZYDA 1P02A 1O3NA 1TX6A 4RKOB 1P2MA 2SGDE 1SFIA 4ZHMU 2XXLA 5F8XA 1CO7E 3PV4A 3PROA 3VB3A 1TX7A 4Y0YE 4KELA 2ZDNA 4X1RU 1S81A 4VGCC 1TABE 3SQEE 4I31A 2C8ZB 1GBLA 3GY7A 2GP9B 3PTNA 3SUEA 4ABIA 1SG8B 3I77A 1XX9A 5AFZH 3RM0H 4NGAH 3M5LA 1Z1JA 2IN2A 3HGPA 1P03A 1GBDA 1TGCA 1WTGH 2PUXB 1QURH 2XC0A 2ZHQH 2ZC9H 2JETC 1YF4A 1F0TA 3KNXA 4ABDA 2VIQA 2PTCE 1FDPA 1HAZB 1K22H 8ESTE 1E35B 5GPIB 3ZVAA 2OQUA 1NPMA 1V3XA 3SV2H 3A8AA 1MBQA 1C2LA 1DX5M 3RXJA 4ZROA 3UOPA 3A8CA 1ZTLA 1VZQH 5EXLA 2A4OA 2LNCA 5IYTA 4BAOB 3Q00A 4JK6A 3MHWU 1LVOA 1J8AA 1JIRA 1NRSH 1BIOA 1E38B 3ELAH 4MNWA 4B73A 3F9EA 5EW2H 3BTFE 1ZR0A 1C5ZB 1MKXK 1UTNA 1JWTA 3M3SA 4Z6AH 3SJKA 1EPTC 2GZ8A 4Y0ZE 1QR3E 1TAWA 4CHAC 1OXGA 4YOJA 4GAWA 8GCHG 2FXRA 2G8TA 4AFQA 1KLIH 2AYWA 3QK1A 4D9RA 1SQOA 1EZUC 1SC8U 4K60A 1ID5H 1F0UA 3P8FA 2BX4A 1ZYOA 2TGPZ 3LPRA 1BHXF 2V0BA 4NA9H 1VGCC 3ZZBA 1QBVH 2Z3DA 5EW1H 3ZZAA 2UUYA 3H7TA 2XWAA 1AO5A 3TK9A 2UWOA 4NG9H 4UFGH 5HXFA 1UHBB 3M3TA 3T25A 1O0DH 3LONA 2BM2A 1BBRE 1SHYA 1V2LT 1TWXB 1RJXB 1Z8JB 2O8LA 2Z94A 2HLCA 2GCHF 2R2WU 4FXGH 1S83A 3W95A 3L3TA 3NCLA 1ARBA 2FTLE 3A87A 3LGTA 3GY5A 3MMGA 1AUTC 1GHXH 4ASHA 1LMWB 3SU4A 2W26A 1DUEA 1EB1H 1V2NT 2HPQH 1EKBB 3RM2H 4GHQA 2BHGA 5LPEA 1MAXA 1TBRH 2O8WA 1XXDA 3DFLA 1ELBA 2BDHA 2NU3E 2NU4E 3T2NA 1RFNA 2XTTB 4MNVA 4FUGA 3A7ZA 1TNKA 1AZ8A 5AF9H 1GHWH 1GGDC 1O39A 2A2XH 3S7KB 4DW2U 1FZZA 2FOBA 3CS7A 1NFXA 3GOVB 1C2IA 3LH1A 1ORFA 2XBVA 2WINI 1VCQA 1ARCA 1C4U2 4AORA 2A31A 1FXYA 2VNTA 4X8VH 1CQQA 4Q7YA 1GBKA 3MH7A 3DT0H 3F6UH 3HKIB 6ESTA 2BQWB 1XUKA 1Y5UT 2BD9A 1BTWA 2XYAA 3E8LA 4ABBA 1SGPE 5F8TA 4JK5A 3BEUA 1AIXH 4X6PA 2HOBA 5A8ZA 3GY2A 5LPFA 2C4FH 2ZP0H 1DS2E 2FOCA 2ZQ2A 4A92A 3QO6A 5C67A 1F5RA 4MTBA 3SJ8A 3GCTG 1SGNE 2PGQB 4GCHG 1IQNA 2C90B 1P2NA 3ESTA 4JZDH 1OWIA 1LDTT 3NPSA 1FN8A 3R3GB 1IQJA 5A8YA 2TPIZ 3UQVA 2OD3B 1TNLA 2Y7ZA 3D49H 1GJBB 4DOQA 4UDWH 1AQ7A 2F9PA 1GVLA 4NCYA 4B1TA 1O5FH 1AB9C 3P8NA 5DP3A 1D6RA 3PYHA 1UHBA 1PPBH 2FOFA 3LKWA 3MU8A 3MH6A 1K9OE 4ZKSU 1TBZH 2O8TA 2ZZUH 5EXMA 1ANCA 2VVCA 3MO9A 4FUJA 1O2UA 1OX1A 2J92A 1HDTH 4AG1A 4BAQB 3GY8A 4CRGA 3SV8A 1GPZA 4Y8YA 5EQSA 1T7CA 3UWIA 1UTMA 3ATWA 1TMUH 1TQ0B 2PSXA 3BTDE 2ZU3A 2G52A 4XFQA 1TGBA 3D23A 4E06H 1A4WH 1C1VH 1UCYE 2UWLA 1ZGIA 4X6NA 3GICB 1L4ZA 1MUEB 1SQTA 3KQBA 4MNXA 1D3PB 1C5VA 1SGRE 1QB9A 3BTME 1Y3WA 5GXPA 4LOYH 1HV7A 3GY3A 1W10U 5FXLA 1IOEA 1ZZZA 2W5EA 1SGTA 1TALA 5ESTE 1SVPA 2OLGA 2AMPA 2SFAA 1BTXA 1THPB 3PTBA 1NROH 1O5GH 2QYIA 3QN7A 3QGNB 3T62A 8GCHF 2ZGCA 1H9HE 4Y7AA 3LOXA 2NWNA 3LGYA 4O97A 1BRCE 3SU1A 2XCNA 5DP4A 4VGCB 2GDEH 1PPEE 5A2MH 1UVTH 2ZHWH 2ZWLH 2D8WA 2Q1JA 3JZ1B 4D7GA 2P94A 1YPEH 6GCHF 1GHZA 1UJ1A 2BZAA 1AFQC 1BA8B 1ZTJA 4GVUA 2JETB 1OYTH 1AUJA 4AB8A 3GYMA 1D3DB 1SOZA 3RXEA 2NU1E 1AWFH 1EZQA 3D62A 4IN1A 1C1RA 2XBXA 4E7RG 4NFEA 3RLYH 5CHAC 3CENA 2BD4A 1JOUB 1G3BA 4E7NA 3AAUA 3A81A 4JYTA 4JZEH 3TLOA 2R0LA 1XKBC 2PSYA 1A3EH 3KQEA 2C8WB 3ZZ5A 1TLDA 1CVWH 8LPRA 1Z71A 1GI5A 4HFPB 3O8RA 1GI7B 1QTFA 1FIWA 2GTBA 4ISNA 4ZXYH 3TK5A 3VEQB 2NU0E 1KLTA 3TPIZ 2OUAA 2DE8A 2G00A 3ATMA 1FPHH 5A0AE 1EPTB 3SNEA 3BV9B 1KXFA 3BG4B 2QN5T 1UTPA 4YZUA 4I8HA 3ODDA 1S84A 4H6TA 2ANWA 1O3FA 2F83A 1LHGH 5AVDA 4WXVA 1GCDA 1A2CH 1YGCH 5E2PA 3STIA 2ODQA 2TGDA 4J2YB 2LPRA 3SORA 2ZPRA 4Y71A 4I33A 1FY4A 4IN2A 2FI4E 1P3CA 2EI6A 4K2YA 1VGCB 1QBOA 1BMAA 5EPYA 5C1XA 4AB9A 3SGBE 1DICA 1W7GH 2H1UA 2WV4A 3C1KA 1YPKH 2YOLA 3RXFA 3A89A 3MWIU 5A0CA 4CRCA 1O2SA 1P0SH 2P59A 4KP0A 5BPEA 1AI8H 1V6DA 1QBNA 1AVGH 1ZPZA 1UTQA 2CV3A 1YPMH 2ZU5A 3PMJA 3GY4A 1IQFA 1GVZA 1O2WA 2J94A 3VB6A 1KSNA 1KXEA 3VXFH 2FI3E 3NWUA 2Y5FA 1HXEH 3MU1A 5EXNA 4MDSA 2J95A 1BB0B 1O2NA 2ALPA 1ANEA 1KLJH 2GCTC 4UONA 1A5GH 1EJMA 5T6DA 4ZHAA 1O37A 1FAXA 2TIOA 1FN6A 5HYOA 1MTSA 4MPUA 3ZVGA 1LVYA 1T8OA 3G01A 1BJVA 1GBMA 2WV5A 3UWJH 1PQ8A 3OYPA 2VWOA 1NT1A 1S5SA 3RXMA 3K9XB 3Q76A 1EAIA 2XBYA 1K1LA 2ZPQA 1SL3A 5DO4H 2ESTE 2GD4B 1GGDB 1UVPA 1HPGA 4BAKB 3A7TA 5L2ZH 3LH3A 1O34A 2VU8E 2WPIS 3LJOA 5E2OA 3V12A 2OC0A 2R0KA 2FLRH 4X2YA 4RSPA 4ZAEA 1WBGB 2FEQH 1GI8B 4NIXA 3SU2A 2UWPA 1Y5BT 2BX3A 3TGJE 3BTEE 4ABEA 5IDKA 1GI4A 2F3CE 2ZHFH 5PTPA 3QUMP 1IQMA 1SGFG 3SU3A 1BBRH 2F9OA 2J38A 2BDCA 3MH5A 1C2HA 3SI3H 5EPNA 5FPSA 1XUJA 1LKAA 1D9IA 1TE0A 1EJNA 2A2QH 4UFFH 3M5OA 4F4OC 2BY5X 1C5LH 1P3EA 1O5CB 2A4GA 5G4BA 2I6QA 2QGRA 1EPTA 1DSTA 1IHTH 3I78A 2XC4A 2PGBB 5E8EH 3EDXB 3F1SB 1FONA 1GBCA 1O2LA 3LU9B 4YLQH 4OGXA 1SGCA 1C1WH 1S85A 2C93B 4JZFH 1C5MD 3UPEA 4FUIA 1O2OA 1JRTA 1L1NA 3S9AA 2BLVA 5HMAA 1F7ZA 2V3HH 1C5SA 2ZIQH 2ZHEH 3SNBA 1A3BH 4U2WA 3T27A 2AIPA 2FDAA 1MTVA 4YESB 5J4SA 2H2ZA 3ITIA 5EG4A 2PTNA 3E1XB 3SW2B 1V2WT 3MTYA 1BMMH 1MD8A 3RU4T 4WH6A 2OBQA 1V2QT 1KYNA 4B75A 1A61H 1TNGA 1O2IA 1GHBF 1AB9B 5DPAA 1WCZA 1FI8A 4HI3A 1LQDB 1MCTA 1O5AB 3P95A 3RXSA 2QXIA 3GCOA 1P12E 4AOQA 4DT7B 3BEFB 4ZUHA 2VB0A 3FVFB 3LT3A 2Q6FA 2RA0A 1IQHA 1NRPH 4ZXXH 2PV9B 3L6PA 3ZZ9A 4NIWA 2VGCC 4WF8A 1A7SA 3TGKE 2CMYA 4BOHA 1V2VT 1O3LA 1WQSA 2CN0H 2HNTC 4CRBA 2QIQA 2BMGB 4H6SB 1AHTH 1HGTH 1YLCA 1TPSA 1P04A 3E0PB 4X2VA 2FMJA 4LZ1H 3A7XA 4YTAA 3AAVA 2OXSA 3PMAB 4WMEA 4Y76A 2SNWA 4YM9A 1MH0A 1F92A 1LQEA 1RD3B 4H4FA 1PFXC 5F8ZA 2ZFFH 2FP7B 1H8DH 5JBAS 1IQKA 1MBMA 1RS0A 1KTTB 3OSYA 1EZSC 2AEIH 1BJUA 1TFXA 1PPHE 2A4QA 1Y59T 3OU0A 3LGVA 1P57B 2FOMB 4NSYA 4O03A 4TPIZ 1PPFE 1DE7H 1ZOMA 1YCPH 1G30B 4CH8B 3SV6A 1NN6A 1HYLA 4I8LA 1AFQB 1GJCB 1KTSB 2FESH 1NFWA 4OS6A 1VCWA 1ZRKA 1UCYH 1C1PA 1HAYB 3UNRA 1OS8A 3A83A 1ZSLA 4MPXA 1GI6A 2F9UA 4OS7A 5CHAB 4ISOA 1NM6A 2BTCE 2DE9A 4K5ZA 3UUZA 1RTKA 3PWCA 1HFDA 4IW4E 3RXPA 1ZPCA 3SUGA 3MO6A 1EAWA 1ANDA 3KF2A 4BTIB 1C5WB 2H9TH 3E6PH 1EP6A 1QA7A 1NS3A 2ALVA 1EOJA 5LGOA 2WUBA 2DUCA 1DITH 2BY9X 4INHA 4CRDA 1D4PB 2M5TA 2GZ9A 1VJAU 2ZDAH 1HBTH 2ZDMA 5JPMH 2A5KA 5I46H 3PB1E 2GMTC 1SSXA 3KQDA 2XW9A 5L6NH 1O2KA 3E91A 3ZV9A 1MQ6A 1EAUA 4DVAU 3K2UA 2WUCA 2R3UA 1FPCH 2HGTH 4CREA 1YPHE 1O3HA 5DP5A 3EA8A 6GCHG 3EYDA 3MU4A 2Z3CA 6LPRA 1LHFH 1FV9A 5FX6A 1SLVB 1Q3XA 1W0ZU 2FTMA 2IOTA 1FY1A 1GI2A 5AHGH 3QGJA 2W7SA 1TOMH 5JDUB 4NZLA 4LZ4B 3EA7A 2Y81A 2AFQB 4SGAE 1U6QA 3ZZ8A 3MO3A 2P8OC 4Q80A 5DJ7A 1P2KA 1L2EA 1TIOA 1UK3A 3VPKA 1V2KT 1O5DH 3ZVDA 3QLPH 2GCTB 4OS5A 3KIDU 1ABJH 4AYVB 1CA0C 4CH2B 5A8XA 3U1JB 3O8DA 4XBDA 2THFB 1NFYA 4I32A 4Y8ZA 1AD8H 3P8OA 2PKSC 1W13U 1GMCF 2QF0A 3SU5A 1FJSA 1O3IA 2G4TA 3RC5A 3K6YA 2A0QB 3PLPA 4IMZA 2STAE 1P01A 3V7TA 1SLUB 4XSKU 2G5VA 3STJA 1IQEA 1NO9H 1D3TB 3GISB 4OS1A 2VWLA 2ODPA 1PYTC 1FY3A 1QRWA 2ODYB 1HJAC 2Y80A 1Q31A 1CBWC 5CE1A 2C3SA 3RXIA 1IQGA 1ELAA 1N6YA 2HWLB 3LGUA 1UTJA 1V2OT 4RKJB 1O3JA 2RA3A 5GIBA 1B5GH 1O5EH 2OC7A 2BYAX 1SLWB 2Y5GA 4Y11E 4XBBA 1HXFH 2ZA5A 1TNHA 3GCNA 1A0LA 3NKKA 1JIMA 4TPYA 2UUKB 3VFEA 1Z8RA 5TJXA 1ELEE 1H4WA 1SMFE 4WXIA 2GGVB 2CXVA 2XC5A 4TWYA 1ZMJA 2G51A 3TH3H 1O3GA 4DIIH 5DP6A 3A85A 2SGEE 1GL1A 4AZ2B 3SN8A 3ZYEA 4WH8A 2EI7A 2FX6A 1OWKA 3RDZA 2SNVA 4Q7ZA 1HUTH 1UMAH 2H5CA 2OQ5A 1K1NA 3SU0A 1TMTH 2PW8H 3K6ZA 2P95A 4D7FA 4KTUA 1EP5A 2FX4A 2AERH 1BRAA 1O5BB 1S82A 3BN9A 2W3KA 4BNRA 4FU8A 1C5OH 2FS8A 3S9BA 2JH5D 3E16B 1E37B 2OBOA 4X8UH 3FFGA 1GBTA 1O2RA 1OSSA 4K8YA 5EODA 1DXWA 1ELTA 3L33A 1HAXB 1C5YB 1P9UA 1UTOA 4B2CA 2BD8A 2PHBA 2VGCB 3W94A 5JBTA 3RXQA 2XBWA 1O3MA 1Y3XA 1J16A 1BRUP 7LPRA 2ULLA 1AE5A 4U30A 2FWWA 1O2TA 3P70B 4YLUA 4FUBA 3SNAA 4YO9A 1MKWH 1C5NH 5HGGA 1K1OA 3TJNA 3UTUH 2ANKH 3URDA 1LHDH 1LPZB 3QX5H 3RXLA 1EATA 1C9PA 5FPYA 1DSUA 1A46H 1CT4E 4WMDA 1GL0E 4KKDA 1O2HA 1MU8B 1VITF 4KTSA 5GCHF 1XKAC 3V13A 1TMBH 4UFDH 1Y5AT 1UVUH 1XUGA 1NZQH 1GJ6A 1SPJA 4GLYA 1CSOE 1QRZA 3RMOH 3RXBA 1O2XA 1QY6A 2BDGA 1UK2A 1O2QA 4GUXA 2ZGXH 1P09A 1A5HA 1GHBG 1ETSH 4A1VA 1TRMA 1G2LA 2XWBI 2CF9H 5AFYH 4ZMAH 1ACBE 1AFEH 4X2WA 1JBUH 5A09A 1QJ6B 2JH0D 1GI3A 1YYY1 1P9SA 2EA3A 2FOGA 3EGKH 1C1OA 4X6MA 3RXUA 1J9CH 3TGIE 1GCTC 3LDXH 2V6NA 3RXRA 2VVUA 2Y82A 3PO1C 1C1TA 1GJ4H 1AE8H 5H4IB 3M61U 1ZMNA 3RU4D 2WPKS 6CHAC 5FHTA 1AGJA 7GCHF 5EGMA 3PM3A 2QXHA 4FU7A 4QT8C 2QV1A 1OP2A 2OP9A 4Q7XA 1HAGE 1K1MA 2RDLA 3M36A 3MYWA 5DP7A 4CRFA 1G32B 2A5AA 2ILNA 4U32A 4M7GA 4NZQA 2BXUH 1EQ9A 2WPJS 3RP2A 5HM2A 1T31A 1ZSKA 2ZHDA 3V0XA 4CHAB 1GG6C 1BDAA 1V2TT 4XE4A 1G37A 3TJUA 3BSQA 3TK6A 1OOKB 1EOLA 2XRCA 1TPPA 4NWKA 1C4Y2 1P06A 2GMTB 3FZDA 1QB1A 1ETRH 1X7AC 1O2VA 3M5NA 1HB0B 3TJOA 1WOFA 1TGSZ 2ZTXA 3U69H 3DD2H 2HPPH 1C2KA 1OKXA 3U9AH 2CF8H 2GVFA 5C5NA 1BOQA 1L1GA 2BD5A 1ELDE 3JZ2B 3V3MA 1DLKB 1EX3A 1ZGVA 2G55A 1LVBA 2ZGHA 3T5FH 2P3UB 1HAPH 5JB9S 2VIWA 5K7RA 2OCVB 2ASUB 3B9FH 2FODA 1F5KU 1FNIA 4XOJA 1QNJA 4BTUB 4ZH8A 1C1SA 2RG3A 1Z6EA 1D6WA 1T32A 2Z6BD 1DDJA 4NA7A 2O8UA 3A7WA 2P8OB 3F68H 1HRTH 1NTPA 2WPMS 3SZNA 5JBBS 2WPLS 1EUFA 1C2GA 1CHOF 3KL6A 3E0NB 1MMJN 1BUIA 3KQCA 4DIHH 1ZJKA 1CA0B 4ABAA 2HRVA 1SI5H 3LJJA 2VIPA 3ZZ7A 3M3VA 1GBIA 3A8BA 1GMDF 3SHAH 2PKSB 3S9CA 1PQ7A 3OX7U 1NY22 5JB8S 1AMHA 5EOKA 2BQ6B 4WVPE 1EJAA 2W3IA 1XVOA 4D76A 3FAOA 1PPZA 1Y3YA 2SGPE 1INCA 5F6MA 2A45B 1IHSH 1K28D 1O2MA 5F03A 2FM2A 2ZF0H 3AASA 2A5IA 4F49A 1GDUA 2P3TB 2I6SA 2GT8A 1O3CA 1RIWC 2A32A 1ABIH 2A7HA 1CE5A 3RLWH 1HJ9A 4K1TA 4KTCA 1O32A 4X6OA 5LPRA 2BD3A 1ESTA 1OPHB
chains in the Genus database with same CATH superfamily
4WMFA 2BDBA 1MKXH 2B7DH 2ZPSA 1O2JA 1PYTD 2RCEA 4ABFA 1W12U 1DFPA 1AWHB 1OYQA 3T28A 2V3OH 5FL7D 1OP8A 4Z0KA 2WV9A 4YXWD 3BF6H 1BTPA 1MZDA 2GKVE 5L2YH 4WJG2 3N7OA 4X1PU 4RT0A 1Q2WA 1F0RA 1GMHF 1TONA 1IAUA 1VKYA 1GHVH 1JRSA 3IWMA 3SGAE 4MVNA 4UD9H 1LVMA 4O9VA 4LXBH 4NFFA 4TWWA 2M2AA 1TQ7B 1C5TA 1G3CA 1GVKB 4THNH 5ETXA 4JCNA 4YT6H 4FVBA 3UR9A 4UFEH 2AGIX 1AVWA 1TNJA 3PMBB 3MU5A 1AN1E 1O3KA 4BXSA 1BTHH 1GJDB 1NFUA 3FANA 1C2FA 1BT7A 1UTKA 5J4QA 2OC8A 3UFAA 1W2KH 3TH2H 1O3EA 4CBOA 2FOEA 3ZVFA 5B6OA 1SR5C 3T29A 2ZCHP 4GHTA 1GMCG 4INLA 5ABWA 1T8LA 1GDQA 2R3YA 4I8KA 5E0JA 4DCDA 2TGAA 2P3FH 4TY7A 1C5RA 3FP8E 4Q4LA 3OY6U 1GBEA 3ZZ6A 2AH4X 4IBLH 5HKKD 4OGYA 5EJLA 3GDVA 3SU6A 2EQNA 3E3TA 1T4VH 2NU2E 3ENSB 2Z9LA 3LGIA 2ZI2H 4ABJA 2R9PA 4NWLA 1JXPA 1Z8IB 4MPWA 1GHYH 4AN7A 5KEDA 2BQ7B 3RC4A 2A4RA 1YBWA 3MH4A 1DLEA 4H42U 4ISIH 1YM0A 4Y10E 3ZZDA 4AFSA 2AGEX 1Z1IA 1Y3UA 3KCGH 5FX5A 3SJIA 4B74A 1MTNC 3IITA 2BDIA 1EZXC 2BLWA 1DWBH 1K0HA 2B9LA 3RC6A 1CGJE 3BIUH 2Z9JA 1CT2E 3WY8A 1DWEH 3CNRA 2JJ2D 2ZCLP 3M7QA 5C1YA 4DY7B 1C9TA 3MI4A 1LHEH 1TGNA 1CGIE 3ZVCA 2BVSH 5HIYA 1DM4B 2VWNA 4WWYA 3EE7A 1ESBA 3F9FA 4MNYA 1ELFA 4NA8A 1B7XB 4CR9A 1Z7KA 3Q3XA 2KR7A 1C1UH 3ZZ4A 4AG2A 2QY0B 3BTTE 2ZTZA 1PQAA 2Y7XA 3E90B 1L4DA 1O30A 4ISHH 2VH6A 4FETA 1G3DA 1O3DA 1WU1A 1AZZA 2J34A 1J17T 4B2AA 1ZPBA 1XUFA 5SGAE 1XM1A 2ZNKH 3VGCC 4IS5A 1GI9B 1A0JA 3U8TH 1OHHD 3EQ0H 1KMHB 2Z9KA 2YMSC 3BEIB 4AGJA 1V2PT 2VINA 1GCTB 1K21H 1UK4A 1TPOA 3SNCA 3P8GA 3PLKA 4KGAA 1Y3VA 1EB2A 2G4UA 3Q3KA 3RXCA 3TNTA 4JZ1A 5EU8A 2ZDVH 2QF4A 1KXCA 3PO1B 1A0HB 3A86A 1P2JA 5T6FA 2ZDKA 6CHAB 3KYGA 1SGQE 4B2BA 1W7XH 3FP6E 3ZZCA 3TJVA 1G2MA 1DWDH 1TPAE 1TA2A 2V35A 3A7VA 3ZVEA 1PJPA 3MNXA 1P11E 3ZIAD 1HJ8A 1C2MA 1L1JA 4SGBE 1DWCH 4AC9A 3SV7A 5FBEA 1A5IA 1PQ5A 1MQ5A 2BD2A 2R2MB 2A7JA 3QZQA 3TIUA 1AKSA 3GDUA 1FLEE 1GG6B 1XXFA 2G5NA 4ZHLU 1NRQH 2BZ6H 2PLXA 4FUDA 4I7YH 1VITG 5GCHG 1Z8GA 1E0FD 1O2PA 2VJ1A 3QWCH 2CHAC 3SZEA 1VITH 4B71A 1O3OA 1BTZA 1MZAA 1QGFA 3SJ9A 3PRDA 2PKAB 3SQHE 3EAJA 1O2GH 1OWJA 2BLQA 1GBAA 3GY6A 3VXEH 2SGAA 1BBRK 3SJOA 1MCVA 3BG4C 1GBFA 4TSFD 1GBJA 1O31A 2FYRA 1J14A 3VB4A 3F2FA 2ZGJA 2J2UA 1BRBE 3HATH 3OE7D 3TVJB 3K65B 1TA6A 2UUFB 2ZFSA 4XBCA 4FUEA 1SBWA 1QZ8A 1W8BH 3UR6A 1CA8B 2STBE 5DP9A 4WY3A 1QCPA 2FIRH 1H9IE 1WDIA 1UO6A 1G3EA 3SHCH 7KMEH 4Y8XA 5FAHA 3NZIA 4X1NU 4DJZB 3URCA 2B5TB 1O36A 3SYJA 3S7HB 4X1QU 5ESBA 7GCHG 4FUCA 1N8OC 2K8IA 1GWAA 4A6LA 3SNDA 3LC5A 1YCPM 4A5TS 1V2UT 1WYKA 2AGGX 1ZHMA 3H7OA 2O9QA 3CP7A 3Q77A 4CBNA 3SGQE 3D65E 1WUNH 3FKSD 1K1IA 1V2JT 1F0SA 3OEED 4HZHA 1QJ7B 3BTWE 1J15A 3AW1A 2FZZA 2CJIA 1EASA 1RIWB 2Q6GA 3TITA 1BHXB 2J4IA 3SI4H 3UY9A 1DANH 1KXDA 3HK3B 4K69A 1W11U 3U1IB 3AW0A 2WPHS 1CHGA 2GDDA 3DHKH 1LCYA 1O38A 1BTYA 2PUQH 2ZCKP 4X2XA 5EQQA 1GHAF 1HCGA 5C5OA 1QFKH 1UVSH 3ODFA 3A84A 2B8OH 3FP7E 2V3MA 1DVAH 2KZ4A 2B0FA 3F9GA 2ZEBA 1A1RA 1N1LA 2CK3D 1O2ZA 3ZV8A 2BB4A 5CDFE 4B76A 5C20A 2D26C 4FUHA 5GDSH 1BITA 4I8GA 2ZU2A 5KECA 1MTUA 1WSSH 2C8YB 2FOAA 2BOKA 3VB5A 5EIYA 3A7YA 3DA9B 1THRH 4Y7BA 2ZU1A 1C2EA 1WAYB 1GBHA 4HGCA 2KFWA 1C1QA 3LIWA 1CHOG 1C4V2 5K0HA 2QCYA 3HKJB 5C1UA 1W14U 1QRXA 1HIAB 1C2JA 2O8MA 1TOCB 2Z3EA 3TH4H 1NU9A 2PKAA 1QJ1B 1LPKB 2PFEA 2HNTF 2ZO3H 4D9QA 1YPLH 1FQ3A 1YKTA 2VWMA 1QB6A 2XNIA 4MG3A 2ZG0H 4X0WU 4A1TA 5LH8A 5L30H 1GMDG 5FPTA 1YPGH 1DY8A 1KIGH 4ISLA 3VB7A 1VCPA 2Q6DA 1YCPK 1SGIB 2W7UA 2ZFRH 1NESE 2UUJB 4JMYA 5A0BA 4AGKA 1GBBA 1UTLM 4Y6DA 1BZXE 3N99A 3B23B 3FZZA 3QZRA 1TYNA 1P10A 1UCYK 2C8XB 3A82A 4K3JA 1CT0E 1ZTKA 2BD7A 2HNTE 2F91A 2ZFTA 2LELA 4UE7H 4CR5A 1ELVA 3PWBA 4IMQA 1RRKA 5I25A 1CGHA 5E0GA 1HAVB 1LHCH 4ABHA 1DOJA 1DY9A 1IQIA 1OWHA 1NRRH 1FY8E 3O8BA 4INKA 4FUFA 3A8DA 1EAXA 1S6FA 1MD7A 3M7UA 4LK4A 5FCRA 4DURA 2GJGA 1BTUA 2JKHA 3SUFA 3U8OH 1YPJH 3UAIC 1OWEA 4R0IA 1GDNA 3GCHC 4NSVA 1EFRD 3F9HA 1MTNB 1OP0A 1GMHG 3WWFA 2BVXH 2JH6D 4BTTB 2PWXA 2AS9A 3RXHA 3HGNA 4Y79A 2KAIB 2VIVA 4GPGA 3SBKA 4K1EA 1SGFA 1S0QA 1NC6A 5JBCS 2ZECA 4ACBA 2IJOB 1V2ST 2GV6A 2GX4A 3KGPA 1TNIA 3RU4E 4J1YA 2H9HA 2GZ7A 2ZGBH 3A88A 5FBIA 1HLTH 3BIVH 1LTOA 2OINA 3IG6B 3S69A 2FO9A 1NU7B 2QAAA 1AU8A 4MQAA 2F9BH 2QC2A 1YP9A 3BG8A 4AFZA 3P6ZB 1QQ4A 3BTGE 4R8TB 1C5UA 1QA0A 1GJ7B 3Q3YA 1KXBA 1TRYA 3B8JA 4NIYA 3TNSA 2BVRH 1P2OA 1SFQB 3VGCB 3FN8A 2WYGA 2BDYA 3MOCA 1TBQH 1LKBA 2YMSB 3OTJE 3P17H 1AVXA 1O35A 2HALA 2BY6X 3KHVA 1P2IA 3EA9A 3U98H 2BY8X 4ESTE 1K1PA 1TRNA 1SB1H 4BANB 3NK8A 2KX4A 1HIAA 4B6FA 1IQLA 1G36A 1SGDE 2EC9H 1B0EA 1K1JA 2ZDLA 4CRAA 2H6MA 2YMSD 1G9IE 2Y5HA 4RN6A 1ZMLA 1KY9A 4ZKRU 8KME2 1HAIH 4AYYB 2FOHA 1P8VC 2AIQA 2FI5E 3M5MA 4AFUA 3ZZ3A 2VH0A 2XCFA 5C2ZA 1ELGA 3GYLB 3UNSA 5DG6A 2Z9GA 3MNSA 1DUAA 1LPGB 1GI0A 2TRMA 2WZQA 3TU7H 3OY5U 3OEHD 1VJ9U 1DXPA 1L0ZA 2CGAA 1GJAB 3LGWA 1C5XB 2WYJA 3HPTB 3MFJA 1THSH 3UREA 1HAOH 9LPRA 2CHAB 1HAVA 3UQOA 5CHBA 1H8IH 3ATIA 9ESTA 1JMOH 2A7CA 3QTOH 3RXTA 2VIOA 3P92A 4TY6A 1ZRBA 1O2YA 4FU9A 4YT7H 1RTLA 1B0FA 4BXWA 5TCAA 1WV7H 3BTQE 1FAKH 1ZSJA 4YOGA 1QL8A 5C3NA 2P16A 1HNEE 4ZKNU 1GJ5H 3RXDA 1XVMA 2BOHB 1KDQB 2VVVA 3LC3A 4GSOA 3CS0A 1RTFB 4DGJA 5C0UA 1W3CA 1KXAA 2KAIA 5EJZA 1FUJA 5E0HA 5EQRA 1C5QA 5F53A 1MAYA 2H9EH 3M35A 1BMLA 3MU0A 2D2DA 1SQAA 3MNCA 3SUDA 4ABGA 1BCUH 2GV7A 2G81E 1T8MA 3QDZB 2QXGA 5DK1A 1H9LB 1C2DA 1SLXB 3I29A 1ETTH 1V2MT 3KEEA 3AVZA 1N8OB 4OS4A 3RMMH 1QHRB 1XUHA 1TX8A 4JYUH 1DPOA 1ZHRA 4X8TH 1TGTA 3M37A 3RXKA 4O3TA 1YPHC 4DG4A 3RXGA 3VG8A 2ZTYA 2QXJA 1SOTA 3GCTF 4K8BA 4I8JA 4FVDA 1M9UA 1YC0A 4BAHB 2QA9E 4GCHF 4O3UA 1LO6A 2EEKA 1HAHH 3OAAD 4IGDA 5TCCA 1T8NA 4UEHH 3DUXH 4XDEA 2AMDA 3R0FA 3DCLA 1EXFA 3WW7A 1HJAB 1CBWB 1K2I1 2ANYA 3KYFA 3NUMA 4ZKOU 1C5PA 1E34B 1N6XA 5DP8A 3GDSA 4E05H 1CU1A 2AMQA 4IC6A 3PLBA 1RGQA 1PPGE 2SGFE 1O3AA 1E36B 1BQYA 4U01A 4K1SA 5JYIA 1BMNH 1FY5A 4X1SU 3AK5A 1H1BA 1W0YH 2KCAA 3QTVH 5EJ1A 1MKWK 2J9NA 4HTCH 1FMGA 1C1NA 1QQUA 2EI8A 2TBSA 4AX9H 2SGQE 7ESTE 3T26A 2F9NA 5BRRE 5HM9A 3PV5A 1GI1A 3SV9A 1S6HA 2P93A 1ANBA 1SGEE 1XMNB 2H5DA 3RXOA 1E79D 4YOIA 3PMHB 3UOUA 1T4UH 1ZLRA 1D3QB 5GJ4B 5C17A 1SHHB 3A80A 2ZQ1A 4RT1A 2ANMH 1P2QA 2ZFPH 4BAMB 4A1XA 3UNQA 3PV2A 2WHXA 1YLDA 2FS9A 1NRNH 2QF3A 2XNDD 1XUIA 2YNAA 1SGYE 1YLNA 1FIZA 3EE0B 1Z6JH 2BY7X 2VIDA 2GCHG 2BXTH 5CMXH 2FLBH 1Y8TA 2OC1A 5T6GA 2FYQA 2Z7FE 5FCKA 2D1JA 1OWDA 5T3HA 3S0NA 1KDQA 1ESAA 4A7IB 2A1DB 2F9VA 3HK6B 1AKSB 1O33A 1WTHD 3RUOA 1O3PB 1ZJDA 2HVXA 3RMLH 3RXAA 4ASUD 2GT7A 2J98A 5IK2D 4JYVH 1P05A 4DT4A 1QL9A 3SO3A 2BLOA 3DFJA 2PR3A 1VR1H 2ZFQH 5GWZA 4NIVA 3NXPA 3SOSA 2OTVA 1F5LA 1GHAG 1ELCA 3C27B 1NBMD 3ATKA 5DGJA 4X8SH 4Q2KA 3KN2A 4MLFB 4TYDA 2K1QA 3ZVBA 3RMNH 1TB6H 3U8RH 3ATLA 2BDAA 1WQVH 3GCHB 1V2RT 1UVOA 4JZIA 4D8NA 4M9FA 2ZKSA 2Y6TA 3O8CA 1PPCE 2IPHA 3MNBA 3M7TA 4MPVA 1ZHPA 4IC5A 1DT2A 2YNBA 4OS2A 1MU6B 1F2SE 2ZU4A 2FPZA 1GJ9B 4PROA 3UIRA 3BTHE 1AY6H 1O3BA 1GJ8B 3BTKE 5DKMA 2TGTA 1C1MA 1QL7A 1QIXB 1E1RD 3RXVA 2QF5A 1RXPA 1MTWA 3H5CB 2Z9IA 1S0RA 3ZYDA 1P02A 1O3NA 1TX6A 4RKOB 1P2MA 2SGDE 1SFIA 4ZHMU 2XXLA 5F8XA 1CO7E 3PV4A 3PROA 3VB3A 1TX7A 4Y0YE 4KELA 2ZDNA 4X1RU 1S81A 4VGCC 1TABE 3SQEE 4I31A 2C8ZB 1GBLA 3GY7A 2GP9B 3PTNA 3SUEA 4ABIA 1SG8B 3I77A 1XX9A 5AFZH 3RM0H 4NGAH 3M5LA 1Z1JA 2IN2A 3HGPA 2JDID 1P03A 1GBDA 1TGCA 1WTGH 2PUXB 1QURH 2XC0A 2ZHQH 2ZC9H 2JETC 1YF4A 1F0TA 3KNXA 4ABDA 2VIQA 2PTCE 1FDPA 1HAZB 1K22H 8ESTE 1E35B 5GPIB 3ZVAA 2OQUA 1NPMA 1V3XA 3SV2H 3A8AA 1MBQA 1C2LA 1DX5M 3RXJA 4ZROA 3UOPA 3A8CA 1ZTLA 1VZQH 5EXLA 2A4OA 2LNCA 5IYTA 4BAOB 3Q00A 4JK6A 3MHWU 4OM9A 1LVOA 3GS9A 1J8AA 1JIRA 1NRSH 1BIOA 1E38B 3ELAH 4MNWA 4B73A 3F9EA 5EW2H 3BTFE 1ZR0A 1C5ZB 1MKXK 1UTNA 1JWTA 3M3SA 4Z6AH 3SJKA 1EPTC 2GZ8A 4Y0ZE 1QR3E 2OK5A 1TAWA 4CHAC 1OXGA 4YOJA 4GAWA 8GCHG 2FXRA 2G8TA 4AFQA 1KLIH 2AYWA 3QK1A 4D9RA 1SQOA 1EZUC 1SC8U 4K60A 1ID5H 1F0UA 3P8FA 2BX4A 1ZYOA 4F48B 2TGPZ 3LPRA 1BHXF 2V0BA 4NA9H 1VGCC 3ZZBA 1QBVH 2Z3DA 5EW1H 3ZZAA 2UUYA 3H7TA 2XWAA 1AO5A 3TK9A 2UWOA 4NG9H 4UFGH 5HXFA 1UHBB 3M3TA 3T25A 1O0DH 3LONA 2BM2A 1BBRE 1SHYA 1V2LT 1TWXB 1RJXB 1Z8JB 2O8LA 2Z94A 2HLCA 2GCHF 2R2WU 4FXGH 1S83A 3W95A 3L3TA 3NCLA 1ARBA 2FTLE 3A87A 3LGTA 3GY5A 3MMGA 1AUTC 1GHXH 4ASHA 1LMWB 3SU4A 2W26A 1DUEA 1EB1H 1V2NT 2HPQH 1EKBB 3RM2H 4GHQA 2BHGA 5LPEA 1MAXA 1TBRH 2O8WA 1XXDA 3DFLA 1ELBA 2BDHA 2NU3E 2NU4E 3T2NA 1RFNA 2XTTB 4MNVA 4FUGA 3A7ZA 1TNKA 4ACAA 1AZ8A 5AF9H 1GHWH 1GGDC 1O39A 2A2XH 3S7KB 4DW2U 1FZZA 2FOBA 3CS7A 1NFXA 3GOVB 3WWBA 1C2IA 3F2GA 3LH1A 1ORFA 2XBVA 3F0OA 1YWUA 2WINI 1VCQA 1ARCA 1C4U2 4AORA 2A31A 1FXYA 2VNTA 4X8VH 1CQQA 4Q7YA 1GBKA 3MH7A 3DT0H 3F6UH 3HKIB 6ESTA 2BQWB 2HVYB 5DN6D 1XUKA 1Y5UT 2BD9A 1BTWA 2XYAA 3E8LA 4ABBA 1SGPE 5F8TA 2IPQX 4JK5A 3BEUA 1AIXH 4X6PA 4ZCNA 2HOBA 5A8ZA 3GY2A 5LPFA 2C4FH 2ZP0H 1DS2E 3FOAA 2FOCA 2ZQ2A 4A92A 3QO6A 5C67A 1F5RA 4MTBA 3SJ8A 3GCTG 1SGNE 2PGQB 4GCHG 1IQNA 2C90B 1P2NA 3ESTA 4JZDH 1OWIA 1LDTT 3NPSA 1FN8A 3R3GB 1IQJA 5A8YA 2TPIZ 3UQVA 2OD3B 1TNLA 2Y7ZA 3D49H 1GJBB 4DOQA 4UDWH 1AQ7A 2F9PA 1GVLA 4NCYA 4B1TA 1O5FH 1AB9C 3P8NA 5DP3A 1D6RA 3PYHA 1UHBA 1PPBH 2FOFA 3LKWA 3MU8A 3MH6A 1K9OE 4ZKSU 5GNDA 1TBZH 2O8TA 2ZZUH 5EXMA 1ANCA 2VVCA 1FX0B 3MO9A 4FUJA 1O2UA 1OX1A 2J92A 1HDTH 4AG1A 4BAQB 3GY8A 2LP6A 4CRGA 3SV8A 1GPZA 4Y8YA 5EQSA 1T7CA 3UWIA 1UTMA 3ATWA 1TMUH 1TQ0B 2PSXA 3BTDE 2ZU3A 2G52A 4XD7D 4XFQA 1TGBA 3D23A 4E06H 1A4WH 1C1VH 2RFKC 1UCYE 2UWLA 1ZGIA 4X6NA 3GICB 1SKYE 1L4ZA 1MUEB 1SQTA 3KQBA 1UW7A 4MNXA 1D3PB 1C5VA 1SGRE 1QB9A 3BTME 1Y3WA 5GXPA 4LOYH 1E1QD 1HV7A 3GY3A 1W10U 5FXLA 1IOEA 1ZZZA 2W5EA 1SGTA 1TALA 5ESTE 1SVPA 2OLGA 2AMPA 5C0TA 2SFAA 1BTXA 1THPB 3PTBA 1NROH 1O5GH 2QYIA 3QN7A 3QGNB 3T62A 8GCHF 2ZGCA 1H9HE 4Y7AA 3LOXA 5HIZA 2NWNA 3LGYA 4O97A 1BRCE 3SU1A 2XCNA 5DP4A 4VGCB 2GDEH 1PPEE 1WXRA 5A2MH 1UVTH 2ZHWH 2ZWLH 2D8WA 2Q1JA 3JZ1B 4D7GA 2P94A 1YPEH 6GCHF 1GHZA 1UJ1A 2BZAA 1AFQC 1BA8B 1ZTJA 4GVUA 2JETB 1OYTH 2J5UA 1AUJA 4AB8A 3GYMA 1D3DB 1SOZA 3RXEA 4P00A 2NU1E 1AWFH 1EZQA 3D62A 4IN1A 1C1RA 2XBXA 4E7RG 4NFEA 3RLYH 5CHAC 3CENA 3DSOA 2BD4A 1JOUB 1G3BA 4E7NA 3AAUA 3A81A 4JYTA 4JZEH 3TLOA 2R0LA 1XKBC 2PSYA 1A3EH 3KQEA 2F4LA 2C8WB 3ZZ5A 1TLDA 1CVWH 8LPRA 1Z71A 1GI5A 4HFPB 3O8RA 1GI7B 1QTFA 1FIWA 2GTBA 4ISNA 4ZXYH 3TK5A 3VEQB 2NU0E 1KLTA 3TPIZ 2OUAA 2DE8A 2G00A 3ATMA 1FPHH 5A0AE 1EPTB 3SNEA 3BV9B 1KXFA 3BG4B 2QN5T 1UTPA 4YZUA 4I8HA 3ODDA 1S84A 4H6TA 2ANWA 1O3FA 2F83A 1LHGH 5AVDA 4WXVA 1GCDA 1A2CH 1YGCH 5E2PA 3STIA 2ODQA 2TGDA 4J2YB 2EY4C 2LPRA 3SORA 2ZPRA 4Y71A 4I33A 1FY4A 4IN2A 2FI4E 1P3CA 2EI6A 4K2YA 2JIZD 1VGCB 1QBOA 1BMAA 5EPYA 5C1XA 4AB9A 3SGBE 1DICA 1W7GH 2H1UA 2WV4A 3C1KA 1YPKH 2J98B 2YOLA 3RXFA 3A89A 3MWIU 5A0CA 4CRCA 1O2SA 1P0SH 2P59A 4KP0A 5BPEA 1AI8H 1V6DA 1QBNA 1AVGH 1ZPZA 1UTQA 2CV3A 1YPMH 2ZU5A 3PMJA 3GY4A 1IQFA 1GVZA 1O2WA 2J94A 3VB6A 1KSNA 1KXEA 3VXFH 2FI3E 2W6ID 3NWUA 2Y5FA 1HXEH 3MU1A 5EXNA 4MDSA 2J95A 1BB0B 1O2NA 2ALPA 1ANEA 1KLJH 2GCTC 4UONA 1A5GH 1EJMA 5T6DA 4ZHAA 1O37A 1FAXA 2TIOA 1FN6A 4I86A 5HYOA 1MTSA 4MPUA 3ZVGA 1LVYA 1T8OA 3G01A 1BJVA 1GBMA 2WV5A 3UWJH 1PQ8A 3OYPA 2VWOA 1NT1A 1S5SA 3RXMA 3K9XB 5C94A 4RI0A 3Q76A 1EAIA 2XBYA 1K1LA 2ZPQA 1SL3A 5DO4H 2ESTE 2GD4B 1GGDB 1UVPA 1HPGA 4BAKB 3A7TA 5L2ZH 3LH3A 1O34A 2VU8E 2WPIS 3LJOA 5E2OA 3V12A 2OC0A 2R0KA 2FLRH 4X2YA 4RSPA 4ZAEA 1WBGB 2FEQH 1GI8B 4NIXA 3SU2A 2UWPA 1Y5BT 2BX3A 3TGJE 3BTEE 4ABEA 5IDKA 1GI4A 2F3CE 2ZHFH 5PTPA 3QUMP 1IQMA 1SGFG 3SU3A 1BBRH 2F9OA 2J38A 2BDCA 3MH5A 1C2HA 3SI3H 5EPNA 5FPSA 1XUJA 1LKAA 1D9IA 1TE0A 1EJNA 2A2QH 4UFFH 3M5OA 4F4OC 2BY5X 1C5LH 1P3EA 3PRBA 1O5CB 2A4GA 5G4BA 2I6QA 2QGRA 1EPTA 1DSTA 1IHTH 1NBME 3I78A 2XC4A 2PGBB 5E8EH 3EDXB 3F1SB 1FONA 1GBCA 1O2LA 3LU9B 4YLQH 1YY3A 4OGXA 1SGCA 1C1WH 1S85A 2C93B 4JZFH 1C5MD 2J97A 4FUIA 3UPEA 1O2OA 1JRTA 1L1NA 3S9AA 2BLVA 5HMAA 1F7ZA 2V3HH 1C5SA 2ZIQH 2ZHEH 3SNBA 1A3BH 4U2WA 3T27A 2L6OA 2AIPA 2FDAA 1MTVA 4YESB 5J4SA 2H2ZA 3ITIA 5EG4A 2PTNA 3E1XB 3SW2B 1V2WT 3MTYA 1BMMH 1MD8A 3RU4T 4WH6A 1V2QT 2OBQA 1KYNA 4B75A 1A61H 1TNGA 1O2IA 1GHBF 2F43B 3W1EA 1AB9B 2WPDD 5DPAA 1WCZA 1FI8A 4HI3A 1LQDB 2VBCA 1MCTA 1O5AB 3P95A 3RXSA 2QXIA 3GCOA 1P12E 4AOQA 4DT7B 3BEFB 4ZUHA 2VB0A 3FVFB 3LT3A 2Q6FA 2RA0A 1IQHA 4Q63A 1NRPH 4ZXXH 2PV9B 3L6PA 3ZZ9A 4NIWA 2VGCC 4WF8A 1A7SA 2PP6A 3TGKE 2CMYA 4BOHA 1V2VT 1O3LA 1WQSA 2CN0H 2HNTC 4CRBA 2QIQA 2BMGB 4H6SB 1AHTH 1HGTH 3N7EA 1YLCA 1TPSA 1P04A 3E0PB 4X2VA 2FMJA 4LZ1H 3A7XA 4YTAA 3AAVA 2OXSA 3PMAB 4WMEA 4Y76A 2SNWA 4YM9A 1MH0A 1F92A 1LQEA 1RD3B 4H4FA 1PFXC 5F8ZA 2ZFFH 2FP7B 1H8DH 5JBAS 1IQKA 1MBMA 1RS0A 1KTTB 3OSYA 1EZSC 2AEIH 4B6EA 1BJUA 1TFXA 1PPHE 2A4QA 1Y59T 3OU0A 3LGVA 1P57B 2FOMB 4NSYA 4O03A 4TPIZ 1PPFE 1DE7H 1ZOMA 1YCPH 1G30B 4CH8B 3SV6A 1NN6A 1HYLA 4I8LA 1AFQB 1GJCB 3NRLA 1KTSB 2FESH 1NFWA 4F55A 4OS6A 1VCWA 1ZRKA 1UCYH 1C1PA 1HAYB 3UNRA 1OS8A 3A83A 1ZSLA 4MPXA 2QE7D 1GI6A 2F9UA 2K0QA 4OS7A 5CHAB 4ISOA 1NM6A 2BTCE 2DE9A 4K5ZA 3UUZA 1RTKA 3PWCA 1HFDA 3OFND 4IW4E 1W0JD 3RXPA 1ZPCA 3SUGA 3MO6A 1EAWA 1ANDA 3KF2A 4BTIB 1C5WB 2H9TH 3E6PH 1EP6A 1QA7A 1NS3A 2ALVA 1EOJA 5LGOA 2WUBA 2DUCA 1DITH 2BY9X 4INHA 4CRDA 1D4PB 2M5TA 1H8ED 2GZ9A 1VJAU 2ZDAH 1HBTH 2KCPA 2ZDMA 3N7DA 5JPMH 2A5KA 5I46H 3PB1E 2GMTC 1SSXA 3KQDA 2XW9A 5L6NH 1O2KA 3E91A 3UB0A 3ZV9A 1MQ6A 1EAUA 4DVAU 3K2UA 2WUCA 2R3UA 1FPCH 2HGTH 4CREA 1YPHE 1O3HA 5B6LA 5DP5A 3EA8A 6GCHG 3EYDA 3MU4A 2Z3CA 6LPRA 1LHFH 1FV9A 5FX6A 1SLVB 1Q3XA 1W0ZU 2FTMA 2IOTA 1FY1A 1GI2A 5AHGH 3QGJA 1S6LA 2W7SA 1TOMH 5JDUB 4NZLA 4LZ4B 3EA7A 2Y81A 2AFQB 4SGAE 1U6QA 3ZZ8A 3MO3A 2P8OC 4Q80A 5DJ7A 3DSGA 1P2KA 1L2EA 1TIOA 1UK3A 3VPKA 1V2KT 1O5DH 3ZVDA 3QLPH 2GCTB 4OS5A 3KIDU 1ABJH 4AYVB 1CA0C 4CH2B 5A8XA 3U1JB 3O8DA 4XBDA 2THFB 1NFYA 4I32A 4Y8ZA 1AD8H 3P8OA 2L74A 2PKSC 1W13U 1GMCF 2QF0A 3SU5A 5KGOA 1FJSA 1O3IA 2G4TA 3RC5A 3K6YA 2A0QB 3PLPA 4IMZA 2STAE 1P01A 3V7TA 1SLUB 4XSKU 2G5VA 3STJA 1IQEA 1NO9H 1D3TB 3GISB 4OS1A 2VWLA 2XOKD 2ODPA 1PYTC 1FY3A 1QRWA 2ODYB 1HJAC 2Y80A 1Q31A 1CBWC 5CE1A 2C3SA 3RXIA 1IQGA 1ELAA 1N6YA 2HWLB 3LGUA 2JJ1D 1UTJA 1V2OT 4RKJB 1O3JA 2RA3A 5GIBA 1B5GH 1O5EH 2OC7A 2BYAX 1SLWB 5DSFA 2IJD1 2Y5GA 4Y11E 2WSSD 4XBBA 1HXFH 2ZA5A 1TNHA 3GCNA 1A0LA 3NKKA 1JIMA 4TPYA 2UUKB 3VFEA 1MABB 1Z8RA 5TJXA 1ELEE 1H4WA 4XRNA 1SMFE 4WXIA 2GGVB 2CXVA 2XC5A 4TWYA 1ZMJA 2G51A 3TH3H 1O3GA 4DIIH 5DP6A 3A85A 2SGEE 1GL1A 4AZ2B 3SN8A 3ZYEA 4WH8A 2KCOA 3MQKC 2EI7A 2FX6A 1OWKA 3RDZA 2SNVA 4Q7ZA 1HUTH 1UMAH 2H5CA 2OQ5A 1K1NA 2KM0A 3SU0A 1TMTH 2PW8H 3K6ZA 2P95A 3F2HA 3OTPA 4KTUA 1EP5A 4D7FA 2HLDD 2FX4A 2AERH 1BRAA 1O5BB 1S82A 3BN9A 2W3KA 2W6JD 4BNRA 4FU8A 1C5OH 2FS8A 3S9BA 2JH5D 3E16B 1E37B 2OBOA 4X8UH 3FFGA 1GBTA 1O2RA 1OSSA 1H8HD 4K8YA 5EODA 1DXWA 1ELTA 3L33A 1HAXB 1C5YB 1P9UA 1UTOA 4B2CA 2BD8A 2PHBA 2VGCB 3W94A 5JBTA 3RXQA 3DSPA 2XBWA 1O3MA 1Y3XA 1J16A 1BRUP 7LPRA 2ULLA 1AE5A 4U30A 2FWWA 1O2TA 3P70B 4YLUA 4FUBA 3SNAA 4YO9A 1MKWH 1C5NH 3F0PA 5HGGA 1K1OA 3TJNA 3UTUH 2ANKH 3URDA 1LHDH 1LPZB 3QX5H 3RXLA 3H09A 1EATA 1C9PA 5FPYA 3FO8D 1DSUA 1A46H 4P02A 1CT4E 4WMDA 1GL0E 4KKDA 1O2HA 1MU8B 1VITF 4KTSA 5GCHF 1XKAC 3V13A 1TMBH 4UFDH 1Y5AT 1UVUH 1XUGA 1NZQH 1GJ6A 1SPJA 4GLYA 1CSOE 1QRZA 3RMOH 3RXBA 1O2XA 1QY6A 2BDGA 1UK2A 1O2QA 2AHME 4GUXA 2ZGXH 1P09A 2RDEA 1A5HA 1GHBG 1ETSH 4A1VA 1TRMA 1G2LA 2XWBI 2CF9H 5AFYH 4ZMAH 1ACBE 1AFEH 4X2WA 1JBUH 5A09A 1QJ6B 2JH0D 1GI3A 1YYY1 3U28C 1P9SA 2EA3A 2FOGA 3EGKH 1C1OA 4X6MA 3RXUA 1J9CH 3TGIE 1GCTC 3LDXH 5T1VA 2V6NA 3RXRA 2VVUA 2Y82A 3PO1C 3KQ5A 1C1TA 1GJ4H 1AE8H 5H4IB 3M61U 1ZMNA 3RU4D 2WPKS 6CHAC 5FHTA 1AGJA 7GCHF 5EGMA 3PM3A 2QXHA 4FU7A 4QT8C 1W0KD 2QV1A 1OP2A 2OP9A 4Q7XA 1HAGE 1K1MA 2RDLA 3M36A 1SQRA 3MYWA 5DP7A 4TT3D 4CRFA 1G32B 2A5AA 2ILNA 4U32A 1COWD 4M7GA 4NZQA 2BXUH 1EQ9A 2WPJS 3RP2A 5HM2A 1T31A 1ZSKA 2ZHDA 4FOUC 3V0XA 4CHAB 1GG6C 1BDAA 1V2TT 4Z1MD 4XE4A 1G37A 3TJUA 3BSQA 3TK6A 1OOKB 1EOLA 2XRCA 1TPPA 4NWKA 1C4Y2 1P06A 2GMTB 3FZDA 1QB1A 1ETRH 1X7AC 1O2VA 3M5NA 1HB0B 4HG6A 3TJOA 1WOFA 2V7QD 1TGSZ 2ZTXA 3U69H 3DD2H 2HPPH 1C2KA 1OKXA 3U9AH 2CF8H 2GVFA 5C5NA 1BOQA 1L1GA 2BD5A 1ELDE 3JZ2B 3V3MA 1DLKB 1EX3A 1ZGVA 2G55A 1LVBA 2ZGHA 3T5FH 2P3UB 1HAPH 5JB9S 2VIWA 5K7RA 2OCVB 2ASUB 3B9FH 2FODA 1F5KU 1FNIA 4XOJA 1QNJA 4BTUB 4ZH8A 1C1SA 2RG3A 1Z6EA 1D6WA 1T32A 2Z6BD 1DDJA 4NA7A 2O8UA 3A7WA 2P8OB 3F68H 1HRTH 1NTPA 2WPMS 3SZNA 5JBBS 2WPLS 1EUFA 1C2GA 1CHOF 3KL6A 3E0NB 1MMJN 1BUIA 3KQCA 4DIHH 1ZJKA 1CA0B 4ABAA 2HRVA 3F3BA 1SI5H 3LJJA 2VIPA 3ZZ7A 3M3VA 1GBIA 3A8BA 1GMDF 3SHAH 2PKSB 3S9CA 1PQ7A 2KCYA 3OX7U 1NY22 5JB8S 1AMHA 5EOKA 2BQ6B 4WVPE 1EJAA 2W3IA 1XVOA 4D76A 3FAOA 1PPZA 1Y3YA 2SGPE 1INCA 5F6MA 2A45B 1BMFD 1IHSH 1K28D 1O2MA 5F03A 2FM2A 2ZF0H 3AASA 2A5IA 4F49A 1GDUA 2P3TB 2I6SA 2GT8A 1O3CA 1RIWC 2A32A 1ABIH 2A7HA 1CE5A 3RLWH 1HJ9A 4K1TA 4KTCA 1O32A 4X6OA 5LPRA 2BD3A 1ESTA 1OPHB
chains in the Genus database with same CATH topology
4WMFA 2BDBA 1MKXH 2B7DH 2ZPSA 1O2JA 1PYTD 2RCEA 4ABFA 1W12U 1DFPA 1AWHB 1OYQA 3T28A 2V3OH 1OP8A 4Z0KA 3BF6H 1BTPA 1MZDA 2GKVE 5L2YH 4WJG2 3N7OA 4X1PU 1Q2WA 1F0RA 1GMHF 1TONA 1IAUA 1GHVH 1JRSA 3IWMA 3SGAE 4MVNA 4UD9H 1LVMA 4O9VA 4LXBH 4NFFA 4TWWA 1TQ7B 1C5TA 1G3CA 1GVKB 4THNH 5ETXA 4JCNA 4YT6H 4FVBA 3UR9A 4UFEH 2AGIX 1AVWA 1TNJA 3PMBB 3MU5A 1AN1E 1O3KA 4BXSA 1BTHH 1GJDB 1NFUA 3FANA 1C2FA 1BT7A 1UTKA 5J4QA 2OC8A 3UFAA 1W2KH 3TH2H 1O3EA 4CBOA 2FOEA 3ZVFA 5B6OA 1SR5C 3T29A 2ZCHP 4GHTA 1GMCG 4INLA 5ABWA 1T8LA 1GDQA 2R3YA 4I8KA 5E0JA 4DCDA 2TGAA 2P3FH 4TY7A 1C5RA 3FP8E 3OY6U 1GBEA 3ZZ6A 2AH4X 4IBLH 4OGYA 3GDVA 3SU6A 3E3TA 1T4VH 2NU2E 3ENSB 2Z9LA 3LGIA 2ZI2H 4ABJA 2R9PA 4NWLA 1JXPA 1Z8IB 4MPWA 1GHYH 4AN7A 2BQ7B 3RC4A 2A4RA 1YBWA 3MH4A 1DLEA 4H42U 4ISIH 1YM0A 4Y10E 3ZZDA 4AFSA 2AGEX 1Z1IA 1Y3UA 3KCGH 5FX5A 3SJIA 4B74A 1MTNC 3IITA 2BDIA 1EZXC 2BLWA 1DWBH 2B9LA 3RC6A 1CGJE 3BIUH 2Z9JA 1CT2E 3WY8A 1DWEH 2ZCLP 3M7QA 5C1YA 4DY7B 1C9TA 3MI4A 1LHEH 1TGNA 1CGIE 3ZVCA 2BVSH 1DM4B 2VWNA 4WWYA 1ESBA 3F9FA 4MNYA 1ELFA 4NA8A 1B7XB 4CR9A 1Z7KA 3Q3XA 1C1UH 3ZZ4A 4AG2A 2QY0B 3BTTE 2ZTZA 1PQAA 2Y7XA 3E90B 1L4DA 1O30A 4ISHH 2VH6A 1G3DA 1O3DA 1WU1A 1AZZA 2J34A 1J17T 4B2AA 1ZPBA 1XUFA 5SGAE 1XM1A 2ZNKH 3VGCC 4IS5A 1GI9B 1A0JA 3U8TH 3EQ0H 2Z9KA 3BEIB 4AGJA 1V2PT 2VINA 1GCTB 1K21H 1UK4A 1TPOA 3SNCA 3P8GA 3PLKA 4KGAA 1Y3VA 1EB2A 2G4UA 3Q3KA 3RXCA 3TNTA 4JZ1A 5EU8A 2ZDVH 1KXCA 3PO1B 1A0HB 3A86A 1P2JA 5T6FA 2ZDKA 6CHAB 1SGQE 4B2BA 1W7XH 3FP6E 3ZZCA 3TJVA 1G2MA 1DWDH 1TPAE 1TA2A 2V35A 3A7VA 3ZVEA 1PJPA 3MNXA 1P11E 1HJ8A 1C2MA 1L1JA 4SGBE 1DWCH 3SV7A 5FBEA 1A5IA 1PQ5A 1MQ5A 2BD2A 2R2MB 2A7JA 3QZQA 3TIUA 1AKSA 3GDUA 1FLEE 1GG6B 1XXFA 2G5NA 4ZHLU 1NRQH 2BZ6H 2PLXA 4FUDA 4I7YH 1VITG 5GCHG 1Z8GA 1E0FD 1O2PA 2VJ1A 3QWCH 2CHAC 1VITH 4B71A 1O3OA 1BTZA 1MZAA 1QGFA 3SJ9A 2PKAB 3SQHE 3EAJA 1O2GH 1OWJA 2BLQA 1GBAA 3GY6A 3VXEH 2SGAA 1BBRK 3SJOA 1MCVA 3BG4C 1GBFA 1GBJA 1O31A 2FYRA 1J14A 3VB4A 2ZGJA 2J2UA 1BRBE 3HATH 3TVJB 3K65B 1TA6A 2UUFB 2ZFSA 4XBCA 4FUEA 1SBWA 1W8BH 3UR6A 1CA8B 2STBE 5DP9A 4WY3A 1QCPA 2FIRH 1H9IE 1UO6A 1G3EA 3SHCH 7KMEH 4Y8XA 5FAHA 3NZIA 4X1NU 4DJZB 3URCA 2B5TB 1O36A 3S7HB 4X1QU 5ESBA 7GCHG 4FUCA 1N8OC 1GWAA 4A6LA 3SNDA 3LC5A 1YCPM 4A5TS 1V2UT 1WYKA 2AGGX 1ZHMA 3H7OA 2O9QA 3CP7A 3Q77A 4CBNA 3SGQE 3D65E 1WUNH 1K1IA 1V2JT 1F0SA 4HZHA 1QJ7B 3BTWE 1J15A 3AW1A 2FZZA 2CJIA 1EASA 1RIWB 2Q6GA 3TITA 1BHXB 2J4IA 3SI4H 3UY9A 1DANH 1KXDA 3HK3B 4K69A 1W11U 3U1IB 3AW0A 2WPHS 1CHGA 2GDDA 3DHKH 1LCYA 1O38A 1BTYA 2PUQH 2ZCKP 4X2XA 5EQQA 1GHAF 1HCGA 5C5OA 1QFKH 1UVSH 3ODFA 3A84A 2B8OH 3FP7E 1DVAH 2B0FA 3F9GA 2ZEBA 1A1RA 1N1LA 1O2ZA 3ZV8A 2BB4A 4B76A 5C20A 2D26C 4FUHA 5GDSH 1BITA 4I8GA 2ZU2A 1MTUA 1WSSH 2C8YB 2FOAA 2BOKA 3VB5A 3A7YA 3DA9B 1THRH 4Y7BA 2ZU1A 1C2EA 1WAYB 1GBHA 4HGCA 1C1QA 3LIWA 1CHOG 1C4V2 5K0HA 2QCYA 3HKJB 5C1UA 1W14U 2O8MA 1HIAB 1C2JA 1QRXA 1TOCB 2Z3EA 3TH4H 1NU9A 2PKAA 1QJ1B 1LPKB 2PFEA 2HNTF 2ZO3H 4D9QA 1YPLH 1FQ3A 1YKTA 2VWMA 1QB6A 2XNIA 4MG3A 2ZG0H 4X0WU 4A1TA 5LH8A 5L30H 1GMDG 5FPTA 1YPGH 1DY8A 1KIGH 4ISLA 3VB7A 1VCPA 2Q6DA 1YCPK 1SGIB 2W7UA 2ZFRH 1NESE 2UUJB 4JMYA 5A0BA 4AGKA 1GBBA 1UTLM 4Y6DA 1BZXE 3B23B 3FZZA 3QZRA 1TYNA 1P10A 1UCYK 2C8XB 3A82A 4K3JA 1CT0E 1ZTKA 2BD7A 2HNTE 2F91A 2ZFTA 4UE7H 4CR5A 1ELVA 3PWBA 4IMQA 1RRKA 5I25A 1CGHA 5E0GA 1HAVB 1LHCH 4ABHA 1DOJA 1DY9A 1IQIA 1OWHA 1NRRH 1FY8E 3O8BA 4INKA 4FUFA 3A8DA 1EAXA 1S6FA 1MD7A 3M7UA 4LK4A 5FCRA 4DURA 1BTUA 2JKHA 3SUFA 3U8OH 1YPJH 1OWEA 4R0IA 1GDNA 3GCHC 4NSVA 3F9HA 1MTNB 1OP0A 1GMHG 2BVXH 2JH6D 4BTTB 2PWXA 2AS9A 3RXHA 3HGNA 4Y79A 2KAIB 2VIVA 4GPGA 3SBKA 4K1EA 1SGFA 1S0QA 1NC6A 5JBCS 2ZECA 2IJOB 1V2ST 2GV6A 2GX4A 3KGPA 1TNIA 3RU4E 4J1YA 2H9HA 2GZ7A 2ZGBH 3A88A 5FBIA 1HLTH 3BIVH 1LTOA 2OINA 3IG6B 3S69A 2FO9A 1NU7B 2QAAA 1AU8A 4MQAA 2F9BH 2QC2A 1YP9A 3BG8A 4AFZA 3P6ZB 1QQ4A 3BTGE 4R8TB 1C5UA 1QA0A 1GJ7B 3Q3YA 1KXBA 1TRYA 3B8JA 4NIYA 3TNSA 2BVRH 1P2OA 1SFQB 3VGCB 2WYGA 2BDYA 3MOCA 1TBQH 1LKBA 3OTJE 3P17H 1AVXA 1O35A 2HALA 2BY6X 3KHVA 1P2IA 3EA9A 3U98H 2BY8X 4ESTE 1K1PA 1TRNA 1SB1H 4BANB 3NK8A 1HIAA 1IQLA 1G36A 1SGDE 2EC9H 1B0EA 1K1JA 2ZDLA 4CRAA 2H6MA 1G9IE 2Y5HA 4RN6A 1ZMLA 1KY9A 4ZKRU 8KME2 1HAIH 4AYYB 2FOHA 1P8VC 2AIQA 2FI5E 3M5MA 4AFUA 3ZZ3A 2VH0A 2XCFA 5C2ZA 1ELGA 3GYLB 3UNSA 5DG6A 2Z9GA 3MNSA 1DUAA 1LPGB 1GI0A 2TRMA 3TU7H 3OY5U 1VJ9U 1DXPA 1L0ZA 2CGAA 1GJAB 3LGWA 1C5XB 2WYJA 3HPTB 3MFJA 1THSH 3UREA 1HAOH 9LPRA 2CHAB 1HAVA 3UQOA 1H8IH 3ATIA 9ESTA 1JMOH 2A7CA 3QTOH 3RXTA 2VIOA 3P92A 4TY6A 1ZRBA 1O2YA 4FU9A 4YT7H 1RTLA 1B0FA 4BXWA 5TCAA 1WV7H 3BTQE 1FAKH 1ZSJA 4YOGA 1QL8A 5C3NA 2P16A 1HNEE 4ZKNU 1GJ5H 3RXDA 1XVMA 2BOHB 1KDQB 2VVVA 3LC3A 4GSOA 3CS0A 1RTFB 4DGJA 1W3CA 1KXAA 2KAIA 1FUJA 5E0HA 5EQRA 1C5QA 1MAYA 2H9EH 3M35A 1BMLA 3MU0A 2D2DA 1SQAA 3MNCA 3SUDA 4ABGA 1BCUH 2GV7A 2G81E 1T8MA 3QDZB 2QXGA 5DK1A 1H9LB 1C2DA 1SLXB 3I29A 1ETTH 1V2MT 3KEEA 3AVZA 1N8OB 4OS4A 3RMMH 1QHRB 1XUHA 1TX8A 4JYUH 1DPOA 1ZHRA 4X8TH 1TGTA 3M37A 3RXKA 4O3TA 1YPHC 4DG4A 3RXGA 2ZTYA 2QXJA 1SOTA 3GCTF 4K8BA 4I8JA 4FVDA 1M9UA 1YC0A 4BAHB 2QA9E 4GCHF 4O3UA 1LO6A 2EEKA 1HAHH 4IGDA 5TCCA 1T8NA 4UEHH 3DUXH 4XDEA 2AMDA 3R0FA 1EXFA 1HJAB 1CBWB 1K2I1 2ANYA 3NUMA 4ZKOU 1C5PA 1E34B 1N6XA 5DP8A 3GDSA 4E05H 1CU1A 2AMQA 4IC6A 3PLBA 1RGQA 1PPGE 2SGFE 1O3AA 1E36B 1BQYA 4U01A 4K1SA 5JYIA 1BMNH 1FY5A 4X1SU 1H1BA 1W0YH 3QTVH 1MKWK 2J9NA 4HTCH 1FMGA 1C1NA 1QQUA 2EI8A 2TBSA 4AX9H 2SGQE 7ESTE 3T26A 2F9NA 5BRRE 5HM9A 1GI1A 3SV9A 1S6HA 2P93A 1ANBA 1SGEE 1XMNB 2H5DA 3RXOA 4YOIA 3PMHB 3UOUA 1T4UH 1ZLRA 1D3QB 5GJ4B 1SHHB 3A80A 2ZQ1A 2ANMH 1P2QA 2ZFPH 4BAMB 4A1XA 3UNQA 1YLDA 2FS9A 1NRNH 2QF3A 1XUIA 2YNAA 1SGYE 1FIZA 3EE0B 1Z6JH 2BY7X 2VIDA 2GCHG 2BXTH 5CMXH 2FLBH 1Y8TA 2OC1A 5T6GA 2FYQA 2Z7FE 5FCKA 2D1JA 1OWDA 5T3HA 3S0NA 1KDQA 1ESAA 4A7IB 2A1DB 2F9VA 3HK6B 1AKSB 1O33A 1WTHD 3RUOA 1O3PB 1ZJDA 2HVXA 3RMLH 3RXAA 2GT7A 4JYVH 1P05A 1QL9A 3SO3A 2BLOA 3DFJA 2PR3A 1VR1H 2ZFQH 5GWZA 4NIVA 3NXPA 3SOSA 2OTVA 1F5LA 1GHAG 1ELCA 3C27B 3ATKA 5DGJA 4X8SH 4Q2KA 3KN2A 4MLFB 4TYDA 2K1QA 3ZVBA 3RMNH 1TB6H 3U8RH 3ATLA 2BDAA 1WQVH 3GCHB 1V2RT 1UVOA 4JZIA 4D8NA 2ZKSA 2Y6TA 3O8CA 1PPCE 2IPHA 3MNBA 3M7TA 4MPVA 1ZHPA 4IC5A 1DT2A 2YNBA 4OS2A 1MU6B 1F2SE 2ZU4A 2FPZA 1GJ9B 4PROA 3UIRA 3BTHE 1AY6H 1O3BA 1GJ8B 3BTKE 5DKMA 2TGTA 1C1MA 1QL7A 1QIXB 3RXVA 1RXPA 1MTWA 3H5CB 2Z9IA 1S0RA 3ZYDA 1P02A 1O3NA 1TX6A 4RKOB 1P2MA 2SGDE 1SFIA 4ZHMU 2XXLA 5F8XA 1CO7E 3PV4A 3PROA 3VB3A 1TX7A 4Y0YE 4KELA 2ZDNA 4X1RU 1S81A 4VGCC 1TABE 3SQEE 4I31A 2C8ZB 1GBLA 3GY7A 2GP9B 3PTNA 3SUEA 4ABIA 1SG8B 3I77A 1XX9A 5AFZH 3RM0H 4NGAH 3M5LA 1Z1JA 2IN2A 3HGPA 1P03A 1GBDA 1TGCA 1WTGH 2PUXB 1QURH 2XC0A 2ZHQH 2ZC9H 2JETC 1YF4A 1F0TA 3KNXA 4ABDA 2VIQA 2PTCE 1FDPA 1HAZB 1K22H 8ESTE 1E35B 5GPIB 3ZVAA 2OQUA 1NPMA 1V3XA 3SV2H 3A8AA 1MBQA 1C2LA 1DX5M 3RXJA 4ZROA 3UOPA 3A8CA 1ZTLA 1VZQH 5EXLA 2A4OA 2LNCA 5IYTA 4BAOB 3Q00A 4JK6A 3MHWU 1LVOA 1J8AA 1JIRA 1NRSH 1BIOA 1E38B 3ELAH 4MNWA 4B73A 3F9EA 5EW2H 3BTFE 1ZR0A 1C5ZB 1MKXK 1UTNA 1JWTA 3M3SA 4Z6AH 3SJKA 1EPTC 2GZ8A 4Y0ZE 1QR3E 1TAWA 4CHAC 1OXGA 4YOJA 4GAWA 8GCHG 2FXRA 2G8TA 4AFQA 1KLIH 2AYWA 3QK1A 4D9RA 1SQOA 1EZUC 1SC8U 4K60A 1ID5H 1F0UA 3P8FA 2BX4A 1ZYOA 2TGPZ 3LPRA 1BHXF 2V0BA 4NA9H 1VGCC 3ZZBA 1QBVH 2Z3DA 5EW1H 3ZZAA 2UUYA 3H7TA 2XWAA 1AO5A 3TK9A 2UWOA 4NG9H 4UFGH 5HXFA 1UHBB 3M3TA 3T25A 1O0DH 3LONA 2BM2A 1BBRE 1SHYA 1V2LT 1TWXB 1RJXB 1Z8JB 2O8LA 2Z94A 2HLCA 2GCHF 2R2WU 4FXGH 1S83A 3W95A 3L3TA 3NCLA 1ARBA 2FTLE 3A87A 3LGTA 3GY5A 3MMGA 1AUTC 1GHXH 4ASHA 1LMWB 3SU4A 2W26A 1DUEA 1EB1H 1V2NT 2HPQH 1EKBB 3RM2H 4GHQA 2BHGA 5LPEA 1MAXA 1TBRH 2O8WA 1XXDA 3DFLA 1ELBA 2BDHA 2NU3E 2NU4E 3T2NA 1RFNA 2XTTB 4MNVA 4FUGA 3A7ZA 1TNKA 1AZ8A 5AF9H 1GHWH 1GGDC 1O39A 2A2XH 3S7KB 4DW2U 1FZZA 2FOBA 3CS7A 1NFXA 3GOVB 1C2IA 3LH1A 1ORFA 2XBVA 2WINI 1VCQA 1ARCA 1C4U2 4AORA 2A31A 1FXYA 2VNTA 4X8VH 1CQQA 4Q7YA 1GBKA 3MH7A 3DT0H 3F6UH