1L1MA

Solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity in protein-DNA recognition: lac repressor interacts with its natural operator 01 through alternative conformations of its DNA-binding domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator/dna
molecule keywords 5'-D(*GP*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*GP*GP*AP*TP*AP*AP*CP*
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1l1mA00
1ZZBA 4J1XA 1JFSA 3FMYA 4Z59A 4PU4C 3GN5B 1X2LA 1POUA 2R1JL 2LCVA 1E3OC 3F52A 1O4XA 1UXDA 1QP0A 1ZUGA 1LCCA 3F51A 2LYQA 2PUBA 2PUCA 3L1PA 1WETA 3EUSA 3O9XA 2IVBA 4Z5CA 3ZKCA 2HSGA 3FYAA 3FYMA 2JCGA 3PXPA 3QWGA 4GQMA 4PU7A 4PU3C 1RZRD 3D1NI 1ZZ7A 4MCTA 4F8DA 2XJ3A 3LISA 5A7LA 1RIOA 1QP4A 1NEQA 2KEIA 1EFAA 3OMTA 3KZ3A 2KZ8A 1X57A 1GT0C 1ADRA 3ZHIA 1QQAA 2IVGA 3SCHA 1RPEL 4I6RA 1S7EA 2XIUA 2IV1A 3OQNA 3QYXA 4X4EA 2XSDC 4X4GA 4Z5HA 2KEJA 2B5AA 2GRLA 1QPZA 1UTXA 1RZRA 1VPWA 1ZZ8A 2CSFA 2IU7A 3KJXA 4YG7B 2A6CA 3CECA 3HZIB 1PNRA 1OCTC 4O8BA 3DNVB 1RZSA 3U3WA 2L49A 2WIUB 1ZPQA 2GRMA 4NDWA 2OFYA 2GZUA 3BD1A 3F6WA 3QQ6A 1HF0A 3B7HA 3JXBC 1B0NA 4X4BA 3G5GA 2OR1L 3CLCA 1PRVA 2BNNA 3OP9A 3UFDA 2KPJA 3OQMA 3GN5A 4X4IA 4X4DA 4X4HA 2LYLA 3QF3A 3JXCL 2L8NA 4IVZA 2JVLA 1QP7A 1OSLA 1QQBA 4PU8A 1YSEA 1PERL 3CROL 3R1FA 4Z5DA 1L1MA 2O38A 1PRAA 3IVPA 4YG1A 2LYKA 1CQTA 3GBFA 1JWLA 4JQDA 1LCDA 3BDNA 2PUAA 2BNOA 1DW9A 2LYSA 1LQCA 1WH8A 3RZZA 2LYPA 1BDHA 2H8RA 3G7DA 2BNMA 3ZHMA 4X4FA 1ZAYA 4Z58A 3SCFA 1ZS4A 1SQ8A 4JCXA 4JCYA 2IVQA 3MLFA 2AXZA 2MQKA 3VK0A 2FJRA 2O4AA 4MCXA 2R63A 1R69A 1ZVVA 2EWTA 3BS3A 3LFPA 2PUGA 2AXVA 2IUOA 4IA8A 4OB4A 4Y42A 3TRBA 2D5VA 4IWRA 5K98B 2HINA 4FN3A 4YBAA 4FBIA 1LMB3 4X4CA 1LLIA 2KEKA 2LYJA 1WH6A 1CJGA 2PE5A 1Y7YA 1ZZCA 3KXAA 2AW6A 1JH9A 1NERA 2PPXA 4I6TA 2XI8A 1WIZA 2WUSR 4GHJA 3OQOA 2MEZA 1BDIA 2PUFA 2O49A 2BJCA 2AXUA 2PUDA 2LYRA 1R63A 2PIJA 3JXDL 2ICPA 4I6UA 2XCJA 4J1WA 2ICTA 2AUWA 2AWIA 1IC8A 1UXCA 1ZZ9A 3H5TA 3SCGA 4YARA 1DWKA 1PRUA 3S8QA 4I8TA 1XWRA 4YG4A 1ZZ6A 1JFTA 2EF8A 2EBYA 2CROA 1AU7A 1Y9QA 2PUEA
chains in the Genus database with same CATH superfamily
4J1XA 1JFSA 3FMYA 5GAGi 4Z59A 3R09A 4PU4C 3GN5B 1X2LA 1POUA 1NW3A 2LCVA 1E3OC 1O4XA 1UXDA 1LCCA 3F51A 5DTQA 1U2ZA 3L1PA 2J7WA 3EUSA 3O9XA 4Z5CA 4WVLA 4ER7A 4PU7A 3D1NI 2XJ3A 1QP4A 1EFAA 3OMTA 1ADRA 1S7EA 2XIUA 3NXHA 2KEJA 1QPZA 1ZZ8A 3KJXA 2IU7A 2A6CA 3CECA 3MEJA 2L49A 2WIUB 3JXBC 3G0TA 4X4IA 4X4DA 5DTRA 1QP7A 3TFLA 1PERL 3CROL 2O38A 4ER3A 2PUAA 2BNOA 1DW9A 3OWQA 1LQCA 3G7DA 1SQ8A 2IVQA 3MLFA 2FJRA 1ZVVA 2EWTA 4IA8A 4IWRA 3TRBA 5DTMA 5K98B 2HINA 3QOXA 4FN3A 3NZLA 4FBIA 1LLIA 2KEKA 1WH6A 3SR4A 1CJGA 1NERA 2PXUA 4GHJA 2ODRD 2MEZA 3TEPA 2PIJA 4ER5A 2ICPA 4EZIA 4I6UA 2FFHA 2ICTA 3SCGA 4YARA 3SX0A 1ZZ6A 3A9ZA 2R1JL 3F52A 1QP0A 2PUCA 1RZRD 3FYMA 4OBMA 4MCTA 4F8DA 3LISA 2PXKA 5A7LA 1RIOA 3KZ3A 2KZ8A 1X57A 2IVGA 2XSDC 4X4GA 4Z5HA 2B5AA 3HZIB 1OCTC 4O8BA 5DRTA 3LQXA 3U3WA 4NDWA 2OFYA 2GZUA 1B0NA 2OR1L 2BNNA 2LNMA 2LYLA 2VEOA 4EKGA 1YSEA 1L1MA 3GZDC 2LYKA 4YG1A 5GAHi 4X4FA 1ZAYA 3OKZA 4Z58A 2PXQA 4JCXA 3VK0A 2O4AA 2R63A 2PUGA 3LFPA 2AXVA 2HCSA 3KXAA 2AW6A 4I6TA 1BDIA 2BJCA 2AXUA 4DE8A 2LYRA 2M4HA 1R63A 3S8QA 2PUEA 1ZZBA 3UWPA 3M9LA 4HRAA 2PUBA 3FYAA 2JCGA 3PXPA 4GQMA 1ZZ7A 2KEIA 1GT0C 3ZHIA 2IV1A 3OQNA 3QYXA 1HQ1A 1VPWA 4YG7B 1PNRA 1RZSA 2GRMA 3F6WA 1HF0A 3B7HA 3PE5A 4X4BA 3CLCA 1PRVA 2LLVA 3UFDA 3OP9A 3OQMA 3GN5A 2PXTA 4IVZA 1QQBA 2PXPA 3NDBB 4Z5DA 1PRAA 1JWLA 4JQDA 3BDNA 1BDHA 2L1PA 3RZZA 2LYPA 3ZHMA 4EKIA 1ZS4A 5DSXA 4MCXA 2PXLA 4OB4A 4Y42A 4YBAA 3GZDA 2LYJA 2PXBA 1ZZCA 2PPXA 2XI8A 1WIZA 3OQOA 2PUFA 2O49A 3JXDL 4J1WA 2XCJA 2AUWA 1IC8A 1ZZ9A 3H5TA 1PRUA 4Q2JA 1AU7A 4ER6A 3A9YA 3VWSA 1ZUGA 2JQEA 2LYQA 3QOWA 1WETA 2LLWA 3ME5A 2IVBA 3ZKCA 2HSGA 3QWGA 4PU3C 2J7UA 4DE9A 1NEQA 4ER0A 1QQAA 3SCHA 1RPEL 4I6RA 4X4EA 2HCNA 4EQZA 2GRLA 1UTXA 1RZRA 2CSFA 4EK9A 3DNVB 1ZPQA 3BD1A 3QQ6A 5DRYA 1QZXA 3GZCA 3DM5A 3G5GA 2XXAA 2XXQA 2KPJA 2YBDA 3NROA 4X4HA 3QF3A 3JXCL 2L8NA 2JVLA 1OSLA 4PU8A 1DULA 3R1FA 3IVPA 1CQTA 3GBFA 1LCDA 5DT2A 2LYSA 1WH8A 2H8RA 3ZPXA 2BNMA 2MXDA 3SCFA 4JCYA 2AXZA 2MQKA 1R69A 2HFZA 3BS3A 2IUOA 3QFIA 2D5VA 3GUUA 3A9XA 2PXVA 1LMB3 4X4CA 2PE5A 1Y7YA 5JUWA 1JH9A 2WUSR 1MFQC 2PXEA 2PXDA 1QB2A 2PUDA 3TELA 2XXPA 2AWIA 1UXCA 3KL4A 1DWKA 4I8TA 1XWRA 4YG4A 1JFTA 2V3CC 2EF8A 2EBYA 2CROA 2PXFA 1Y9QA
chains in the Genus database with same CATH topology
1ZZBA 4J1XA 1JFSA 3FMYA 4Z59A 4PU4C 3GN5B 1X2LA 1POUA 2R1JL 2LCVA 1E3OC 3F52A 1O4XA 1UXDA 1QP0A 1ZUGA 1LCCA 3F51A 2LYQA 2PUBA 2PUCA 3L1PA 1WETA 3EUSA 3O9XA 2IVBA 4Z5CA 3ZKCA 2HSGA 3FYAA 3FYMA 2JCGA 3PXPA 3QWGA 4GQMA 4PU7A 4PU3C 1RZRD 3D1NI 1ZZ7A 4MCTA 4F8DA 2XJ3A 3LISA 5A7LA 1RIOA 1QP4A 1NEQA 2KEIA 1EFAA 3OMTA 3KZ3A 2KZ8A 1X57A 1GT0C 1ADRA 3ZHIA 1QQAA 2IVGA 3SCHA 1RPEL 4I6RA 1S7EA 2XIUA 2IV1A 3OQNA 3QYXA 4X4EA 2XSDC 4X4GA 4Z5HA 2KEJA 2B5AA 2GRLA 1QPZA 1UTXA 1RZRA 1VPWA 1ZZ8A 2CSFA 2IU7A 3KJXA 4YG7B 2A6CA 3CECA 3HZIB 1PNRA 1OCTC 4O8BA 3DNVB 1RZSA 3U3WA 2L49A 2WIUB 1ZPQA 2GRMA 4NDWA 2OFYA 2GZUA 3BD1A 3F6WA 3QQ6A 1HF0A 3B7HA 3JXBC 1B0NA 4X4BA 3G5GA 2OR1L 3CLCA 1PRVA 2BNNA 3OP9A 3UFDA 2KPJA 3OQMA 3GN5A 4X4IA 4X4DA 4X4HA 2LYLA 3QF3A 3JXCL 2L8NA 4IVZA 2JVLA 1QP7A 1OSLA 1QQBA 4PU8A 1YSEA 1PERL 3CROL 3R1FA 4Z5DA 1L1MA 2O38A 1PRAA 3IVPA 4YG1A 2LYKA 1CQTA 3GBFA 1JWLA 4JQDA 1LCDA 3BDNA 2PUAA 2BNOA 1DW9A 2LYSA 1LQCA 1WH8A 3RZZA 2LYPA 1BDHA 2H8RA 3G7DA 2BNMA 3ZHMA 4X4FA 1ZAYA 4Z58A 3SCFA 1ZS4A 1SQ8A 4JCXA 4JCYA 2IVQA 3MLFA 2AXZA 2MQKA 3VK0A 2FJRA 2O4AA 4MCXA 2R63A 1R69A 1ZVVA 2EWTA 3BS3A 3LFPA 2PUGA 2AXVA 2IUOA 4IA8A 4OB4A 4Y42A 3TRBA 2D5VA 4IWRA 5K98B 2HINA 4FN3A 4YBAA 4FBIA 1LMB3 4X4CA 1LLIA 2KEKA 2LYJA 1WH6A 1CJGA 2PE5A 1Y7YA 1ZZCA 3KXAA 2AW6A 1JH9A 1NERA 2PPXA 4I6TA 2XI8A 1WIZA 2WUSR 4GHJA 3OQOA 2MEZA 1BDIA 2PUFA 2O49A 2BJCA 2AXUA 2PUDA 2LYRA 1R63A 2PIJA 3JXDL 2ICPA 4I6UA 2XCJA 4J1WA 2ICTA 2AUWA 2AWIA 1IC8A 1UXCA 1ZZ9A 3H5TA 3SCGA 4YARA 1DWKA 1PRUA 3S8QA 4I8TA 1XWRA 4YG4A 1ZZ6A 1JFTA 2EF8A 2EBYA 2CROA 1AU7A 1Y9QA 2PUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZB A;  4J1X A;  1JFS A;  3FMY A;  4Z59 A;  4PU4 C;  3GN5 B;  1X2L A;  1POU A;  2R1J L;  2LCV A;  1E3O C;  3F52 A;  1O4X A;  1UXD A;  1QP0 A;  1ZUG A;  1LCC A;  3F51 A;  2LYQ A;  2PUB A;  2PUC A;  3L1P A;  1WET A;  3EUS A;  3O9X A;  2IVB A;  4Z5C A;  3ZKC A;  2HSG A;  3FYA A;  3FYM A;  2JCG A;  3PXP A;  3QWG A;  4GQM A;  4PU7 A;  4PU3 C;  1RZR D;  3D1N I;  1ZZ7 A;  4MCT A;  4F8D A;  2XJ3 A;  3LIS A;  5A7L A;  1RIO A;  1QP4 A;  1NEQ A;  2KEI A;  1EFA A;  3OMT A;  3KZ3 A;  2KZ8 A;  1X57 A;  1GT0 C;  1ADR A;  3ZHI A;  1QQA A;  2IVG A;  3SCH A;  1RPE L;  4I6R A;  1S7E A;  2XIU A;  2IV1 A;  3OQN A;  3QYX A;  4X4E A;  2XSD C;  4X4G A;  4Z5H A;  2KEJ A;  2B5A A;  2GRL A;  1QPZ A;  1UTX A;  1RZR A;  1VPW A;  1ZZ8 A;  2CSF A;  2IU7 A;  3KJX A;  4YG7 B;  2A6C A;  3CEC A;  3HZI B;  1PNR A;  1OCT C;  4O8B A;  3DNV B;  1RZS A;  3U3W A;  2L49 A;  2WIU B;  1ZPQ A;  2GRM A;  4NDW A;  2OFY A;  2GZU A;  3BD1 A;  3F6W A;  3QQ6 A;  1HF0 A;  3B7H A;  3JXB C;  1B0N A;  4X4B A;  3G5G A;  2OR1 L;  3CLC A;  1PRV A;  2BNN A;  3OP9 A;  3UFD A;  2KPJ A;  3OQM A;  3GN5 A;  4X4I A;  4X4D A;  4X4H A;  2LYL A;  3QF3 A;  3JXC L;  2L8N A;  4IVZ A;  2JVL A;  1QP7 A;  1OSL A;  1QQB A;  4PU8 A;  1YSE A;  1PER L;  3CRO L;  3R1F A;  4Z5D A;  1L1M A;  2O38 A;  1PRA A;  3IVP A;  4YG1 A;  2LYK A;  1CQT A;  3GBF A;  1JWL A;  4JQD A;  1LCD A;  3BDN A;  2PUA A;  2BNO A;  1DW9 A;  2LYS A;  1LQC A;  1WH8 A;  3RZZ A;  2LYP A;  1BDH A;  2H8R A;  3G7D A;  2BNM A;  3ZHM A;  4X4F A;  1ZAY A;  4Z58 A;  3SCF A;  1ZS4 A;  1SQ8 A;  4JCX A;  4JCY A;  2IVQ A;  3MLF A;  2AXZ A;  2MQK A;  3VK0 A;  2FJR A;  2O4A A;  4MCX A;  2R63 A;  1R69 A;  1ZVV A;  2EWT A;  3BS3 A;  3LFP A;  2PUG A;  2AXV A;  2IUO A;  4IA8 A;  4OB4 A;  4Y42 A;  3TRB A;  2D5V A;  4IWR A;  5K98 B;  2HIN A;  4FN3 A;  4YBA A;  4FBI A;  1LMB 3;  4X4C A;  1LLI A;  2KEK A;  2LYJ A;  1WH6 A;  1CJG A;  2PE5 A;  1Y7Y A;  1ZZC A;  3KXA A;  2AW6 A;  1JH9 A;  1NER A;  2PPX A;  4I6T A;  2XI8 A;  1WIZ A;  2WUS R;  4GHJ A;  3OQO A;  2MEZ A;  1BDI A;  2PUF A;  2O49 A;  2BJC A;  2AXU A;  2PUD A;  2LYR A;  1R63 A;  2PIJ A;  3JXD L;  2ICP A;  4I6U A;  2XCJ A;  4J1W A;  2ICT A;  2AUW A;  2AWI A;  1IC8 A;  1UXC A;  1ZZ9 A;  3H5T A;  3SCG A;  4YAR A;  1DWK A;  1PRU A;  3S8Q A;  4I8T A;  1XWR A;  4YG4 A;  1ZZ6 A;  1JFT A;  2EF8 A;  2EBY A;  2CRO A;  1AU7 A;  1Y9Q A;  2PUE A; 
#chains in the Genus database with same CATH topology
 4J1X A;  1JFS A;  3FMY A;  5GAG i;  4Z59 A;  3R09 A;  4PU4 C;  3GN5 B;  1X2L A;  1POU A;  1NW3 A;  2LCV A;  1E3O C;  1O4X A;  1UXD A;  1LCC A;  3F51 A;  5DTQ A;  1U2Z A;  3L1P A;  2J7W A;  3EUS A;  3O9X A;  4Z5C A;  4WVL A;  4ER7 A;  4PU7 A;  3D1N I;  2XJ3 A;  1QP4 A;  1EFA A;  3OMT A;  1ADR A;  1S7E A;  2XIU A;  3NXH A;  2KEJ A;  1QPZ A;  1ZZ8 A;  3KJX A;  2IU7 A;  2A6C A;  3CEC A;  3MEJ A;  2L49 A;  2WIU B;  3JXB C;  3G0T A;  4X4I A;  4X4D A;  5DTR A;  1QP7 A;  3TFL A;  1PER L;  3CRO L;  2O38 A;  4ER3 A;  2PUA A;  2BNO A;  1DW9 A;  3OWQ A;  1LQC A;  3G7D A;  1SQ8 A;  2IVQ A;  3MLF A;  2FJR A;  1ZVV A;  2EWT A;  4IA8 A;  4IWR A;  3TRB A;  5DTM A;  5K98 B;  2HIN A;  3QOX A;  4FN3 A;  3NZL A;  4FBI A;  1LLI A;  2KEK A;  1WH6 A;  3SR4 A;  1CJG A;  1NER A;  2PXU A;  4GHJ A;  2ODR D;  2MEZ A;  3TEP A;  2PIJ A;  4ER5 A;  2ICP A;  4EZI A;  4I6U A;  2FFH A;  2ICT A;  3SCG A;  4YAR A;  3SX0 A;  1ZZ6 A;  3A9Z A;  2R1J L;  3F52 A;  1QP0 A;  2PUC A;  1RZR D;  3FYM A;  4OBM A;  4MCT A;  4F8D A;  3LIS A;  2PXK A;  5A7L A;  1RIO A;  3KZ3 A;  2KZ8 A;  1X57 A;  2IVG A;  2XSD C;  4X4G A;  4Z5H A;  2B5A A;  3HZI B;  1OCT C;  4O8B A;  5DRT A;  3LQX A;  3U3W A;  4NDW A;  2OFY A;  2GZU A;  1B0N A;  2OR1 L;  2BNN A;  2LNM A;  2LYL A;  2VEO A;  4EKG A;  1YSE A;  1L1M A;  3GZD C;  2LYK A;  4YG1 A;  5GAH i;  4X4F A;  1ZAY A;  3OKZ A;  4Z58 A;  2PXQ A;  4JCX A;  3VK0 A;  2O4A A;  2R63 A;  2PUG A;  3LFP A;  2AXV A;  2HCS A;  3KXA A;  2AW6 A;  4I6T A;  1BDI A;  2BJC A;  2AXU A;  4DE8 A;  2LYR A;  2M4H A;  1R63 A;  3S8Q A;  2PUE A;  1ZZB A;  3UWP A;  3M9L A;  4HRA A;  2PUB A;  3FYA A;  2JCG A;  3PXP A;  4GQM A;  1ZZ7 A;  2KEI A;  1GT0 C;  3ZHI A;  2IV1 A;  3OQN A;  3QYX A;  1HQ1 A;  1VPW A;  4YG7 B;  1PNR A;  1RZS A;  2GRM A;  3F6W A;  1HF0 A;  3B7H A;  3PE5 A;  4X4B A;  3CLC A;  1PRV A;  2LLV A;  3UFD A;  3OP9 A;  3OQM A;  3GN5 A;  2PXT A;  4IVZ A;  1QQB A;  2PXP A;  3NDB B;  4Z5D A;  1PRA A;  1JWL A;  4JQD A;  3BDN A;  1BDH A;  2L1P A;  3RZZ A;  2LYP A;  3ZHM A;  4EKI A;  1ZS4 A;  5DSX A;  4MCX A;  2PXL A;  4OB4 A;  4Y42 A;  4YBA A;  3GZD A;  2LYJ A;  2PXB A;  1ZZC A;  2PPX A;  2XI8 A;  1WIZ A;  3OQO A;  2PUF A;  2O49 A;  3JXD L;  4J1W A;  2XCJ A;  2AUW A;  1IC8 A;  1ZZ9 A;  3H5T A;  1PRU A;  4Q2J A;  1AU7 A;  4ER6 A;  3A9Y A;  3VWS A;  1ZUG A;  2JQE A;  2LYQ A;  3QOW A;  1WET A;  2LLW A;  3ME5 A;  2IVB A;  3ZKC A;  2HSG A;  3QWG A;  4PU3 C;  2J7U A;  4DE9 A;  1NEQ A;  4ER0 A;  1QQA A;  3SCH A;  1RPE L;  4I6R A;  4X4E A;  2HCN A;  4EQZ A;  2GRL A;  1UTX A;  1RZR A;  2CSF A;  4EK9 A;  3DNV B;  1ZPQ A;  3BD1 A;  3QQ6 A;  5DRY A;  1QZX A;  3GZC A;  3DM5 A;  3G5G A;  2XXA A;  2XXQ A;  2KPJ A;  2YBD A;  3NRO A;  4X4H A;  3QF3 A;  3JXC L;  2L8N A;  2JVL A;  1OSL A;  4PU8 A;  1DUL A;  3R1F A;  3IVP A;  1CQT A;  3GBF A;  1LCD A;  5DT2 A;  2LYS A;  1WH8 A;  2H8R A;  3ZPX A;  2BNM A;  2MXD A;  3SCF A;  4JCY A;  2AXZ A;  2MQK A;  1R69 A;  2HFZ A;  3BS3 A;  2IUO A;  3QFI A;  2D5V A;  3GUU A;  3A9X A;  2PXV A;  1LMB 3;  4X4C A;  2PE5 A;  1Y7Y A;  5JUW A;  1JH9 A;  2WUS R;  1MFQ C;  2PXE A;  2PXD A;  1QB2 A;  2PUD A;  3TEL A;  2XXP A;  2AWI A;  1UXC A;  3KL4 A;  1DWK A;  4I8T A;  1XWR A;  4YG4 A;  1JFT A;  2V3C C;  2EF8 A;  2EBY A;  2CRO A;  2PXF A;  1Y9Q A; 
#chains in the Genus database with same CATH homology
 1ZZB A;  4J1X A;  1JFS A;  3FMY A;  4Z59 A;  4PU4 C;  3GN5 B;  1X2L A;  1POU A;  2R1J L;  2LCV A;  1E3O C;  3F52 A;  1O4X A;  1UXD A;  1QP0 A;  1ZUG A;  1LCC A;  3F51 A;  2LYQ A;  2PUB A;  2PUC A;  3L1P A;  1WET A;  3EUS A;  3O9X A;  2IVB A;  4Z5C A;  3ZKC A;  2HSG A;  3FYA A;  3FYM A;  2JCG A;  3PXP A;  3QWG A;  4GQM A;  4PU7 A;  4PU3 C;  1RZR D;  3D1N I;  1ZZ7 A;  4MCT A;  4F8D A;  2XJ3 A;  3LIS A;  5A7L A;  1RIO A;  1QP4 A;  1NEQ A;  2KEI A;  1EFA A;  3OMT A;  3KZ3 A;  2KZ8 A;  1X57 A;  1GT0 C;  1ADR A;  3ZHI A;  1QQA A;  2IVG A;  3SCH A;  1RPE L;  4I6R A;  1S7E A;  2XIU A;  2IV1 A;  3OQN A;  3QYX A;  4X4E A;  2XSD C;  4X4G A;  4Z5H A;  2KEJ A;  2B5A A;  2GRL A;  1QPZ A;  1UTX A;  1RZR A;  1VPW A;  1ZZ8 A;  2CSF A;  2IU7 A;  3KJX A;  4YG7 B;  2A6C A;  3CEC A;  3HZI B;  1PNR A;  1OCT C;  4O8B A;  3DNV B;  1RZS A;  3U3W A;  2L49 A;  2WIU B;  1ZPQ A;  2GRM A;  4NDW A;  2OFY A;  2GZU A;  3BD1 A;  3F6W A;  3QQ6 A;  1HF0 A;  3B7H A;  3JXB C;  1B0N A;  4X4B A;  3G5G A;  2OR1 L;  3CLC A;  1PRV A;  2BNN A;  3OP9 A;  3UFD A;  2KPJ A;  3OQM A;  3GN5 A;  4X4I A;  4X4D A;  4X4H A;  2LYL A;  3QF3 A;  3JXC L;  2L8N A;  4IVZ A;  2JVL A;  1QP7 A;  1OSL A;  1QQB A;  4PU8 A;  1YSE A;  1PER L;  3CRO L;  3R1F A;  4Z5D A;  1L1M A;  2O38 A;  1PRA A;  3IVP A;  4YG1 A;  2LYK A;  1CQT A;  3GBF A;  1JWL A;  4JQD A;  1LCD A;  3BDN A;  2PUA A;  2BNO A;  1DW9 A;  2LYS A;  1LQC A;  1WH8 A;  3RZZ A;  2LYP A;  1BDH A;  2H8R A;  3G7D A;  2BNM A;  3ZHM A;  4X4F A;  1ZAY A;  4Z58 A;  3SCF A;  1ZS4 A;  1SQ8 A;  4JCX A;  4JCY A;  2IVQ A;  3MLF A;  2AXZ A;  2MQK A;  3VK0 A;  2FJR A;  2O4A A;  4MCX A;  2R63 A;  1R69 A;  1ZVV A;  2EWT A;  3BS3 A;  3LFP A;  2PUG A;  2AXV A;  2IUO A;  4IA8 A;  4OB4 A;  4Y42 A;  3TRB A;  2D5V A;  4IWR A;  5K98 B;  2HIN A;  4FN3 A;  4YBA A;  4FBI A;  1LMB 3;  4X4C A;  1LLI A;  2KEK A;  2LYJ A;  1WH6 A;  1CJG A;  2PE5 A;  1Y7Y A;  1ZZC A;  3KXA A;  2AW6 A;  1JH9 A;  1NER A;  2PPX A;  4I6T A;  2XI8 A;  1WIZ A;  2WUS R;  4GHJ A;  3OQO A;  2MEZ A;  1BDI A;  2PUF A;  2O49 A;  2BJC A;  2AXU A;  2PUD A;  2LYR A;  1R63 A;  2PIJ A;  3JXD L;  2ICP A;  4I6U A;  2XCJ A;  4J1W A;  2ICT A;  2AUW A;  2AWI A;  1IC8 A;  1UXC A;  1ZZ9 A;  3H5T A;  3SCG A;  4YAR A;  1DWK A;  1PRU A;  3S8Q A;  4I8T A;  1XWR A;  4YG4 A;  1ZZ6 A;  1JFT A;  2EF8 A;  2EBY A;  2CRO A;  1AU7 A;  1Y9Q A;  2PUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...