1L1JA

Crystal structure of the protease domain of an atp-independent heat shock protease htra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
228
structure length
226
Chain Sequence
DYESPIVNVVEACAPAVVKIDVVKTTSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Protease Domain of a Heat-shock Protein HtrA from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords heat shock protease HtrA
total genus 49
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1jA01
3FZDA 3BTME 2ZG0H 1CO7E 1XUFA 2Z94A 1BTYA 3KHVA 3MNSA 1GI2A 3P92A 3SNAA 4ABGA 1YPJH 1CBWB 1UHBB 4DG4A 3GY8A 3L3TA 3T26A 2PKAA 3T25A 1W3CA 2Q6FA 5GXPA 3LDXH 5DKMA 4X8UH 1FQ3A 1XUIA 1PQ7A 1NY22 1JRSA 2EI8A 4XBBA 1FN8A 1TMTH 1AMHA 1XXDA 4YOIA 1ANEA 4M7GA 3RXFA 3SV8A 4YTAA 1LTOA 5ESTE 1GMCG 1F0SA 2D8WA 1BB0B 1GJCB 4JYTA 1ANBA 1VCPA 3OY5U 2VIWA 4I8KA 2C8XB 4AFZA 4WJG2 5DJ7A 1EP5A 1H9LB 1MCVA 2AIQA 2Y5HA 3G01A 1NFWA 4LOYH 5C5NA 5FCRA 2DUCA 1T7CA 1A46H 1YC0A 1VGCB 2P3UB 2VINA 2NU1E 3VB3A 3KN2A 1P10A 1C5RA 1K9OE 1E34B 1ZJKA 3SQHE 1O3NA 8ESTE 3SJOA 3TPIZ 3TJNA 1SGFG 1QJ6B 1LPGB 5GCHG 1W12U 3PMAB 4AYVB 4FUBA 1O39A 1N6YA 1P2NA 5E0GA 1P2OA 2ZHFH 2BDBA 3UR9A 4JYVH 5EODA 2G55A 2W5EA 2BLOA 2FOCA 3HGPA 2ZO3H 4GSOA 4GVUA 4E05H 4OGXA 1C5TA 1FNIA 1Y3YA 4I7YH 1TGTA 2VIDA 3GYLB 2QIQA 5IDKA 5I25A 2ZPSA 1IQGA 3KF2A 3O8DA 4LXBH 2O8LA 1FMGA 2ZGXH 1C1VH 2G52A 3BTTE 4JZIA 1NRPH 1WQSA 1O2SA 1LKBA 2CXVA 2FX4A 2ZU2A 1THSH 4Y79A 3T5FH 2H9EH 1IQIA 2BLVA 1OP2A 1A0LA 3UQOA 1E36B 3VPKA 2UWLA 3F68H 2XWBI 1DPOA 3DFJA 2R2MB 3EDXB 1TA2A 3B8JA 2J2UA 4IW4E 5JB8S 4FVDA 4X6MA 3LGVA 2ZF0H 3M7QA 1LVOA 3M7TA 2VB0A 1KXEA 4GUXA 3Q3KA 4OS6A 1HJAC 3ZVFA 1DDJA 1O3OA 1DS2E 1FUJA 1GI6A 4HI3A 3P95A 2TGPZ 2HRVA 1JIRA 4DCDA 1W11U 4MQAA 1RRKA 3TLOA 1LHDH 2BD3A 4X0WU 1AU8A 4ABAA 2H6MA 1JIMA 5IYTA 1WYKA 1AE8H 2WPMS 3KGPA 1W2KH 4RKJB 1C2GA 1W7XH 3HPTB 5E0HA 2F9UA 1KXDA 2SNWA 1F0RA 2F3CE 2NU2E 5DP8A 1ELCA 2J9NA 3LT3A 1GMDF 1UTQA 1DANH 4SGAE 3K6ZA 4Z0KA 5T6FA 4NFFA 1CVWH 1GHAG 1P05A 2XRCA 3P8GA 2ZFTA 1KIGH 3UTUH 2D26C 2V3HH 1A3BH 2FXRA 1INCA 4H4FA 3GY2A 4ISNA 2ANKH 2C93B 1UTNA 2A31A 3RXSA 2O8MA 4SGBE 1S6HA 4A5TS 3CS0A 2BY7X 4ESTE 1UCYE 1ZTLA 3KEEA 2SNVA 3SNEA 4B71A 1BRAA 3NCLA 1C1PA 2Q1JA 1C2MA 1F5KU 1QB9A 1YPHE 2BVRH 4HZHA 3V7TA 2BQ7B 4BANB 1DM4B 3GYMA 4GCHF 1BJUA 1WSSH 3KIDU 2PTNA 4D7FA 4B2BA 2G5VA 4WY3A 3T2NA 1O3LA 2G4UA 2Q6DA 3ZZBA 3N7OA 1J15A 1PPZA 2F83A 4TYDA 2FOBA 3UNSA 2BTCE 1HDTH 1C5QA 3TH3H 2OINA 2AMDA 2ZP0H 4INHA 3PM3A 2G4TA 5J4QA 2ALPA 3E16B 4Y71A 2YOLA 1UJ1A 2BD4A 1OS8A 1T31A 2OBOA 1DWEH 1CBWC 5C3NA 4KTSA 9LPRA 3UQVA 5DP4A 3SNDA 2AFQB 4WH8A 2W3IA 1TYNA 3SGAE 2ZIQH 3GDVA 1L0ZA 4CRFA 1MKWK 1FAKH 2RDLA 1OYTH 3LJOA 1DVAH 4CRBA 5CE1A 4Y76A 3UOUA 1SC8U 3QWCH 2ZWLH 4JZEH 1EP6A 5CHAC 3F1SB 1QL9A 3RXBA 1LQEA 3A7VA 4E7NA 1C4U2 3VB6A 2F9OA 2QGRA 5F03A 2BVXH 1PFXC 2FOGA 1OXGA 3VXEH 3LGUA 2DE8A 2FI3E 3BSQA 4X2XA 2IN2A 1EUFA 3A88A 3AAVA 4JZ1A 3STIA 4OS5A 1ARBA 3UWJH 1MU8B 3NPSA 3SJKA 2BLWA 3EA7A 5EXLA 3BTEE 1E37B 1TPOA 1BRUP 1GHVH 2Z9JA 2BD2A 3S7KB 4BTIB 1HFDA 5ESBA 2C8ZB 1MCTA 2BB4A 3F9EA 1AUJA 1V3XA 1O3IA 2ZI2H 4UFFH 4F49A 4Y7BA 2B7DH 4ABHA 1U6QA 3BTDE 3R0FA 1BOQA 5JYIA 3RMLH 2ZNKH 1QHRB 1XMNB 2ZCHP 2ZPRA 1TRYA 4AFQA 1KLIH 3D49H 1O3DA 2PSYA 4WH6A 1UHBA 3E90B 1JBUH 5FX5A 4PROA 4XSKU 3RXAA 3MNCA 2HPQH 2Z7FE 4GAWA 2BDGA 1YPKH 1BTZA 4ISHH 5L6NH 1GI0A 1YP9A 4RSPA 4B73A 3D62A 4OS2A 1O5EH 5FHTA 6ESTA 2XNIA 1NO9H 3SUFA 4MG3A 4FUEA 3SJIA 1HAHH 1OWIA 1Z8RA 3E91A 2VH6A 5F6MA 1ZMLA 4CRAA 5C1UA 3FAOA 4X8VH 1DLKB 4X2WA 4UFGH 2P8OB 3QGNB 3EGKH 1C5UA 4FUDA 1NM6A 3BTHE 1ELEE 1O0DH 1MKWH 1E38B 2O8UA 1BRCE 1ELDE 1DLEA 1RTKA 2BX4A 1C1SA 8LPRA 3T29A 2GV7A 3NWUA 5C1XA 2ASUB 3TNSA 1LPKB 1WQVH 4MVNA 1O5BB 4U32A 2HWLB 3SORA 1O2TA 3Q76A 3SV7A 1GG6C 2PV9B 3GY3A 3MI4A 1YCPK 3L33A 2F91A 2FOEA 4AFSA 4K5ZA 3I29A 1AD8H 3HK6B 5CMXH 3S69A 2M5TA 3A8BA 3W94A 4R8TB 4YM9A 4Q7XA 4D8NA 3RU4T 1XUGA 1FPHH 1Y59T 1ZSLA 4K8BA 3DD2H 1QQ4A 1V2KT 1GCTB 3QUMP 1UK2A 1O2JA 8KME2 5EU8A 3RXMA 3QGJA 2B9LA 1V2NT 1WU1A 1SGTA 2CJIA 3QX5H 2ZCLP 1V2JT 2VNTA 2ZECA 1RGQA 4CHAC 2OTVA 1TGCA 5EPNA 2R9PA 4MNXA 1KSNA 5FPSA 7LPRA 1TOCB 3A8AA 2QC2A 2OQ5A 4RKOB 2FS9A 1W14U 2WV5A 1GJBB 5I46H 1A0HB 1HIAB 2XCNA 1FONA 1SGIB 4I8HA 2BOKA 5EXMA 2JH5D 4I8LA 3NXPA 1L1GA 2BXTH 1XUHA 3A82A 5JPMH 4YLUA 1UCYH 1TGNA 1ESAA 1GHYH 1GBJA 1WTHD 2VVVA 5EG4A 2BZ6H 5LH8A 1FY3A 4OS7A 2JETC 1EOLA 1MH0A 4A1TA 1DWDH 2H1UA 2PGQB 1HAVA 1A2CH 1UTOA 3KL6A 1PPCE 1ZMJA 1DWBH 1NRNH 2ZGHA 1MTUA 1SGRE 1L1JA 2OC1A 1GL0E 2J95A 4BAHB 3A7TA 4K69A 1F0TA 1SLXB 4X6OA 2AYWA 1HPGA 1M9UA 3SGQE 4NSVA 1WAYB 3E8LA 3NUMA 1Y5UT 4B2CA 1AB9B 1GL1A 2UWOA 2WYGA 1P03A 4E7RG 1QRWA 1RTFB 2SGEE 1O5CB 1EAIA 2H2ZA 1HLTH 1S82A 1UVUH 3RM2H 3RXEA 1UMAH 2PW8H 2NU4E 1GJ4H 1VITF 1MD7A 2F9NA 4IBLH 3VEQB 4TY7A 1HAGE 1G36A 1GGDC 3ESTA 4TPYA 4ZHMU 2BY9X 5EQRA 2ANYA 3P8OA 1TAWA 3RXQA 2FO9A 4BNRA 1IHTH 4XBDA 2WV4A 3V0XA 1CA0C 1A7SA 2GP9B 3SNBA 2UWPA 2ZTZA 3SV2H 2RA0A 3BF6H 4Y6DA 2Y5FA 1QBNA 3OSYA 1JXPA 2BVSH 4KP0A 1BITA 4NSYA 1K2I1 1K1NA 1GJDB 2RA3A 1C2DA 3VB5A 5E8EH 4YOGA 1HGTH 4BTTB 3ZYEA 4MPXA 5DO4H 2XC5A 1UTPA 3NK8A 1Z7KA 5CHAB 3UPEA 2BQWB 1SL3A 1ZTJA 1RS0A 2QF0A 3MO3A 3M3TA 4FU9A 3RUOA 3BTFE 1EB2A 4AB9A 1GI8B 2Y7XA 1MTSA 2FZZA 1Z8GA 5DP7A 1OWKA 2FWWA 3MH7A 2ZU3A 1LVBA 1BQYA 3RMOH 4INLA 1N6XA 3T27A 1HIAA 4IN2A 3RXDA 2G8TA 2ZA5A 1QTFA 2G00A 2ZFQH 1ABJH 1IQNA 2CHAC 3A80A 1SGQE 1XUJA 2HVXA 4BOHA 3MH6A 3PROA 1GI9B 3GDSA 2HPPH 2Z9LA 1HV7A 2V3OH 8GCHF 4TY6A 1LQDB 2QXJA 3SV9A 2QYIA 1TBQH 2FMJA 3LPRA 4DGJA 1S6FA 3MH5A 1LCYA 1ELGA 1HJ8A 2IJOB 5C20A 3PO1C 1KDQB 5A0BA 4ABIA 2PKSC 3MU8A 1D3DB 2TBSA 3LC5A 4D9QA 1MTNB 3K9XB 3ZZ5A 3GY7A 4Q7ZA 1Q3XA 1SVPA 1H9IE 3BG4B 1MD8A 1C1MA 1DSUA 4WWYA 1TGBA 1C5WB 7ESTE 5TCCA 2QV1A 1MBMA 1GI3A 3PWCA 1ZMNA 4A7IB 1GJ6A 1PPFE 1ZTKA 3BG4C 3U8TH 1C2KA 1GGDB 2J4IA 2CV3A 2AIPA 5EQQA 1O2OA 1VR1H 2PWXA 2R2WU 1NROH 1ZHRA 3AAUA 1O3FA 3C27B 2FTMA 1NFXA 4BAQB 4K60A 2FM2A 3M5MA 5HYOA 4ZKRU 5BRRE 1A1RA 1PJPA 1NRSH 2C90B 2ZU1A 3SZNA 5A8XA 1O2GH 2G51A 1ELBA 1GBFA 5FAHA 2EC9H 3ATWA 4Q7YA 3RC4A 1THPB 3H7TA 1FN6A 3GY6A 2VU8E 4AORA 1SQAA 3GDUA 3U69H 2J94A 2FDAA 1C5NH 4R0IA 1WTGH 2PGBB 3I77A 1EATA 1OSSA 3H5CB 5H4IB 2ODPA 1AKSA 5L2ZH 2D2DA 2ZQ1A 2P95A 1CGIE 1OX1A 2XBXA 2FS8A 2H5CA 2AGEX 2CMYA 3KQBA 1O35A 4FUJA 1TONA 4YT7H 4GLYA 2QXIA 5G4BA 2OQUA 1TBZH 1FXYA 2GT8A 4A1XA 3OYPA 1CHOF 3LC3A 3RU4E 1WBGB 1HXEH 1IQHA 3RDZA 4ISOA 1T4VH 2BOHB 1G3BA 1O5GH 3UR6A 1YPEH 3A89A 5AFZH 4H42U 4AG1A 3DT0H 1BHXF 1C1TA 4MTBA 4FUFA 2ANWA 1SI5H 2ZCKP 2VIQA 3VB7A 4WVPE 2PTCE 1D6WA 3A85A 4D9RA 1UVSH 1NESE 4AYYB 3F9GA 2Q6GA 1LMWB 1WV7H 5EQSA 1KXAA 1E0FD 1N1LA 1O5DH 2O9QA 3FVFB 4NG9H 1AUTC 3HKJB 1TNHA 1A0JA 1D3PB 1AY6H 2R0KA 1UK4A 1YPLH 3SU5A 1SBWA 5J4SA 1P12E 1GPZA 5A2MH 5FPTA 1VGCC 2HNTC 4ZKOU 2FOFA 1QA7A 2WPIS 1ZR0A 1HAYB 4NIWA 2ZDKA 1CT4E 1KY9A 1OWHA 2W26A 1O2YA 3IG6B 4IC6A 1UO6A 4YOJA 3SI3H 1SGEE 2PLXA 1SSXA 3PYHA 1BMNH 1T8LA 2BD9A 3F9FA 3FZZA 5T6DA 3AW0A 2GCTC 2VVUA 1HYLA 1QA0A 3TNTA 4NWKA 2BD7A 2QCYA 1O5FH 1MMJN 5LPFA 4WMFA 2QY0B 1ZSJA 1MUEB 2AEIH 1P57B 2P8OC 1P02A 2GDEH 1O3EA 5DP5A 1A5GH 1O3MA 2F9VA 4IGDA 4U01A 1Y3VA 2QAAA 1MAYA 8GCHG 3HK3B 3ZVBA 3BEUA 1DXPA 1N8OC 1GJ8B 1QJ7B 1QL8A 2BY8X 3ATIA 2Z9KA 3VB4A 3ZZ3A 1SHHB 2BD5A 1P3EA 3M5LA 1ELFA 4BXSA 1G3DA 1HNEE 1EASA 2H9TH 4Y8YA 1O31A 2ZHEH 2VGCB 2VWLA 3QLPH 5FBEA 1FLEE 3SU6A 2SGQE 3JZ1B 3P8NA 1KTSB 2Y7ZA 1QRZA 1O2HA 1IQEA 1L4ZA 4JYUH 4ABJA 1ANCA 1P0SH 2ANMH 1TBRH 6GCHF 5JBBS 1G3EA 5ETXA 3SUDA 2A32A 3K6YA 4CHAB 4ZXYH 1FZZA 4X2YA 1ZRKA 5C1YA 2FYRA 1KTTB 1QRXA 2GCTB 1X7AC 2HLCA 4J2YB 3SHAH 2NU0E 3A8DA 3LU9B 1FY1A 2P59A 1T8NA 2GZ9A 3PMHB 1G9IE 3SU3A 2ZHQH 3TVJB 3UOPA 1O2IA 2GZ7A 1NT1A 5K0HA 1TB6H 3ZV8A 1PQ5A 4Y0ZE 1P09A 2BDYA 4MPWA 4NIVA 1Z71A 3S7HB 2A45B 5E2PA 3D65E 1HAIH 3SHCH 1THRH 1TX7A 2VH0A 1BTHH 1QJ1B 1ACBE 1EZUC 1YCPH 4X1RU 2ZDVH 1C1UH 5FXLA 3GCTF 2OUAA 4GCHG 3RXCA 5FCKA 3HGNA 3SU0A 1F2SE 3U8OH 2PKAB 1C5LH 3FP7E 3SU2A 1ETTH 2FOAA 5DP6A 1VCWA 1ELVA 1GJ5H 4D7GA 2XC0A 1BTUA 2VIPA 3MHWU 1KLJH 2ZC9H 6CHAB 2TGAA 5JBAS 1O3KA 3BIUH 3FP6E 4Y7AA 3U9AH 1BDAA 1V6DA 3TH2H 1TNKA 1GHWH 1W13U 1P2KA 1W0YH 1SMFE 4K2YA 3M61U 1SGPE 2THFB 3M36A 1EJMA 3MMGA 4NZLA 5FX6A 4DOQA 4XE4A 4Y11E 2VWOA 4NCYA 3V3MA 3BTQE 3A83A 3O8RA 1CT0E 1TPPA 4O97A 1BHXB 1QB1A 1JWTA 3OTJE 3ATLA 2Y82A 3PLPA 1NTPA 3LH1A 2C8WB 3TGKE 2FODA 1AKSB 1K22H 1V2TT 4X1NU 1ZHPA 3O8BA 3GCHB 2D1JA 3IWMA 1YPHC 4KGAA 3AVZA 4LK4A 3B9FH 1NRQH 1TPAE 1ESTA 4CBNA 1N8OB 2ZDNA 4NA8A 2A4QA 1C5PA 4AX9H 2AH4X 1KDQA 1P01A 1P9UA 3BIVH 1SOTA 3CENA 1J17T 1F0UA 2P3TB 1EAWA 1GI5A 2AGIX 3STJA 5EW1H 1GHZA 1MZAA 1SG8B 4A1VA 1HBTH 4MPVA 3GISB 3PMJA 1DY9A 2A5AA 1JOUB 3DHKH 2WYJA 1C5MD 5FBIA 2CF9H 2BDAA 4ZAEA 1G3CA 1BTPA 1AVWA 4ABFA 2ZTXA 2B8OH 2Z3CA 3SN8A 2A1DB 4MNVA 1ELTA 1KXBA 3L6PA 4BTUB 2Z3DA 1MZDA 2CGAA 4Y8ZA 2QN5T 1EAXA 3RXLA 2GVFA 4BAOB 4DURA 1NZQH 5GWZA 3SJ9A 4FU8A 4U2WA 5T3HA 2AGGX 2GX4A 2R3YA 3A84A 1V2UT 3VXFH 3UNRA 1RIWC 3GCOA 1EB1H 5EW2H 4J1YA 1ID5H 2XTTB 1S81A 1YLDA 4DIHH 1SFQB 2WINI 4INKA 4FU7A 4ISIH 1O3PB 3ATKA 3PWBA 2ZGJA 1GVKB 2RG3A 2WUBA 4UEHH 3M35A 1IQJA 1BJVA 2XCFA 1QR3E 3RLWH 4Z6AH 3QK1A 2STAE 1C5OH 1IQKA 2FOMB 3M7UA 1ETSH 1O30A 3TIUA 4TWWA 4MPUA 2GGVB 3CS7A 3O8CA 1UTKA 1PPBH 2LPRA 3LGTA 1SGYE 1ZGVA 4ZHLU 4FUCA 4X1QU 3TGIE 1C4V2 3AW1A 5GPIB 1ZPCA 2I6QA 3T28A 3TH4H 1SFIA 4VGCC 3ZVAA 3RXPA 4YT6H 1ARCA 4IN1A 3VGCB 1DOJA 1DT2A 4K1EA 1O32A 1AGJA 4NA7A 4AFUA 3ZVGA 1J8AA 1Y5AT 1MQ6A 1NFYA 3CP7A 3BEIB 3ZV9A 1DY8A 4B2AA 2OP9A 3GCNA 3RLYH 1C5ZB 2ZU5A 3SOSA 1BUIA 1PPEE 2H5DA 2FYQA 1Y3XA 1SGNE 3SI4H 1Y5BT 3ZVCA 1EJNA 3P17H 1C2LA 2ZPQA 1O3CA 1CA8B 1OPHB 1BMAA 2VWMA 1C1OA 3P8FA 2P16A 3PB1E 1W8BH 1GHAF 1HCGA 2ZHDA 9ESTA 4KELA 6LPRA 4I8JA 1CGHA 3EQ0H 2O8WA 1ZPZA 1UCYK 4GHTA 1RIWB 1CSOE 1O33A 2R3UA 3DA9B 1DXWA 3URCA 4A6LA 1V2ST 2K1QA 2GV6A 1G2LA 3RXVA 5L2YH 1V2RT 5A8ZA 5A0CA 2ALVA 4YESB 1LDTT 5TCAA 1LHGH 5AHGH 4O03A 1MTNC 2A0QB 3B23B 1GHXH 1IQFA 1GWAA 3RXJA 1B7XB 1NU7B 2CF8H 1B5GH 1DICA 2BDHA 3GICB 3Q3YA 3BTKE 1RJXB 1BTWA 1BTXA 4TWYA 2J92A 1D3TB 1LO6A 3RP2A 1TALA 4IS5A 2ODQA 4CREA 3ODDA 2FIRH 4B1TA 1MKXK 5GJ4B 1YPGH 2ZZUH 5LPEA 4ZXXH 2PFEA 3R3GB 1NU9A 3QZRA 1GBMA 4HFPB 1Z6EA 1ZJDA 5F8TA 1L1NA 3PMBB 1VJ9U 4X8TH 3SBKA 2CHAB 3TGJE 1SB1H 3GCHC 5A09A 1W10U 1Y3WA 3BTWE 3SU4A 3FP8E 2BYAX 1RTLA 1VCQA 3S9AA 4CBOA 2FP7B 2PUQH 1H9HE 1TA6A 2NWNA 2WPHS 1J16A 5HXFA 1TRMA 1QB6A 2TGTA 1UTMA 1GVZA 4I33A 4UDWH 5GCHF 2XBYA 1XM1A 2BDIA 3S0NA 4I8GA 1TX8A 4X6NA 1T8OA 3I78A 2ZFFH 4X2VA 4CRCA 1FIZA 1KYNA 1ANDA 2GD4B 5HM2A 3RXOA 4FVBA 1YBWA 1O2MA 1TQ0B 2R0LA 1T32A 3SNCA 1CGJE 3SUEA 1Q31A 2GCHG 1TOMH 3QDZB 4ZROA 1YKTA 1EZQA 1NN6A 3A7XA 1FY8E 4AN7A 2XXLA 1EAUA 4IMZA 5A0AE 3UUZA 5JBTA 1CA0B 3Q00A 3LOXA 1SQOA 2BM2A 2UUKB 4WXIA 3ZZ7A 1O5AB 5AFYH 1IHSH 5EGMA 5T6GA 2ESTE 1GDUA 2VIVA 2TIOA 3S9CA 1EZXC 1KXFA 2WPJS 2AERH 1GBTA 1RD3B 1GI4A 1V2LT 3EAJA 2BD8A 3UFAA 1VZQH 3M3VA 2TGDA 1GJ9B 2BY6X 3DFLA 1P2QA 3TK5A 3SJ8A 1BBRH 2WPLS 4CH8B 2Y6TA 4FXGH 2JH6D 1PPHE 1J9CH 1AHTH 1NFUA 4JK6A 1GDQA 1IQLA 3RC6A 2B5TB 4XOJA 1MQ5A 1HUTH 3MTYA 5BPEA 1AIXH 3KCGH 2Z9IA 2XBWA 1G2MA 1HJ9A 3E0NB 1PYTD 4XDEA 2ZEBA 1YLCA 1ZZZA 1CU1A 2FX6A 4Y10E 1VITG 1QGFA 1LHEH 1L2EA 1MTWA 1OP0A 3SV6A 4NA9H 2A5KA 1AWFH 2FLBH 2TPIZ 3TJUA 1VITH 3MO6A 2RCEA 3QN7A 5JDUB 2QXGA 1DUAA 1K1JA 2EI6A 3A7WA 1Z8IB 1SR5C 3MU1A 4H6TA 3QTOH 4ZUHA 1AI8H 2SGDE 1AQ7A 1QL7A 2ILNA 4WXVA 2SGAA 1GBIA 4ISLA 1C9PA 2FOHA 4MNWA 6CHAC 1DSTA 4K1TA 4DY7B 1C5SA 1ZLRA 1UVOA 5DPAA 1P2IA 1HAOH 4JZFH 1ZOMA 2YNAA 5GDSH 4JMYA 1QNJA 3F9HA 1FI8A 5LPRA 2BLQA 5E0JA 2BY5X 1DITH 1IQMA 3RXHA 1LVMA 1C2EA 1C2FA 3LGWA 4FUGA 1HAPH 2AMQA 1ZPBA 1S0QA 2ULLA 3ZZDA 1HXFH 1O2PA 1UVPA 6GCHG 3C1KA 1V2OT 1O36A 2A4OA 4JK5A 3MU4A 3ZZCA 4K3JA 1DUEA 4UD9H 1A61H 1LHCH 1AZZA 4B74A 4HGCA 3ZZ9A 5F8ZA 1C9TA 1A3EH 3LGIA 2A4RA 3MH4A 1C5VA 1BZXE 2ZGBH 4WMDA 1AVGH 5JB9S 1AZ8A 2XW9A 1D4PB 3RU4D 3BV9B 4CH2B 1GMCF 3KNXA 1QQUA 1H1BA 1SLWB 1V2VT 2Z6BD 1FY5A 1SLVB 2BHGA 4AGKA 2I6SA 3A8CA 1AE5A 1ORFA 2C4FH 4HTCH 1DFPA 4CR9A 1O3JA 3M37A 1LKAA 2GMTB 5HMAA 2GT7A 3UY9A 3LIWA 1BRBE 1G30B 4U30A 3ZVDA 1Z8JB 3LH3A 4ZHAA 2VIOA 2P94A 3MU0A 5PTPA 1AN1E 3RXRA 1TNGA 1GBLA 1LHFH 1GMHF 1LPZB 2BDCA 2SGFE 2W7SA 1L4DA 2PUXB 3F6UH 4NZQA 3WY8A 3A81A 3P6ZB 3SO3A 1SGDE 4IMQA 2VVCA 5C2ZA 1HB0B 2BZAA 4K1SA 3TJOA 4I32A 1GMDG 2Y5GA 2F9PA 3VFEA 3K2UA 2PR3A 4DVAU 1O2WA 2DE9A 2A5IA 2XBVA 3BEFB 2JKHA 1E35B 3GOVB 1TE0A 1HRTH 3SQEE 3OY6U 3RXIA 5SGAE 1V2WT 5E2OA 1EPTB 1QIXB 1TX6A 2PSXA 3A7YA 4NWLA 1ZGIA 4F4OC 2BMGB 5TJXA 3MWIU 2OC7A 4H6SB 1G32B 3IITA 4KTCA 4JZDH 1ABIH 5K7RA 3EE0B 3UREA 1PQAA 2STBE 1ELAA 4B76A 3TK6A 1J14A 1Z1IA 3GY5A 3ZZ4A 1WUNH 1D6RA 1XVMA 2UUFB 1GHBF 1B0EA 2GKVE 3MFJA 4DIIH 3V13A 3PO1B 1P06A 3EA8A 3RC5A 4MDSA 2HNTE 1K1IA 4WMEA 2GCHF 3A87A 4KTUA 2WPKS 2W7UA 1MBQA 4YLQH 1RXPA 1RFNA 1YGCH 1S5SA 1O34A 3M5NA 5FPYA 1S84A 1K1PA 1NC6A 2QF3A 1PQ8A 1TMBH 3QO6A 4CR5A 1YM0A 1O37A 1C5YB 1GBCA 1GJAB 1H8IH 1P8VC 2FTLE 1C1WH 1QURH 1SQTA 1K1LA 1HAXB 2XWAA 2PHBA 4A92A 3VGCC 1F5LA 1GBBA 4DT7B 3RXKA 1A4WH 3SU1A 2A2XH 1KLTA 2ZFSA 1GBHA 4GHQA 2A2QH 1O2UA 3HATH 5DGJA 1PYTC 1YPMH 3ZVEA 3S9BA 4FUIA 1ETRH 1C2HA 5LGOA 5EXNA 2HGTH 1DWCH 1XUKA 1V2PT 1XKBC 3M3SA 3K65B 1ZSKA 7GCHF 1Y3UA 1H4WA 4NGAH 4ASHA 4LZ1H 3HKIB 1XXFA 1XVOA 2ZFRH 4MLFB 3ZZ6A 1MKXH 1Z1JA 3KQEA 2V6NA 2AMPA 3GY4A 3PLBA 1UTJA 1TNJA 1EZSC 1SHYA 4AGJA 1B0FA 3URDA 3QZQA 4GPGA 1QBVH 2FPZA 5DG6A 2VJ1A 1S0RA 1ESBA 3SGBE 2V35A 4AOQA 2FI5E 1K21H 3ENSB 1JRTA 4UFDH 1FIWA 1CHOG 4Q80A 1BIOA 4X1SU 1O2RA 2QA9E 4DJZB 3RXTA 1QY6A 1EPTC 4CRDA 1GI7B 1NRRH 4DW2U 5L30H 1O2ZA 3DUXH 4Y8XA 3ATMA 3ZYDA 2C8YB 1AO5A 3U8RH 3EA9A 4ABBA 2PKSB 3RXUA 2FLRH 1AB9C 1EPTA 1TMUH 2ZTYA 1O3BA 4ZH8A 4YZUA 3A7ZA 3FFGA 2ZDMA 2ZFPH 3TJVA 1P9SA 5EOKA 1P3CA 2XC4A 3P70B 3BTGE 1NS3A 5F8XA 3PV4A 3BG8A 3ODFA 4JCNA 3MNBA 1P04A 2FI4E 2QXHA 1MU6B 1AFEH 1H8DH 4E06H 4X1PU 3ZZ8A 1HJAB 2EA3A 1A5IA 4YO9A 1TPSA 3PTBA 3U1JB 1BT7A 1HAVB 1EXFA 3E0PB 4XBCA 1TFXA 1BA8B 1MTVA 1O2VA 3RMMH 1O3AA 3RXGA 2P93A 3A86A 3OX7U 2J34A 4VGCB 1WCZA 1TRNA 1FJSA 1BCUH 4X6PA 2YNBA 3E6PH 1F92A 1SPJA 1TNLA 5AF9H 1CHGA 1WOFA 2O8TA 3TU7H 1IOEA 1LVYA 1F7ZA 4BXWA 1GCDA 2A4GA 1A5HA 1SGCA 1DE7H 3KQDA 3NZIA 2G81E 4ZMAH 1SLUB 4XFQA 3NKKA 3TK9A 3OU0A 2GZ8A 2GDDA 3MOCA 4D76A 4TPIZ 1Y8TA 3E3TA 2BQ6B 1GBKA 1QFKH 4LZ4B 1TWXB 1K1MA 1V2QT 1GJ7B 3MNXA 3GCTG 4K8YA 1KXCA 2ZGCA 1C2JA 1GBEA 3UWIA 4QT8C 3MO9A 5C5OA 4ZKSU 3UNQA 4X8SH 2A7HA 1HAZB 1PPGE 1GMHG 1EJAA 1UTLM 2ZKSA 4WF8A 1OP8A 3RM0H 1TNIA 2J38A 4I31A 2P3FH 2A7CA 1AFQB 1BMMH 2SGPE 3AASA 3U98H 7GCHG 1Q2WA 1O2XA 1AVXA 1T4UH 3LONA 1O2QA 2XYAA 3PLKA 2AS9A 3KQCA 1O3HA 3EYDA 1S85A 4OS4A 2EEKA 3ITIA 3LKWA 1OOKB 1O2NA 1FAXA 2LNCA 4CRGA 3LJJA 4Q2KA 1TQ7B 1EX3A 1OKXA 4MNYA 1FY4A 2Y80A 2G5NA 2H9HA 4AB8A 2F9BH 5A8YA 2TRMA 2Z9GA 1UK3A 2OLGA 2VWNA 1CE5A 1OWEA 2KAIB 1YF4A 1TGSZ 1Z6JH 1OWJA 1T8MA 1ZYOA 2ZDLA 4NIYA 2ODYB 2BXUH 1EKBB 2WUCA 4IC5A 1OYQA 4ABEA 1W0ZU 2EI7A 1CT2E 1O38A 1GBDA 4ABDA 1FDPA 1EOJA 5DP3A 1O2LA 2VGCC 2JETB 1C5XB 4AZ2B 2KAIA 3MYWA 2HOBA 4Y0YE 3U1IB 4BAKB 3TITA 2NU3E 1GHBG 3FANA 1P11E 5DP9A 3W95A 2GMTC 3V12A 2OBQA 1BMLA 1W7GH 2OXSA 2C3SA 3SW2B 2W3KA 1GDNA 1V2MT 1AWHB 3H7OA 1QCPA 1D9IA 5GIBA 2B0FA 4NIXA 4UE7H 1P2MA 4RN6A 4UFEH 2FESH 5JBCS 1BBRK 3D23A 4FUHA 1YCPM 1TABE 7KMEH 1C1RA 1XKAC 3SUGA 1JMOH 2HALA 2IPHA 3Q3XA 1C1NA 1ZHMA 5EPYA 3ELAH 1QBOA 5HM9A 5HGGA 1VJAU 5ABWA 2HNTF 1GCTC 1K28D 1O2KA 1XX9A 3M5OA 3MU5A 4O3TA 2OD3B 4ZKNU 3RMNH 3E1XB 2BX3A 2UUJB 3LGYA 3UIRA 2OCVB 2UUYA 1OWDA 1S83A 1F5RA 3QTVH 1SOZA 1TLDA 4AG2A 1ZRBA 1UVTH 3T62A 2CN0H 4O3UA 4BAMB 2JH0D 1GBAA 3BN9A 1TIOA 1NPMA 4OS1A 5C67A 3JZ2B 1BBRE 4UONA 1YYY1 2ZHWH 1AFQC 5B6OA 1CQQA 1GVLA 1P2JA 1SGFA 2Y81A 2OC8A 2GTBA 4B75A 1GG6B 4THNH 1G37A 3ZZAA 1GI1A 1FPCH 1K1OA 1IAUA 1D3QB 4KKDA 2FEQH 1C4Y2 4OGYA 1FV9A 4NFEA 1C1QA 1EQ9A 2ZDAH 2OC0A 2SFAA 2A7JA 2Z3EA 3PTNA 3Q77A 2ZQ2A 5DK1A 2IOTA 2V0BA 1C2IA 4O9VA 1DX5M 5AVDA 2ZU4A 1O3GA 1MAXA
chains in the Genus database with same CATH superfamily
3FZDA 3BTME 2ZG0H 1CO7E 1XUFA 2Z94A 1BTYA 3KHVA 3MNSA 1GI2A 3P92A 3SNAA 4ABGA 1YPJH 1CBWB 1UHBB 4DG4A 3GY8A 3L3TA 3T26A 2PKAA 3T25A 1W3CA 2Q6FA 5GXPA 3LDXH 5DKMA 4X8UH 1FQ3A 1XUIA 1PQ7A 1NY22 1JRSA 2EI8A 4XBBA 1FN8A 1TMTH 2KZ4A 1AMHA 1XXDA 3ZIAD 4YOIA 1ANEA 2V3MA 4M7GA 3RXFA 3SV8A 4YTAA 1LTOA 5ESTE 1GMCG 1F0SA 2D8WA 1BB0B 1GJCB 2YMSD 4JYTA 1ANBA 1VCPA 3OY5U 2VIWA 2YMSB 4I8KA 5EJLA 2C8XB 4AFZA 4WJG2 5DJ7A 1EP5A 1H9LB 3SYJA 1MCVA 2AIQA 2Y5HA 3G01A 1NFWA 4LOYH 5C5NA 5FCRA 2DUCA 1T7CA 1A46H 1YC0A 1VGCB 2P3UB 2VINA 2NU1E 3VB3A 3KN2A 1P10A 1C5RA 1K9OE 1E34B 1ZJKA 3SQHE 3PV5A 1O3NA 8ESTE 3SJOA 3TPIZ 3TJNA 1SGFG 1QJ6B 1LPGB 5GCHG 1W12U 3PMAB 4AYVB 4FUBA 1O39A 1N6YA 1P2NA 3WWBA 5E0GA 1P2OA 2ZHFH 2BDBA 3UR9A 4JYVH 5EODA 2G55A 2W5EA 2BLOA 2FOCA 3HGPA 2ZO3H 4GSOA 4GVUA 4E05H 4OGXA 1C5TA 1FNIA 1Y3YA 4I7YH 1TGTA 2VIDA 3GYLB 2QIQA 5IDKA 5I25A 2ZPSA 1IQGA 3KF2A 3O8DA 4LXBH 2O8LA 1FMGA 2ZGXH 1C1VH 2G52A 3BTTE 4JZIA 1NRPH 2L6OA 1WQSA 1O2SA 1LKBA 2CXVA 2FX4A 2ZU2A 1THSH 4Y79A 3T5FH 2H9EH 1IQIA 2BLVA 1OP2A 1A0LA 3UQOA 1E36B 3VPKA 2UWLA 3F68H 2XWBI 1DPOA 3DFJA 2R2MB 3EDXB 1TA2A 3B8JA 2J2UA 4IW4E 5JB8S 4FVDA 4X6MA 3LGVA 2ZF0H 3M7QA 1LVOA 3M7TA 4XD7D 2VB0A 1KXEA 4GUXA 3Q3KA 4OS6A 1HJAC 3ZVFA 1DDJA 1O3OA 1DS2E 1FUJA 1GI6A 2IJD1 4HI3A 3P95A 2TGPZ 2HRVA 1JIRA 4DCDA 1W11U 4MQAA 1RRKA 3TLOA 1LHDH 2BD3A 4X0WU 1AU8A 4ABAA 2H6MA 1JIMA 5IYTA 1WYKA 1AE8H 2WPMS 3KGPA 1W2KH 2WV9A 4RKJB 1C2GA 1W7XH 3HPTB 5E0HA 2F9UA 1KXDA 2SNWA 1F0RA 2F3CE 2NU2E 2XNDD 5DP8A 1ELCA 2M2AA 2J9NA 3LT3A 1GMDF 1UTQA 1DANH 4SGAE 3K6ZA 4Z0KA 5T6FA 4NFFA 1CVWH 1GHAG 1P05A 2XRCA 3P8GA 2ZFTA 1KIGH 3UTUH 2D26C 2V3HH 1A3BH 2FXRA 1INCA 4H4FA 3GY2A 4ISNA 2ANKH 2C93B 1UTNA 2A31A 3RXSA 2O8MA 4SGBE 1S6HA 2JDID 3CS0A 4A5TS 2BY7X 4ESTE 1UCYE 1ZTLA 3KEEA 2SNVA 3SNEA 4B71A 1BRAA 3NCLA 1C1PA 2Q1JA 1C2MA 1F5KU 1QB9A 1YPHE 2BVRH 4HZHA 3V7TA 2BQ7B 4BANB 1DM4B 3GYMA 4GCHF 1BJUA 1WSSH 3KIDU 2PTNA 4D7FA 4B2BA 2G5VA 5B6LA 4WY3A 3T2NA 1O3LA 2G4UA 2Q6DA 3ZZBA 3N7OA 3U28C 1J15A 1PPZA 2F83A 4TYDA 2HLDD 2HVYB 2FOBA 3UNSA 2BTCE 1HDTH 1C5QA 3TH3H 1FX0B 2OINA 2AMDA 2ZP0H 4INHA 3PM3A 2G4TA 5J4QA 2ALPA 3E16B 4Y71A 2YOLA 1UJ1A 2BD4A 1OS8A 1T31A 2OBOA 1DWEH 1CBWC 3EE7A 5C3NA 4KTSA 9LPRA 3UQVA 5DP4A 3SNDA 2AFQB 4WH8A 2W3IA 1TYNA 1WXRA 5C94A 3SGAE 2ZIQH 3GDVA 1L0ZA 4CRFA 1MKWK 1FAKH 3OTPA 2RDLA 1OYTH 3LJOA 1DVAH 4CRBA 5CE1A 4Y76A 3UOUA 1SC8U 3QWCH 2ZWLH 4JZEH 1EP6A 5KGOA 5CHAC 3F1SB 1QL9A 3RXBA 1LQEA 3A7VA 4E7NA 1C4U2 3VB6A 2F9OA 2QGRA 5F03A 2BVXH 1PFXC 2FOGA 1OXGA 3VXEH 3LGUA 2DE8A 2FI3E 3BSQA 4X2XA 2IN2A 1EUFA 3A88A 3AAVA 4JZ1A 3STIA 4OS5A 1ARBA 3UWJH 1MU8B 3NPSA 3SJKA 2BLWA 3EA7A 5EXLA 4Z1MD 3BTEE 1E37B 1TPOA 1BRUP 2EY4C 1GHVH 2Z9JA 2BD2A 3S7KB 4BTIB 1HFDA 5ESBA 2C8ZB 1MCTA 2BB4A 3F9EA 1AUJA 1V3XA 1O3IA 2ZI2H 4UFFH 4F49A 4Y7BA 2B7DH 4ABHA 1U6QA 3BTDE 3R0FA 1BOQA 5JYIA 3RMLH 2ZNKH 1QHRB 1XMNB 2ZCHP 2ZPRA 1TRYA 4AFQA 2YMSC 4ZCNA 1KLIH 3D49H 1O3DA 5HKKD 2PSYA 4WH6A 1UHBA 3E90B 2KCPA 1JBUH 5FX5A 4PROA 4XSKU 3RXAA 3MNCA 2HPQH 2Z7FE 4GAWA 2BDGA 1YPKH 1BTZA 4ISHH 5L6NH 1GI0A 1YP9A 4RSPA 5C0UA 4B73A 3D62A 4OS2A 1O5EH 5FHTA 6ESTA 2XNIA 1NO9H 3SUFA 4MG3A 4FUEA 3SJIA 1HAHH 1OWIA 1Z8RA 3E91A 1VKYA 2VH6A 5F6MA 1ZMLA 4CRAA 5C1UA 3FAOA 4X8VH 1DLKB 4X2WA 4UFGH 2P8OB 3QGNB 3EGKH 1C5UA 1BMFD 4FUDA 1NM6A 3BTHE 1ELEE 1O0DH 1MKWH 1E38B 2O8UA 1BRCE 1ELDE 1DLEA 2WHXA 1RTKA 2BX4A 1C1SA 8LPRA 2EQNA 3T29A 2GV7A 3NWUA 5C1XA 2ASUB 3TNSA 1LPKB 1WQVH 4MVNA 1O5BB 2CK3D 4U32A 2HWLB 3SORA 1O2TA 3Q76A 3SV7A 1GG6C 2PV9B 3GY3A 3MI4A 1YCPK 3L33A 2F91A 2FOEA 4AFSA 4K5ZA 3I29A 1AD8H 3HK6B 5CMXH 3S69A 2M5TA 3A8BA 3W94A 4R8TB 4YM9A 4Q7XA 2IPQX 4D8NA 3RU4T 1XUGA 1FPHH 1Y59T 1ZSLA 4K8BA 4TT3D 3DD2H 1QQ4A 1V2KT 1GCTB 3QUMP 1UK2A 1O2JA 8KME2 5EU8A 3RXMA 3QGJA 2B9LA 1V2NT 1WU1A 1SGTA 2CJIA 3QX5H 2ZCLP 1V2JT 1YWUA 3DCLA 2VNTA 2ZECA 1RGQA 4CHAC 2OTVA 1TGCA 5EPNA 2R9PA 4MNXA 1KSNA 5FPSA 7LPRA 1TOCB 3A8AA 2QC2A 2OQ5A 4RKOB 2FS9A 1W14U 2WV5A 1GJBB 5I46H 1A0HB 1HIAB 2XCNA 1FONA 1SGIB 4I8HA 2BOKA 5EXMA 2JH5D 4I8LA 3NXPA 1L1GA 2BXTH 1XUHA 3A82A 5JPMH 4YLUA 1UCYH 1TGNA 1ESAA 1GHYH 1GBJA 1WTHD 2VVVA 5EG4A 3F0PA 2BZ6H 1MABB 5LH8A 1FY3A 1W0KD 4OS7A 2JETC 1EOLA 1MH0A 4A1TA 1DWDH 2H1UA 2PGQB 1HAVA 1A2CH 1UTOA 3KL6A 1PPCE 1ZMJA 1DWBH 1NRNH 2ZGHA 1MTUA 1SGRE 1L1JA 2OC1A 1GL0E 2J95A 4BAHB 3A7TA 4K69A 1F0TA 1SLXB 4X6OA 2AYWA 1HPGA 1M9UA 3SGQE 4NSVA 1WAYB 4F48B 3E8LA 3NUMA 1Y5UT 4B2CA 1AB9B 1GL1A 2UWOA 2WYGA 1P03A 4E7RG 1QRWA 1RTFB 2SGEE 1O5CB 1EAIA 2H2ZA 1HLTH 1S82A 1UVUH 3RM2H 3RXEA 1UMAH 2PW8H 2NU4E 1GJ4H 1VITF 1MD7A 2F9NA 4IBLH 3VEQB 4TY7A 1HAGE 1G36A 1GGDC 3ESTA 4TPYA 4ZHMU 2BY9X 5EQRA 5GNDA 2RDEA 2ANYA 3P8OA 1TAWA 3RXQA 2FO9A 2LP6A 4BNRA 1IHTH 4XBDA 2WV4A 3V0XA 1CA0C 1A7SA 2GP9B 3SNBA 2UWPA 2ZTZA 3SV2H 2RA0A 3OEED 3BF6H 4Y6DA 2Y5FA 1QBNA 3OSYA 1JXPA 2BVSH 4KP0A 1BITA 4NSYA 1K2I1 3KQ5A 1K1NA 1GJDB 2RA3A 1C2DA 3VB5A 5E8EH 4YOGA 2XOKD 1HGTH 4BTTB 3ZYEA 4MPXA 5DO4H 2XC5A 1UTPA 3NK8A 1Z7KA 5CHAB 3UPEA 2BQWB 1SL3A 1ZTJA 1RS0A 2QF0A 3MO3A 3M3TA 4FU9A 3RUOA 3BTFE 1EB2A 4AB9A 2J98A 1GI8B 2Y7XA 1MTSA 2FZZA 1Z8GA 5DP7A 1OWKA 2FWWA 3MH7A 2ZU3A 1LVBA 1BQYA 3RMOH 4INLA 1N6XA 3T27A 1HIAA 4IN2A 3RXDA 2G8TA 2ZA5A 1QTFA 2G00A 2ZFQH 1ABJH 1IQNA 2CHAC 3A80A 1SGQE 1XUJA 2HVXA 4BOHA 3MH6A 3PROA 1GI9B 4FOUC 3GDSA 2HPPH 2Z9LA 1HV7A 2V3OH 8GCHF 4TY6A 1LQDB 2QXJA 3SV9A 2QYIA 1TBQH 2FMJA 3LPRA 4DGJA 1S6FA 3MH5A 1LCYA 1ELGA 1HJ8A 2IJOB 5C20A 3PO1C 1KDQB 5A0BA 3OFND 4ABIA 2PKSC 3MU8A 1D3DB 2TBSA 3LC5A 4D9QA 1MTNB 3K9XB 3ZZ5A 3GY7A 4Q7ZA 1Q3XA 1SVPA 1H9IE 3BG4B 1MD8A 1C1MA 1DSUA 4WWYA 1TGBA 1C5WB 7ESTE 5TCCA 1YLNA 2QV1A 1MBMA 1GI3A 3PWCA 1ZMNA 4A7IB 1GJ6A 1PPFE 1ZTKA 3BG4C 3U8TH 1C2KA 1GGDB 2J4IA 2CV3A 2AIPA 5EQQA 1O2OA 1VR1H 5DSFA 2PWXA 2R2WU 1NROH 1ZHRA 3AAUA 1O3FA 3C27B 2FTMA 1NFXA 4BAQB 4K60A 2FM2A 3M5MA 4RT0A 5HYOA 4ZKRU 5BRRE 1A1RA 3WWFA 1PJPA 1NRSH 2C90B 2ZU1A 3SZNA 5A8XA 1O2GH 2G51A 1ELBA 1GBFA 5FAHA 2EC9H 3ATWA 4Q7YA 3RC4A 1THPB 3H7TA 1FN6A 3GY6A 2VU8E 4AORA 1SQAA 3GDUA 3N99A 3U69H 2J94A 2FDAA 1C5NH 4R0IA 1WTGH 2PGBB 3I77A 1EATA 1OSSA 3H5CB 5H4IB 2ODPA 1AKSA 2KX4A 5L2ZH 5C17A 2D2DA 2ZQ1A 2P95A 1CGIE 1OX1A 2XBXA 2FS8A 2H5CA 2AGEX 2CMYA 3KQBA 1O35A 4FUJA 1TONA 4YT7H 4GLYA 2QXIA 5G4BA 4AC9A 2OQUA 1TBZH 1FXYA 2GT8A 4A1XA 3OYPA 1CHOF 3LC3A 3RU4E 1WBGB 1HXEH 1IQHA 2W6ID 3RDZA 4ISOA 1T4VH 2BOHB 1G3BA 1O5GH 3UR6A 1YPEH 3A89A 5AFZH 4H42U 4AG1A 3DT0H 1BHXF 1C1TA 2KCYA 4MTBA 4FUFA 2ANWA 1SI5H 2ZCKP 2WZQA 2VIQA 3VB7A 4WVPE 2PTCE 1D6WA 3A85A 4D9RA 1UVSH 1NESE 4AYYB 2L74A 3F9GA 2Q6GA 1LMWB 1WV7H 5EQSA 4Q63A 1KXAA 1E0FD 1N1LA 1O5DH 2O9QA 3FVFB 4NG9H 1AUTC 3HKJB 1TNHA 1A0JA 1D3PB 1AY6H 2R0KA 1UK4A 1YPLH 3SU5A 1SBWA 5J4SA 1P12E 1GPZA 5A2MH 5FPTA 1VGCC 2HNTC 2VBCA 2QF4A 4ZKOU 2FOFA 1QA7A 2WPIS 1ZR0A 1HAYB 4NIWA 2ZDKA 1CT4E 1KY9A 1OWHA 2W26A 1O2YA 3IG6B 4IC6A 1UO6A 4YOJA 3SI3H 3CNRA 1SGEE 2PLXA 1SSXA 3PYHA 1BMNH 1T8LA 2BD9A 3F9FA 3FZZA 5T6DA 3AW0A 2GCTC 2VVUA 1HYLA 1QA0A 3TNTA 4NWKA 2BD7A 2QCYA 1O5FH 1MMJN 5LPFA 4WMFA 2QY0B 1ZSJA 1MUEB 2AEIH 1P57B 1E1QD 2P8OC 1P02A 2GDEH 1O3EA 5DP5A 1A5GH 1O3MA 2F9VA 3NRLA 4IGDA 1Y3VA 4U01A 2QAAA 1MAYA 8GCHG 3HK3B 3ZVBA 3BEUA 1DXPA 1N8OC 1GJ8B 1QJ7B 1QL8A 2BY8X 3ATIA 2Z9KA 3VB4A 3ZZ3A 1SHHB 2BD5A 1P3EA 3M5LA 5EIYA 1ELFA 4BXSA 1QZ8A 1G3DA 1HNEE 1WDIA 1EASA 2H9TH 4Y8YA 3PRBA 1O31A 2ZHEH 2VGCB 2VWLA 3QLPH 5FBEA 1FLEE 3SU6A 2SGQE 3JZ1B 3P8NA 1KTSB 2V7QD 2Y7ZA 1QRZA 1O2HA 1IQEA 1L4ZA 4JYUH 4ABJA 1ANCA 1P0SH 2ANMH 1TBRH 2KM0A 6GCHF 4YXWD 5JBBS 1G3EA 5ETXA 3SUDA 2A32A 3K6YA 4CHAB 4ZXYH 1FZZA 4X2YA 1ZRKA 5C1YA 2FYRA 1KTTB 1QRXA 2GCTB 1X7AC 2HLCA 4J2YB 3SHAH 2NU0E 3A8DA 3LU9B 1FY1A 2P59A 2GZ9A 1T8NA 3PMHB 1W0JD 1G9IE 3SU3A 1EFRD 2ZHQH 3TVJB 3UOPA 1O2IA 2GZ7A 3VG8A 1NT1A 5K0HA 1TB6H 3ZV8A 1PQ5A 4Y0ZE 1P09A 2BDYA 4MPWA 4NIVA 1Z71A 3S7HB 2A45B 5E2PA 3D65E 1HAIH 3SHCH 1THRH 1TX7A 2VH0A 1BTHH 1QJ1B 1ACBE 1EZUC 1YCPH 4X1RU 2ZDVH 3DSGA 1C1UH 5FXLA 3GCTF 2OUAA 4GCHG 3RXCA 5FCKA 3HGNA 3SU0A 1F2SE 5DN6D 3U8OH 2PKAB 1C5LH 3FP7E 3SU2A 1ETTH 2FOAA 5DP6A 1VCWA 1ELVA 1GJ5H 4D7GA 2XC0A 1BTUA 2JJ2D 2VIPA 3F2HA 3MHWU 1KLJH 2ZC9H 6CHAB 2TGAA 5JBAS 1O3KA 3FOAA 3BIUH 3FP6E 1UW7A 4Y7AA 3U9AH 1BDAA 1V6DA 3TH2H 1TNKA 1GHWH 1W13U 1P2KA 1W0YH 1SMFE 4K2YA 3M61U 1SGPE 2THFB 3M36A 1EJMA 3MMGA 4NZLA 5FX6A 4DOQA 4XE4A 4Y11E 2VWOA 4NCYA 3V3MA 3BTQE 3A83A 3O8RA 1CT0E 1TPPA 4O97A 1BHXB 1QB1A 1JWTA 3OTJE 3ATLA 2Y82A 3PLPA 1NTPA 3LH1A 2C8WB 3TGKE 2FODA 1AKSB 3KYFA 1K22H 1V2TT 4X1NU 1ZHPA 3O8BA 3GCHB 2D1JA 3IWMA 1YPHC 4KGAA 3AVZA 4LK4A 3B9FH 1NRQH 1TPAE 1ESTA 4CBNA 1N8OB 2ZDNA 4NA8A 2A4QA 1C5PA 4AX9H 2AH4X 2W6JD 1KDQA 3OAAD 1P01A 1P9UA 3BIVH 1SOTA 3CENA 1J17T 1F0UA 2P3TB 1EAWA 1GI5A 2AGIX 3STJA 5EW1H 1GHZA 1MZAA 1SG8B 4A1VA 1HBTH 4MPVA 3GISB 3PMJA 4I86A 1DY9A 1NBMD 2A5AA 1JOUB 3DHKH 2WYJA 1C5MD 5FBIA 2CF9H 2BDAA 4ZAEA 1G3CA 1BTPA 1AVWA 4DT4A 4ABFA 2ZTXA 1KMHB 3MQKC 2B8OH 2J98B 2Z3CA 3SN8A 2A1DB 4MNVA 1ELTA 1KXBA 3L6PA 5HIZA 2Z3DA 1MZDA 4BTUB 2CGAA 4Y8ZA 2QN5T 1EAXA 3RXLA 2GVFA 4BAOB 4DURA 1NZQH 5GWZA 3SJ9A 4FU8A 4RI0A 4U2WA 5T3HA 2AGGX 2GX4A 2R3YA 3A84A 1V2UT 3VXFH 3UNRA 1RIWC 3GCOA 1EB1H 5EW2H 4J1YA 1ID5H 2XTTB 1COWD 1S81A 1YLDA 4DIHH 1SFQB 2WINI 4INKA 4FU7A 4ISIH 1O3PB 3ATKA 3PWBA 2ZGJA 1GVKB 2RG3A 2WUBA 4UEHH 3M35A 1IQJA 1BJVA 2XCFA 1QR3E 3RLWH 4Z6AH 3QK1A 2STAE 3KYGA 1C5OH 1IQKA 2FOMB 3M7UA 5C0TA 1ETSH 1O30A 3TIUA 4TWWA 4MPUA 2GGVB 3CS7A 3O8CA 1UTKA 1PPBH 2LPRA 3LGTA 5T1VA 1SGYE 1ZGVA 4ZHLU 4FUCA 4X1QU 3TGIE 1C4V2 3AW1A 5GPIB 1ZPCA 2I6QA 3T28A 3TH4H 1NBME 1SFIA 4VGCC 3ZVAA 3RXPA 4YT6H 1ARCA 4IN1A 3VGCB 1DOJA 1DT2A 4K1EA 1O32A 1AGJA 4NA7A 4AFUA 3ZVGA 1J8AA 1Y5AT 1MQ6A 1NFYA 3CP7A 3BEIB 3ZV9A 1DY8A 4B2AA 2OP9A 3GCNA 3RLYH 1C5ZB 2ZU5A 3SOSA 2LELA 1BUIA 1PPEE 2H5DA 2FYQA 3GS9A 1Y3XA 1SGNE 3SI4H 1Y5BT 3ZVCA 1EJNA 3P17H 1C2LA 2ZPQA 1O3CA 1CA8B 1OPHB 1BMAA 2VWMA 5F53A 1C1OA 3P8FA 2P16A 3PB1E 1W8BH 1GHAF 1HCGA 2ZHDA 9ESTA 4KELA 6LPRA 4I8JA 1CGHA 3EQ0H 2O8WA 1ZPZA 4F55A 1UCYK 4GHTA 1SQRA 1RIWB 1CSOE 1O33A 2R3UA 3DA9B 1DXWA 3URCA 3PV2A 4A6LA 1V2ST 2K1QA 2GV6A 3PRDA 1G2LA 3RXVA 5L2YH 1V2RT 3N7EA 5A8ZA 1S6LA 5A0CA 3OE7D 2ALVA 4YESB 1LDTT 5TCAA 5EJ1A 1LHGH 3F0OA 5AHGH 4O03A 1MTNC 2A0QB 3B23B 1GHXH 1IQFA 1GWAA 3RXJA 1B7XB 1NU7B 2CF8H 1B5GH 1DICA 2BDHA 4OM9A 3GICB 3Q3YA 3BTKE 5IK2D 1RJXB 1BTWA 1BTXA 4TWYA 2J92A 1D3TB 5KEDA 1LO6A 3RP2A 1TALA 4IS5A 2ODQA 4CREA 3ODDA 2FIRH 4B1TA 2J5UA 1MKXK 5GJ4B 1YPGH 2ZZUH 5LPEA 2WPDD 4ZXXH 2PFEA 3R3GB 1NU9A 3QZRA 1GBMA 4HFPB 1Z6EA 1ZJDA 5F8TA 1L1NA 3PMBB 1VJ9U 4X8TH 3SBKA 2CHAB 3TGJE 1SB1H 3GCHC 5A09A 1W10U 1Y3WA 3BTWE 2F4LA 3SU4A 2GJGA 3FP8E 2JIZD 2BYAX 1RTLA 1VCQA 3S9AA 4CBOA 2FP7B 2PUQH 1H9HE 1TA6A 2NWNA 2WPHS 1J16A 5HXFA 1TRMA 2K0QA 1QB6A 2TGTA 1UTMA 1GVZA 4I33A 4UDWH 5GCHF 2XBYA 1XM1A 2BDIA 3S0NA 3FKSD 4I8GA 1TX8A 4X6NA 1T8OA 3I78A 2ZFFH 4X2VA 4CRCA 5EJZA 1FIZA 1KYNA 1ANDA 2GD4B 5HM2A 3RXOA 1H8ED 4FVBA 1YBWA 1O2MA 1TQ0B 2R0LA 1T32A 3SNCA 1CGJE 3SUEA 3SZEA 5HIYA 1Q31A 2GCHG 1TOMH 3QDZB 4ZROA 1YKTA 1EZQA 1NN6A 3A7XA 1FY8E 4AN7A 2XXLA 1EAUA 4IMZA 5A0AE 3UUZA 5JBTA 1CA0B 3Q00A 3LOXA 1SQOA 2BM2A 2UUKB 4WXIA 3ZZ7A 4HG6A 1O5AB 5AFYH 1IHSH 2KFWA 5EGMA 5T6GA 2ESTE 1GDUA 2VIVA 2TIOA 3S9CA 1EZXC 1KXFA 2WPJS 2AERH 3W1EA 1GBTA 1RD3B 1GI4A 1V2LT 3EAJA 2BD8A 3UFAA 1VZQH 3M3VA 2TGDA 1GJ9B 2BY6X 3DFLA 1P2QA 3TK5A 3SJ8A 1BBRH 2WPLS 4CH8B 2Y6TA 4FXGH 2JH6D 1PPHE 1J9CH 1AHTH 1NFUA 4JK6A 3UAIC 1GDQA 3WW7A 1IQLA 3RC6A 2B5TB 3F2FA 4XOJA 1MQ5A 1HUTH 3MTYA 5BPEA 1AIXH 3KCGH 2Z9IA 2XBWA 1G2MA 1HJ9A 3E0NB 1PYTD 4XDEA 2ZEBA 1YLCA 1ZZZA 1CU1A 2FX6A 4Y10E 1VITG 1QGFA 1LHEH 1L2EA 1MTWA 1OP0A 3SV6A 4NA9H 2A5KA 1AWFH 2FLBH 2TPIZ 3TJUA 1VITH 3MO6A 2RCEA 3QN7A 5JDUB 1YY3A 2QXGA 1DUAA 1K1JA 2EI6A 3A7WA 1Z8IB 1SR5C 3MU1A 4H6TA 3QTOH 4ZUHA 5CDFE 3AK5A 1AI8H 2SGDE 1AQ7A 1QL7A 2ILNA 4WXVA 2SGAA 1GBIA 4ISLA 1C9PA 2FOHA 4MNWA 6CHAC 1DSTA 4K1TA 4DY7B 1C5SA 1ZLRA 1UVOA 5DPAA 1P2IA 1HAOH 4JZFH 1ZOMA 2YNAA 5GDSH 4JMYA 1QNJA 3F9HA 1FI8A 5LPRA 2BLQA 5E0JA 2BY5X 1DITH 1IQMA 3DSPA 2K8IA 3RXHA 1LVMA 1C2EA 1C2FA 3LGWA 4FUGA 1HAPH 2AMQA 1ZPBA 1S0QA 2ULLA 3ZZDA 1HXFH 1O2PA 1UVPA 6GCHG 3C1KA 1V2OT 1O36A 2A4OA 4JK5A 3MU4A 3ZZCA 4K3JA 1DUEA 4UD9H 1A61H 1LHCH 1AZZA 4B74A 4HGCA 3ZZ9A 5F8ZA 1C9TA 1A3EH 3LGIA 2A4RA 3MH4A 1C5VA 4ACBA 1BZXE 2ZGBH 4WMDA 1AVGH 5JB9S 1AZ8A 2XW9A 1D4PB 3RU4D 3BV9B 1K0HA 4CH2B 1GMCF 3KNXA 1QQUA 1H1BA 1SLWB 1V2VT 2Z6BD 1FY5A 1SLVB 2BHGA 4AGKA 2I6SA 3A8CA 1AE5A 1ORFA 2C4FH 4HTCH 1DFPA 4CR9A 1O3JA 3M37A 1LKAA 2GMTB 5HMAA 2GT7A 3UY9A 3LIWA 1BRBE 1G30B 4U30A 3ZVDA 1Z8JB 3LH3A 4ZHAA 2VIOA 2P94A 3MU0A 5PTPA 1AN1E 3RXRA 1TNGA 1GBLA 1LHFH 1GMHF 1LPZB 2BDCA 2SGFE 2W7SA 1L4DA 2PUXB 3F6UH 4NZQA 3WY8A 3A81A 4Q4LA 3P6ZB 3SO3A 1SGDE 4IMQA 2VVCA 5C2ZA 1HB0B 2BZAA 4K1SA 3TJOA 4I32A 1GMDG 2Y5GA 2F9PA 3VFEA 3K2UA 2PR3A 4DVAU 1O2WA 2DE9A 2KCOA 2A5IA 2XBVA 3BEFB 2JKHA 1E35B 3GOVB 1TE0A 1HRTH 3SQEE 3OY6U 3RXIA 5SGAE 1V2WT 5E2OA 3FO8D 1EPTB 1QIXB 1TX6A 2PSXA 1H8HD 3A7YA 4NWLA 1ZGIA 4F4OC 2BMGB 5TJXA 3MWIU 2OC7A 4H6SB 1G32B 3IITA 4KTCA 4JZDH 1ABIH 4ACAA 5K7RA 3EE0B 3N7DA 3UREA 1PQAA 2STBE 1ELAA 4B76A 3TK6A 1J14A 1Z1IA 3GY5A 3ZZ4A 1WUNH 1D6RA 1XVMA 2UUFB 1GHBF 1B0EA 2GKVE 3MFJA 4DIIH 3V13A 3PO1B 1P06A 3EA8A 3RC5A 4MDSA 2HNTE 1K1IA 4WMEA 2GCHF 3A87A 4KTUA 2WPKS 2W7UA 1MBQA 4YLQH 1RXPA 1RFNA 1YGCH 1S5SA 1O34A 3M5NA 5FPYA 1S84A 1K1PA 1NC6A 2QF3A 1PQ8A 1TMBH 3QO6A 4CR5A 1YM0A 1O37A 1C5YB 1GBCA 1GJAB 1H8IH 1P8VC 2FTLE 1C1WH 1QURH 1SQTA 1K1LA 1HAXB 2XWAA 2PHBA 4A92A 3VGCC 1F5LA 1GBBA 4DT7B 3RXKA 1A4WH 3SU1A 4TSFD 2A2XH 1KLTA 2ZFSA 1GBHA 4GHQA 2A2QH 1O2UA 3HATH 5DGJA 2J97A 1PYTC 1YPMH 3ZVEA 3S9BA 4FUIA 1ETRH 1C2HA 5LGOA 5EXNA 2HGTH 1DWCH 1XUKA 1V2PT 1XKBC 3M3SA 3K65B 1ZSKA 7GCHF 1Y3UA 1H4WA 4NGAH 4ASHA 4LZ1H 3HKIB 1XXFA 1XVOA 2ZFRH 4MLFB 3ZZ6A 1MKXH 1Z1JA 3KQEA 2V6NA 2AMPA 3GY4A 3PLBA 1UTJA 1TNJA 1EZSC 1SHYA 4AGJA 1B0FA 3URDA 3QZQA 4GPGA 1QBVH 2FPZA 5DG6A 4RT1A 2VJ1A 1S0RA 1ESBA 3SGBE 2QF5A 3F2GA 2V35A 4AOQA 2FI5E 1K21H 3ENSB 1JRTA 4UFDH 1FIWA 1CHOG 4Q80A 1BIOA 4X1SU 1O2RA 2QA9E 4DJZB 3RXTA 1QY6A 1EPTC 4CRDA 1GI7B 1NRRH 4DW2U 5L30H 1O2ZA 3DUXH 4Y8XA 3ATMA 3ZYDA 2C8YB 1AO5A 3U8RH 3EA9A 4ABBA 2PKSB 3RXUA 2FLRH 1AB9C 1EPTA 1TMUH 2ZTYA 1O3BA 4ZH8A 4YZUA 3A7ZA 3FFGA 2ZDMA 2ZFPH 3TJVA 1P9SA 5EOKA 1P3CA 2XC4A 3P70B 3BTGE 1NS3A 5F8XA 4FETA 3PV4A 3BG8A 3ODFA 4JCNA 3MNBA 4P00A 1P04A 2FI4E 2QXHA 1MU6B 1AFEH 1H8DH 4E06H 3DSOA 4X1PU 3ZZ8A 1HJAB 2EA3A 1A5IA 4YO9A 1TPSA 3PTBA 3U1JB 1BT7A 1HAVB 1EXFA 3E0PB 4XBCA 1TFXA 1BA8B 1MTVA 1O2VA 3RMMH 1O3AA 3RXGA 2P93A 3A86A 3OX7U 2J34A 4VGCB 1WCZA 1TRNA 1FJSA 1BCUH 3OEHD 2YNBA 4X6PA 3E6PH 1F92A 1SPJA 1TNLA 5AF9H 1CHGA 1WOFA 2O8TA 4XRNA 3TU7H 1IOEA 1LVYA 1F7ZA 4BXWA 1GCDA 2A4GA 1A5HA 1SGCA 1DE7H 3KQDA 2AHME 3NZIA 2G81E 4ZMAH 1SLUB 4XFQA 3NKKA 3TK9A 3F3BA 2RFKC 3OU0A 2GZ8A 2GDDA 3MOCA 4D76A 4TPIZ 1Y8TA 3E3TA 2BQ6B 1GBKA 1QFKH 4LZ4B 1TWXB 1K1MA 1V2QT 1GJ7B 3MNXA 3GCTG 4K8YA 1KXCA 2ZGCA 1C2JA 1GBEA 3UWIA 4QT8C 3MO9A 2KCAA 5C5OA 4ZKSU 3UNQA 4X8SH 2A7HA 1HAZB 1PPGE 1GMHG 4B6EA 1EJAA 1UTLM 2ZKSA 4WF8A 1OP8A 3RM0H 1TNIA 2J38A 4I31A 2P3FH 2A7CA 1AFQB 1BMMH 2SGPE 3AASA 3U98H 7GCHG 1Q2WA 5FL7D 1O2XA 1AVXA 1T4UH 3LONA 1O2QA 2XYAA 3PLKA 2AS9A 3FN8A 3KQCA 1O3HA 3EYDA 1S85A 4OS4A 4B6FA 2EEKA 3ITIA 3LKWA 1OOKB 1O2NA 1FAXA 2LNCA 4CRGA 3LJJA 4Q2KA 1TQ7B 1EX3A 1OKXA 4MNYA 1FY4A 2Y80A 2G5NA 2H9HA 4AB8A 2F9BH 5A8YA 2TRMA 4P02A 2Z9GA 2PP6A 1UK3A 2OLGA 1CE5A 1OWEA 2KAIB 2VWNA 2WSSD 1YF4A 1TGSZ 1Z6JH 5CHBA 1OWJA 1T8MA 1ZYOA 2ZDLA 4NIYA 2ODYB 2BXUH 1EKBB 2WUCA 4IC5A 1OYQA 4ABEA 1W0ZU 2EI7A 5KECA 1CT2E 1O38A 1GBDA 4ABDA 1FDPA 1EOJA 5DP3A 1O2LA 2VGCC 2JETB 3UB0A 1C5XB 4AZ2B 2KAIA 3MYWA 2HOBA 4Y0YE 3U1IB 4BAKB 2KR7A 3TITA 2NU3E 1GHBG 3FANA 1P11E 5DP9A 3W95A 2GMTC 3V12A 2QE7D 2OBQA 1BMLA 1W7GH 2OXSA 2C3SA 3SW2B 2W3KA 1GDNA 1V2MT 1AWHB 3H7OA 1QCPA 1D9IA 5GIBA 2B0FA 4NIXA 4UE7H 1P2MA 4RN6A 4UFEH 2FESH 5JBCS 1BBRK 3D23A 4ASUD 4FUHA 1E1RD 1YCPM 1TABE 7KMEH 1C1RA 1XKAC 3SUGA 1JMOH 2HALA 2IPHA 2JJ1D 3Q3XA 1C1NA 1ZHMA 5EPYA 3ELAH 2OK5A 1QBOA 5HM9A 5HGGA 1VJAU 5ABWA 2HNTF 1GCTC 1K28D 1O2KA 1XX9A 3M5OA 3MU5A 4O3TA 2OD3B 4ZKNU 1E79D 3RMNH 3E1XB 2BX3A 2UUJB 3LGYA 3UIRA 2OCVB 2UUYA 1OWDA 1S83A 1F5RA 3QTVH 1SOZA 1TLDA 4AG2A 1ZRBA 1UVTH 3T62A 2CN0H 4O3UA 4BAMB 2JH0D 1GBAA 3BN9A 1TIOA 1NPMA 4OS1A 5C67A 3JZ2B 1BBRE 4UONA 1YYY1 2ZHWH 1AFQC 5B6OA 1CQQA 1GVLA 1P2JA 1SGFA 2Y81A 2OC8A 2GTBA 4B75A 1GG6B 4THNH 1G37A 3ZZAA 1GI1A 1FPCH 1K1OA 1IAUA 1D3QB 4KKDA 2FEQH 1C4Y2 4OGYA 1FV9A 4NFEA 1C1QA 3H09A 4M9FA 1EQ9A 2F43B 2ZDAH 2OC0A 2SFAA 2A7JA 1SKYE 1OHHD 2Z3EA 3PTNA 3Q77A 2ZQ2A 5DK1A 2IOTA 2V0BA 1C2IA 4O9VA 1DX5M 5AVDA 2ZU4A 1O3GA 1MAXA
chains in the Genus database with same CATH topology
3FZDA 3BTME 2ZG0H 1CO7E 1XUFA 2Z94A 1BTYA 3KHVA 3MNSA 1GI2A 3P92A 3SNAA 4ABGA 1YPJH 1CBWB 1UHBB 4DG4A 3GY8A 3L3TA 3T26A 2PKAA 3T25A 1W3CA 2Q6FA 5GXPA 3LDXH 5DKMA 4X8UH 1FQ3A 1XUIA 1PQ7A 1NY22 1JRSA 2EI8A 4XBBA 1FN8A 1TMTH 1AMHA 1XXDA 4YOIA 1ANEA 4M7GA 3RXFA 3SV8A 4YTAA 1LTOA 5ESTE 1GMCG 1F0SA 2D8WA 1BB0B 1GJCB 4JYTA 1ANBA 1VCPA 3OY5U 2VIWA 4I8KA 2C8XB 4AFZA 4WJG2 5DJ7A 1EP5A 1H9LB 1MCVA 2AIQA 2Y5HA 3G01A 1NFWA 4LOYH 5C5NA 5FCRA 2DUCA 1T7CA 1A46H 1YC0A 1VGCB 2P3UB 2VINA 2NU1E 3VB3A 3KN2A 1P10A 1C5RA 1K9OE 1E34B 1ZJKA 3SQHE 1O3NA 8ESTE 3SJOA 3TPIZ 3TJNA 1SGFG 1QJ6B 1LPGB 5GCHG 1W12U 3PMAB 4AYVB 4FUBA 1O39A 1N6YA 1P2NA 5E0GA 1P2OA 2ZHFH 2BDBA 3UR9A 4JYVH 5EODA 2G55A 2W5EA 2BLOA 2FOCA 3HGPA 2ZO3H 4GSOA 4GVUA 4E05H 4OGXA 1C5TA 1FNIA 1Y3YA 4I7YH 1TGTA 2VIDA 3GYLB 2QIQA 5IDKA 5I25A 2ZPSA 1IQGA 3KF2A 3O8DA 4LXBH 2O8LA 1FMGA 2ZGXH 1C1VH 2G52A 3BTTE 4JZIA 1NRPH 1WQSA 1O2SA 1LKBA 2CXVA 2FX4A 2ZU2A 1THSH 4Y79A 3T5FH 2H9EH 1IQIA 2BLVA 1OP2A 1A0LA 3UQOA 1E36B 3VPKA 2UWLA 3F68H 2XWBI 1DPOA 3DFJA 2R2MB 3EDXB 1TA2A 3B8JA 2J2UA 4IW4E 5JB8S 4FVDA 4X6MA 3LGVA 2ZF0H 3M7QA 1LVOA 3M7TA 2VB0A 1KXEA 4GUXA 3Q3KA 4OS6A 1HJAC 3ZVFA 1DDJA 1O3OA 1DS2E 1FUJA 1GI6A 4HI3A 3P95A 2TGPZ 2HRVA 1JIRA 4DCDA 1W11U 4MQAA 1RRKA 3TLOA 1LHDH 2BD3A 4X0WU 1AU8A 4ABAA 2H6MA 1JIMA 5IYTA 1WYKA 1AE8H 2WPMS 3KGPA 1W2KH 4RKJB 1C2GA 1W7XH 3HPTB 5E0HA 2F9UA 1KXDA 2SNWA 1F0RA 2F3CE 2NU2E 5DP8A 1ELCA 2J9NA 3LT3A 1GMDF 1UTQA 1DANH 4SGAE 3K6ZA 4Z0KA 5T6FA 4NFFA 1CVWH 1GHAG 1P05A 2XRCA 3P8GA 2ZFTA 1KIGH 3UTUH 2D26C 2V3HH 1A3BH 2FXRA 1INCA 4H4FA 3GY2A 4ISNA 2ANKH 2C93B 1UTNA 2A31A 3RXSA 2O8MA 4SGBE 1S6HA 4A5TS 3CS0A 2BY7X 4ESTE 1UCYE 1ZTLA 3KEEA 2SNVA 3SNEA 4B71A 1BRAA 3NCLA 1C1PA 2Q1JA 1C2MA 1F5KU 1QB9A 1YPHE 2BVRH 4HZHA 3V7TA 2BQ7B 4BANB 1DM4B 3GYMA 4GCHF 1BJUA 1WSSH 3KIDU 2PTNA 4D7FA 4B2BA 2G5VA 4WY3A 3T2NA 1O3LA 2G4UA 2Q6DA 3ZZBA 3N7OA 1J15A 1PPZA 2F83A 4TYDA 2FOBA 3UNSA 2BTCE 1HDTH 1C5QA 3TH3H 2OINA 2AMDA 2ZP0H 4INHA 3PM3A 2G4TA 5J4QA 2ALPA 3E16B 4Y71A 2YOLA 1UJ1A 2BD4A 1OS8A 1T31A 2OBOA 1DWEH 1CBWC 5C3NA 4KTSA 9LPRA 3UQVA 5DP4A 3SNDA 2AFQB 4WH8A 2W3IA 1TYNA 3SGAE 2ZIQH 3GDVA 1L0ZA 4CRFA 1MKWK 1FAKH 2RDLA 1OYTH 3LJOA 1DVAH 4CRBA 5CE1A 4Y76A 3UOUA 1SC8U 3QWCH 2ZWLH 4JZEH 1EP6A 5CHAC 3F1SB 1QL9A 3RXBA 1LQEA 3A7VA 4E7NA 1C4U2 3VB6A 2F9OA 2QGRA 5F03A 2BVXH 1PFXC 2FOGA 1OXGA 3VXEH 3LGUA 2DE8A 2FI3E 3BSQA 4X2XA 2IN2A 1EUFA 3A88A 3AAVA 4JZ1A 3STIA 4OS5A 1ARBA 3UWJH 1MU8B 3NPSA 3SJKA 2BLWA 3EA7A 5EXLA 3BTEE 1E37B 1TPOA 1BRUP 1GHVH 2Z9JA 2BD2A 3S7KB 4BTIB 1HFDA 5ESBA 2C8ZB 1MCTA 2BB4A 3F9EA 1AUJA 1V3XA 1O3IA 2ZI2H 4UFFH 4F49A 4Y7BA 2B7DH 4ABHA 1U6QA 3BTDE 3R0FA 1BOQA 5JYIA 3RMLH 2ZNKH 1QHRB 1XMNB 2ZCHP 2ZPRA 1TRYA 4AFQA 1KLIH 3D49H 1O3DA 2PSYA 4WH6A 1UHBA 3E90B 1JBUH 5FX5A 4PROA 4XSKU 3RXAA 3MNCA 2HPQH 2Z7FE 4GAWA 2BDGA 1YPKH 1BTZA 4ISHH 5L6NH 1GI0A 1YP9A 4RSPA 4B73A 3D62A 4OS2A 1O5EH 5FHTA 6ESTA 2XNIA 1NO9H 3SUFA 4MG3A 4FUEA 3SJIA 1HAHH 1OWIA 1Z8RA 3E91A 2VH6A 5F6MA 1ZMLA 4CRAA 5C1UA 3FAOA 4X8VH 1DLKB 4X2WA 4UFGH 2P8OB 3QGNB 3EGKH 1C5UA 4FUDA 1NM6A 3BTHE 1ELEE 1O0DH 1MKWH 1E38B 2O8UA 1BRCE 1ELDE 1DLEA 1RTKA 2BX4A 1C1SA 8LPRA 3T29A 2GV7A 3NWUA 5C1XA 2ASUB 3TNSA 1LPKB 1WQVH 4MVNA 1O5BB 4U32A 2HWLB 3SORA 1O2TA 3Q76A 3SV7A 1GG6C 2PV9B 3GY3A 3MI4A 1YCPK 3L33A 2F91A 2FOEA 4AFSA 4K5ZA 3I29A 1AD8H 3HK6B 5CMXH 3S69A 2M5TA 3A8BA 3W94A 4R8TB 4YM9A 4Q7XA 4D8NA 3RU4T 1XUGA 1FPHH 1Y59T 1ZSLA 4K8BA 3DD2H 1QQ4A 1V2KT 1GCTB 3QUMP 1UK2A 1O2JA 8KME2 5EU8A 3RXMA 3QGJA 2B9LA 1V2NT 1WU1A 1SGTA 2CJIA 3QX5H 2ZCLP 1V2JT 2VNTA 2ZECA 1RGQA 4CHAC 2OTVA 1TGCA 5EPNA 2R9PA 4MNXA 1KSNA 5FPSA 7LPRA 1TOCB 3A8AA 2QC2A 2OQ5A 4RKOB 2FS9A 1W14U 2WV5A 1GJBB 5I46H 1A0HB 1HIAB 2XCNA 1FONA 1SGIB 4I8HA 2BOKA 5EXMA 2JH5D 4I8LA 3NXPA 1L1GA 2BXTH 1XUHA 3A82A 5JPMH 4YLUA 1UCYH 1TGNA 1ESAA 1GHYH 1GBJA 1WTHD 2VVVA 5EG4A 2BZ6H 5LH8A 1FY3A 4OS7A 2JETC 1EOLA 1MH0A 4A1TA 1DWDH 2H1UA 2PGQB 1HAVA 1A2CH 1UTOA 3KL6A 1PPCE 1ZMJA 1DWBH 1NRNH 2ZGHA 1MTUA 1SGRE 1L1JA 2OC1A 1GL0E 2J95A 4BAHB 3A7TA 4K69A 1F0TA 1SLXB 4X6OA 2AYWA 1HPGA 1M9UA 3SGQE 4NSVA 1WAYB 3E8LA 3NUMA 1Y5UT 4B2CA 1AB9B 1GL1A 2UWOA 2WYGA 1P03A 4E7RG 1QRWA 1RTFB 2SGEE 1O5CB 1EAIA 2H2ZA 1HLTH 1S82A 1UVUH 3RM2H 3RXEA 1UMAH 2PW8H 2NU4E 1GJ4H 1VITF 1MD7A 2F9NA 4IBLH 3VEQB 4TY7A 1HAGE 1G36A 1GGDC 3ESTA 4TPYA 4ZHMU 2BY9X 5EQRA 2ANYA 3P8OA 1TAWA 3RXQA 2FO9A 4BNRA 1IHTH 4XBDA 2WV4A 3V0XA 1CA0C 1A7SA 2GP9B 3SNBA 2UWPA 2ZTZA 3SV2H 2RA0A 3BF6H 4Y6DA 2Y5FA 1QBNA 3OSYA 1JXPA 2BVSH 4KP0A 1BITA 4NSYA 1K2I1 1K1NA 1GJDB 2RA3A 1C2DA 3VB5A 5E8EH 4YOGA 1HGTH 4BTTB 3ZYEA 4MPXA 5DO4H 2XC5A 1UTPA 3NK8A 1Z7KA 5CHAB 3UPEA 2BQWB 1SL3A 1ZTJA 1RS0A 2QF0A 3MO3A 3M3TA 4FU9A 3RUOA 3BTFE 1EB2A 4AB9A 1GI8B 2Y7XA 1MTSA 2FZZA 1Z8GA 5DP7A 1OWKA 2FWWA 3MH7A 2ZU3A 1LVBA 1BQYA 3RMOH 4INLA 1N6XA 3T27A 1HIAA 4IN2A 3RXDA 2G8TA 2ZA5A 1QTFA 2G00A 2ZFQH 1ABJH 1IQNA 2CHAC 3A80A 1SGQE 1XUJA 2HVXA 4BOHA 3MH6A 3PROA 1GI9B 3GDSA 2HPPH 2Z9LA 1HV7A 2V3OH 8GCHF 4TY6A 1LQDB 2QXJA 3SV9A 2QYIA 1TBQH 2FMJA 3LPRA 4DGJA 1S6FA 3MH5A 1LCYA 1ELGA 1HJ8A 2IJOB 5C20A 3PO1C 1KDQB 5A0BA 4ABIA 2PKSC 3MU8A 1D3DB 2TBSA 3LC5A 4D9QA 1MTNB 3K9XB 3ZZ5A 3GY7A 4Q7ZA 1Q3XA 1SVPA 1H9IE 3BG4B 1MD8A 1C1MA 1DSUA 4WWYA 1TGBA 1C5WB 7ESTE 5TCCA 2QV1A 1MBMA 1GI3A 3PWCA 1ZMNA 4A7IB 1GJ6A 1PPFE 1ZTKA 3BG4C 3U8TH 1C2KA 1GGDB 2J4IA 2CV3A 2AIPA 5EQQA 1O2OA 1VR1H 2PWXA 2R2WU 1NROH 1ZHRA 3AAUA 1O3FA 3C27B 2FTMA 1NFXA 4BAQB 4K60A 2FM2A 3M5MA 5HYOA 4ZKRU 5BRRE 1A1RA 1PJPA 1NRSH 2C90B 2ZU1A 3SZNA 5A8XA 1O2GH 2G51A 1ELBA 1GBFA 5FAHA 2EC9H 3ATWA 4Q7YA 3RC4A 1THPB 3H7TA 1FN6A 3GY6A 2VU8E 4AORA 1SQAA 3GDUA 3U69H 2J94A 2FDAA 1C5NH 4R0IA 1WTGH 2PGBB 3I77A 1EATA 1OSSA 3H5CB 5H4IB 2ODPA 1AKSA 5L2ZH 2D2DA 2ZQ1A 2P95A 1CGIE 1OX1A 2XBXA 2FS8A 2H5CA 2AGEX 2CMYA 3KQBA 1O35A 4FUJA 1TONA 4YT7H 4GLYA 2QXIA 5G4BA 2OQUA 1TBZH 1FXYA 2GT8A 4A1XA 3OYPA 1CHOF 3LC3A 3RU4E 1WBGB 1HXEH 1IQHA 3RDZA 4ISOA 1T4VH 2BOHB 1G3BA 1O5GH 3UR6A 1YPEH 3A89A 5AFZH 4H42U 4AG1A 3DT0H 1BHXF 1C1TA 4MTBA 4FUFA 2ANWA 1SI5H 2ZCKP 2VIQA 3VB7A 4WVPE 2PTCE 1D6WA 3A85A 4D9RA 1UVSH 1NESE 4AYYB 3F9GA 2Q6GA 1LMWB 1WV7H 5EQSA 1KXAA 1E0FD 1N1LA 1O5DH 2O9QA 3FVFB 4NG9H 1AUTC 3HKJB 1TNHA 1A0JA 1D3PB 1AY6H 2R0KA 1UK4A 1YPLH 3SU5A 1SBWA 5J4SA 1P12E 1GPZA 5A2MH 5FPTA 1VGCC 2HNTC 4ZKOU 2FOFA 1QA7A 2WPIS 1ZR0A 1HAYB 4NIWA 2ZDKA 1CT4E 1KY9A 1OWHA 2W26A 1O2YA 3IG6B 4IC6A 1UO6A 4YOJA 3SI3H 1SGEE 2PLXA 1SSXA 3PYHA 1BMNH 1T8LA 2BD9A 3F9FA 3FZZA 5T6DA 3AW0A 2GCTC 2VVUA 1HYLA 1QA0A 3TNTA 4NWKA 2BD7A 2QCYA 1O5FH 1MMJN 5LPFA 4WMFA 2QY0B 1ZSJA 1MUEB 2AEIH 1P57B 2P8OC 1P02A 2GDEH 1O3EA 5DP5A 1A5GH 1O3MA 2F9VA 4IGDA 4U01A 1Y3VA 2QAAA 1MAYA 8GCHG 3HK3B 3ZVBA 3BEUA 1DXPA 1N8OC 1GJ8B 1QJ7B 1QL8A 2BY8X 3ATIA 2Z9KA 3VB4A 3ZZ3A 1SHHB 2BD5A 1P3EA 3M5LA 1ELFA 4BXSA 1G3DA 1HNEE 1EASA 2H9TH 4Y8YA 1O31A 2ZHEH 2VGCB 2VWLA 3QLPH 5FBEA 1FLEE 3SU6A 2SGQE 3JZ1B 3P8NA 1KTSB 2Y7ZA 1QRZA 1O2HA 1IQEA 1L4ZA 4JYUH 4ABJA 1ANCA 1P0SH 2ANMH 1TBRH 6GCHF 5JBBS 1G3EA 5ETXA 3SUDA 2A32A 3K6YA 4CHAB 4ZXYH 1FZZA 4X2YA 1ZRKA 5C1YA 2FYRA 1KTTB 1QRXA 2GCTB 1X7AC 2HLCA 4J2YB 3SHAH 2NU0E 3A8DA 3LU9B 1FY1A 2P59A 1T8NA 2GZ9A 3PMHB 1G9IE 3SU3A 2ZHQH 3TVJB 3UOPA 1O2IA 2GZ7A 1NT1A 5K0HA 1TB6H 3ZV8A 1PQ5A 4Y0ZE 1P09A 2BDYA 4MPWA 4NIVA 1Z71A 3S7HB 2A45B 5E2PA 3D65E 1HAIH 3SHCH 1THRH 1TX7A 2VH0A 1BTHH 1QJ1B 1ACBE 1EZUC 1YCPH 4X1RU 2ZDVH 1C1UH 5FXLA 3GCTF 2OUAA 4GCHG 3RXCA 5FCKA 3HGNA 3SU0A 1F2SE 3U8OH 2PKAB 1C5LH 3FP7E 3SU2A 1ETTH 2FOAA 5DP6A 1VCWA 1ELVA 1GJ5H 4D7GA 2XC0A 1BTUA 2VIPA 3MHWU 1KLJH 2ZC9H 6CHAB 2TGAA 5JBAS 1O3KA 3BIUH 3FP6E 4Y7AA 3U9AH 1BDAA 1V6DA 3TH2H 1TNKA 1GHWH 1W13U 1P2KA 1W0YH 1SMFE 4K2YA 3M61U 1SGPE 2THFB 3M36A 1EJMA 3MMGA 4NZLA 5FX6A 4DOQA 4XE4A 4Y11E 2VWOA 4NCYA 3V3MA 3BTQE 3A83A 3O8RA 1CT0E 1TPPA 4O97A 1BHXB 1QB1A 1JWTA 3OTJE 3ATLA 2Y82A 3PLPA 1NTPA 3LH1A 2C8WB 3TGKE 2FODA 1AKSB