1L1JA

Crystal structure of the protease domain of an atp-independent heat shock protease htra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
228
structure length
226
Chain Sequence
DYESPIVNVVEACAPAVVKIDVVKTTSFFDPYFEQFFKKWFGELPPGFERQVASLGSGFIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heat shock protease HtrA
publication title Crystal Structure of the Protease Domain of a Heat-shock Protein HtrA from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 49
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1jA01
1UTQA 4JCNA 4ZH8A 2OC1A 3RXDA 2FX6A 3SU3A 1JBUH 3N7OA 4E7RG 2ZPSA 5K7RA 2PHBA 1NRSH 1KLJH 2G4UA 1UCYE 3MWIU 2VGCC 1P04A 5G4BA 1LVMA 1P05A 3NZIA 1A0JA 2TRMA 1QQ4A 1YPGH 1Y59T 1FONA 2F9BH 5C5NA 5IYTA 1TPSA 1H9HE 2FOGA 1FY4A 1MZDA 1P09A 1Q3XA 1P01A 3HK6B 4CHAC 1D3TB 1HV7A 3SORA 7GCHF 3TH4H 1C2JA 1GBTA 2ZO3H 3AASA 4BAOB 3PTNA 4A6LA 2ASUB 2BY5X 2FZZA 1K28D 4ABJA 1WU1A 3LH1A 4DVAU 1THRH 4GCHG 1BB0B 2PSXA 2M5TA 2ALVA 3BV9B 1F7ZA 3EA9A 2STAE 2A4GA 1MZAA 2EI6A 4I32A 3BIUH 1LMWB 2VWMA 2ZU2A 3DT0H 1P9SA 5DP5A 1MQ6A 1QIXB 3EDXB 3M7UA 4LZ4B 1YKTA 2BD5A 3TVJB 1IQKA 1UTPA 3SNBA 4B1TA 3P92A 2VIWA 2H9EH 1QJ7B 2HLCA 2P95A 1KTTB 4NZLA 3T62A 1C2HA 3F9EA 1GDUA 1O5FH 3RXUA 2SGPE 3SJ9A 2JKHA 2XWAA 4DOQA 2O8UA 1XMNB 1DLKB 1EZUC 6ESTA 1DOJA 4K69A 1C1RA 1LPGB 2CF9H 4D76A 3VXFH 1FAXA 1FMGA 1TPOA 5LPFA 5DP4A 2F9UA 3ELAH 2VVUA 3VXEH 3H5CB 1O3PB 4ZHLU 2OUAA 5GJ4B 3A8CA 1Y5AT 3RLYH 2B5TB 2BQWB 3E6PH 1BBRH 4Q7ZA 3SJKA 3SUFA 3VFEA 3RU4D 1JXPA 4JZFH 3M61U 3PO1B 2GCTB 1XUGA 3LGWA 5HM2A 3V7TA 1CT0E 2Q1JA 3HGPA 2JETB 1TA6A 1YBWA 4K5ZA 4GCHF 1QB6A 3OY6U 3QZRA 3B8JA 2P3UB 1NPMA 5ABWA 1AFEH 1K2I1 1Q31A 3D65E 3Q3KA 2R3UA 3U1JB 3SV7A 3UWIA 1O0DH 3QN7A 2CGAA 2BY6X 1EQ9A 3KIDU 1GJ6A 4O03A 1WSSH 4NWLA 2P8OC 1P2OA 2BDHA 1LVOA 1C2EA 1FPHH 2PUXB 3A84A 5EG4A 4AFQA 3RC5A 3ATMA 2BQ7B 3F1SB 3PMJA 4I8GA 1F5RA 1TWXB 4YM9A 2XXLA 2C8ZB 4JYVH 1OKXA 1MKWK 2TGTA 4TY6A 2QF3A 4F49A 2NU3E 4OGYA 3D23A 4B75A 5CE1A 2H2ZA 1F0UA 1S81A 3TPIZ 2OC7A 3IWMA 1BTHH 1SFQB 1SQTA 3SNCA 2CN0H 1D6RA 1GHZA 1Y5BT 1M9UA 3GICB 2J9NA 4INHA 3HKIB 5GWZA 5DO4H 1QB9A 4MVNA 1RS0A 4MPWA 1PQ8A 4K3JA 3KHVA 2WPIS 5DP7A 1FN8A 1P9UA 3LGVA 1AVWA 4AYYB 1GJBB 4ISHH 1S83A 3RM0H 2VH0A 1ETSH 3C27B 4HGCA 4X2YA 1O2MA 1D3QB 1ID5H 2BVXH 1HAOH 2ANYA 4DCDA 1L1GA 4TPYA 2ZKSA 3SU5A 4K1EA 1GHXH 3UWJH 1C5SA 1QHRB 3PTBA 3PROA 2A2QH 4WJG2 3BN9A 4IBLH 1THPB 1G2MA 1UK4A 3RC4A 4ABFA 4BTIB 3UFAA 2R2MB 1RD3B 1Z1JA 2XCNA 2BXTH 4X1QU 2AIQA 4UDWH 1GBCA 1SOZA 2GP9B 1RTLA 1O2NA 3PMBB 1K9OE 4J1YA 3TNSA 1ZSKA 3EQ0H 1LPZB 2Q6GA 2GZ7A 1ZR0A 1GBDA 3B23B 3R3GB 3PWCA 3A7VA 1GPZA 1CA8B 2ODYB 5E0GA 3RMLH 1P11E 4ABHA 2GMTC 2TGAA 3NWUA 4FU9A 1ZPZA 1NRPH 3PMAB 1C2LA 4Y10E 1HAGE 1MAXA 2ZG0H 4K1SA 2BQ6B 1ZMJA 3V0XA 3GCHC 2IOTA 3RMMH 3UNRA 1O35A 1AY6H 4NIYA 1G9IE 5A8XA 2NU1E 4SGAE 2ZFSA 3RXAA 2XBVA 3K65B 3VGCB 1V2TT 1C2IA 4AN7A 1TLDA 1BTYA 3E16B 2ZGJA 3O8CA 1B0FA 2ZPQA 5TCCA 3ZV9A 3BIVH 1Z8RA 1O2PA 5EOKA 3SNEA 2QY0B 3O8BA 1G32B 2FXRA 1C1OA 3LPRA 3L6PA 3T25A 2BLOA 1O2UA 1FZZA 3EYDA 2FOAA 4KTUA 3TLOA 1ELAA 1EXFA 3QLPH 1BMAA 4ABAA 1HJAB 4DW2U 3F9FA 3M3SA 4DGJA 1EZQA 4X2XA 1O5BB 1RJXB 5BRRE 8ESTE 3VB3A 1RGQA 2QCYA 2AGGX 2B8OH 3ATWA 4MDSA 2ZGCA 4XE4A 1RTFB 2PSYA 1CQQA 3DD2H 3ZZCA 3S9BA 1GBAA 1HYLA 5CMXH 3RMOH 1C5RA 4UFGH 4THNH 3RXOA 2OD3B 4X8UH 4AORA 4BAKB 1GBBA 4K1TA 2BZ6H 1C5UA 1FV9A 3EE0B 2DE9A 2BVSH 5C2ZA 2ZA5A 1UK3A 1GHYH 2A4OA 3HATH 3TNTA 4WXVA 1OWEA 3A8AA 4JK6A 1CHGA 2P59A 2Y5GA 1AUJA 1BTXA 2VVVA 3RXQA 3PYHA 1YP9A 2RCEA 2BB4A 3GISB 1P2QA 1EATA 5I46H 1QRZA 3CS0A 5C67A 1O2OA 2NU4E 1DY8A 4O97A 1TRMA 1LHEH 1T32A 5FX6A 5EW1H 4X8SH 1BITA 2F9OA 2G81E 1NRNH 5T6GA 4CRGA 4ABIA 3SI4H 1NROH 1V2ST 2UUYA 3SJ8A 3SV6A 3FP8E 3O8DA 4F4OC 4Y8ZA 1TIOA 1GI9B 1TQ7B 2GV7A 3ZZ4A 1O33A 2P94A 1ELDE 2CJIA 3P17H 2QIQA 3MU0A 4BNRA 3TH2H 1QBNA 3P8NA 3STJA 4YOJA 2K1QA 3C1KA 1BMNH 3OY5U 3W95A 2OQ5A 2IJOB 3RP2A 4OS1A 1AZZA 1B7XB 1SGNE 1Y3XA 2FOHA 1NFUA 3SUGA 1CBWB 3VB7A 1CE5A 3AW0A 1B0EA 4VGCC 4ISIH 4ISLA 2GV6A 4O3TA 3M7TA 5EW2H 4AB8A 2C8WB 2VWLA 3A7WA 4PROA 3TIUA 3MO3A 5J4SA 1V2RT 1Z71A 1C2MA 1FAKH 1C2FA 3SBKA 1TRNA 3MH6A 1KYNA 1SGYE 1TB6H 3I29A 3MU4A 1SOTA 2ZCHP 1C2KA 3BG4B 4HI3A 3P6ZB 3MO9A 1ETRH 1AO5A 1QNJA 4KTCA 5JBAS 1HIAA 2H5DA 4X1RU 3UNQA 1W12U 5JBTA 1GMHF 3A86A 1C4U2 2ODQA 2C4FH 2I6QA 1DWEH 1TGTA 3ZYDA 4NIXA 5FBEA 2Y81A 1UMAH 1E36B 2PTNA 4ZKSU 2FX4A 2JH6D 1BQYA 1ORFA 1UTJA 2WPLS 3U8RH 2C8XB 1ZRKA 1VCQA 3RXIA 3QDZB 1N8OC 1A1RA 3TJNA 4LZ1H 5I25A 5DP3A 3LGIA 2A31A 2HALA 1W0YH 1U6QA 5BPEA 9LPRA 1K1OA 4K2YA 3BTDE 2C8YB 3PWBA 5H4IB 5F8XA 1GI8B 1O3IA 2BM2A 1BTZA 4WMDA 1AFQB 1EP6A 1C4V2 1C1UH 3JZ1B 4HZHA 2QF0A 1O3NA 1G37A 3QGJA 3E3TA 5JPMH 2FIRH 4AFUA 3TK5A 2A45B 3VGCC 1CVWH 1O3EA 3RM2H 1FIWA 2LNCA 5E0HA 1PPEE 2J92A 4B71A 3GY7A 4KGAA 4FVDA 1H1BA 1MMJN 2ILNA 2PUQH 1O2ZA 1P10A 1VCPA 1WQSA 3MFJA 1BMMH 1ARCA 3MU8A 1BT7A 1G36A 1GI6A 1W3CA 3GY6A 3PLKA 4JZIA 1HIAB 1SLVB 5FXLA 3QGNB 3F6UH 6GCHF 2A7CA 1AUTC 2O8WA 1INCA 2P3FH 1FY3A 1WYKA 1EJMA 2STBE 1DSTA 3GY8A 1HJAC 1BA8B 2HPPH 4JYUH 4D7GA 4GPGA 4D8NA 4ZHAA 4BAQB 1GWAA 1PPGE 5F6MA 3A82A 1QGFA 1WTHD 1V2JT 2OINA 3U8OH 2BXUH 1YYY1 2D26C 3E91A 1QB1A 1LVBA 1GBHA 2QAAA 1TPAE 2B0FA 1T8NA 4A7IB 1ZSJA 3RXSA 4ZUHA 2A4QA 3SU4A 3I77A 1PQAA 1NY22 4BOHA 3ZZDA 1EAXA 3S7HB 1SSXA 1ANEA 1DDJA 1L4ZA 1UCYH 3BEFB 1LHDH 4IN1A 1S0RA 1XUFA 2QGRA 4I31A 2JH5D 2NWNA 1NTPA 2RG3A 2A1DB 3S0NA 1JOUB 4YZUA 3IITA 1TGBA 1OS8A 4D7FA 2Y7ZA 1SI5H 2FLRH 1EOLA 1LCYA 1HCGA 1O2VA 4XFQA 3U69H 2BTCE 3GY2A 3SU6A 4A92A 2R2WU 1C2DA 2BDIA 1MTSA 1TNIA 2V6NA 4AG1A 4B74A 1GGDB 1P12E 2BYAX 3RXFA 2FOBA 3ATKA 4X1NU 1SPJA 2PKAA 3RMNH 2A5KA 2W7UA 1DY9A 1OX1A 2ZHEH 4X8VH 1L2EA 1HB0B 1O30A 1GHVH 4R8TB 2ODPA 3GCNA 1T7CA 3DFLA 2HVXA 1FN6A 3E1XB 1O2HA 3RXRA 1O2WA 4RKOB 3ZVBA 3S7KB 1FI8A 5T6DA 1HJ8A 3SGAE 1HAYB 3BSQA 3MHWU 4QT8C 5C3NA 3OYPA 4I8JA 1T31A 1ZGVA 2BMGB 3A7YA 1HAIH 2CHAC 1H8IH 4K8YA 3RXTA 5EQRA 1O2XA 1SLWB 5FPTA 1NN6A 4FU7A 4BXWA 2BOKA 4ABEA 4NSVA 1QJ1B 4X2WA 2WV4A 4AOQA 2F3CE 4MLFB 5DP6A 1MTNC 2FOCA 1RFNA 4KELA 4OS6A 1TGNA 2A2XH 1BDAA 2WPKS 4OS2A 2O8TA 4ESTE 1QA0A 1DLEA 4IMQA 5FPYA 4Y6DA 4GHQA 1MTWA 3GYMA 3LJOA 1D9IA 1BHXB 1UO6A 2D8WA 1GBFA 4X6NA 1DFPA 1SHYA 3BG4C 4YO9A 3PM3A 2EI7A 1A2CH 1O3BA 7LPRA 2FTLE 2BX4A 2PKAB 4ZROA 1SB1H 3SJIA 4IMZA 3TH3H 1ZLRA 1C5XB 1ABJH 1S6HA 1SGCA 2G8TA 2ZGXH 3K6ZA 1C9PA 1IHSH 1EASA 2A5IA 1G3BA 4NA7A 2ESTE 1GVKB 3LDXH 1A4WH 2FM2A 3MNSA 1ZTJA 1OWKA 1TGSZ 1HBTH 1O3LA 2TGPZ 2GZ8A 4ISNA 1NRRH 3MYWA 2SGAA 3RXJA 2TGDA 3KNXA 1C5ZB 2QC2A 3RC6A 4TPIZ 2PKSB 1VZQH 1L1JA 1ELTA 3GCOA 4CRCA 3SHCH 2ZDMA 2FDAA 1C1VH 1KXDA 1NC6A 2AMDA 2DE8A 1FY5A 4WWYA 3TK9A 5EQQA 1KIGH 3RXGA 4BAHB 2W7SA 2W26A 1ZHRA 4I8LA 3UQOA 4GUXA 5L30H 7ESTE 1J17T 1DUAA 3A7ZA 1YLCA 4M7GA 2RA3A 1XVMA 4O3UA 1YC0A 5CHAB 3UOUA 5JDUB 1SL3A 1EUFA 4TY7A 4TYDA 2J4IA 1CGIE 3S9CA 1SGEE 4YT7H 1L0ZA 4IS5A 5GPIB 1UVUH 3ZVAA 4IGDA 4CBNA 1YPKH 2OCVB 3HGNA 1W0ZU 1P3CA 3KQCA 2SGFE 1O3OA 4H6TA 4XBCA 9ESTA 2FS9A 1YPJH 1EZSC 1LHCH 1FQ3A 3QZQA 5IDKA 1FY8E 3M7QA 2XBXA 2UUJB 2WPMS 2ANKH 4UFFH 3CP7A 2XTTB 1C9TA 1P3EA 1IOEA 2O8MA 1GG6B 1GBEA 1THSH 1YPMH 3TGKE 1O2KA 2C3SA 3NPSA 5A0CA 1DVAH 4XSKU 3P8OA 3LGUA 4JMYA 3BG8A 3UNSA 1ZMLA 1MD8A 3KL6A 2YNAA 1P2JA 2THFB 2O8LA 3P8GA 1TOMH 4BXSA 1QY6A 3AVZA 1NFWA 2Z9LA 1XX9A 1KY9A 1ZZZA 3IG6B 4MG3A 2OBOA 2BD7A 5C5OA 1QL8A 1FIZA 1ELFA 1ZPBA 4X6OA 5GCHG 4AZ2B 2QN5T 5L6NH 2ZCLP 1KXBA 3RU4T 2G55A 3ZZ9A 1P2NA 5FCRA 2ANMH 2G52A 1ELBA 4X8TH 2SGQE 2D1JA 1N6YA 1W10U 1TQ0B 5AVDA 4RKJB 5A8ZA 1HDTH 1PPCE 4UE7H 5FCKA 4CRBA 1SR5C 2W5EA 4WVPE 3A87A 1V2LT 5GXPA 1DANH 1TONA 3PMHB 1EPTA 3E0PB 4U30A 3VPKA 1HXFH 1GHAG 2A4RA 5JBBS 1O5AB 1O38A 4YTAA 3K9XB 3ATLA 1AWHB 5PTPA 1V2MT 1YCPM 1Z1IA 4Y7BA 2GVFA 2UWOA 1O2SA 3UUZA 1O5EH 1PPFE 1Z8GA 1GDNA 1QL7A 5DP8A 3A83A 1OYQA 1O3FA 2B9LA 3ATIA 3ESTA 3GYLB 1LVYA 2C93B 5DG6A 3SU0A 4UFEH 2ZNKH 1C5LH 1KXAA 1HGTH 3LJJA 2UUKB 2V35A 3VB4A 5DKMA 1E34B 1CA0B 4WY3A 1AWFH 1DS2E 3SW2B 1OWDA 5TCAA 1NO9H 1C5PA 4X6MA 1GJDB 1MD7A 4A1VA 4DIHH 3RXMA 3BTHE 3TGIE 3MO6A 4MTBA 2BOHB 5T3HA 2QXHA 3LC5A 1Q2WA 2P93A 1EPTB 4RSPA 4WF8A 3SO3A 3M5LA 1MH0A 1PQ7A 4AB9A 4MNXA 1MBQA 1O3HA 1JIMA 1K1IA 2FLBH 1TX8A 2PKSC 1SFIA 1GHAF 1VITH 3A7XA 3TK6A 4CH8B 1D3DB 1XKAC 3L3TA 2HOBA 2KAIA 3MMGA 1ANDA 1UJ1A 2ZF0H 1G3DA 1GI1A 1HAVA 3SUEA 1NFXA 1FNIA 1QBVH 1ELCA 1EZXC 1EJNA 3D49H 4X6PA 3RXEA 5C20A 1KLIH 2BLQA 1FJSA 3EAJA 1UTMA 1GJ7B 3STIA 3PO1C 2QV1A 2GCTC 3LT3A 4CREA 1JMOH 4YOIA 1G3CA 5DK1A 2JETC 5CHAC 6CHAB 2BDAA 2ZU1A 3RXVA 3SNAA 2TIOA 1W7GH 1Z8JB 1EB1H 1RRKA 1S6FA 2QXIA 3GDUA 1SQAA 1O2RA 1T4VH 3M5MA 1JRSA 3E0NB 1GCTB 3PLBA 4OS5A 2DUCA 1OXGA 1IQFA 2I6SA 1GL1A 2ZIQH 3LONA 3MH5A 3P95A 3QTVH 4WMEA 2BD3A 4OS4A 3T2NA 1C2GA 3U1IB 4GSOA 3RXHA 1A5GH 2KAIB 1PPBH 3UPEA 2AEIH 1GVLA 2UUFB 1HAVB 1QFKH 1S0QA 1YPEH 4KP0A 1T4UH 2P16A 2AH4X 1GI2A 2AS9A 4JZEH 4FUJA 1KXEA 3U9AH 2GDDA 1HAHH 4XBDA 1MQ5A 2GD4B 5EQSA 5E0JA 3PV4A 3DHKH 1FLEE 4ZKRU 1KXFA 1VJAU 1Y3UA 3D62A 2VB0A 1SGIB 1UTOA 4RN6A 2BY7X 2XC5A 4SGBE 4A5TS 2WINI 1SLUB 3ZZ5A 2BDBA 1EAUA 1PYTD 2VVCA 4NCYA 4B2AA 1A7SA 2AGEX 4Q7XA 1SGFG 1WAYB 1ZYOA 1O2JA 2FI5E 2XYAA 3A80A 1ZOMA 4NFFA 2ZI2H 1GBIA 1GDQA 2ZGBH 3RXBA 4IC5A 1C5MD 5HMAA 3SI3H 3E90B 4ABBA 1F0RA 3QTOH 5AFZH 3SQEE 1BIOA 1RXPA 1UCYK 1V3XA 1YM0A 2IN2A 1P06A 3HKJB 3RU4E 1GJAB 2CF8H 1BRUP 1FY1A 1OWHA 1Z6JH 1TNGA 3UR6A 2VIDA 5HXFA 5JB9S 3MH7A 2EA3A 5HM9A 4CHAB 2BHGA 1C1PA 3TJVA 2PTCE 4CRFA 2FP7B 2ZDLA 3JZ2B 1HLTH 2EEKA 4MQAA 1NU7B 2YNBA 1S5SA 2ZQ1A 3GY4A 2R3YA 5F8ZA 1GBJA 2OC8A 2ZFQH 2GCHG 1D4PB 1DM4B 1WCZA 1UTLM 1EX3A 2GT8A 3BTFE 3A81A 4GHTA 3S69A 4X2VA 2AGIX 3EA8A 1CHOG 1D3PB 2VJ1A 1TNHA 1YF4A 1J14A 2ZDKA 5EXMA 4A1XA 4I7YH 1SGFA 1O32A 3HK3B 4MNVA 2BD9A 1Y5UT 3VB5A 3OU0A 2O9QA 1BTPA 2OBQA 1ELVA 2FEQH 3BF6H 2F91A 4IC6A 3LIWA 5ESBA 3Q77A 1C1SA 1C5VA 3FZZA 1MU8B 3GOVB 1B5GH 3A88A 1IAUA 2Z6BD 1FDPA 1TPPA 1BUIA 1NT1A 1V2VT 1Z8IB 2BD4A 1MTUA 2FESH 2W3KA 1O5DH 1DWCH 2JH0D 1A0LA 1O5GH 2J38A 1TALA 2QXGA 4Y76A 4BANB 2Y7XA 4FU8A 1K1PA 2VWOA 4E7NA 1V2PT 3E8LA 3CS7A 2XW9A 1SBWA 1Y8TA 3DA9B 2V3OH 2ZFPH 3QX5H 2XWBI 1WOFA 5LPRA 1KXCA 3AAVA 4D9QA 2UWLA 2GX4A 2ZHWH 8GCHG 1MU6B 3L33A 4JZDH 1EOJA 2ZC9H 5C1UA 1SGQE 3A85A 1NFYA 1YPHC 4LK4A 1DICA 1LQDB 2ZWLH 4R0IA 3GY5A 3SOSA 2P8OB 4X1SU 5L2YH 2ZQ2A 4MNYA 5LPEA 3NUMA 2PWXA 4CR5A 1GBKA 1SG8B 3ZVDA 4BTUB 1LO6A 4CBOA 1JIRA 1G3EA 5AFYH 2FYQA 2A7JA 3ZZBA 2ZU5A 2A5AA 3BTKE 3ZVCA 2P3TB 4HTCH 2VU8E 1LHGH 1YPLH 3FFGA 4TWYA 1T8OA 3SV8A 1QL9A 3SV2H 2NU2E 1O2GH 4CR9A 1HXEH 3BEIB 1AE5A 1L4DA 2FMJA 1IQEA 1O3MA 2RA0A 2ZCKP 5E2OA 3LOXA 1GMCG 5HYOA 2VWNA 3BTEE 1C1QA 2PW8H 3SQHE 4WXIA 1O2IA 7GCHG 2AMPA 1FPCH 1MCTA 2G5NA 5DP9A 1DUEA 1MAYA 4AX9H 4OS7A 1JRTA 1DWDH 1LKBA 3Q3XA 1BHXF 1PPHE 1GJ9B 3NXPA 4KTSA 1Z6EA 1HAXB 2V0BA 3KGPA 3MNXA 3V12A 3MNCA 2WYGA 5A0BA 1DT2A 2Q6DA 4Y8XA 1HUTH 3SV9A 1T8MA 3BTWE 2PV9B 2FTMA 2SGDE 2Y5FA 4A1TA 1ZTLA 5DGJA 4ZKOU 1CO7E 1NU9A 3Q3YA 5F8TA 1IQGA 1C5YB 8LPRA 1W2KH 2Y80A 1GI4A 2GKVE 3BEUA 1GI7B 1HPGA 1QRWA 1K1LA 1P2KA 1CBWC 3T26A 4I33A 2WPHS 2FOMB 2PGQB 3W94A 5B6OA 5T6FA 1UHBA 2H9HA 1AN1E 2AFQB 4KKDA 3KQBA 5E8EH 1TNLA 2BDCA 1TX6A 1TFXA 1ELGA 1TOCB 4FUEA 3SZNA 1TA2A 3ZZAA 2BZAA 3LU9B 4IN2A 2BY9X 4J2YB 2GMTB 2ZFFH 4YESB 4Q7YA 3M5NA 7KMEH 1ESAA 1GMCF 1A61H 1W8BH 3MU5A 3K2UA 4AFZA 1TABE 3GCHB 5EODA 3U8TH 4H6SB 4AFSA 2OLGA 5HGGA 2B7DH 1O2YA 4X1PU 4ABDA 3RLWH 3M35A 1AB9B 2FOFA 2Z7FE 4NG9H 1DE7H 1IQHA 2XC0A 3T28A 1L1NA 3GCTG 1UVTH 1GBMA 4ZHMU 3TU7H 1NM6A 4OGXA 1F92A 3SU2A 5FX5A 1H9LB 2G00A 1SGRE 1VITG 1TMTH 3SUDA 1OYTH 4GAWA 2ZTZA 1AFQC 2XNIA 3AW1A 1IQLA 1GI5A 1UHBB 1T8LA 2G51A 1MKXH 2AYWA 1H8DH 4JK5A 4B73A 1OWJA 2VIVA 1Y3VA 1XVOA 4AG2A 1PJPA 1UVSH 4NA9H 1F5LA 3M3VA 4BTTB 3KCGH 4UD9H 2AIPA 1F2SE 1UTNA 1TE0A 2UWPA 1VR1H 2BDYA 1K22H 1V2UT 5EU8A 2FS8A 3M5OA 3H7OA 5K0HA 3NCLA 4NGAH 2PR3A 3FP6E 1O2QA 1Z7KA 3HPTB 2GGVB 1AU8A 4UONA 4Y71A 5C1YA 3VEQB 2QXJA 3ZZ8A 2F83A 1SC8U 1ABIH 2XBYA 1J9CH 3UY9A 4U2WA 1LHFH 4H42U 5LGOA 1O3CA 1GJ5H 1VGCB 4I8KA 1E37B 1OPHB 5EGMA 1E35B 1N6XA 4DT7B 1C4Y2 1K1MA 4U32A 4Y0YE 1A3BH 1FUJA 3GCTF 3SGBE 2Z94A 8KME2 3RXCA 3QO6A 2BD2A 1O2LA 1KTSB 3ITIA 1VITF 2TBSA 1AHTH 5ESTE 1PFXC 1O3KA 1FXYA 1ZHPA 5JYIA 3P70B 3UREA 1TNJA 3UTUH 4FXGH 1PYTC 2WPJS 2XC4A 1YLDA 1IQIA 1PQ5A 1ZRBA 2ZU3A 2YOLA 5EXLA 2CXVA 2FODA 1NZQH 1LDTT 3RDZA 1O34A 2V3HH 1C5OH 3ZZ7A 5A8YA 1MCVA 1SHHB 1BBRE 1DX5M 1LQEA 2ZDNA 4I8HA 1BJVA 2H9TH 1O3AA 2G5VA 1TMBH 1GHWH 2J94A 1GGDC 3V3MA 1HAPH 2FYRA 3BTTE 3RXLA 3VB6A 5L2ZH 4Y8YA 2HNTF 4B2BA 3SU1A 4AYVB 2HWLB 3M36A 4VGCB 4AGKA 3BTGE 4LOYH 3FP7E 1NS3A 2ZP0H 2ZU4A 4CRAA 1QURH 1GBLA 4MPVA 2BLVA 1BOQA 4FUHA 3F68H 4GVUA 3UQVA 1EJAA 2IPHA 2R0LA 3OX7U 1ZPCA 4NZQA 1QQUA 1XUJA 1SGPE 5JB8S 2ZEBA 4NWKA 2CV3A 1O5CB 3RUOA 1QCPA 1GMDG 1H4WA 3ZZ6A 3TGJE 1F0TA 2H6MA 2BD8A 4NIVA 2ZGHA 1MBMA 1QJ6B 3A7TA 4Y11E 5AHGH 1BZXE 4ASHA 2R9PA 1E0FD 1LTOA 3OSYA 3KN2A 3LC3A 1VJ9U 3KQEA 3LGTA 2G4TA 1W13U 2BY8X 2VIOA 4XBBA 1GVZA 1GJ4H 3F9HA 3T27A 4XDEA 2BX3A 4H4FA 1N8OB 1V2NT 3ZV8A 1DXWA 1QTFA 1XUKA 2A0QB 3AAUA 2W3IA 2OTVA 2R0KA 5GCHF 1IQMA 2Z3EA 1C1WH 1GL0E 2TPIZ 4CH2B 4DIIH 1HFDA 1G2LA 1GI0A 1AQ7A 2OC0A 3ZVEA 4NFEA 1C1MA 1O3DA 4ABGA 3ZVFA 2ZFRH 2BVRH 3QK1A 1ARBA 1GCDA 4Z6AH 1OWIA 1AB9C 3B9FH 1OSSA 3TJUA 2F9VA 1P2MA 1EAWA 1S84A 1G30B 4INLA 3TJOA 1OP2A 2VIPA 5A09A 1MKWH 1TBRH 3RXPA 2WYJA 2Z9GA 2D2DA 3MU1A 1J15A 3FVFB 3UOPA 1HNEE 4DY7B 1C5TA 5TJXA 1AMHA 1P03A 2ZPRA 1GMDF 1AZ8A 4DG4A 1SQOA 1MTVA 4NSYA 1C1NA 2PGBB 3BTME 2A32A 1BRBE 2Z3DA 3GY3A 1WUNH 1BTUA 1ESBA 4XOJA 3EGKH 1CGHA 3QWCH 2GT7A 5LH8A 2SNWA 3SGQE 1TAWA 3S9AA 1OP0A 1AVGH 2HRVA 3V13A 2Z9KA 2BDGA 1AE8H 1ZMNA 1NRQH 1WBGB 1TX7A 5DJ7A 1BCUH 1RIWB 3CENA 2OQUA 3A8DA 1WV7H 4BAMB 1BJUA 1SGDE 1ESTA 2J2UA 5A2MH 2ZTXA 4Q80A 1BTWA 1QA7A 2FI4E 2RDLA 4HFPB 5GIBA 3I78A 3R0FA 4Y0ZE 1W14U 1Y3YA 2XRCA 2Y5HA 1DWBH 4JYTA 3UIRA 1VGCC 4YLUA 3ZVGA 2H1UA 4FUIA 3MOCA 1V6DA 4INKA 2ZHQH 1O31A 4FUGA 3EA7A 1DITH 1GG6C 1ZSLA 2VINA 4JZ1A 4Q2KA 2EC9H 4K8BA 1GMHG 1O3GA 3ODDA 5JBCS 1UVPA 1S82A 3MNBA 4K60A 1QR3E 4Z0KA 5F03A 4DURA 2WUCA 4O9VA 2AMQA 1BRAA 2PLXA 1X7AC 2J95A 3GDVA 5SGAE 3SHAH 1GI3A 1Y3WA 3LKWA 4MPUA 5C1XA 1PPZA 2GDEH 1LPKB 1IHTH 3Q76A 1TMUH 2ZFTA 3A8BA 4B2CA 4UEHH 1ELEE 4WH8A 2ANWA 5EXNA 3H7TA 1S85A 1NESE 2ZDAH 1O2TA 3MTYA 1QBOA 2VGCB 3KQDA 4FUBA 1KLTA 4ZAEA 1DSUA 1WQVH 4B76A 1XXDA 2XCFA 3A89A 5E2PA 1P02A 3DUXH 4U01A 3ZZ3A 1W11U 2HPQH 2CHAB 2HNTE 2QYIA 2PFEA 3NKKA 1N1LA 4YOGA 1MTNB 1TRYA 3LH3A 1CU1A 1D6WA 2Z9JA 1HJ9A 2VIQA 2AERH 4WH6A 1A3EH 1YCPK 6LPRA 4E05H 4ZXXH 2ZECA 1ZTKA 1V2WT 1EKBB 1V2QT 2NU0E 5EPNA 3TITA 1DPOA 2C90B 4MPXA 1XM1A 1VCWA 3FAOA 2ZZUH 1LKAA 1C5QA 5FHTA 4ISOA 1HRTH 3URDA 1QRXA 2XBWA 6GCHG 1OOKB 3QUMP 1CGJE 1A0HB 1SGTA 2GTBA 1TBQH 1OP8A 1UVOA 1O36A 2H5CA 3P8FA 1IQNA 1HAZB 1XXFA 4LXBH 2SFAA 1EAIA 1EP5A 4FVBA 1J8AA 1P57B 4YLQH 4GLYA 3FANA 4FUDA 1CT4E 1C1TA 1KDQA 1A5IA 3NK8A 1P0SH 2VH6A 2HNTC 1UK2A 2QA9E 1SMFE 2VNTA 1JWTA 4MNWA 1YPHE 4D9RA 1GHBG 3UR9A 1K21H 3ZYEA 2OP9A 1BRCE 1CA0C 1AIXH 3SJOA 1O39A 1GJCB 1TYNA 2Z9IA 4NA8A 2LPRA 1E38B 2Y6TA 1KSNA 1A5HA 1AI8H 1ANCA 4AGJA 3URCA 2ALPA 2ZHFH 2J34A 4CRDA 1K1NA 1YGCH 3LGYA 3U98H 5FPSA 1XUHA 1ZHMA 3KF2A 5EPYA 2OXSA 1EPTC 2GZ9A 3M37A 2FPZA 1XUIA 2FWWA 1ZGIA 4DJZB 3Q00A 2CMYA 4TWWA 1UTKA 1AD8H 2WV5A 2WUBA 2Q6FA 1J16A 3PB1E 4UFDH 1AKSA 1K1JA 2A7HA 3F9GA 3RXKA 2FI3E 1CT2E 4E06H 4ZXYH 1GJ8B 1AGJA 5FAHA 2GCHF 1ANBA 2SGEE 3ODFA 1EB2A 1W7XH 4ZKNU 2ZHDA 3WY8A 4ZMAH 3M3TA 1KDQB 3O8RA 1TGCA 1CHOF 2FO9A 2HGTH 3OTJE 5ETXA 2EI8A 3BTQE 1BMLA 1ACBE 1H9IE 1RTKA 3T5FH 3G01A 3MH4A 3SN8A 1ZJDA 2FOEA 3DFJA 5GDSH 4FUFA 4WMFA 3T29A 1SLXB 6CHAC 1XKBC 1TBZH 2Y82A 4Y79A 1YCPH 1O37A 3SNDA 3K6YA 1GHBF 1IQJA 5DPAA 4Y7AA 2ULLA 1A46H 2ZTYA 3KEEA 1RIWC 1WTGH 1CSOE 1GCTC 1C5WB 4IW4E 5J4QA 1TNKA 5FBIA 4NIWA 1V2OT 1MKXK 1AVXA 3PLPA 4FUCA 2F9NA 1P8VC 1AKSB 4YT6H 1MUEB 1P2IA 5A0AE 1ETTH 1C5NH 2SNVA 3FZDA 1F5KU 8GCHF 2ZDVH 1BBRK 2Z3CA 3MI4A 1DXPA 2BLWA 1O3JA 4X0WU 3ENSB 1V2KT 1SVPA 3GDSA 5AF9H 1ZJKA 1F0SA 2F9PA
chains in the Genus database with same CATH superfamily
1UTQA 4JCNA 4ZH8A 2QE7D 2WZQA 2OC1A 3RXDA 2FX6A 2J98A 3SU3A 1JBUH 3N7OA 4E7RG 2ZPSA 5K7RA 2PHBA 1NRSH 1KLJH 2G4UA 1UCYE 3MWIU 2VGCC 1P04A 5G4BA 1LVMA 1P05A 3NZIA 1A0JA 2TRMA 1QQ4A 1YPGH 2IJD1 1Y59T 1FONA 2F9BH 5C5NA 5IYTA 1TPSA 1H9HE 2FOGA 1FY4A 1MZDA 1P09A 1Q3XA 1P01A 5C17A 3HK6B 4CHAC 1D3TB 1HV7A 3SORA 5C0UA 7GCHF 3TH4H 1C2JA 1GBTA 2ZO3H 3AASA 4BAOB 3PTNA 4A6LA 2ASUB 2BY5X 2FZZA 1K28D 4ABJA 1WU1A 2QF4A 3LH1A 4DVAU 1THRH 4GCHG 1BB0B 2PSXA 2M5TA 2ALVA 3BV9B 1F7ZA 3EA9A 2STAE 2A4GA 1MZAA 2EI6A 4I32A 3BIUH 1LMWB 2VWMA 2ZU2A 3DT0H 1P9SA 5DP5A 1MQ6A 1QIXB 3EDXB 3M7UA 4LZ4B 1YKTA 2BD5A 3TVJB 1IQKA 3OTPA 1UTPA 3SNBA 2QF5A 4B1TA 3P92A 2VIWA 2H9EH 2XOKD 2J98B 1QJ7B 2HLCA 2P95A 1KTTB 4NZLA 3T62A 1C2HA 3F9EA 1GDUA 1O5FH 3RXUA 2SGPE 3SJ9A 2JKHA 2XWAA 4DOQA 2O8UA 1XMNB 1DLKB 1EZUC 6ESTA 1DOJA 4K69A 1C1RA 1LPGB 5DSFA 2CF9H 4D76A 2L6OA 1FAXA 3VXFH 1FMGA 1TPOA 5LPFA 5DP4A 2F9UA 3ELAH 2VVUA 3VXEH 3H5CB 1O3PB 4ZHLU 2OUAA 5GJ4B 3A8CA 1Y5AT 3RLYH 2B5TB 2BQWB 3E6PH 1BBRH 4Q63A 4Q7ZA 3SJKA 3SUFA 3VFEA 3RU4D 1JXPA 4JZFH 3M61U 3PO1B 2GCTB 1XUGA 3LGWA 5HM2A 3V7TA 1CT0E 2Q1JA 3HGPA 3NRLA 2JETB 1TA6A 1YBWA 4K5ZA 4GCHF 1QB6A 3OY6U 3QZRA 3B8JA 2P3UB 1NPMA 5ABWA 1AFEH 1K2I1 1Q31A 3D65E 3Q3KA 2R3UA 3U1JB 3SV7A 3UWIA 1O0DH 3QN7A 1QZ8A 2CGAA 2BY6X 1EQ9A 3KIDU 1GJ6A 4O03A 1WSSH 4NWLA 2P8OC 1P2OA 2BDHA 1LVOA 1C2EA 1FPHH 2PUXB 3A84A 5EG4A 4AFQA 3RC5A 4DT4A 3ATMA 2BQ7B 3F1SB 3PMJA 4I8GA 1F5RA 1TWXB 4Q4LA 4YM9A 2XXLA 2C8ZB 4JYVH 1OKXA 1MKWK 2TGTA 4TY6A 2QF3A 4F49A 2NU3E 4OGYA 3D23A 4B75A 4F55A 5CE1A 2H2ZA 1F0UA 1S81A 3TPIZ 2OC7A 3IWMA 1BTHH 1SFQB 1SQTA 3SNCA 2CN0H 1D6RA 1GHZA 1Y5BT 1M9UA 2W6JD 3GICB 2J9NA 4INHA 3HKIB 5GWZA 5DO4H 1QB9A 4MVNA 1RS0A 4MPWA 1PQ8A 4K3JA 3KHVA 2WPIS 5DP7A 1FN8A 1P9UA 3LGVA 1AVWA 4AYYB 1GJBB 4ISHH 1S83A 3RM0H 2VH0A 1ETSH 3C27B 4HGCA 4X2YA 1O2MA 2KCOA 1D3QB 1ID5H 2BVXH 1W0JD 1HAOH 2ANYA 4DCDA 1L1GA 4TPYA 1UW7A 2ZKSA 3SU5A 4K1EA 1GHXH 3UWJH 4YXWD 1C5SA 1QHRB 3PTBA 3PROA 2A2QH 4WJG2 3BN9A 4IBLH 1THPB 1G2MA 1UK4A 3RC4A 4ABFA 4BTIB 3UFAA 2R2MB 1RD3B 1Z1JA 2XCNA 2BXTH 2LP6A 4X1QU 2AIQA 4UDWH 1GBCA 1SOZA 2GP9B 1RTLA 5FL7D 1O2NA 3PMBB 1K9OE 2WPDD 4J1YA 3TNSA 1ZSKA 3EQ0H 1LPZB 2Q6GA 2GZ7A 1ZR0A 1GBDA 3B23B 3R3GB 3PWCA 3A7VA 1GPZA 1CA8B 3N7EA 2ODYB 5E0GA 3RMLH 1P11E 4ABHA 2GMTC 2TGAA 3NWUA 4FU9A 1ZPZA 1NRPH 3PMAB 1C2LA 1H8HD 4Y10E 1HAGE 1MAXA 2ZG0H 4K1SA 2BQ6B 1ZMJA 3V0XA 3GCHC 2IOTA 3RMMH 3UNRA 1O35A 1AY6H 4NIYA 1G9IE 5A8XA 2NU1E 4SGAE 2ZFSA 3RXAA 2XBVA 3K65B 3VGCB 1V2TT 1C2IA 4AN7A 1TLDA 1BTYA 3E16B 2ZGJA 3O8CA 1B0FA 2ZPQA 5TCCA 3ZV9A 3BIVH 1Z8RA 1O2PA 5EOKA 3SNEA 2QY0B 5HIZA 1E79D 3O8BA 1G32B 2FXRA 1C1OA 3LPRA 3L6PA 3T25A 2BLOA 1O2UA 1FZZA 3EYDA 2FOAA 4KTUA 3TLOA 1ELAA 1EXFA 3QLPH 1EFRD 1BMAA 4ABAA 1HJAB 4DW2U 3F9FA 3M3SA 4DGJA 1EZQA 4X2XA 1O5BB 1RJXB 5BRRE 8ESTE 1COWD 3VB3A 1RGQA 2QCYA 2AGGX 2B8OH 3ATWA 4MDSA 2ZGCA 4XE4A 1RTFB 2PSYA 1CQQA 3DD2H 3ZZCA 3S9BA 4P02A 1GBAA 1HYLA 3DCLA 5CMXH 3RMOH 1C5RA 4UFGH 4THNH 3RXOA 2OD3B 3FN8A 4X8UH 4AORA 4BAKB 1GBBA 4K1TA 2BZ6H 1C5UA 1FV9A 3EE0B 2DE9A 2BVSH 5C2ZA 2ZA5A 1UK3A 3PRBA 1GHYH 2A4OA 3HATH 3TNTA 4WXVA 4B6FA 1OWEA 3A8AA 4JK6A 1CHGA 2P59A 2Y5GA 1AUJA 1BTXA 2VVVA 3RXQA 3PYHA 1YP9A 2RCEA 2BB4A 3GISB 1P2QA 1EATA 5I46H 1QRZA 3CS0A 5C67A 1O2OA 2NU4E 1DY8A 4O97A 1TRMA 1LHEH 1T32A 5FX6A 5EW1H 4X8SH 1BITA 2F9OA 2G81E 1NRNH 5T6GA 4CRGA 4ABIA 3SI4H 1NROH 1V2ST 2UUYA 3SJ8A 3SV6A 3FP8E 3O8DA 4F4OC 4Y8ZA 1TIOA 2JDID 1GI9B 1TQ7B 2GV7A 3ZZ4A 1O33A 2P94A 1ELDE 2CJIA 3P17H 2QIQA 3WWBA 3MU0A 4BNRA 3TH2H 1QBNA 3P8NA 3STJA 4YOJA 2K1QA 3C1KA 5IK2D 1BMNH 3OY5U 3W95A 2OQ5A 2IJOB 3N99A 3RP2A 4OS1A 1AZZA 3KYGA 1B7XB 1SGNE 1Y3XA 2FOHA 1NFUA 3SUGA 1CBWB 3VB7A 1CE5A 3AW0A 1B0EA 4VGCC 4ISIH 4ISLA 2GV6A 3VG8A 4O3TA 3M7TA 5EW2H 2JJ1D 4AB8A 2C8WB 2VWLA 3A7WA 4PROA 3TIUA 3MO3A 5J4SA 1V2RT 1Z71A 1C2MA 1FAKH 1C2FA 3SBKA 1TRNA 3MH6A 1KYNA 1SGYE 1TB6H 3I29A 3MU4A 1SOTA 2ZCHP 1C2KA 3BG4B 4HI3A 3P6ZB 3MO9A 1ETRH 1AO5A 1QNJA 4KTCA 5JBAS 1HIAA 2H5DA 4X1RU 3UNQA 1W12U 5JBTA 1GMHF 3A86A 3W1EA 1C4U2 2ODQA 5DN6D 2C4FH 2I6QA 1DWEH 1TGTA 3U28C 3ZYDA 4NIXA 5FBEA 2Y81A 1UMAH 1E36B 2PTNA 4ZKSU 2FX4A 2JH6D 1BQYA 1ORFA 1UTJA 2WPLS 3U8RH 2C8XB 1ZRKA 1VCQA 3RXIA 4FOUC 3QDZB 1N8OC 1A1RA 3TJNA 4LZ1H 5I25A 5DP3A 3LGIA 2A31A 2LELA 2HALA 1W0YH 1U6QA 5BPEA 9LPRA 1K1OA 4K2YA 3BTDE 2C8YB 3PWBA 5H4IB 5F8XA 1GI8B 1O3IA 2BM2A 1BTZA 4WMDA 1AFQB 1EP6A 1C4V2 1C1UH 3JZ1B 4HZHA 2QF0A 1O3NA 1G37A 3QGJA 3E3TA 5JPMH 2FIRH 4AFUA 3TK5A 2A45B 3VGCC 1CVWH 1O3EA 3RM2H 1FIWA 2LNCA 2PP6A 5E0HA 4Z1MD 1PPEE 2J92A 4B71A 3GY7A 4KGAA 4FVDA 1H1BA 1MMJN 2ILNA 2PUQH 1O2ZA 1P10A 1VCPA 1WQSA 4I86A 3MFJA 1BMMH 1ARCA 3MU8A 1BT7A 1G36A 1GI6A 1W3CA 3GY6A 3PLKA 4JZIA 1HIAB 1SLVB 5FXLA 3QGNB 3F6UH 6GCHF 2A7CA 1AUTC 2O8WA 1INCA 2M2AA 2P3FH 1FY3A 1WYKA 1EJMA 2STBE 1DSTA 3GY8A 1HJAC 1BA8B 2HPPH 4JYUH 4D7GA 4GPGA 4D8NA 4ZHAA 4BAQB 1GWAA 1PPGE 5F6MA 3A82A 1QGFA 1WTHD 1V2JT 2L74A 2OINA 3U8OH 2BXUH 1YYY1 2D26C 3E91A 1QB1A 1LVBA 4RT1A 1GBHA 2QAAA 1TPAE 2B0FA 1T8NA 4A7IB 1ZSJA 3RXSA 5C94A 2WHXA 4ZUHA 2A4QA 3SU4A 3I77A 1PQAA 1NY22 4BOHA 3ZZDA 1EAXA 3S7HB 2AHME 1SSXA 1ANEA 1DDJA 1L4ZA 1UCYH 4AC9A 3BEFB 1LHDH 4IN1A 1S0RA 1XUFA 2QGRA 4I31A 3WW7A 2IPQX 2JH5D 3PRDA 2NWNA 1NTPA 2RG3A 2A1DB 3S0NA 1JOUB 4YZUA 3SZEA 3IITA 1TGBA 1OS8A 5T1VA 4D7FA 2Y7ZA 1SI5H 2FLRH 1EOLA 1LCYA 1HCGA 1O2VA 4XFQA 3U69H 2BTCE 3GY2A 3SU6A 4A92A 2R2WU 1C2DA 2BDIA 1MTSA 1TNIA 2V6NA 4AG1A 4B74A 1GGDB 1P12E 2BYAX 3RXFA 3DSPA 2FOBA 3ATKA 4X1NU 1SPJA 2PKAA 3RMNH 2A5KA 2W7UA 1NBMD 5GNDA 1DY9A 1OX1A 2ZHEH 4X8VH 1L2EA 1HB0B 1O30A 1GHVH 4R8TB 2ODPA 3GCNA 1T7CA 3DFLA 2HVXA 1FN6A 3E1XB 1O2HA 3RXRA 1O2WA 4RKOB 3ZVBA 3S7KB 1FI8A 3DSGA 5T6DA 1HJ8A 3SGAE 1HAYB 3BSQA 3GS9A 3MHWU 4QT8C 5C3NA 3OYPA 4I8JA 1T31A 1ZGVA 2BMGB 3A7YA 1HAIH 2CHAC 5KGOA 1H8IH 4K8YA 3RXTA 5EQRA 1O2XA 1SLWB 5FPTA 1NN6A 4FU7A 4BXWA 2BOKA 4ABEA 4NSVA 1QJ1B 4X2WA 2WV4A 4AOQA 2F3CE 4MLFB 5DP6A 1MTNC 2FOCA 1RFNA 4KELA 4OS6A 1TGNA 3AK5A 3UB0A 2A2XH 1BDAA 2WPKS 4OS2A 2O8TA 4ESTE 1QA0A 1DLEA 4IMQA 5FPYA 4Y6DA 4GHQA 1MTWA 2K8IA 3GYMA 3LJOA 1D9IA 3OEHD 1BHXB 1UO6A 2D8WA 1FX0B 1GBFA 4X6NA 1DFPA 1SHYA 3BG4C 4YO9A 3PM3A 2EI7A 1A2CH 1O3BA 7LPRA 2FTLE 2BX4A 2PKAB 4ZROA 1SB1H 3SJIA 4IMZA 3TH3H 1ZLRA 1C5XB 1ABJH 1S6HA 1SGCA 2G8TA 2ZGXH 3K6ZA 1C9PA 1IHSH 1EASA 2A5IA 1G3BA 4NA7A 2ESTE 1GVKB 3LDXH 1A4WH 2FM2A 3MNSA 4FETA 1ZTJA 2K0QA 1OWKA 1TGSZ 1HBTH 1O3LA 2TGPZ 2GZ8A 4ISNA 1NRRH 3MYWA 2SGAA 3RXJA 2TGDA 3KNXA 1C5ZB 2QC2A 3RC6A 4TPIZ 2PKSB 4ACBA 3OE7D 1VZQH 1L1JA 1ELTA 3GCOA 4CRCA 3SHCH 2ZDMA 5EJ1A 2FDAA 1C1VH 1KXDA 1NC6A 2AMDA 2DE8A 1FY5A 4WWYA 3TK9A 5EQQA 1KIGH 3RXGA 3F2FA 4BAHB 2W7SA 2W26A 1ZHRA 4I8LA 3UQOA 4GUXA 5L30H 3EE7A 7ESTE 1J17T 3F0OA 1DUAA 3A7ZA 1YLCA 4M7GA 2RA3A 1XVMA 4O3UA 1YC0A 5CHAB 3UOUA 5JDUB 1SL3A 1EUFA 4TY7A 4TYDA 2J4IA 1CGIE 3S9CA 1SGEE 4YT7H 1L0ZA 4IS5A 5GPIB 1UVUH 3ZVAA 4IGDA 4CBNA 1YPKH 2OCVB 3HGNA 1W0ZU 1P3CA 3KQCA 2SGFE 1O3OA 4H6TA 4XBCA 9ESTA 2FS9A 1YPJH 1EZSC 1LHCH 1FQ3A 3QZQA 5IDKA 1FY8E 3M7QA 2XBXA 2UUJB 2WPMS 1E1RD 2ANKH 4UFFH 3CP7A 2XTTB 1C9TA 1P3EA 1IOEA 2O8MA 1GG6B 5CDFE 1GBEA 1THSH 1YPMH 3TGKE 1O2KA 2C3SA 3NPSA 5A0CA 1DVAH 4XSKU 3P8OA 3LGUA 4JMYA 3BG8A 3SYJA 3UNSA 1ZMLA 1MD8A 3KL6A 2YNAA 1P2JA 2THFB 2O8LA 3P8GA 4HG6A 1TOMH 4BXSA 2F43B 1QY6A 3AVZA 1NFWA 2Z9LA 1XX9A 1KY9A 1ZZZA 2CK3D 3IG6B 4MG3A 2OBOA 2BD7A 3OEED 5C5OA 2KCYA 1QL8A 1FIZA 1ELFA 1ZPBA 4X6OA 5GCHG 4AZ2B 2QN5T 5L6NH 2ZCLP 1KXBA 3RU4T 2G55A 3ZZ9A 1P2NA 5FCRA 2ANMH 2G52A 1ELBA 4X8TH 2SGQE 1BMFD 2D1JA 1N6YA 1W10U 1TQ0B 5AVDA 4RKJB 5A8ZA 1HDTH 1PPCE 4UE7H 5FCKA 4CRBA 1SR5C 2W5EA 4WVPE 3A87A 1V2LT 5GXPA 1DANH 1TONA 3PMHB 1EPTA 3E0PB 4U30A 3VPKA 1HXFH 1GHAG 2A4RA 5JBBS 1O5AB 3FOAA 2HVYB 1O38A 4YTAA 3K9XB 3ATLA 3PV2A 1AWHB 5PTPA 1V2MT 1YCPM 1Z1IA 4Y7BA 2GVFA 2UWOA 1O2SA 3UUZA 2WSSD 1O5EH 1PPFE 1Z8GA 1GDNA 1QL7A 5DP8A 3A83A 1OYQA 1O3FA 2B9LA 3ATIA 3ESTA 3GYLB 1LVYA 2EY4C 3F2GA 2C93B 5DG6A 3SU0A 4UFEH 2ZNKH 1C5LH 1KXAA 1HGTH 3LJJA 2UUKB 2V35A 3VB4A 5DKMA 1E34B 1CA0B 4WY3A 1AWFH 1DS2E 3SW2B 1OWDA 5TCAA 1NO9H 1C5PA 4X6MA 1GJDB 1MD7A 4A1VA 2YMSD 4DIHH 3RXMA 3BTHE 4ASUD 3MO6A 3TGIE 4MTBA 2BOHB 5T3HA 2QXHA 3LC5A 1Q2WA 2P93A 1EPTB 4RSPA 4WF8A 3SO3A 3M5LA 1MH0A 1PQ7A 4AB9A 4MNXA 1MBQA 1O3HA 1JIMA 1K1IA 2FLBH 1TX8A 2PKSC 1SFIA 1GHAF 1VITH 3A7XA 3TK6A 4CH8B 1D3DB 1XKAC 3L3TA 2HOBA 2KAIA 3MMGA 1ANDA 2HLDD 1UJ1A 2ZF0H 1G3DA 1GI1A 1HAVA 3SUEA 1NFXA 1FNIA 1QBVH 1ELCA 1EZXC 1EJNA 3D49H 4X6PA 3RXEA 5C20A 1KLIH 2BLQA 1FJSA 3EAJA 1UTMA 1GJ7B 3STIA 3PO1C 2QV1A 2GCTC 3LT3A 4CREA 1JMOH 4YOIA 1G3CA 5DK1A 2JETC 5CHAC 6CHAB 2BDAA 2ZU1A 3RXVA 3SNAA 2TIOA 1W7GH 1Z8JB 1EB1H 1RRKA 1S6FA 2QXIA 3GDUA 1SQAA 1O2RA 1T4VH 3M5MA 1JRSA 3E0NB 1GCTB 3PLBA 4OS5A 2DUCA 1OXGA 1IQFA 2I6SA 1GL1A 2ZIQH 3LONA 3MH5A 3P95A 3QTVH 4WMEA 2BD3A 4OS4A 3T2NA 1C2GA 3U1IB 4GSOA 3RXHA 1A5GH 2KAIB 1PPBH 3UPEA 2AEIH 1GVLA 2UUFB 1YWUA 1HAVB 1QFKH 1S0QA 1YPEH 4KP0A 1T4UH 2KCAA 2P16A 2AH4X 1GI2A 1W0KD 2AS9A 4JZEH 4FUJA 1KXEA 3U9AH 2GDDA 1HAHH 4XBDA 1MQ5A 2GD4B 5EQSA 5E0JA 2OK5A 3PV4A 3DHKH 1FLEE 4ZKRU 1KXFA 1VJAU 1Y3UA 3D62A 2VB0A 4TSFD 1SGIB 1UTOA 4RN6A 2BY7X 2XC5A 4SGBE 4A5TS 2WINI 1SLUB 3ZZ5A 2BDBA 1EAUA 1PYTD 2VVCA 4NCYA 4B2AA 1A7SA 2AGEX 4Q7XA 1SGFG 1WAYB 1ZYOA 1O2JA 2FI5E 2XYAA 3A80A 1ZOMA 4NFFA 2ZI2H 1GBIA 1GDQA 2KCPA 2ZGBH 3RXBA 4IC5A 1C5MD 5HMAA 3SI3H 3E90B 4ABBA 1F0RA 3QTOH 5AFZH 3SQEE 1BIOA 1RXPA 1UCYK 1V3XA 1YM0A 2IN2A 1P06A 3HKJB 3RU4E 1GJAB 2CF8H 1BRUP 1FY1A 1OWHA 1Z6JH 1TNGA 3UR6A 2VIDA 5HXFA 5JB9S 2YMSB 3MH7A 2EA3A 5HM9A 4CHAB 2BHGA 1C1PA 3TJVA 2PTCE 4CRFA 2FP7B 2ZDLA 1MABB 3JZ2B 1HLTH 2EEKA 4MQAA 1NU7B 2YNBA 1S5SA 5EJLA 2ZQ1A 3GY4A 2R3YA 5F8ZA 1GBJA 2OC8A 2ZFQH 2GCHG 1D4PB 1DM4B 1WCZA 1UTLM 1EX3A 2GT8A 3BTFE 2F4LA 3A81A 4GHTA 3S69A 3FO8D 3F0PA 4X2VA 2AGIX 3EA8A 1CHOG 5EIYA 1D3PB 2VJ1A 1TNHA 1YF4A 1J14A 2ZDKA 5EXMA 4A1XA 4I7YH 1SGFA 1O32A 3HK3B 4MNVA 2BD9A 1Y5UT 3VB5A 3OU0A 2O9QA 1BTPA 2OBQA 1ELVA 4F48B 2FEQH 3BF6H 2F91A 2KZ4A 4IC6A 3LIWA 2RFKC 5ESBA 3Q77A 1C1SA 3OFND 1C5VA 3FZZA 1MU8B 3GOVB 1B5GH 3A88A 1IAUA 2Z6BD 1FDPA 1TPPA 1BUIA 1NT1A 1V2VT 1Z8IB 2BD4A 1MTUA 2FESH 2W3KA 1O5DH 1DWCH 2JH0D 1A0LA 1O5GH 3DSOA 2J38A 1TALA 2QXGA 4Y76A 4BANB 2Y7XA 4FU8A 1K1PA 2VWOA 4E7NA 1V2PT 3E8LA 3CS7A 2XW9A 1SBWA 1Y8TA 3DA9B 2V3OH 2ZFPH 3QX5H 2XWBI 1WOFA 5LPRA 1KXCA 3AAVA 4D9QA 2UWLA 2GX4A 2ZHWH 8GCHG 1MU6B 3L33A 4JZDH 1EOJA 2ZC9H 5C1UA 1SGQE 3A85A 1NFYA 1YPHC 4LK4A 1DICA 1LQDB 2ZWLH 4R0IA 3GY5A 3SOSA 2P8OB 4X1SU 5L2YH 2ZQ2A 4MNYA 5LPEA 3NUMA 2PWXA 4CR5A 1GBKA 1SG8B 3ZVDA 4BTUB 1LO6A 4CBOA 1JIRA 1G3EA 5AFYH 2FYQA 2A7JA 3ZZBA 2ZU5A 2A5AA 3BTKE 3ZVCA 2P3TB 4HTCH 2VU8E 1SKYE 1LHGH 2KR7A 1YPLH 3FFGA 4TWYA 1T8OA 3SV8A 1QL9A 3SV2H 2NU2E 1O2GH 4CR9A 1HXEH 3BEIB 1AE5A 1L4DA 2FMJA 1IQEA 1O3MA 2RA0A 2ZCKP 5E2OA 3LOXA 1GMCG 5HYOA 2VWNA 3BTEE 1C1QA 2PW8H 3SQHE 4WXIA 1O2IA 7GCHG 2AMPA 1FPCH 1MCTA 2G5NA 5DP9A 1DUEA 1MAYA 4AX9H 4OS7A 1JRTA 1DWDH 1LKBA 3Q3XA 3F2HA 1BHXF 1PPHE 1GJ9B 3NXPA 4KTSA 1Z6EA 1HAXB 2V0BA 3KGPA 3MNXA 3V12A 3MNCA 2WYGA 5A0BA 2GJGA 1DT2A 2Q6DA 4Y8XA 1HUTH 3SV9A 1T8MA 3BTWE 2PV9B 3FKSD 2FTMA 2SGDE 2Y5FA 4A1TA 1ZTLA 5DGJA 4ZKOU 1CO7E 1NU9A 3Q3YA 5F8TA 1IQGA 1C5YB 8LPRA 1W2KH 2Y80A 1GI4A 2GKVE 3BEUA 1GI7B 1HPGA 1QRWA 1K1LA 1P2KA 1CBWC 4TT3D 3T26A 2JJ2D 4I33A 2WPHS 2FOMB 5HIYA 2PGQB 3W94A 5B6OA 5T6FA 1UHBA 2H9HA 3H09A 1AN1E 2AFQB 4KKDA 3KQBA 5E8EH 4RI0A 1TNLA 2BDCA 1TX6A 1TFXA 1ELGA 1TOCB 4FUEA 3SZNA 1TA2A 3ZZAA 2BZAA 3LU9B 4IN2A 2BY9X 4J2YB 2GMTB 2YMSC 2ZFFH 4YESB 3PV5A 4Q7YA 3M5NA 4B6EA 7KMEH 1ESAA 1GMCF 1A61H 1W8BH 3MU5A 3K2UA 4AFZA 1TABE 3GCHB 5EODA 3U8TH 4H6SB 4AFSA 2OLGA 5HGGA 2B7DH 1O2YA 4X1PU 4ABDA 3RLWH 3M35A 1AB9B 2FOFA 2Z7FE 4NG9H 1DE7H 1IQHA 2XC0A 3T28A 1L1NA 3GCTG 1UVTH 1GBMA 4ZHMU 3TU7H 1NM6A 4OGXA 1F92A 3SU2A 5FX5A 1H9LB 2G00A 1SGRE 1VITG 1TMTH 3SUDA 1OYTH 4GAWA 2ZTZA 1AFQC 2XNIA 3AW1A 1IQLA 1GI5A 1UHBB 1T8LA 2G51A 1MKXH 2AYWA 1H8DH 4JK5A 4B73A 1OWJA 2VIVA 1Y3VA 1XVOA 4AG2A 1PJPA 1UVSH 4NA9H 1F5LA 1YY3A 3M3VA 4BTTB 3KCGH 4UD9H 2AIPA 1F2SE 1UTNA 1TE0A 2UWPA 1VR1H 2BDYA 2XNDD 1K22H 2JIZD 5HKKD 1V2UT 5EU8A 2FS8A 3M5OA 1VKYA 3H7OA 5K0HA 3NCLA 4NGAH 2PR3A 3FP6E 1O2QA 1Z7KA 3HPTB 2GGVB 1AU8A 4UONA 4Y71A 1KMHB 5C1YA 3VEQB 2QXJA 3ZZ8A 2F83A 1SC8U 1ABIH 2XBYA 1J9CH 3UY9A 4U2WA 1LHFH 4H42U 5LGOA 1O3CA 1GJ5H 1VGCB 2J97A 4I8KA 1E37B 1OPHB 5EGMA 1E35B 1N6XA 4DT7B 1C4Y2 1K1MA 4U32A 4Y0YE 1A3BH 1FUJA 3GCTF 3SGBE 2Z94A 4XRNA 3KQ5A 8KME2 3RXCA 3QO6A 2BD2A 3KYFA 1O2LA 1KTSB 3ITIA 1VITF 2TBSA 1AHTH 5ESTE 1PFXC 1O3KA 1FXYA 1ZHPA 5JYIA 3P70B 3UREA 1TNJA 3UTUH 4FXGH 1E1QD 1PYTC 2WPJS 2XC4A 1YLDA 1IQIA 1H8ED 1PQ5A 1ZRBA 2ZU3A 2YOLA 5EXLA 2CXVA 2FODA 1NZQH 1LDTT 3RDZA 1O34A 2V3HH 4OM9A 1C5OH 3ZZ7A 5A8YA 1MCVA 1SHHB 1BBRE 1DX5M 1LQEA 2ZDNA 4I8HA 1BJVA 2H9TH 1O3AA 2G5VA 1TMBH 1GHWH 2J94A 1GGDC 3V3MA 1HAPH 2FYRA 3BTTE 2J5UA 3RXLA 3VB6A 5L2ZH 4Y8YA 2HNTF 4B2BA 3SU1A 4AYVB 2HWLB 3M36A 4VGCB 4AGKA 3BTGE 4LOYH 3FP7E 1NS3A 2ZP0H 2ZU4A 4CRAA 1QURH 1GBLA 4MPVA 2BLVA 1BOQA 4FUHA 3F68H 4GVUA 3UQVA 1EJAA 2IPHA 2R0LA 3OX7U 1ZPCA 4NZQA 1QQUA 1XUJA 1SGPE 5JB8S 2ZEBA 4NWKA 2CV3A 1O5CB 3RUOA 1QCPA 1GMDG 1H4WA 3ZZ6A 3TGJE 1F0TA 2H6MA 2BD8A 4NIVA 2ZGHA 1MBMA 1QJ6B 3A7TA 4Y11E 5AHGH 1BZXE 4ASHA 2R9PA 1E0FD 1LTOA 3OSYA 3MQKC 3KN2A 3LC3A 1VJ9U 3KQEA 3LGTA 2G4TA 4ZCNA 1W13U 2BY8X 2VIOA 4XBBA 1GVZA 1GJ4H 3F9HA 3T27A 4XDEA 2BX3A 4H4FA 1N8OB 1V2NT 3ZV8A 1DXWA 1QTFA 1XUKA 2A0QB 3AAUA 2W3IA 2OTVA 2R0KA 5GCHF 1IQMA 2Z3EA 1C1WH 1GL0E 2TPIZ 4CH2B 4DIIH 1HFDA 1G2LA 1GI0A 1AQ7A 3ZIAD 2OC0A 3ZVEA 4NFEA 1C1MA 1O3DA 1OHHD 4ABGA 3ZVFA 2ZFRH 2BVRH 3QK1A 1ARBA 1GCDA 5KECA 4Z6AH 1OWIA 1AB9C 3B9FH 1OSSA 3TJUA 2F9VA 1P2MA 1EAWA 1S84A 5C0TA 1G30B 4INLA 3TJOA 1OP2A 2VIPA 5A09A 1MKWH 1TBRH 1NBME 3RXPA 2VBCA 2WYJA 2Z9GA 2D2DA 3MU1A 1J15A 3FVFB 3UOPA 1HNEE 4DY7B 1C5TA 5TJXA 1WXRA 1AMHA 1P03A 2ZPRA 1GMDF 1AZ8A 4DG4A 1SQOA 1MTVA 4NSYA 1C1NA 1SQRA 2PGBB 3BTME 2A32A 1BRBE 2Z3DA 3GY3A 1WUNH 1BTUA 1ESBA 4XOJA 3EGKH 1CGHA 3QWCH 2GT7A 5LH8A 2SNWA 3SGQE 1TAWA 3S9AA 1OP0A 1AVGH 2HRVA 3V13A 2Z9KA 2BDGA 1AE8H 1ZMNA 1NRQH 1WBGB 1TX7A 5DJ7A 1BCUH 1RIWB 3CENA 2OQUA 3A8DA 1WV7H 4BAMB 1BJUA 1SGDE 1ESTA 2J2UA 5A2MH 2V3MA 2ZTXA 4Q80A 1BTWA 1QA7A 2FI4E 2RDLA 4HFPB 5GIBA 3I78A 3R0FA 4Y0ZE 1W14U 3WWFA 1Y3YA 2XRCA 2Y5HA 1DWBH 4JYTA 3UIRA 1VGCC 4YLUA 3ZVGA 2H1UA 3CNRA 4FUIA 4ACAA 3MOCA 1V6DA 4INKA 2ZHQH 1O31A 4FUGA 3EA7A 1DITH 1GG6C 1ZSLA 2VINA 4JZ1A 1YLNA 2KX4A 2EC9H 4Q2KA 4K8BA 1GMHG 1O3GA 3ODDA 5JBCS 1UVPA 1S82A 3MNBA 4K60A 1QR3E 4Z0KA 5F03A 4DURA 2WUCA 4O9VA 2AMQA 1BRAA 2PLXA 1X7AC 2J95A 3GDVA 5SGAE 3SHAH 1GI3A 1Y3WA 3LKWA 4MPUA 5C1XA 1PPZA 2GDEH 1LPKB 1IHTH 1WDIA 1TMUH 3Q76A 2ZFTA 3A8BA 4B2CA 4UEHH 1ELEE 4WH8A 2ANWA 5EXNA 3H7TA 1S85A 1NESE 2ZDAH 1O2TA 3MTYA 1QBOA 2VGCB 3KQDA 4FUBA 1KLTA 4ZAEA 1DSUA 1WQVH 4B76A 1XXDA 2XCFA 3A89A 5E2PA 1P02A 3DUXH 4U01A 3ZZ3A 1S6LA 1W11U 2HPQH 2CHAB 2HNTE 2QYIA 2PFEA 3NKKA 1N1LA 4YOGA 5B6LA 1MTNB 1TRYA 3LH3A 1CU1A 1D6WA 2Z9JA 1HJ9A 2VIQA 2AERH 4WH6A 1A3EH 1YCPK 6LPRA 4E05H 5F53A 2ZECA 1ZTKA 1V2WT 4XD7D 4ZXXH 5KEDA 1EKBB 1V2QT 2NU0E 5EPNA 3TITA 1DPOA 2C90B 4MPXA 1XM1A 1VCWA 3FAOA 2ZZUH 1LKAA 1C5QA 5FHTA 4ISOA 1HRTH 3URDA 1QRXA 2XBWA 6GCHG 1OOKB 3QUMP 1CGJE 1A0HB 1SGTA 2GTBA 1TBQH 5CHBA 1OP8A 1UVOA 1O36A 2H5CA 3P8FA 1IQNA 1HAZB 1XXFA 4LXBH 2SFAA 1EAIA 1EP5A 4FVBA 1J8AA 1P57B 4YLQH 4GLYA 3FANA 4FUDA 1CT4E 1C1TA 1KDQA 2V7QD 1A5IA 3NK8A 1P0SH 2VH6A 2HNTC 1UK2A 2KFWA 2QA9E 1SMFE 2VNTA 1JWTA 4MNWA 1YPHE 4D9RA 1GHBG 3UR9A 1K21H 3ZYEA 2OP9A 1BRCE 1CA0C 1AIXH 3SJOA 1O39A 1GJCB 1TYNA 2Z9IA 4NA8A 2LPRA 1E38B 2Y6TA 1KSNA 1A5HA 1AI8H 1ANCA 4AGJA 2EQNA 3URCA 2ALPA 2ZHFH 2J34A 4CRDA 1K1NA 2RDEA 1YGCH 3LGYA 3U98H 5FPSA 1XUHA 1ZHMA 3KF2A 5EPYA 2OXSA 1EPTC 2GZ9A 3M37A 2FPZA 1XUIA 2FWWA 1ZGIA 4DJZB 3Q00A 2CMYA 4TWWA 1UTKA 1AD8H 2WV5A 2WUBA 2Q6FA 1J16A 3PB1E 3N7DA 4UFDH 1AKSA 1K1JA 2A7HA 3F9GA 3RXKA 2FI3E 1CT2E 4RT0A 4E06H 4ZXYH 1GJ8B 1AGJA 5FAHA 2GCHF 1ANBA 2SGEE 3ODFA 1EB2A 1W7XH 3OAAD 2ZHDA 4ZKNU 3WY8A 4ZMAH 3M3TA 1KDQB 3O8RA 1TGCA 1CHOF 2FO9A 2HGTH 3OTJE 5ETXA 2EI8A 3BTQE 1BMLA 1ACBE 1H9IE 3F3BA 1RTKA 3T5FH 3G01A 3MH4A 3SN8A 1ZJDA 2FOEA 3DFJA 5GDSH 4FUFA 4WMFA 3T29A 1SLXB 6CHAC 1XKBC 1TBZH 2Y82A 4Y79A 1YCPH 1O37A 3SNDA 3K6YA 1GHBF 1K0HA 1IQJA 5DPAA 4Y7AA 2ULLA 1A46H 2ZTYA 3KEEA 4P00A 3UAIC 1RIWC 1WTGH 1CSOE 1GCTC 1C5WB 4IW4E 5J4QA 1TNKA 5FBIA 4NIWA 1V2OT 1MKXK 1AVXA 3PLPA 2WV9A 4FUCA 5EJZA 4M9FA 2F9NA 1P8VC 1AKSB 4YT6H 1MUEB 1P2IA 5A0AE 1ETTH 1C5NH 2SNVA 3FZDA 1F5KU 8GCHF 2ZDVH 1BBRK 2Z3CA 3MI4A 1DXPA 2BLWA 1O3JA 4X0WU 2KM0A 3ENSB 1V2KT 1SVPA 3GDSA 2W6ID 5AF9H 1ZJKA 1F0SA 2F9PA
chains in the Genus database with same CATH topology
1UTQA 4JCNA 4ZH8A 2OC1A 3RXDA 2FX6A 3SU3A 1JBUH 3N7OA 4E7RG 2ZPSA 5K7RA 2PHBA 1NRSH 1KLJH 2G4UA 1UCYE 3MWIU 2VGCC 1P04A 5G4BA 1LVMA 1P05A 3NZIA 1A0JA 2TRMA 1QQ4A 1YPGH 1Y59T 1FONA 2F9BH 5C5NA 5IYTA 1TPSA 1H9HE 2FOGA 1FY4A 1MZDA 1P09A 1Q3XA 1P01A 3HK6B 4CHAC 1D3TB 1HV7A 3SORA 7GCHF 3TH4H 1C2JA 1GBTA 2ZO3H 3AASA 4BAOB 3PTNA 4A6LA 2ASUB 2BY5X 2FZZA 1K28D 4ABJA 1WU1A 3LH1A 4DVAU 1THRH 4GCHG 1BB0B 2PSXA 2M5TA 2ALVA 3BV9B 1F7ZA 3EA9A 2STAE 2A4GA 1MZAA 2EI6A 4I32A 3BIUH 1LMWB 2VWMA 2ZU2A 3DT0H 1P9SA 5DP5A 1MQ6A 1QIXB 3EDXB 3M7UA 4LZ4B 1YKTA 2BD5A 3TVJB 1IQKA 1UTPA 3SNBA 4B1TA 3P92A 2VIWA 2H9EH 1QJ7B 2HLCA 2P95A 1KTTB 4NZLA 3T62A 1C2HA 3F9EA 1GDUA 1O5FH 3RXUA 2SGPE 3SJ9A 2JKHA 2XWAA 4DOQA 2O8UA 1XMNB 1DLKB 1EZUC 6ESTA 1DOJA 4K69A 1C1RA 1LPGB 2CF9H 4D76A 3VXFH 1FAXA 1FMGA 1TPOA 5LPFA 5DP4A 2F9UA 3ELAH 2VVUA 3VXEH 3H5CB 1O3PB 4ZHLU 2OUAA 5GJ4B 3A8CA 1Y5AT 3RLYH 2B5TB 2BQWB 3E6PH 1BBRH 4Q7ZA 3SJKA 3SUFA 3VFEA 3RU4D 1JXPA 4JZFH 3M61U 3PO1B 2GCTB 1XUGA 3LGWA 5HM2A 3V7TA 1CT0E 2Q1JA 3HGPA 2JETB 1TA6A 1YBWA 4K5ZA 4GCHF 1QB6A 3OY6U 3QZRA 3B8JA 2P3UB 1NPMA 5ABWA 1AFEH 1K2I1 1Q31A 3D65E 3Q3KA 2R3UA 3U1JB 3SV7A 3UWIA 1O0DH 3QN7A 2CGAA 2BY6X 1EQ9A 3KIDU 1GJ6A 4O03A 1WSSH 4NWLA 2P8OC 1P2OA 2BDHA 1LVOA 1C2EA 1FPHH 2PUXB 3A84A 5EG4A 4AFQA 3RC5A 3ATMA 2BQ7B 3F1SB 3PMJA 4I8GA 1F5RA 1TWXB 4YM9A 2XXLA 2C8ZB 4JYVH 1OKXA 1MKWK 2TGTA 4TY6A 2QF3A 4F49A 2NU3E 4OGYA 3D23A 4B75A 5CE1A 2H2ZA 1F0UA 1S81A 3TPIZ 2OC7A 3IWMA 1BTHH 1SFQB 1SQTA 3SNCA 2CN0H 1D6RA 1GHZA 1Y5BT 1M9UA 3GICB 2J9NA 4INHA 3HKIB 5GWZA 5DO4H 1QB9A 4MVNA 1RS0A 4MPWA 1PQ8A 4K3JA 3KHVA 2WPIS 5DP7A 1FN8A 1P9UA 3LGVA 1AVWA 4AYYB 1GJBB 4ISHH 1S83A 3RM0H 2VH0A 1ETSH 3C27B 4HGCA 4X2YA 1O2MA 1D3QB 1ID5H 2BVXH 1HAOH 2ANYA 4DCDA 1L1GA 4TPYA 2ZKSA 3SU5A 4K1EA 1GHXH 3UWJH 1C5SA 1QHRB 3PTBA 3PROA 2A2QH 4WJG2 3BN9A 4IBLH 1THPB 1G2MA 1UK4A 3RC4A 4ABFA 4BTIB 3UFAA 2R2MB 1RD3B 1Z1JA 2XCNA 2BXTH 4X1QU 2AIQA 4UDWH 1GBCA 1SOZA 2GP9B 1RTLA 1O2NA 3PMBB 1K9OE 4J1YA 3TNSA 1ZSKA 3EQ0H 1LPZB 2Q6GA 2GZ7A 1ZR0A 1GBDA 3B23B 3R3GB 3PWCA 3A7VA 1GPZA 1CA8B 2ODYB 5E0GA 3RMLH 1P11E 4ABHA 2GMTC 2TGAA 3NWUA 4FU9A 1ZPZA 1NRPH 3PMAB 1C2LA 4Y10E 1HAGE 1MAXA 2ZG0H 4K1SA 2BQ6B 1ZMJA 3V0XA 3GCHC 2IOTA 3RMMH 3UNRA 1O35A 1AY6H 4NIYA 1G9IE 5A8XA 2NU1E 4SGAE 2ZFSA 3RXAA 2XBVA 3K65B 3VGCB 1V2TT 1C2IA 4AN7A 1TLDA 1BTYA 3E16B 2ZGJA 3O8CA 1B0FA 2ZPQA 5TCCA 3ZV9A 3BIVH 1Z8RA 1O2PA 5EOKA 3SNEA 2QY0B 3O8BA 1G32B 2FXRA 1C1OA 3LPRA 3L6PA 3T25A 2BLOA 1O2UA 1FZZA 3EYDA 2FOAA 4KTUA 3TLOA 1ELAA 1EXFA 3QLPH 1BMAA 4ABAA 1HJAB 4DW2U 3F9FA 3M3SA 4DGJA 1EZQA 4X2XA 1O5BB 1RJXB 5BRRE 8ESTE 3VB3A 1RGQA 2QCYA 2AGGX 2B8OH 3ATWA 4MDSA 2ZGCA 4XE4A 1RTFB 2PSYA 1CQQA 3DD2H 3ZZCA 3S9BA 1GBAA 1HYLA 5CMXH 3RMOH 1C5RA 4UFGH 4THNH 3RXOA 2OD3B 4X8UH 4AORA 4BAKB 1GBBA 4K1TA 2BZ6H 1C5UA 1FV9A 3EE0B 2DE9A 2BVSH 5C2ZA 2ZA5A 1UK3A 1GHYH 2A4OA 3HATH 3TNTA 4WXVA 1OWEA 3A8AA 4JK6A 1CHGA 2P59A 2Y5GA 1AUJA 1BTXA 2VVVA 3RXQA 3PYHA 1YP9A 2RCEA 2BB4A 3GISB 1P2QA 1EATA 5I46H 1QRZA 3CS0A 5C67A 1O2OA 2NU4E 1DY8A 4O97A 1TRMA 1LHEH 1T32A 5FX6A 5EW1H 4X8SH 1BITA 2F9OA 2G81E 1NRNH 5T6GA 4CRGA 4ABIA 3SI4H 1NROH 1V2ST 2UUYA 3SJ8A 3SV6A 3FP8E 3O8DA 4F4OC 4Y8ZA 1TIOA 1GI9B 1TQ7B 2GV7A 3ZZ4A 1O33A 2P94A 1ELDE 2CJIA 3P17H 2QIQA 3MU0A 4BNRA 3TH2H 1QBNA 3P8NA 3STJA 4YOJA 2K1QA 3C1KA 1BMNH 3OY5U 3W95A 2OQ5A 2IJOB 3RP2A 4OS1A 1AZZA 1B7XB 1SGNE 1Y3XA 2FOHA 1NFUA 3SUGA 1CBWB 3VB7A 1CE5A 3AW0A 1B0EA 4VGCC 4ISIH 4ISLA 2GV6A 4O3TA 3M7TA 5EW2H 4AB8A 2C8WB 2VWLA 3A7WA 4PROA 3TIUA 3MO3A 5J4SA 1V2RT 1Z71A 1C2MA 1FAKH 1C2FA 3SBKA 1TRNA 3MH6A 1KYNA 1SGYE 1TB6H 3I29A 3MU4A 1SOTA 2ZCHP 1C2KA 3BG4B 4HI3A 3P6ZB 3MO9A 1ETRH 1AO5A 1QNJA 4KTCA 5JBAS 1HIAA 2H5DA 4X1RU 3UNQA 1W12U 5JBTA 1GMHF 3A86A 1C4U2 2ODQA 2C4FH 2I6QA 1DWEH 1TGTA 3ZYDA 4NIXA 5FBEA 2Y81A 1UMAH 1E36B 2PTNA 4ZKSU 2FX4A 2JH6D 1BQYA 1ORFA 1UTJA 2WPLS 3U8RH 2C8XB 1ZRKA 1VCQA 3RXIA 3QDZB 1N8OC 1A1RA 3TJNA 4LZ1H 5I25A 5DP3A 3LGIA 2A31A 2HALA 1W0YH 1U6QA 5BPEA 9LPRA 1K1OA 4K2YA 3BTDE 2C8YB 3PWBA 5H4IB 5F8XA 1GI8B 1O3IA 2BM2A 1BTZA 4WMDA 1AFQB 1EP6A 1C4V2 1C1UH 3JZ1B 4HZHA 2QF0A 1O3NA 1G37A 3QGJA 3E3TA 5JPMH 2FIRH 4AFUA 3TK5A 2A45B 3VGCC 1CVWH 1O3EA 3RM2H 1FIWA 2LNCA 5E0HA 1PPEE 2J92A 4B71A 3GY7A 4KGAA 4FVDA 1H1BA 1MMJN 2ILNA 2PUQH 1O2ZA 1P10A 1VCPA 1WQSA 3MFJA 1BMMH 1ARCA 3MU8A 1BT7A 1G36A 1GI6A 1W3CA 3GY6A 3PLKA 4JZIA 1HIAB 1SLVB 5FXLA 3QGNB 3F6UH 6GCHF 2A7CA 1AUTC 2O8WA 1INCA 2P3FH 1FY3A 1WYKA 1EJMA 2STBE 1DSTA 3GY8A 1HJAC 1BA8B 2HPPH 4JYUH 4D7GA 4GPGA 4D8NA 4ZHAA 4BAQB 1GWAA 1PPGE 5F6MA 3A82A 1QGFA 1WTHD 1V2JT 2OINA 3U8OH 2BXUH 1YYY1 2D26C 3E91A 1QB1A 1LVBA 1GBHA 2QAAA 1TPAE 2B0FA 1T8NA 4A7IB 1ZSJA 3RXSA 4ZUHA 2A4QA 3SU4A 3I77A 1PQAA 1NY22 4BOHA 3ZZDA 1EAXA 3S7HB 1SSXA 1ANEA 1DDJA 1L4ZA 1UCYH 3BEFB 1LHDH 4IN1A 1S0RA 1XUFA 2QGRA 4I31A 2JH5D 2NWNA 1NTPA 2RG3A 2A1DB 3S0NA 1JOUB 4YZUA 3IITA 1TGBA 1OS8A 4D7FA 2Y7ZA 1SI5H 2FLRH 1EOLA 1LCYA 1HCGA 1O2VA 4XFQA 3U69H 2BTCE 3GY2A 3SU6A 4A92A 2R2WU 1C2DA 2BDIA 1MTSA 1TNIA 2V6NA 4AG1A 4B74A 1GGDB 1P12E 2BYAX 3RXFA 2FOBA 3ATKA 4X1NU 1SPJA 2PKAA 3RMNH 2A5KA 2W7UA 1DY9A 1OX1A 2ZHEH 4X8VH 1L2EA 1HB0B 1O30A 1GHVH 4R8TB 2ODPA 3GCNA 1T7CA 3DFLA 2HVXA 1FN6A 3E1XB 1O2HA 3RXRA 1O2WA 4RKOB 3ZVBA 3S7KB 1FI8A 5T6DA 1HJ8A 3SGAE 1HAYB 3BSQA 3MHWU 4QT8C 5C3NA 3OYPA 4I8JA 1T31A 1ZGVA 2BMGB 3A7YA 1HAIH 2CHAC 1H8IH 4K8YA 3RXTA 5EQRA 1O2XA 1SLWB 5FPTA 1NN6A 4FU7A 4BXWA 2BOKA 4ABEA 4NSVA 1QJ1B 4X2WA 2WV4A 4AOQA 2F3CE 4MLFB 5DP6A 1MTNC 2FOCA 1RFNA 4KELA 4OS6A 1TGNA 2A2XH 1BDAA 2WPKS 4OS2A 2O8TA 4ESTE 1QA0A 1DLEA 4IMQA 5FPYA 4Y6DA 4GHQA 1MTWA 3GYMA 3LJOA 1D9IA 1BHXB 1UO6A 2D8WA 1GBFA 4X6NA 1DFPA 1SHYA 3BG4C 4YO9A 3PM3A 2EI7A 1A2CH 1O3BA 7LPRA 2FTLE 2BX4A 2PKAB 4ZROA 1SB1H 3SJIA 4IMZA 3TH3H 1ZLRA 1C5XB 1ABJH 1S6HA 1SGCA 2G8TA 2ZGXH 3K6ZA 1C9PA 1IHSH 1EASA 2A5IA 1G3BA 4NA7A 2ESTE 1GVKB 3LDXH 1A4WH 2FM2A 3MNSA 1ZTJA 1OWKA 1TGSZ 1HBTH 1O3LA 2TGPZ 2GZ8A 4ISNA 1NRRH 3MYWA 2SGAA 3RXJA 2TGDA 3KNXA 1C5ZB 2QC2A 3RC6A 4TPIZ 2PKSB 1VZQH 1L1JA 1ELTA 3GCOA 4CRCA 3SHCH 2ZDMA 2FDAA 1C1VH 1KXDA 1NC6A 2AMDA 2DE8A 1FY5A 4WWYA 3TK9A 5EQQA 1KIGH 3RXGA 4BAHB 2W7SA 2W26A 1ZHRA 4I8LA 3UQOA 4GUXA 5L30H 7ESTE 1J17T 1DUAA 3A7ZA 1YLCA 4M7GA 2RA3A 1XVMA 4O3UA 1YC0A 5CHAB 3UOUA 5JDUB 1SL3A 1EUFA 4TY7A 4TYDA 2J4IA 1CGIE 3S9CA 1SGEE 4YT7H 1L0ZA 4IS5A 5GPIB 1UVUH 3ZVAA 4IGDA 4CBNA 1YPKH 2OCVB 3HGNA 1W0ZU 1P3CA 3KQCA 2SGFE 1O3OA 4H6TA 4XBCA 9ESTA 2FS9A 1YPJH 1EZSC 1LHCH 1FQ3A 3QZQA 5IDKA 1FY8E 3M7QA 2XBXA 2UUJB 2WPMS 2ANKH 4UFFH 3CP7A 2XTTB 1C9TA 1P3EA 1IOEA 2O8MA 1GG6B 1GBEA 1THSH 1YPMH 3TGKE 1O2KA 2C3SA 3NPSA 5A0CA 1DVAH 4XSKU 3P8OA 3LGUA 4JMYA 3BG8A 3UNSA 1ZMLA 1MD8A 3KL6A 2YNAA 1P2JA 2THFB 2O8LA 3P8GA 1TOMH 4BXSA 1QY6A 3AVZA 1NFWA 2Z9LA 1XX9A 1KY9A 1ZZZA 3IG6B 4MG3A 2OBOA 2BD7A 5C5OA 1QL8A 1FIZA 1ELFA 1ZPBA 4X6OA 5GCHG 4AZ2B 2QN5T 5L6NH 2ZCLP 1KXBA 3RU4T 2G55A 3ZZ9A 1P2NA 5FCRA 2ANMH 2G52A 1ELBA 4X8TH 2SGQE 2D1JA 1N6YA 1W10U 1TQ0B 5AVDA 4RKJB 5A8ZA 1HDTH 1PPCE 4UE7H 5FCKA 4CRBA 1SR5C 2W5EA 4WVPE 3A87A 1V2LT 5GXPA 1DANH 1TONA 3PMHB 1EPTA 3E0PB 4U30A 3VPKA 1HXFH 1GHAG 2A4RA 5JBBS 1O5AB 1O38A 4YTAA 3K9XB 3ATLA 1AWHB 5PTPA 1V2MT 1YCPM 1Z1IA 4Y7BA 2GVFA 2UWOA 1O2SA 3UUZA 1O5EH 1PPFE 1Z8GA 1GDNA 1QL7A 5DP8A 3A83A 1OYQA 1O3FA 2B9LA 3ATIA 3ESTA 3GYLB 1LVYA 2C93B 5DG6A 3SU0A 4UFEH 2ZNKH 1C5LH 1KXAA 1HGTH 3LJJA 2UUKB 2V35A 3VB4A 5DKMA 1E34B 1CA0B 4WY3A 1AWFH 1DS2E 3SW2B 1OWDA 5TCAA 1NO9H 1C5PA 4X6MA 1GJDB 1MD7A 4A1VA 4DIHH 3RXMA 3BTHE 3TGIE 3MO6A 4MTBA 2BOHB 5T3HA 2QXHA 3LC5A 1Q2WA 2P93A 1EPTB 4RSPA 4WF8A 3SO3A 3M5LA 1MH0A 1PQ7A 4AB9A 4MNXA 1MBQA 1O3HA 1JIMA 1K1IA 2FLBH 1TX8A 2PKSC 1SFIA 1GHAF 1VITH 3A7XA 3TK6A 4CH8B 1D3DB 1XKAC 3L3TA 2HOBA 2KAIA 3MMGA 1ANDA 1UJ1A 2ZF0H 1G3DA 1GI1A 1HAVA 3SUEA 1NFXA 1FNIA 1QBVH 1ELCA 1EZXC 1EJNA 3D49H 4X6PA 3RXEA 5C20A 1KLIH 2BLQA 1FJSA 3EAJA 1UTMA