1L2NA

Smt3 solution structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Solution structure of a yeast ubiquitin-like protein Smt3: the role of structurally less defined sequences in protein-protein recognitions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 8
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l2nA00
1C3TA 1E8ZA 2M8SA 4J6IA 3VTUA 1EO6A 1P3QU 3L10B 3ZNHB 2IO3B 2KDIA 3ENEA 1E5WA 4ICUA 4ICVA 1XQQA 1WR1A 2K6DB 4ZRKA 3VAWA 3KUZA 2ZEQA 4K81A 4JQWC 1TTNA 2NS5A 2ZJDA 2KTRA 1WMHA 2KKCA 2ASQA 2BYEA 1VD2A 3A9KA 2KC2A 3PSEB 4WWPA 3EFUA 3C0RB 1OEYA 4FJYA 1UBIA 3WAPA 2K8HA 1GJZA 3DDCB 4IWQA 3VVWB 2MQJA 2WX1A 2G4DB 1UBQA 4GGQA 2CU1A 2DX5B 3QC8B 1WI0A 2CHZA 4KDLB 3ECIA 5DPTA 1I42A 2B3AA 2L0FA 5G2NA 2IY1B 5CHWA 2IYDB 2D3GA 3RCZA 2J0MA 2LXCA 5JH5C 1WE6A 4NQLB 1WH3A 4K7SA 2ZZPB 2Z0EB 3X0WA 3M62B 1WIAA 2DAJA 4ZRIA 4W9LA 3ONSA 4URKA 3APDA 3UGBB 2C7NB 3K9OB 4GB9A 4XX5A 2JWZA 2WDTB 2FNJB 2LI5A 3ZNID 3JSVB 3DBHI 4IM3A 2Y5BB 5TR5A 1P98A 3PPAA 3U8ZA 4KIKB 2Z59B 4G0NB 3UIPB 5J18A 1V9JA 1G6JA 1NBFC 2MBBB 4MELA 4HDQA 3HIZA 2MCNB 5LXIB 3I3TB 2JPHA 4FHKA 3DVNU 4KZ0A 1S3SG 5D2MB 1WJNA 1OEYJ 3HHMA 1GC6A 2JUOA 2FCNA 4GMVA 4IWPA 4ANXA 3QK0A 3RULA 4BBNF 4K1RB 4F7ZA 4AUQC 5G55A 4FBJB 3RUIB 1WE7A 3EECA 4EFOA 1UELA 2LVOA 4E3CA 2LZ6A 4NJ6A 1X1MA 4ANVA 4OVUA 2XBBC 3LJ3A 1RAXA 3QA8A 1CMXB 3H9DA 2L7RA 3U7DA 2KTRB 1BT0A 2J0JA 1WMHB 2KN5A 2EKEC 3B08A 1Z2MA 1WGDA 3CSTA 4AWJA 4EZLA 4W9KA 3A9KB 3QIJA 4KDIC 3W1SC 2MP2A 3ZVVA 2J0KA 3PVLA 2LJ5A 2KDEB 4IM0A 1MG8A 2UWQA 3NHEB 4FA6A 3APFA 1TZ1A 3PLVA 2PPHA 3A4RA 4F1SA 2DHZA 1KM7A 2N9PC 3H7PB 4HWIB 1JRUA 1WZ0A 2REXA 2WYQA 5DPWA 1L2NA 1UZXB 4W9GA 3APCA 1WGRA 4EOYA 2K1FA 4LJOB 1UGMA 2MWSB 4JGHB 2DZIA 5AZHA 1WR6E 2CS4A 5LXHA 1SE9A 2HJ8A 1AARA 3DVNV 3DVGX 3GZNI 3W1SA 3KW5B 5FR6A 3V62A 2FCSA 2UYZB 3TCAA 4CO7A 2JRHA 2L3ZA 3DBRI 2NPTB 3T9LA 4ZYNA 4MGYE 3EC8A 1ZGUB 3V6EB 1E8XA 3PLUA 2ZVNA 1UD7A 2KLGA 3QAQA 1Q0WB 1YD8U 2BYFA 4IM2A 2N9XA 3O65B 1WGGA 1M94A 1OGWA 4FADA 1XD3B 5JHAA 4A3PA 4XC2A 2L05A 2MLBA 2DZJA 4LJPB 2IBIB 2NBWB 3PHXB 1Q5WB 4HVBA 3ZUNA 4KZCA 2M1MA 4M0WB 3RYTA 2BWES 3BINA 2AL3A 2M4NA 1Z5SB 3IFWB 1L7YA 1H4RA 2MBOA 3AULA 4M8MA 3VQIA 1Q1OA 2DZKA 3JVZX 1V80A 2GBKA 4N9F4 4WWOA 4DDID 1LXDA 1WXVA 2GOWA 2KFJA 3WAOA 4TQ0A 5EDSA 3OJ4B 2DAFA 3RD2A 2C7MB 4II3B 1IYFA 1E90A 1WZ3A 2KK8A 4GDLB 2OJRA 4WJQA 4GDKA 2BKRB 3WIMA 3R7RA 2WWZA 3L08A 2FIDA 2O2VB 2KJ6A 4W9CA 2GBNA 3Q3FA 4BOSC 4MJSA 1P1AA 2XEWA 3AI5A 4PYZA 4NAWB 3R66C 4P7IA 4WQOB 2MBHA 2L0TA 2KMCA 2LD9A 1LQBA 2LXAA 4IWOA 3KYDD 2KHWB 1YX6B 4RM9A 2IO2B 2EMSA 3GOEA 5IAAC 4DXAB 1SIFA 1E8WA 4BVUC 3VH3B 3R7QA 4HDOA 3QWZB 3NS8A 1FXTB 3PRPB 3AU4A 3RZWC 4EKUA 3A9JA 3QHTA 3ZDTA 3IG3A 2NBVB 3UINB 1YIWA 2OOBB 3R3MA 4W9JA 1EUVB 3JYUA 3VH4B 3A1QA 2M17A 2N1VA 2I1JA 2V3SA 2MA9B 1OTRB 4KSLC 4WJNA 3TBLD 3ZTDA 4DBGA 4BBNC 2M0XA 2K8BA 5CHFA 2AWTA 1R4NI 4NPNA 1ISNA 2BWFA 2ZNVC 2NVUI 5E6PA 2FIFA 3NOBA 4ZRJA 2KJRA 3QJZA 4BOZB 3H6NA 3DVGY 2ZCCA 1EF1A 4FLHA 4EZKA 3KVFB 2NR2A 2KQ7A 1ZW7A 1V5TA 1WXAA 1WFYA 1WY8A 2MRPA 4YL8A 3V6CB 3RT3B 1D3ZA 4PS3A 4JLCA 5KHOA 3VHTC 1WYWB 1TBEA 4MGZE 5AZGA 2JVCA 3OAWA 4JIOU 3DPDA 4LCDE 4IC7B 3P2BA 1GNUA 2LVQA 3HK0A 3H1UA 3KUDB 4F8CB 5GMVA 1RLFA 2MBQA 1HE8A 3T8MA 4EUTA 3ZLZA 3DCGA 3OJ3A 4FJZA 3ZNGC 4A3OA 4MJSB 4DHZB 4GSWA 3WAMA 2D07B 2KANA 3M95A 4ZDVA 2GBMA 3LDZE 3PT2B 3PS6A 4HCPB 4I6PA 3WANA 3ZDMC 5IA7A 1GUAB 1WJ4A 2ZPYA 3KUCB 2JXXA 1WGHA 3ZKJC 2I1KA 2KNBA 3V61A 3UQBA 5J17A 4DDGD 1XT9B 2KWCA 4E74A 1J19A 2KDBA 1I35A 2EMTA 4TQ1A 2YLMA 4DHJD 4TUUA 2WX0A 1SGHA 4BKGA 4PYUA 2LGDA 3VDZA 2JF5A 2YVCA 4K7UA 2L76A 4W9FA 3WA0A 4W9EA 3A9JB 1E7UA 1EF5A 1YQBA 2K39A 2C5LC 2BPSA 5E6NA 4KSKC 1YJ1A 5CHVC 2O6VA 1PQSA 2DYMA 2LVPA 2MSED 3A1QB 5BO4B 2RGFA 4I6NB 3CF6E 2D2QA 4JL9A 5CX3A 2HTHA 3PHWB 4LDTD 3ZRFA 3KH0A 3M63B 2JY6A 2CHWA 4DHJB 2A5UA 2LRUA 4IG7B 3X23A 3TJPA 1WXSA 3QARA 5DPRA 3N32A 3SD5A 2KWUB 3UIOB 3L16A 4M8NA 4W9IA 2LGXA 3ZTCA 4EEWA 2AL6A 3HM3A 3DBSA 4IW0A 1RFAA 2DYBA 3M3JA 5C23A 3DBLI 1WJ6A 1WX8A 4CYEA 4MGIE 3PTFC 1GC7A 2IO0B 1WF9A 2MBEA 4I6LB 3TL5A 1KJTA 1V6EA 2KWVB 3KYCD 3NZSA 4G11A 3EHVA 3CMMB 3U30A 3VTWA 4BKSA 4HK2A 1KOTA 1P0RA 2IY0B 2D11A 2L00B 4GU2A 1E8YA 5KHQA 4II2B 4WAAA 3QX1A 4MSMB 5D94A 2N7EA 2RPQA 2IZVB 3L17A 4DHZE 2KC1A 2KQSA 3VFKA 3N3KB 3Q3JA 2LUEA 2KDFB 2R2QA 1RRBA 2MP2B 3QQ8B 2L8JA 2RD0A 3A4SC 2KTFA 2VRRB 1OQYA 2G45B 4BKTA 3IHPC 3JW0X 2O6VD 3SHQA 2FCQA 4B95A 2PEAA 4NQKE 3ZO5B 1GG3A 5JHBA 2RSUA 5D6JB 3ZNZB 2KFKA 2CR5A 2ZVOA 4GXBA 4RMAA 4AJYB 2DYOA 4ANUA 3MTNB 3VXWA 2AEHA 1V49A 4B6WA 3VUXA 5L83A 2JZ3B 1WJUA 1WXMA 3PRMB 2V1YA 4TV3A 2GBRA 5DPSA 2KD0A 2BYVE 3CSFA 3H7PA 1LM8B 2O6VB 1NI2A 3DQVA 1KLVA 3PV1A 4B9KA 2BF8B 3N30A 4W9HA 1WX9A 4GIVA 2N1WA 4CHKA 2MX2A 1A5RA 4ANWA 1IP9A 2GMIC 2KX0A 2RR9A 2A4ZA 1V5OA 1WM3A 2DZMA 2JT4B 4HLEA 2FUHB 4BKSD 3ZW3A 1UH6A 2LGYA 5D7GA 2KO3A 2K6QA 3B0AA 2XK5A 3AXCA 2KMAA 3MJWA 4FN2A 1VCBA 2KJHB 4XZ4A 1WM2A 4G50A 4NJ7A 2NPTA 3UQAA 1WGYA 1P9DU 2DENB 2GBJA 3IVFA 4GN1A 4MSQB 3PRZA 1U4AA 1C1YB 3SU8X 3A33B 2N7DA 1ZKHA 3ML9A 4FULA 4IUMB 5AZFA 2Z0DB 2KZRA 5CTRC 2C9WB 3L0WB 1F9JA 5J2RA 2C60A 2KVRA 4KV2A 4MH0E 5AEKB 2G3QB 3ZRCA 4ASWC 4WJPA 1WX7A 2KOXA 3IBEA 2MW5A 4WJOA 1R4MI 2NCNA 4K7WA 4GDKB 4EZJA 2K8CA 2PE6B 4X57B 2IO1B 3OLMD 4E71A 2QHOA 3ML8A 4MM3A 2HE7A 3H7SA 1NDDA 3DOWA 3VUYA 1K8RB 4PS8A 5C1ZA 2BGFA 4FHJA 4HPMB 3TMPB 4GDLA 1LFDA 1E7VA 3V60A 4OVVA 5DCNA 5L95C 3W1YA 2LASA 2O2VA 3S2AA 1H8CA 4MEMA 4MGKE 2KXJA 3QCAA 3WALA 4AOFA 3AU5A 1V81A 4BFRA 3VTVA 2KFKB 1T0YA 2JZZA 2N9EB 1IPGA 2PJHA 4NAWA 4RM8A 5JZEB 1Y8RC 4DK5A 1V86A 3RZFA 2J7QB 3L13A 1J0GA 2FCMA 2FAZA 2W9NA 2K25A 4TKNA 2JRIB 5E6OA 2G4SA 2NBUA 3L54A 4G3XB 1TGZB 4NY0A 4NNJB 3VUWA 2LWPA 4FJVB 3PREA 1J8CA 4HJKA 2D10A 3PGEA 3SDLC 1WRDB 4HXDA 4KVGB 3BY4B 2KX3A 3MHSD 1V2YA 4HCNB 3JSVA 3ZIMA 2XK5B 3NZUA 2PE9A 2HD5B 2C7HA 4KIKA 4AJWA 3B1LX 1YX5B 4WWNA 5HKHA 3TIXA 2CHXA 4A20A 3HM6X 4MDKE 4LDTB 3NY5A 3UF8A 4AP4C 4PS7A 1S1QB 3ALBA 4DWFA 2BKFA 2R2OA 4HPLB 2CKHB 3K9PB 5LLIA 1QZEA 2V4LA 2N4FA 2AYOB 2ZPNA 2ZNVB 2KLCA 3D32A 2ZCBA 2LRWA 3PZDA 4GOCA 4W9DA
chains in the Genus database with same CATH superfamily
1QT9A 4RGOS 2IO3B 4ICVA 4M01A 2K6DB 3J9CA 2I2YA 4HJGE 3CIRB 3KUZA 1TTNA 2ZJDA 4C7ZA 2KKCA 1FNUA 1LGRA 2ASQA 1LO5D 1VD2A 3PSEB 1UNSA 4BZAA 1OEYA 1UBIA 3DDCB 4GGQA 2CHZA 5G2NA 1WE6A 2BW2A 4YTPB 1T3QA 2NTTA 2Z0EB 3M62B 1K52A 1WIAA 3UGBB 1VJKA 3IT6B 4XYCA 2HDEA 2Y5BB 2WXMA 1JW9D 4KIKB 2BB5A 4NJCA 2J42A 3BVGA 2GRIA 3ZYYX 3PO0A 4XGAB 4HDQA 1TKEA 1KLUD 3DHIC 1IBXA 1UGJA 1SB3C 2E3TA 2FCNA 1J7CA 3QK0A 4ANXA 3RULA 4BBNF 4F7ZA 4AUQC 5G55A 3RUIB 4EFOA 2I38A 2LZ6A 4NJ6A 3MC0B 2XBBC 1FXAA 3TSSA 1CMXB 3H9DA 2LJIA 1BT0A 3CSTA 4AWJA 1L0VB 1Z2MA 4W9KA 2N9LA 3W1SC 3ZJUA 4MH8A 1UUPA 2LHEA 3B9JA 3BYTB 1TZ1A 5HHDG 3A4RA 2DHZA 5IN7A 1L6UA 2N9PC 2REXA 4YTMB 1N5WA 3APCA 1MG4A 2MWSB 2DZIA 5AZHA 2CS4A 5LXHA 2J52A 3DVGX 3KW5B 2FCSA 2UYZB 4HKZE 5FR3A 4LNNA 2NPTB 4ZYNA 3EC8A 5C2TB 3V6EB 2L1AA 2ZVNA 5BYSA 1UD7A 2KLGA 1YD8U 4IM2A 1JALA 2BYFA 3L4PA 2JU6X 2JWUA 2NBWB 1Q5WB 4S0RA 5E6JA 4KZCA 1IBXB 2BWES 2M4NA 1D5MC 1Q1OA 2DZKA 4B0EA 4WWOA 2GOWA 2GLSA 3RD2A 2C7MB 1IYFA 4GDLB 1I4RA 4WJQA 2HJ1A 4K3CA 1Q10A 4WWMA 2KJ6A 3ZQ4A 1E9MA 3N1ZC 2G1EA 2INCC 3AI5A 4OZCA 4PYZA 2MBHA 3AE2B 2PIAA 1LQBA 4ZYSA 2KHWB 4YTNB 1YX6B 3E9SA 1SIFA 3BIID 4BVUC 4HDOA 2CJNA 3PRPB 2NTSA 3A9JA 3I9V1 3ZDTA 3IG3A 3UINB 4RH6A 3R3MA 1EUVB 3R8BA 3NS1A 2N1VA 2V3SA 3RPFC 4KSLC 3TBLD 4DBGA 3AE7B 4BBNC 1JWUD 1ISNA 3Q8CA 3NOBA 1MPEA 1Y56A 1MHXA 2KJRA 2OEDA 3QJZA 1AN8A 5H92C 1JRPA 4OHJA 4JLCA 5KHOA 3AE4B 2JVCA 3RFZB 1R4MB 1F0ZA 1EM7A 3HK0A 2BS2B 2MJ3A 3W5UB 4NZLB 1HE8A 4EUTA 3DCGA 3OJ3A 4FJZA 3ZNGC 4A3OA 2MJDA 4DHZB 4ZDVA 2GBMA 4GLSC 2I1KA 3V61A 2PLPA 4ACFA 1TKYA 1J19A 2KDBA 4TQ1A 2BBCA 2YLMA 3RNGC 2WX0A 1SGHA 4RF1A 3IXSA 4K7UA 1FNWA 3A9JB 3CWIA 2BPSA 4KSKC 2QC8A 1HA5A 2WXKA 5BO4B 2RGFA 3HVDA 4I6NB 4LDTD 4C00A 1C76A 1K53A 1DOYA 1TKGA 2WXIA 3AE8B 3X23A 1WXSA 3QARA 2KWUB 1PGBA 2LGXA 2FUG1 3I5JC 1E10A 2LMCA 2AL6A 1NI3A 3M3JA 1WJ6A 3Q8AA 3MC8A 4G11A 4C80A 4FXCA 1RYJA 2LEKA 1E8YA 1ZDVA 3BVZA 4II2B 4WAAA 5D94A 2N7EA 4DHZE 2ON8A 3VFKA 3Q3JA 2W82A 2MP2B 2RD0A 1OQYA 2G45B 2PVGC 2FCQA 2KAJA 1VZ8A 1TS2A 4RMAA 3MTNB 2JZ3B 1WXMA 3GP7A 4WH4A 2V1YA 3H7PA 3N30A 3N1XC 1A5RA 4ANWA 2RDHA 2QJLA 2DZMA 4BKSD 2WHIA 2K6QA 2XK5A 3AH7A 2KMAA 4XZ4A 3W2DA 1WM2A 1P9DU 4MSQB 2PW9A 4LNIA 2QDFA 4FULA 1I4QA 2Z0DB 2KZRA 5J2RA 2KVRA 1YN4A 4WJPA 3V3XA 1WX7A 3IBEA 2WNMA 4GDKB 4EZJA 4X57B 4O1NA 1SEBD 2HE7A 2AX5A 1I4PA 3P1MA 2DBYA 1LFDA 1E7VA 1YOVB 2W3SA 3GB1A 3TMPB 2VH2A 3V60A 5L95C 3W1YA 3NUHB 3R2TA 2N9KA 2KXJA 3WALA 2Z8LA 1T0YA 2JZZA 3AEAB 4RM8A 2CU3A 3N9YC 1P7FA 2FCMA 2W9NA 2K25A 2JRIB 2G4SA 2NBUA 4G3XB 3VUWA 1EU3A 1UWMA 3GZNB 2D10A 2RMMA 3MHSD 4HCNB 2AQ2B 5D3DA 2XK5B 1EU4A 1D5XC 2GB1A 1KTKA 2HD5B 3B1LX 3BWUD 1YX5B 4WWNA 3EFCA 2V3NA 2VH1A 3NY5A 3UF8A 4AP4C 2IPKD 1JWAD 4LK0M 4QAYA 5LLIA 1HTQA 1QZEA 1SF0A 3N20C 1TJEA 2AYOB 2ZNVB 4B0MA 3OWEB 1E8ZA 2M8SA 1IUEA 1EO6A 1AYFA 1XEEA 3L10B 2WS3B 1QOAA 4N6EB 1E0ZA 1XQQA 3VAWA 2MJEA 5HG2A 3SFEB 2M56B 2NS5A 2KTRA 4ZHPA 1WMHA 1XCQL 1C79A 1AWDA 2KC2A 2CJOA 3C0RB 1GJZA 4IWQA 2DX5B 3QC8B 1WI0A 1B1ZA 3ECIA 2B3AA 2JSVX 2D3GA 2J0MA 3IAS1 3W9CB 1KH0A 1WH3A 1L0XB 3Q3MC 2DAJA 4URKA 3APDA 2C7NB 1C4CA 4GB9A 2FNJB 1I7HA 3PZ8A 1P98A 1DOIA 2KQ4X 3HUIA 1G6JA 2M19A 2MBBB 2Q5WD 5I4DA 5G5HA 4KZ0A 1ACCA 3DVNU 1S3SG 4S17A 2OJWA 1RWSA 1WJNA 4HPPA 1K50A 1STEA 4FBJB 1UELA 2LVOA 2KACA 4R3DA 4E3CA 1X1MA 4H2AA 1MFWA 1ZUD2 2L7RA 2KTRB 2KN4A 1WMHB 1JCKB 3QIJA 5BYQA 5EE0A 4IOIE 3NHEB 4FA6A 1ZPSA 3APFA 3PLVA 3EUB2 1NVID 3C8YA 1JRUA 1WZ0A 2WYQA 1L2NA 2KYWA 1UZXB 2PKOA 2WU5B 4EOYA 1UGMA 3VRBB 4A55A 1SE9A 3ZJTA 1ZDXA 3V62A 4BAXA 2JRHA 3DBRI 4MGYE 2WXRA 2INDC 2N9XA 1VDVA 1OGWA 3V05A 4A3PA 4XC2A 2L05A 4LJPB 2IBIB 3PHXB 4HVBA 1NEKB 1WGKA 3IFWB 1Z5SB 1SJED 2WXFA 1H4RA 3P4QB 3VQIA 1L4ZB 5C3JB 3JVZX 1V80A 1WXVA 4TQ0A 1GB4A 2OJRA 2YEPF 3R7RA 2WWZA 4HROA 4ITKA 2O2VB 3MC9A 4W9CA 2Y5PA 4MJSA 4KKJA 2B76B 4P7IA 2D5GA 1J7BA 1TS3A 3MHZA 3AEGB 4L23A 2IO2B 2EMSA 2IJ0A 2QEJC 3VH3B 3U4EG 1FIQA 3AE6B 1JWBD 3QHTA 5IP4D 4HRSA 4OVZA 1PGXA 3JYUA 3A1QA 2MA9B 1OTRB 4WJNA 5CHFA 2WLBA 3P63A 4UDUC 2ZNVC 2INNE 4YSZB 5EE3A 4BOZB 3H6NA 1EF1A 1ZW7A 1WXAA 1D3ZA 4YL8A 1WY8A 2MRPA 3RT3B 4MGZE 2LGSA 4JIOU 1HZ5A 2RDBC 3H1UA 4YWGG 4F8CB 2IGHA 1RLFA 4ZOHC 5G5GA 3ZLZA 1JWSD 4MJSB 2TSSA 2D07B 1OFFA 1XLQA 3LDZE 4HCPB 4DXFA 1GUAB 2ZPYA 1FCLA 3UQBA 3ZXVA 5J17A 1ESFA 4DDGD 2KDMA 4XE0A 3HVZA 4DHJD 1ET6A 4ZHOA 4BKGA 3SR6A 1CK1A 2LGDA 2WQYB 4W9FA 2L76A 2W54A 2C5LC 5E6NA 1YJ1A 3ZJVA 2O6VA 1E7PB 1N61A 2DYMA 2MSED 3A1QB 1FRRA 1SJHD 5CX3A 3PHWB 3ZRFA 1DOXA 4IG7B 2DNFA 3TJPA 1QOGA 3SD5A 3L16A 3LXFA 5GXGB 4EEWA 4HEA1 1XF5L 2DYBA 5C23A 1RFKA 1WX8A 3DBLI 5FK9C 1GC7A 3AEBB 1WF9A 2K5PA 3TL5A 4LNOA 2KWVB 3NZSA 3U30A 1WRIA 3OG5A 2K0PA 1P0RA 2IY0B 2D11A 2L00B 4GU2A 1SE4A 2LUMA 5MPOA 1L6VA 2LUEA 2L8JA 3A4SC 1V1OA 2KTFA 3DWGC 2GI9A 4B95A 2PEAA 1C9FA 4JPSA 5IO9A 4ARCA 4GXBA 4ANUA 1CZPA 3VXWA 4TMAB 2AEHA 3PRMB 1WJUA 5FKAC 4TV3A 2GBRA 4KKIA 4ZRPA 2RDGA 1I4XA 5HI1A 2O6VB 4W9HA 4GIVA 2BYTA 4CHKA 2MX2A 5IKCM 2GMIC 2KX0A 3URYA 2A4ZA 2JT4B 4HLEA 1TY2A 3DBHB 3FILA 3KWLA 5D7GA 1TYGB 3AXCA 4FN2A 2KJHB 4GN1A 2DENB 1C1YB 3SU8X 2X8XX 4IUMB 5AZFA 5CTRC 3RI7C 4KV2A 5HFYA 2G3QB 3NVYA 4RNAA 1R4MI 2K8CA 1MI0A 1TT5B 2QHOA 3ML8A 4MM3A 2L52A 3VUYA 5C1ZA 4KX6B 2OHFA 2LASA 3S2AA 1XLNA 1N60A 3QCAA 3AU5A 1E6EB 1KLGD 1IPGA 4NAWA 5JZEB 1Y8RC 2QMTA 2JX5A 4A6QA 2WXQA 2FAZA 3GE3C 4M00A 4FJVB 4XWTA 4HJKA 2KMMA 3PGEA 1WRDB 4KVGB 3FILB 2WXOA 4N59A 3NG0A 3ZIMA 3NZUA 1ROEA 1WXQA 2Y3AA 4Q2JA 2PMVA 1WWTA 4A20A 3HM6X 1JWMD 3ALBA 4DWFA 1EWCA 2R2OA 3AV8A 2DWQA 4YT0B 3VR8B 2ZPNA 2ZCBA 2LRWA 1OQRA 3VTUA 4MM3B 1FM0D 1P3QU 3ZNHB 2KDIA 1E5WA 4RF0A 1A70A 2ZEQA 1ET9A 4K81A 4JQWC 4LTUA 2BYEA 2LHDA 4DQOC 3A9KA 3RNFC 4WWPA 3EFUA 3Q8BA 3WAPA 4FJYA 2K8HA 3TEXA 3VVWB 2WX1A 3BK1A 2G4DB 2CU1A 3EGRA 5D3IB 2M0AA 4KDLB 5DPTA 2L0FA 4USAA 5CHWA 3DHHC 2IYDB 2LXCA 5JH5C 1TIFA 4NQLB 3X0WA 4W9LA 5IOIA 1K51A 2JWZA 4IM3A 5TR5A 3U8ZA 3PPAA 2Z59B 4G0NB 3UIPB 5J18A 1V9JA 1L4DB 2WXGA 4MELA 5LXIB 3DWMA 2JPHA 1P7EA 5D2MB 2W3RA 1OEYJ 1KFYB 4IDIA 5JXVA 2JUOA 4GMVA 1TY0A 4IWPA 1ZXIA 2WDRB 1PDXA 1YQ4B 1F2RI 1WE7A 3EECA 4K3BA 2JQRB 3SEBA 1J7AA 3B08A 2EKEC 1N5XA 3PZ7A 2LFIA 3A9KB 4KDIC 3ZVVA 2LJ5A 1CJEA 2KDEB 1MG8A 1VR9A 1MVKA 4L2YA 4F1SA 3P4SB 3H7PB 4HWIB 2FE8A 1NYRA 4W9GA 1SBBB 1WGRA 2K1FA 4LJOB 3ZXRA 1WR6E 3MJ5A 1XCTL 3GZNI 3W1SA 3HRDD 3TCAA 4CO7A 1XXGA 4RGMA 2EELA 3U2SC 3AECB 2IGGA 1Q0WB 2QILA 1M4VA 2KWDA 2DZJA 1JROA 3NVWA 2WU2B 2AL3A 2MBOA 4M8MA 4PT5A 4MACA 4DDID 1LXDA 3OJ4B 2DAFA 2VZKB 2N0SB 2KK8A 4JWUC 1QKZA 1CQVA 3L08A 3T3OA 3NVVA 2GBNA 3Q3FA 4BOSC 1P1AA 2XEWA 2WXLA 2J53A 4N58A 4WQOB 2L0TA 4YSXB 1WSPA 4RGTA 4IWOA 3KYDD 5IAAC 3GOEA 1YN5A 3TEYA 3NS8A 4OW0A 1QOBA 2ICIA 3C19A 4US9A 3KWVA 1NYQA 4W9JA 1GPXA 1FRDA 1PYWD 2M17A 2I1JA 2AQ1B 3ZTDA 2AWTA 1R4NI 4NPNA 3FKYA 3TUOA 3FC4A 2V4IB 2NVUI 2FIFA 2JZPA 4P6VF 1L0YB 4ZRJA 4C7YA 4KGSA 3DVGY 2ZCCA 1T5XD 3KVFB 3O13A 2LGIA 3BK2A 3VHTC 1WYWB 1TBEA 3OAWA 1SXTA 2BQQA 3ABVB 3DPDA 4LCDE 4IC7B 3P2BA 2NMQA 1D4BA 2ONQA 5GMVA 1YQ3B 1ZE3D 2MBQA 2UU7A 3Q14C 4EE2A 1IGCA 1FMAD 1TS5A 1VLBA 1YMHE 3MP9A 4GSWA 3M95A 5BMIA 5IA7A 2JXXA 2KNBA 1ZP0B 2KWCA 4E74A 4P1BC 1F1HA 2EMTA 1JMLA 4PYUA 1D5ZC 3VDZA 1DGJA 3NZ3A 3WA0A 4W9EA 1TS4A 1EF5A 1YQBA 5CHVC 1KF6B 1V8CA 3CF6E 2HTHA 3KH0A 2K3UA 1NENB 2LRUA 1R7SA 1PUTA 1F2RC 3N32A 2MH7A 5DPRA 3UIOB 3H8HA 4M8NA 4W9IA 1F52A 1GB1A 1HZ6A 3AEEB 3ZTCA 1BUIC 3DBSA 4XDCA 1RFAA 4CYEA 4ARIA 1FPYA 4TSSA 1TZOA 2BS3B 4I6LB 3AN1A 1V6EA 4BKSA 3KYCD 3CMMB 1BXTA 4HK2A 1FFVA 3T3NA 4OZBA 5KHQA 3QX1A 1IGDA 2KC1A 4RGNA 3N3KB 3QQ8B 3RNBC 4HKQA 3JW0X 3SHQA 4NQKE 1EWYC 1T0SC 2RSUA 5D6JB 3ZNZB 1XO3A 2KFKA 5JHBA 2DYOA 2K9XA 3MFGA 4B6WA 3VUXA 2KD0A 2BTEA 2BYVE 3CSFA 1LM8B 3RNCC 3PV1A 1WX9A 2V3PA 1FFUA 2SEBD 4JWSC 1IP9A 2V0GA 2AQ3B 1VRAB 2RR9A 1V5OA 1WM3A 2FUHB 2D3BA 3MJWA 3UQAA 1I4HA 1MJDA 2NPTA 4NJ7A 1WGYA 3PRZA 1U4AA 1SIJA 3A33B 1ZKHA 2QCZA 3ML9A 2R61A 2C9WB 3L0WB 1F9JA 2C60A 4KGTA 1FEHA 4MH0E 5AEKB 3ZRCA 1PGAA 2PE6B 3OLMD 2WXNA 4C56C 1NDDA 3DOWA 2BGFA 2JXTA 3GE8C 1L5PA 4FHJA 4WIPA 1T0QC 4GDLA 3R2IA 4OVVA 5DCNA 1KRHA 1RM6C 3NVZA 1H8CA 4MEMA 1V81A 2KFKB 2PJHA 3RNAC 2QIEB 4DK5A 2PVOD 1V86A 1HEZE 2J7QB 3NRZA 4D2KA 3UI3A 5E6OA 3AE5B 3AEFB 4OZAA 3Q8EA 2XN9C 5AUIA 2KX3A 1V2YA 3JSVA 3AE9B 1V1PA 2D3AA 3P4RB 2PE9A 4P1CC 4AJWA 1QOFA 5HKHA 1VZ6A 3RMKC 2BKFA 2VZKD 3K9PB 2D3CA 1VZ7A 1HTOA 2KLCA 2KT7A 3D32A 3DBLB 3PZDA 3SFDB 4GOCA 1PFDA 1C3TA 4J6IA 3N1YC 2K22A 3ENEA 4ICUA 4ZRKA 1WR1A 3EA6A 3U52E 3AB5A 4A90A 3DHGC 1FCCC 5EE9A 3LYYA 3IT4B 4YSYB 2MQJA 1UBQA 5EE1A 4P16A 1I42A 2IY1B 3RCZA 4K7SA 2ZZPB 4ZRIA 3ONSA 3K9OB 4XX5A 1WYGA 3AE3B 2IDYA 4XWWA 2WDTB 2LI5A 3ZNID 3JSVB 1N6ZA 3DBHI 1V1PB 5T8IA 1B9RA 4REZA 1NBFC 3I63C 3HIZA 2MCNB 2WDVB 3I3TB 5TSSA 4FHKA 4M0WA 3I57A 4A9AA 3AE1B 4XDDA 3HHMA 1GC6A 4K1RB 3P4PB 1N62A 3P42A 4IKGA 4ANVA 4OVUA 1C78A 3LJ3A 1RAXA 3QA8A 1FO4A 3U7DA 3BVMA 2H88B 2HTME 2J0JA 2KN5A 2Y5CA 1WGDA 4EZLA 1SE2A 3TEWA 3NJTA 2MP2A 3AEDB 2J0KA 3PVLA 4CQNA 4IM0A 2UWQA 2PPHA 1KM7A 3RNEC 2X38A 5BYRA 5DPWA 1C4AA 2IGDA 1HXYD 4JGHB 1SSNA 2HJ8A 1AARA 3DVNV 5FR6A 2L3ZA 3T9LA 2INPE 5AUKA 1ZGUB 1E8XA 3PLUA 3QAQA 3O65B 1WGGA 1M94A 3E56A 2BVCA 4FADA 1XD3B 5JHAA 2DLBA 2MLBA 1GOZA 2FBWB 4LNKA 3ZUNA 2M1MA 2WDQB 4M0WB 3RYTA 3BINA 1L7YA 3AULA 2GBKA 4N9F4 2KFJA 3WAOA 5EDSA 2WXPA 2BB6A 4II3B 1E90A 1WZ3A 3Q3OC 4M02A 2G9HD 2BKRB 4GDKA 3WIMA 2ZW0A 1HQRD 2KVZA 2FIDA 2WP9B 4LNFA 1FD6A 3IAM1 1XLPA 4NAWB 3R66C 2KMCA 2LD9A 2LXAA 4RM9A 4DXAB 3LB8C 1E8WA 4KGRA 2EKIA 3GS2A 3R7QA 3QWZB 1FXTB 3AU4A 4JE3B 3RZWC 4EKUA 3Q2AC 2NBVB 1UWXA 1YIWA 2OOBB 3RN9C 3VH4B 1T6BX 4WQMA 2N7JA 2M0XA 2K8BA 3AM9A 4NAMA 3U7ZA 2BWFA 4RFBA 5E6PA 3VRAB 4FLHA 2PTLA 2WXJA 4EZKA 2NR2A 2KQ7A 1V5TA 1WFYA 3V6CB 4PS3A 3W5VB 5AZGA 2ACZB 1GNUA 2V9HA 2LVQA 3KUDB 4WURA 3BZDB 1FXIA 3T8MA 5BMHA 3WAMA 2KANA 3PT2B 3PS6A 3WANA 4I6PA 3ZDMC 2E6XA 1WJ4A 3KUCB 3ZKJC 1WGHA 1QF6A 1V97A 4US8A 1I4GA 1XT9B 2JYTA 4RCOA 1I35A 4TUUA 2MHJA 2JF5A 2YVCA 1MHHE 2H89B 5LNK1 1E7UA 2K39A 1PQSA 2LVPA 4C4VA 2J4XA 3Q6BA 2D2QA 4JL9A 1JQ4A 1YN3A 4DXGA 3M63B 2JY6A 2MEKA 2CHWA 4DHJB 2A5UA 1QILA 3VR9B 2RPVA 2QSDA 3HM3A 4IW0A 4MGIE 3PTFC 2IO0B 1QLBB 2MBEA 4L1BA 1KJTA 3VTWA 3EHVA 4AS1A 1KOTA 3Q69A 1AW7A 1YJJA 4WAFA 4MSMB 2RPQA 2IZVB 3L17A 1C77A 1YJIA 2KQSA 2R2QA 2KDFB 1RRBA 4PK1A 5H8YE 2VRRB 2WXHA 4BKTA 3IHPC 2O6VD 1FNVA 3ZO5B 1GG3A 4AJYB 2CR5A 2ZVOA 1DYQA 1V49A 5L83A 3KLSX 2ZW1A 3WCQA 5DPSA 3Q3NC 1NI2A 3DQVA 1KLVA 4B9KA 2BF8B 4C4VB 3Q8FA 2N1WA 3FAHA 4LLGM 1SE3A 3ZW3A 1UH6A 2LGYA 2KO3A 3B0AA 4MT5A 1VCBA 4G50A 1XLOA 2GBJA 3IVFA 1ENFA 1OQQA 2JYEA 1GAQB 1R4NB 2N7DA 3ZGZA 3B2FA 4ASWC 2KOXA 4WJOA 2MW5A 2NCNA 4K7WA 2YEPB 2IO1B 1ZXHA 2WGSA 1YNTE 4E71A 3H7SA 1K8RB 4PS8A 4HPMB 4AQ7A 1D6EC 2O2VA 1ZOYB 4MGKE 4AOFA 4BFRA 3VTVA 2N9EB 2XNAC 4ZRQA 4JX1C 1BMLC 1T0RC 3RZFA 3L13A 4J3OD 1J0GA 2L83A 4TKNA 1N63A 3TEZA 3L54A 1TGZB 4NY0A 1UF0A 3KQ4A 2LWPA 4NNJB 3PREA 1J8CA 2L32A 2BS4B 2BT6A 3B2GA 3SDLC 4HXDA 3DBRB 3AMZA 1F77A 3BY4B 5BMGA 2C7HA 4KIKA 3BYYB 3TIXA 2W55A 2CHXA 4MDKE 4LDTB 4PS7A 1S1QB 4HPLB 4A8XC 2CKHB 2SAKA 1C4PA 4YXDB 2V4LA 2N4FA 3ETRA 1QQRA 4W9DA
chains in the Genus database with same CATH topology
1C3TA 1E8ZA 2M8SA 4J6IA 3VTUA 1EO6A 1P3QU 3L10B 3ZNHB 2IO3B 2KDIA 3ENEA 1E5WA 4ICUA 4ICVA 1XQQA 1WR1A 2K6DB 4ZRKA 3VAWA 3KUZA 2ZEQA 4K81A 4JQWC 1TTNA 2NS5A 2ZJDA 2KTRA 1WMHA 2KKCA 2ASQA 2BYEA 1VD2A 3A9KA 2KC2A 3PSEB 4WWPA 3EFUA 3C0RB 1OEYA 4FJYA 1UBIA 3WAPA 2K8HA 1GJZA 3DDCB 4IWQA 3VVWB 2MQJA 2WX1A 2G4DB 1UBQA 4GGQA 2CU1A 2DX5B 3QC8B 1WI0A 2CHZA 4KDLB 3ECIA 5DPTA 1I42A 2B3AA 2L0FA 5G2NA 2IY1B 5CHWA 2IYDB 2D3GA 3RCZA 2J0MA 2LXCA 5JH5C 1WE6A 4NQLB 1WH3A 4K7SA 2ZZPB 2Z0EB 3X0WA 3M62B 1WIAA 2DAJA 4ZRIA 4W9LA 3ONSA 4URKA 3APDA 3UGBB 2C7NB 3K9OB 4GB9A 4XX5A 2JWZA 2WDTB 2FNJB 2LI5A 3ZNID 3JSVB 3DBHI 4IM3A 2Y5BB 5TR5A 1P98A 3PPAA 3U8ZA 4KIKB 2Z59B 4G0NB 3UIPB 5J18A 1V9JA 1G6JA 1NBFC 2MBBB 4MELA 4HDQA 3HIZA 2MCNB 5LXIB 3I3TB 2JPHA 4FHKA 3DVNU 4KZ0A 1S3SG 5D2MB 1WJNA 1OEYJ 3HHMA 1GC6A 2JUOA 2FCNA 4GMVA 4IWPA 4ANXA 3QK0A 3RULA 4BBNF 4K1RB 4F7ZA 4AUQC 5G55A 4FBJB 3RUIB 1WE7A 3EECA 4EFOA 1UELA 2LVOA 4E3CA 2LZ6A 4NJ6A 1X1MA 4ANVA 4OVUA 2XBBC 3LJ3A 1RAXA 3QA8A 1CMXB 3H9DA 2L7RA 3U7DA 2KTRB 1BT0A 2J0JA 1WMHB 2KN5A 2EKEC 3B08A 1Z2MA 1WGDA 3CSTA 4AWJA 4EZLA 4W9KA 3A9KB 3QIJA 4KDIC 3W1SC 2MP2A 3ZVVA 2J0KA 3PVLA 2LJ5A 2KDEB 4IM0A 1MG8A 2UWQA 3NHEB 4FA6A 3APFA 1TZ1A 3PLVA 2PPHA 3A4RA 4F1SA 2DHZA 1KM7A 2N9PC 3H7PB 4HWIB 1JRUA 1WZ0A 2REXA 2WYQA 5DPWA 1L2NA 1UZXB 4W9GA 3APCA 1WGRA 4EOYA 2K1FA 4LJOB 1UGMA 2MWSB 4JGHB 2DZIA 5AZHA 1WR6E 2CS4A 5LXHA 1SE9A 2HJ8A 1AARA 3DVNV 3DVGX 3GZNI 3W1SA 3KW5B 5FR6A 3V62A 2FCSA 2UYZB 3TCAA 4CO7A 2JRHA 2L3ZA 3DBRI 2NPTB 3T9LA 4ZYNA 4MGYE 3EC8A 1ZGUB 3V6EB 1E8XA 3PLUA 2ZVNA 1UD7A 2KLGA 3QAQA 1Q0WB 1YD8U 2BYFA 4IM2A 2N9XA 3O65B 1WGGA 1M94A 1OGWA 4FADA 1XD3B 5JHAA 4A3PA 4XC2A 2L05A 2MLBA 2DZJA 4LJPB 2IBIB 2NBWB 3PHXB 1Q5WB 4HVBA 3ZUNA 4KZCA 2M1MA 4M0WB 3RYTA 2BWES 3BINA 2AL3A 2M4NA 1Z5SB 3IFWB 1L7YA 1H4RA 2MBOA 3AULA 4M8MA 3VQIA 1Q1OA 2DZKA 3JVZX 1V80A 2GBKA 4N9F4 4WWOA 4DDID 1LXDA 1WXVA 2GOWA 2KFJA 3WAOA 4TQ0A 5EDSA 3OJ4B 2DAFA 3RD2A 2C7MB 4II3B 1IYFA 1E90A 1WZ3A 2KK8A 4GDLB 2OJRA 4WJQA 4GDKA 2BKRB 3WIMA 3R7RA 2WWZA 3L08A 2FIDA 2O2VB 2KJ6A 4W9CA 2GBNA 3Q3FA 4BOSC 4MJSA 1P1AA 2XEWA 3AI5A 4PYZA 4NAWB 3R66C 4P7IA 4WQOB 2MBHA 2L0TA 2KMCA 2LD9A 1LQBA 2LXAA 4IWOA 3KYDD 2KHWB 1YX6B 4RM9A 2IO2B 2EMSA 3GOEA 5IAAC 4DXAB 1SIFA 1E8WA 4BVUC 3VH3B 3R7QA 4HDOA 3QWZB 3NS8A 1FXTB 3PRPB 3AU4A 3RZWC 4EKUA 3A9JA 3QHTA 3ZDTA 3IG3A 2NBVB 3UINB 1YIWA 2OOBB 3R3MA 4W9JA 1EUVB 3JYUA 3VH4B 3A1QA 2M17A 2N1VA 2I1JA 2V3SA 2MA9B 1OTRB 4KSLC 4WJNA 3TBLD 3ZTDA 4DBGA 4BBNC 2M0XA 2K8BA 5CHFA 2AWTA 1R4NI 4NPNA 1ISNA 2BWFA 2ZNVC 2NVUI 5E6PA 2FIFA 3NOBA 4ZRJA 2KJRA 3QJZA 4BOZB 3H6NA 3DVGY 2ZCCA 1EF1A 4FLHA 4EZKA 3KVFB 2NR2A 2KQ7A 1ZW7A 1V5TA 1WXAA 1WFYA 1WY8A 2MRPA 4YL8A 3V6CB 3RT3B 1D3ZA 4PS3A 4JLCA 5KHOA 3VHTC 1WYWB 1TBEA 4MGZE 5AZGA 2JVCA 3OAWA 4JIOU 3DPDA 4LCDE 4IC7B 3P2BA 1GNUA 2LVQA 3HK0A 3H1UA 3KUDB 4F8CB 5GMVA 1RLFA 2MBQA 1HE8A 3T8MA 4EUTA 3ZLZA 3DCGA 3OJ3A 4FJZA 3ZNGC 4A3OA 4MJSB 4DHZB 4GSWA 3WAMA 2D07B 2KANA 3M95A 4ZDVA 2GBMA 3LDZE 3PT2B 3PS6A 4HCPB 4I6PA 3WANA 3ZDMC 5IA7A 1GUAB 1WJ4A 2ZPYA 3KUCB 2JXXA 1WGHA 3ZKJC 2I1KA 2KNBA 3V61A 3UQBA 5J17A 4DDGD 1XT9B 2KWCA 4E74A 1J19A 2KDBA 1I35A 2EMTA 4TQ1A 2YLMA 4DHJD 4TUUA 2WX0A 1SGHA 4BKGA 4PYUA 2LGDA 3VDZA 2JF5A 2YVCA 4K7UA 2L76A 4W9FA 3WA0A 4W9EA 3A9JB 1E7UA 1EF5A 1YQBA 2K39A 2C5LC 2BPSA 5E6NA 4KSKC 1YJ1A 5CHVC 2O6VA 1PQSA 2DYMA 2LVPA 2MSED 3A1QB 5BO4B 2RGFA 4I6NB 3CF6E 2D2QA 4JL9A 5CX3A 2HTHA 3PHWB 4LDTD 3ZRFA 3KH0A 3M63B 2JY6A 2CHWA 4DHJB 2A5UA 2LRUA 4IG7B 3X23A 3TJPA 1WXSA 3QARA 5DPRA 3N32A 3SD5A 2KWUB 3UIOB 3L16A 4M8NA 4W9IA 2LGXA 3ZTCA 4EEWA 2AL6A 3HM3A 3DBSA 4IW0A 1RFAA 2DYBA 3M3JA 5C23A 3DBLI 1WJ6A 1WX8A 4CYEA 4MGIE 3PTFC 1GC7A 2IO0B 1WF9A 2MBEA 4I6LB 3TL5A 1KJTA 1V6EA 2KWVB 3KYCD 3NZSA 4G11A 3EHVA 3CMMB 3U30A 3VTWA 4BKSA 4HK2A 1KOTA 1P0RA 2IY0B 2D11A 2L00B 4GU2A 1E8YA 5KHQA 4II2B 4WAAA 3QX1A 4MSMB 5D94A 2N7EA 2RPQA 2IZVB 3L17A 4DHZE 2KC1A 2KQSA 3VFKA 3N3KB 3Q3JA 2LUEA 2KDFB 2R2QA 1RRBA 2MP2B 3QQ8B 2L8JA 2RD0A 3A4SC 2KTFA 2VRRB 1OQYA 2G45B 4BKTA 3IHPC 3JW0X 2O6VD 3SHQA 2FCQA 4B95A 2PEAA 4NQKE 3ZO5B 1GG3A 5JHBA 2RSUA 5D6JB 3ZNZB 2KFKA 2CR5A 2ZVOA 4GXBA 4RMAA 4AJYB 2DYOA 4ANUA 3MTNB 3VXWA 2AEHA 1V49A 4B6WA 3VUXA 5L83A 2JZ3B 1WJUA 1WXMA 3PRMB 2V1YA 4TV3A 2GBRA 5DPSA 2KD0A 2BYVE 3CSFA 3H7PA 1LM8B 2O6VB 1NI2A 3DQVA 1KLVA 3PV1A 4B9KA 2BF8B 3N30A 4W9HA 1WX9A 4GIVA 2N1WA 4CHKA 2MX2A 1A5RA 4ANWA 1IP9A 2GMIC 2KX0A 2RR9A 2A4ZA 1V5OA 1WM3A 2DZMA 2JT4B 4HLEA 2FUHB 4BKSD 3ZW3A 1UH6A 2LGYA 5D7GA 2KO3A 2K6QA 3B0AA 2XK5A 3AXCA 2KMAA 3MJWA 4FN2A 1VCBA 2KJHB 4XZ4A 1WM2A 4G50A 4NJ7A 2NPTA 3UQAA 1WGYA 1P9DU 2DENB 2GBJA 3IVFA 4GN1A 4MSQB 3PRZA 1U4AA 1C1YB 3SU8X 3A33B 2N7DA 1ZKHA 3ML9A 4FULA 4IUMB 5AZFA 2Z0DB 2KZRA 5CTRC 2C9WB 3L0WB 1F9JA 5J2RA 2C60A 2KVRA 4KV2A 4MH0E 5AEKB 2G3QB 3ZRCA 4ASWC 4WJPA 1WX7A 2KOXA 3IBEA 2MW5A 4WJOA 1R4MI 2NCNA 4K7WA 4GDKB 4EZJA 2K8CA 2PE6B 4X57B 2IO1B 3OLMD 4E71A 2QHOA 3ML8A 4MM3A 2HE7A 3H7SA 1NDDA 3DOWA 3VUYA 1K8RB 4PS8A 5C1ZA 2BGFA 4FHJA 4HPMB 3TMPB 4GDLA 1LFDA 1E7VA 3V60A 4OVVA 5DCNA 5L95C 3W1YA 2LASA 2O2VA 3S2AA 1H8CA 4MEMA 4MGKE 2KXJA 3QCAA 3WALA 4AOFA 3AU5A 1V81A 4BFRA 3VTVA 2KFKB 1T0YA 2JZZA 2N9EB 1IPGA 2PJHA 4NAWA 4RM8A 5JZEB 1Y8RC 4DK5A 1V86A 3RZFA 2J7QB 3L13A 1J0GA 2FCMA 2FAZA 2W9NA 2K25A 4TKNA 2JRIB 5E6OA 2G4SA 2NBUA 3L54A 4G3XB 1TGZB 4NY0A 4NNJB 3VUWA 2LWPA 4FJVB 3PREA 1J8CA 4HJKA 2D10A 3PGEA 3SDLC 1WRDB 4HXDA 4KVGB 3BY4B 2KX3A 3MHSD 1V2YA 4HCNB 3JSVA 3ZIMA 2XK5B 3NZUA 2PE9A 2HD5B 2C7HA 4KIKA 4AJWA 3B1LX 1YX5B 4WWNA 5HKHA 3TIXA 2CHXA 4A20A 3HM6X 4MDKE 4LDTB 3NY5A 3UF8A 4AP4C 4PS7A 1S1QB 3ALBA 4DWFA 2BKFA 2R2OA 4HPLB 2CKHB 3K9PB 5LLIA 1QZEA 2V4LA 2N4FA 2AYOB 2ZPNA 2ZNVB 2KLCA 3D32A 2ZCBA 2LRWA 3PZDA 4GOCA 4W9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3T A;  1E8Z A;  2M8S A;  4J6I A;  3VTU A;  1EO6 A;  1P3Q U;  3L10 B;  3ZNH B;  2IO3 B;  2KDI A;  3ENE A;  1E5W A;  4ICU A;  4ICV A;  1XQQ A;  1WR1 A;  2K6D B;  4ZRK A;  3VAW A;  3KUZ A;  2ZEQ A;  4K81 A;  4JQW C;  1TTN A;  2NS5 A;  2ZJD A;  2KTR A;  1WMH A;  2KKC A;  2ASQ A;  2BYE A;  1VD2 A;  3A9K A;  2KC2 A;  3PSE B;  4WWP A;  3EFU A;  3C0R B;  1OEY A;  4FJY A;  1UBI A;  3WAP A;  2K8H A;  1GJZ A;  3DDC B;  4IWQ A;  3VVW B;  2MQJ A;  2WX1 A;  2G4D B;  1UBQ A;  4GGQ A;  2CU1 A;  2DX5 B;  3QC8 B;  1WI0 A;  2CHZ A;  4KDL B;  3ECI A;  5DPT A;  1I42 A;  2B3A A;  2L0F A;  5G2N A;  2IY1 B;  5CHW A;  2IYD B;  2D3G A;  3RCZ A;  2J0M A;  2LXC A;  5JH5 C;  1WE6 A;  4NQL B;  1WH3 A;  4K7S A;  2ZZP B;  2Z0E B;  3X0W A;  3M62 B;  1WIA A;  2DAJ A;  4ZRI A;  4W9L A;  3ONS A;  4URK A;  3APD A;  3UGB B;  2C7N B;  3K9O B;  4GB9 A;  4XX5 A;  2JWZ A;  2WDT B;  2FNJ B;  2LI5 A;  3ZNI D;  3JSV B;  3DBH I;  4IM3 A;  2Y5B B;  5TR5 A;  1P98 A;  3PPA A;  3U8Z A;  4KIK B;  2Z59 B;  4G0N B;  3UIP B;  5J18 A;  1V9J A;  1G6J A;  1NBF C;  2MBB B;  4MEL A;  4HDQ A;  3HIZ A;  2MCN B;  5LXI B;  3I3T B;  2JPH A;  4FHK A;  3DVN U;  4KZ0 A;  1S3S G;  5D2M B;  1WJN A;  1OEY J;  3HHM A;  1GC6 A;  2JUO A;  2FCN A;  4GMV A;  4IWP A;  4ANX A;  3QK0 A;  3RUL A;  4BBN F;  4K1R B;  4F7Z A;  4AUQ C;  5G55 A;  4FBJ B;  3RUI B;  1WE7 A;  3EEC A;  4EFO A;  1UEL A;  2LVO A;  4E3C A;  2LZ6 A;  4NJ6 A;  1X1M A;  4ANV A;  4OVU A;  2XBB C;  3LJ3 A;  1RAX A;  3QA8 A;  1CMX B;  3H9D A;  2L7R A;  3U7D A;  2KTR B;  1BT0 A;  2J0J A;  1WMH B;  2KN5 A;  2EKE C;  3B08 A;  1Z2M A;  1WGD A;  3CST A;  4AWJ A;  4EZL A;  4W9K A;  3A9K B;  3QIJ A;  4KDI C;  3W1S C;  2MP2 A;  3ZVV A;  2J0K A;  3PVL A;  2LJ5 A;  2KDE B;  4IM0 A;  1MG8 A;  2UWQ A;  3NHE B;  4FA6 A;  3APF A;  1TZ1 A;  3PLV A;  2PPH A;  3A4R A;  4F1S A;  2DHZ A;  1KM7 A;  2N9P C;  3H7P B;  4HWI B;  1JRU A;  1WZ0 A;  2REX A;  2WYQ A;  5DPW A;  1L2N A;  1UZX B;  4W9G A;  3APC A;  1WGR A;  4EOY A;  2K1F A;  4LJO B;  1UGM A;  2MWS B;  4JGH B;  2DZI A;  5AZH A;  1WR6 E;  2CS4 A;  5LXH A;  1SE9 A;  2HJ8 A;  1AAR A;  3DVN V;  3DVG X;  3GZN I;  3W1S A;  3KW5 B;  5FR6 A;  3V62 A;  2FCS A;  2UYZ B;  3TCA A;  4CO7 A;  2JRH A;  2L3Z A;  3DBR I;  2NPT B;  3T9L A;  4ZYN A;  4MGY E;  3EC8 A;  1ZGU B;  3V6E B;  1E8X A;  3PLU A;  2ZVN A;  1UD7 A;  2KLG A;  3QAQ A;  1Q0W B;  1YD8 U;  2BYF A;  4IM2 A;  2N9X A;  3O65 B;  1WGG A;  1M94 A;  1OGW A;  4FAD A;  1XD3 B;  5JHA A;  4A3P A;  4XC2 A;  2L05 A;  2MLB A;  2DZJ A;  4LJP B;  2IBI B;  2NBW B;  3PHX B;  1Q5W B;  4HVB A;  3ZUN A;  4KZC A;  2M1M A;  4M0W B;  3RYT A;  2BWE S;  3BIN A;  2AL3 A;  2M4N A;  1Z5S B;  3IFW B;  1L7Y A;  1H4R A;  2MBO A;  3AUL A;  4M8M A;  3VQI A;  1Q1O A;  2DZK A;  3JVZ X;  1V80 A;  2GBK A;  4N9F 4;  4WWO A;  4DDI D;  1LXD A;  1WXV A;  2GOW A;  2KFJ A;  3WAO A;  4TQ0 A;  5EDS A;  3OJ4 B;  2DAF A;  3RD2 A;  2C7M B;  4II3 B;  1IYF A;  1E90 A;  1WZ3 A;  2KK8 A;  4GDL B;  2OJR A;  4WJQ A;  4GDK A;  2BKR B;  3WIM A;  3R7R A;  2WWZ A;  3L08 A;  2FID A;  2O2V B;  2KJ6 A;  4W9C A;  2GBN A;  3Q3F A;  4BOS C;  4MJS A;  1P1A A;  2XEW A;  3AI5 A;  4PYZ A;  4NAW B;  3R66 C;  4P7I A;  4WQO B;  2MBH A;  2L0T A;  2KMC A;  2LD9 A;  1LQB A;  2LXA A;  4IWO A;  3KYD D;  2KHW B;  1YX6 B;  4RM9 A;  2IO2 B;  2EMS A;  3GOE A;  5IAA C;  4DXA B;  1SIF A;  1E8W A;  4BVU C;  3VH3 B;  3R7Q A;  4HDO A;  3QWZ B;  3NS8 A;  1FXT B;  3PRP B;  3AU4 A;  3RZW C;  4EKU A;  3A9J A;  3QHT A;  3ZDT A;  3IG3 A;  2NBV B;  3UIN B;  1YIW A;  2OOB B;  3R3M A;  4W9J A;  1EUV B;  3JYU A;  3VH4 B;  3A1Q A;  2M17 A;  2N1V A;  2I1J A;  2V3S A;  2MA9 B;  1OTR B;  4KSL C;  4WJN A;  3TBL D;  3ZTD A;  4DBG A;  4BBN C;  2M0X A;  2K8B A;  5CHF A;  2AWT A;  1R4N I;  4NPN A;  1ISN A;  2BWF A;  2ZNV C;  2NVU I;  5E6P A;  2FIF A;  3NOB A;  4ZRJ A;  2KJR A;  3QJZ A;  4BOZ B;  3H6N A;  3DVG Y;  2ZCC A;  1EF1 A;  4FLH A;  4EZK A;  3KVF B;  2NR2 A;  2KQ7 A;  1ZW7 A;  1V5T A;  1WXA A;  1WFY A;  1WY8 A;  2MRP A;  4YL8 A;  3V6C B;  3RT3 B;  1D3Z A;  4PS3 A;  4JLC A;  5KHO A;  3VHT C;  1WYW B;  1TBE A;  4MGZ E;  5AZG A;  2JVC A;  3OAW A;  4JIO U;  3DPD A;  4LCD E;  4IC7 B;  3P2B A;  1GNU A;  2LVQ A;  3HK0 A;  3H1U A;  3KUD B;  4F8C B;  5GMV A;  1RLF A;  2MBQ A;  1HE8 A;  3T8M A;  4EUT A;  3ZLZ A;  3DCG A;  3OJ3 A;  4FJZ A;  3ZNG C;  4A3O A;  4MJS B;  4DHZ B;  4GSW A;  3WAM A;  2D07 B;  2KAN A;  3M95 A;  4ZDV A;  2GBM A;  3LDZ E;  3PT2 B;  3PS6 A;  4HCP B;  4I6P A;  3WAN A;  3ZDM C;  5IA7 A;  1GUA B;  1WJ4 A;  2ZPY A;  3KUC B;  2JXX A;  1WGH A;  3ZKJ C;  2I1K A;  2KNB A;  3V61 A;  3UQB A;  5J17 A;  4DDG D;  1XT9 B;  2KWC A;  4E74 A;  1J19 A;  2KDB A;  1I35 A;  2EMT A;  4TQ1 A;  2YLM A;  4DHJ D;  4TUU A;  2WX0 A;  1SGH A;  4BKG A;  4PYU A;  2LGD A;  3VDZ A;  2JF5 A;  2YVC A;  4K7U A;  2L76 A;  4W9F A;  3WA0 A;  4W9E A;  3A9J B;  1E7U A;  1EF5 A;  1YQB A;  2K39 A;  2C5L C;  2BPS A;  5E6N A;  4KSK C;  1YJ1 A;  5CHV C;  2O6V A;  1PQS A;  2DYM A;  2LVP A;  2MSE D;  3A1Q B;  5BO4 B;  2RGF A;  4I6N B;  3CF6 E;  2D2Q A;  4JL9 A;  5CX3 A;  2HTH A;  3PHW B;  4LDT D;  3ZRF A;  3KH0 A;  3M63 B;  2JY6 A;  2CHW A;  4DHJ B;  2A5U A;  2LRU A;  4IG7 B;  3X23 A;  3TJP A;  1WXS A;  3QAR A;  5DPR A;  3N32 A;  3SD5 A;  2KWU B;  3UIO B;  3L16 A;  4M8N A;  4W9I A;  2LGX A;  3ZTC A;  4EEW A;  2AL6 A;  3HM3 A;  3DBS A;  4IW0 A;  1RFA A;  2DYB A;  3M3J A;  5C23 A;  3DBL I;  1WJ6 A;  1WX8 A;  4CYE A;  4MGI E;  3PTF C;  1GC7 A;  2IO0 B;  1WF9 A;  2MBE A;  4I6L B;  3TL5 A;  1KJT A;  1V6E A;  2KWV B;  3KYC D;  3NZS A;  4G11 A;  3EHV A;  3CMM B;  3U30 A;  3VTW A;  4BKS A;  4HK2 A;  1KOT A;  1P0R A;  2IY0 B;  2D11 A;  2L00 B;  4GU2 A;  1E8Y A;  5KHQ A;  4II2 B;  4WAA A;  3QX1 A;  4MSM B;  5D94 A;  2N7E A;  2RPQ A;  2IZV B;  3L17 A;  4DHZ E;  2KC1 A;  2KQS A;  3VFK A;  3N3K B;  3Q3J A;  2LUE A;  2KDF B;  2R2Q A;  1RRB A;  2MP2 B;  3QQ8 B;  2L8J A;  2RD0 A;  3A4S C;  2KTF A;  2VRR B;  1OQY A;  2G45 B;  4BKT A;  3IHP C;  3JW0 X;  2O6V D;  3SHQ A;  2FCQ A;  4B95 A;  2PEA A;  4NQK E;  3ZO5 B;  1GG3 A;  5JHB A;  2RSU A;  5D6J B;  3ZNZ B;  2KFK A;  2CR5 A;  2ZVO A;  4GXB A;  4RMA A;  4AJY B;  2DYO A;  4ANU A;  3MTN B;  3VXW A;  2AEH A;  1V49 A;  4B6W A;  3VUX A;  5L83 A;  2JZ3 B;  1WJU A;  1WXM A;  3PRM B;  2V1Y A;  4TV3 A;  2GBR A;  5DPS A;  2KD0 A;  2BYV E;  3CSF A;  3H7P A;  1LM8 B;  2O6V B;  1NI2 A;  3DQV A;  1KLV A;  3PV1 A;  4B9K A;  2BF8 B;  3N30 A;  4W9H A;  1WX9 A;  4GIV A;  2N1W A;  4CHK A;  2MX2 A;  1A5R A;  4ANW A;  1IP9 A;  2GMI C;  2KX0 A;  2RR9 A;  2A4Z A;  1V5O A;  1WM3 A;  2DZM A;  2JT4 B;  4HLE A;  2FUH B;  4BKS D;  3ZW3 A;  1UH6 A;  2LGY A;  5D7G A;  2KO3 A;  2K6Q A;  3B0A A;  2XK5 A;  3AXC A;  2KMA A;  3MJW A;  4FN2 A;  1VCB A;  2KJH B;  4XZ4 A;  1WM2 A;  4G50 A;  4NJ7 A;  2NPT A;  3UQA A;  1WGY A;  1P9D U;  2DEN B;  2GBJ A;  3IVF A;  4GN1 A;  4MSQ B;  3PRZ A;  1U4A A;  1C1Y B;  3SU8 X;  3A33 B;  2N7D A;  1ZKH A;  3ML9 A;  4FUL A;  4IUM B;  5AZF A;  2Z0D B;  2KZR A;  5CTR C;  2C9W B;  3L0W B;  1F9J A;  5J2R A;  2C60 A;  2KVR A;  4KV2 A;  4MH0 E;  5AEK B;  2G3Q B;  3ZRC A;  4ASW C;  4WJP A;  1WX7 A;  2KOX A;  3IBE A;  2MW5 A;  4WJO A;  1R4M I;  2NCN A;  4K7W A;  4GDK B;  4EZJ A;  2K8C A;  2PE6 B;  4X57 B;  2IO1 B;  3OLM D;  4E71 A;  2QHO A;  3ML8 A;  4MM3 A;  2HE7 A;  3H7S A;  1NDD A;  3DOW A;  3VUY A;  1K8R B;  4PS8 A;  5C1Z A;  2BGF A;  4FHJ A;  4HPM B;  3TMP B;  4GDL A;  1LFD A;  1E7V A;  3V60 A;  4OVV A;  5DCN A;  5L95 C;  3W1Y A;  2LAS A;  2O2V A;  3S2A A;  1H8C A;  4MEM A;  4MGK E;  2KXJ A;  3QCA A;  3WAL A;  4AOF A;  3AU5 A;  1V81 A;  4BFR A;  3VTV A;  2KFK B;  1T0Y A;  2JZZ A;  2N9E B;  1IPG A;  2PJH A;  4NAW A;  4RM8 A;  5JZE B;  1Y8R C;  4DK5 A;  1V86 A;  3RZF A;  2J7Q B;  3L13 A;  1J0G A;  2FCM A;  2FAZ A;  2W9N A;  2K25 A;  4TKN A;  2JRI B;  5E6O A;  2G4S A;  2NBU A;  3L54 A;  4G3X B;  1TGZ B;  4NY0 A;  4NNJ B;  3VUW A;  2LWP A;  4FJV B;  3PRE A;  1J8C A;  4HJK A;  2D10 A;  3PGE A;  3SDL C;  1WRD B;  4HXD A;  4KVG B;  3BY4 B;  2KX3 A;  3MHS D;  1V2Y A;  4HCN B;  3JSV A;  3ZIM A;  2XK5 B;  3NZU A;  2PE9 A;  2HD5 B;  2C7H A;  4KIK A;  4AJW A;  3B1L X;  1YX5 B;  4WWN A;  5HKH A;  3TIX A;  2CHX A;  4A20 A;  3HM6 X;  4MDK E;  4LDT B;  3NY5 A;  3UF8 A;  4AP4 C;  4PS7 A;  1S1Q B;  3ALB A;  4DWF A;  2BKF A;  2R2O A;  4HPL B;  2CKH B;  3K9P B;  5LLI A;  1QZE A;  2V4L A;  2N4F A;  2AYO B;  2ZPN A;  2ZNV B;  2KLC A;  3D32 A;  2ZCB A;  2LRW A;  3PZD A;  4GOC A;  4W9D A; 
#chains in the Genus database with same CATH topology
 1QT9 A;  4RGO S;  2IO3 B;  4ICV A;  4M01 A;  2K6D B;  3J9C A;  2I2Y A;  4HJG E;  3CIR B;  3KUZ A;  1TTN A;  2ZJD A;  4C7Z A;  2KKC A;  1FNU A;  1LGR A;  2ASQ A;  1LO5 D;  1VD2 A;  3PSE B;  1UNS A;  4BZA A;  1OEY A;  1UBI A;  3DDC B;  4GGQ A;  2CHZ A;  5G2N A;  1WE6 A;  2BW2 A;  4YTP B;  1T3Q A;  2NTT A;  2Z0E B;  3M62 B;  1K52 A;  1WIA A;  3UGB B;  1VJK A;  3IT6 B;  4XYC A;  2HDE A;  2Y5B B;  2WXM A;  1JW9 D;  4KIK B;  2BB5 A;  4NJC A;  2J42 A;  3BVG A;  2GRI A;  3ZYY X;  3PO0 A;  4XGA B;  4HDQ A;  1TKE A;  1KLU D;  3DHI C;  1IBX A;  1UGJ A;  1SB3 C;  2E3T A;  2FCN A;  1J7C A;  3QK0 A;  4ANX A;  3RUL A;  4BBN F;  4F7Z A;  4AUQ C;  5G55 A;  3RUI B;  4EFO A;  2I38 A;  2LZ6 A;  4NJ6 A;  3MC0 B;  2XBB C;  1FXA A;  3TSS A;  1CMX B;  3H9D A;  2LJI A;  1BT0 A;  3CST A;  4AWJ A;  1L0V B;  1Z2M A;  4W9K A;  2N9L A;  3W1S C;  3ZJU A;  4MH8 A;  1UUP A;  2LHE A;  3B9J A;  3BYT B;  1TZ1 A;  5HHD G;  3A4R A;  2DHZ A;  5IN7 A;  1L6U A;  2N9P C;  2REX A;  4YTM B;  1N5W A;  3APC A;  1MG4 A;  2MWS B;  2DZI A;  5AZH A;  2CS4 A;  5LXH A;  2J52 A;  3DVG X;  3KW5 B;  2FCS A;  2UYZ B;  4HKZ E;  5FR3 A;  4LNN A;  2NPT B;  4ZYN A;  3EC8 A;  5C2T B;  3V6E B;  2L1A A;  2ZVN A;  5BYS A;  1UD7 A;  2KLG A;  1YD8 U;  4IM2 A;  1JAL A;  2BYF A;  3L4P A;  2JU6 X;  2JWU A;  2NBW B;  1Q5W B;  4S0R A;  5E6J A;  4KZC A;  1IBX B;  2BWE S;  2M4N A;  1D5M C;  1Q1O A;  2DZK A;  4B0E A;  4WWO A;  2GOW A;  2GLS A;  3RD2 A;  2C7M B;  1IYF A;  4GDL B;  1I4R A;  4WJQ A;  2HJ1 A;  4K3C A;  1Q10 A;  4WWM A;  2KJ6 A;  3ZQ4 A;  1E9M A;  3N1Z C;  2G1E A;  2INC C;  3AI5 A;  4OZC A;  4PYZ A;  2MBH A;  3AE2 B;  2PIA A;  1LQB A;  4ZYS A;  2KHW B;  4YTN B;  1YX6 B;  3E9S A;  1SIF A;  3BII D;  4BVU C;  4HDO A;  2CJN A;  3PRP B;  2NTS A;  3A9J A;  3I9V 1;  3ZDT A;  3IG3 A;  3UIN B;  4RH6 A;  3R3M A;  1EUV B;  3R8B A;  3NS1 A;  2N1V A;  2V3S A;  3RPF C;  4KSL C;  3TBL D;  4DBG A;  3AE7 B;  4BBN C;  1JWU D;  1ISN A;  3Q8C A;  3NOB A;  1MPE A;  1Y56 A;  1MHX A;  2KJR A;  2OED A;  3QJZ A;  1AN8 A;  5H92 C;  1JRP A;  4OHJ A;  4JLC A;  5KHO A;  3AE4 B;  2JVC A;  3RFZ B;  1R4M B;  1F0Z A;  1EM7 A;  3HK0 A;  2BS2 B;  2MJ3 A;  3W5U B;  4NZL B;  1HE8 A;  4EUT A;  3DCG A;  3OJ3 A;  4FJZ A;  3ZNG C;  4A3O A;  2MJD A;  4DHZ B;  4ZDV A;  2GBM A;  4GLS C;  2I1K A;  3V61 A;  2PLP A;  4ACF A;  1TKY A;  1J19 A;  2KDB A;  4TQ1 A;  2BBC A;  2YLM A;  3RNG C;  2WX0 A;  1SGH A;  4RF1 A;  3IXS A;  4K7U A;  1FNW A;  3A9J B;  3CWI A;  2BPS A;  4KSK C;  2QC8 A;  1HA5 A;  2WXK A;  5BO4 B;  2RGF A;  3HVD A;  4I6N B;  4LDT D;  4C00 A;  1C76 A;  1K53 A;  1DOY A;  1TKG A;  2WXI A;  3AE8 B;  3X23 A;  1WXS A;  3QAR A;  2KWU B;  1PGB A;  2LGX A;  2FUG 1;  3I5J C;  1E10 A;  2LMC A;  2AL6 A;  1NI3 A;  3M3J A;  1WJ6 A;  3Q8A A;  3MC8 A;  4G11 A;  4C80 A;  4FXC A;  1RYJ A;  2LEK A;  1E8Y A;  1ZDV A;  3BVZ A;  4II2 B;  4WAA A;  5D94 A;  2N7E A;  4DHZ E;  2ON8 A;  3VFK A;  3Q3J A;  2W82 A;  2MP2 B;  2RD0 A;  1OQY A;  2G45 B;  2PVG C;  2FCQ A;  2KAJ A;  1VZ8 A;  1TS2 A;  4RMA A;  3MTN B;  2JZ3 B;  1WXM A;  3GP7 A;  4WH4 A;  2V1Y A;  3H7P A;  3N30 A;  3N1X C;  1A5R A;  4ANW A;  2RDH A;  2QJL A;  2DZM A;  4BKS D;  2WHI A;  2K6Q A;  2XK5 A;  3AH7 A;  2KMA A;  4XZ4 A;  3W2D A;  1WM2 A;  1P9D U;  4MSQ B;  2PW9 A;  4LNI A;  2QDF A;  4FUL A;  1I4Q A;  2Z0D B;  2KZR A;  5J2R A;  2KVR A;  1YN4 A;  4WJP A;  3V3X A;  1WX7 A;  3IBE A;  2WNM A;  4GDK B;  4EZJ A;  4X57 B;  4O1N A;  1SEB D;  2HE7 A;  2AX5 A;  1I4P A;  3P1M A;  2DBY A;  1LFD A;  1E7V A;  1YOV B;  2W3S A;  3GB1 A;  3TMP B;  2VH2 A;  3V60 A;  5L95 C;  3W1Y A;  3NUH B;  3R2T A;  2N9K A;  2KXJ A;  3WAL A;  2Z8L A;  1T0Y A;  2JZZ A;  3AEA B;  4RM8 A;  2CU3 A;  3N9Y C;  1P7F A;  2FCM A;  2W9N A;  2K25 A;  2JRI B;  2G4S A;  2NBU A;  4G3X B;  3VUW A;  1EU3 A;  1UWM A;  3GZN B;  2D10 A;  2RMM A;  3MHS D;  4HCN B;  2AQ2 B;  5D3D A;  2XK5 B;  1EU4 A;  1D5X C;  2GB1 A;  1KTK A;  2HD5 B;  3B1L X;  3BWU D;  1YX5 B;  4WWN A;  3EFC A;  2V3N A;  2VH1 A;  3NY5 A;  3UF8 A;  4AP4 C;  2IPK D;  1JWA D;  4LK0 M;  4QAY A;  5LLI A;  1HTQ A;  1QZE A;  1SF0 A;  3N20 C;  1TJE A;  2AYO B;  2ZNV B;  4B0M A;  3OWE B;  1E8Z A;  2M8S A;  1IUE A;  1EO6 A;  1AYF A;  1XEE A;  3L10 B;  2WS3 B;  1QOA A;  4N6E B;  1E0Z A;  1XQQ A;  3VAW A;  2MJE A;  5HG2 A;  3SFE B;  2M56 B;  2NS5 A;  2KTR A;  4ZHP A;  1WMH A;  1XCQ L;  1C79 A;  1AWD A;  2KC2 A;  2CJO A;  3C0R B;  1GJZ A;  4IWQ A;  2DX5 B;  3QC8 B;  1WI0 A;  1B1Z A;  3ECI A;  2B3A A;  2JSV X;  2D3G A;  2J0M A;  3IAS 1;  3W9C B;  1KH0 A;  1WH3 A;  1L0X B;  3Q3M C;  2DAJ A;  4URK A;  3APD A;  2C7N B;  1C4C A;  4GB9 A;  2FNJ B;  1I7H A;  3PZ8 A;  1P98 A;  1DOI A;  2KQ4 X;  3HUI A;  1G6J A;  2M19 A;  2MBB B;  2Q5W D;  5I4D A;  5G5H A;  4KZ0 A;  1ACC A;  3DVN U;  1S3S G;  4S17 A;  2OJW A;  1RWS A;  1WJN A;  4HPP A;  1K50 A;  1STE A;  4FBJ B;  1UEL A;  2LVO A;  2KAC A;  4R3D A;  4E3C A;  1X1M A;  4H2A A;  1MFW A;  1ZUD 2;  2L7R A;  2KTR B;  2KN4 A;  1WMH B;  1JCK B;  3QIJ A;  5BYQ A;  5EE0 A;  4IOI E;  3NHE B;  4FA6 A;  1ZPS A;  3APF A;  3PLV A;  3EUB 2;  1NVI D;  3C8Y A;  1JRU A;  1WZ0 A;  2WYQ A;  1L2N A;  2KYW A;  1UZX B;  2PKO A;  2WU5 B;  4EOY A;  1UGM A;  3VRB B;  4A55 A;  1SE9 A;  3ZJT A;  1ZDX A;  3V62 A;  4BAX A;  2JRH A;  3DBR I;  4MGY E;  2WXR A;  2IND C;  2N9X A;  1VDV A;  1OGW A;  3V05 A;  4A3P A;  4XC2 A;  2L05 A;  4LJP B;  2IBI B;  3PHX B;  4HVB A;  1NEK B;  1WGK A;  3IFW B;  1Z5S B;  1SJE D;  2WXF A;  1H4R A;  3P4Q B;  3VQI A;  1L4Z B;  5C3J B;  3JVZ X;  1V80 A;  1WXV A;  4TQ0 A;  1GB4 A;  2OJR A;  2YEP F;  3R7R A;  2WWZ A;  4HRO A;  4ITK A;  2O2V B;  3MC9 A;  4W9C A;  2Y5P A;  4MJS A;  4KKJ A;  2B76 B;  4P7I A;  2D5G A;  1J7B A;  1TS3 A;  3MHZ A;  3AEG B;  4L23 A;  2IO2 B;  2EMS A;  2IJ0 A;  2QEJ C;  3VH3 B;  3U4E G;  1FIQ A;  3AE6 B;  1JWB D;  3QHT A;  5IP4 D;  4HRS A;  4OVZ A;  1PGX A;  3JYU A;  3A1Q A;  2MA9 B;  1OTR B;  4WJN A;  5CHF A;  2WLB A;  3P63 A;  4UDU C;  2ZNV C;  2INN E;  4YSZ B;  5EE3 A;  4BOZ B;  3H6N A;  1EF1 A;  1ZW7 A;  1WXA A;  1D3Z A;  4YL8 A;  1WY8 A;  2MRP A;  3RT3 B;  4MGZ E;  2LGS A;  4JIO U;  1HZ5 A;  2RDB C;  3H1U A;  4YWG G;  4F8C B;  2IGH A;  1RLF A;  4ZOH C;  5G5G A;  3ZLZ A;  1JWS D;  4MJS B;  2TSS A;  2D07 B;  1OFF A;  1XLQ A;  3LDZ E;  4HCP B;  4DXF A;  1GUA B;  2ZPY A;  1FCL A;  3UQB A;  3ZXV A;  5J17 A;  1ESF A;  4DDG D;  2KDM A;  4XE0 A;  3HVZ A;  4DHJ D;  1ET6 A;  4ZHO A;  4BKG A;  3SR6 A;  1CK1 A;  2LGD A;  2WQY B;  4W9F A;  2L76 A;  2W54 A;  2C5L C;  5E6N A;  1YJ1 A;  3ZJV A;  2O6V A;  1E7P B;  1N61 A;  2DYM A;  2MSE D;  3A1Q B;  1FRR A;  1SJH D;  5CX3 A;  3PHW B;  3ZRF A;  1DOX A;  4IG7 B;  2DNF A;  3TJP A;  1QOG A;  3SD5 A;  3L16 A;  3LXF A;  5GXG B;  4EEW A;  4HEA 1;  1XF5 L;  2DYB A;  5C23 A;  1RFK A;  1WX8 A;  3DBL I;  5FK9 C;  1GC7 A;  3AEB B;  1WF9 A;  2K5P A;  3TL5 A;  4LNO A;  2KWV B;  3NZS A;  3U30 A;  1WRI A;  3OG5 A;  2K0P A;  1P0R A;  2IY0 B;  2D11 A;  2L00 B;  4GU2 A;  1SE4 A;  2LUM A;  5MPO A;  1L6V A;  2LUE A;  2L8J A;  3A4S C;  1V1O A;  2KTF A;  3DWG C;  2GI9 A;  4B95 A;  2PEA A;  1C9F A;  4JPS A;  5IO9 A;  4ARC A;  4GXB A;  4ANU A;  1CZP A;  3VXW A;  4TMA B;  2AEH A;  3PRM B;  1WJU A;  5FKA C;  4TV3 A;  2GBR A;  4KKI A;  4ZRP A;  2RDG A;  1I4X A;  5HI1 A;  2O6V B;  4W9H A;  4GIV A;  2BYT A;  4CHK A;  2MX2 A;  5IKC M;  2GMI C;  2KX0 A;  3URY A;  2A4Z A;  2JT4 B;  4HLE A;  1TY2 A;  3DBH B;  3FIL A;  3KWL A;  5D7G A;  1TYG B;  3AXC A;  4FN2 A;  2KJH B;  4GN1 A;  2DEN B;  1C1Y B;  3SU8 X;  2X8X X;  4IUM B;  5AZF A;  5CTR C;  3RI7 C;  4KV2 A;  5HFY A;  2G3Q B;  3NVY A;  4RNA A;  1R4M I;  2K8C A;  1MI0 A;  1TT5 B;  2QHO A;  3ML8 A;  4MM3 A;  2L52 A;  3VUY A;  5C1Z A;  4KX6 B;  2OHF A;  2LAS A;  3S2A A;  1XLN A;  1N60 A;  3QCA A;  3AU5 A;  1E6E B;  1KLG D;  1IPG A;  4NAW A;  5JZE B;  1Y8R C;  2QMT A;  2JX5 A;  4A6Q A;  2WXQ A;  2FAZ A;  3GE3 C;  4M00 A;  4FJV B;  4XWT A;  4HJK A;  2KMM A;  3PGE A;  1WRD B;  4KVG B;  3FIL B;  2WXO A;  4N59 A;  3NG0 A;  3ZIM A;  3NZU A;  1ROE A;  1WXQ A;  2Y3A A;  4Q2J A;  2PMV A;  1WWT A;  4A20 A;  3HM6 X;  1JWM D;  3ALB A;  4DWF A;  1EWC A;  2R2O A;  3AV8 A;  2DWQ A;  4YT0 B;  3VR8 B;  2ZPN A;  2ZCB A;  2LRW A;  1OQR A;  3VTU A;  4MM3 B;  1FM0 D;  1P3Q U;  3ZNH B;  2KDI A;  1E5W A;  4RF0 A;  1A70 A;  2ZEQ A;  1ET9 A;  4K81 A;  4JQW C;  4LTU A;  2BYE A;  2LHD A;  4DQO C;  3A9K A;  3RNF C;  4WWP A;  3EFU A;  3Q8B A;  3WAP A;  4FJY A;  2K8H A;  3TEX A;  3VVW B;  2WX1 A;  3BK1 A;  2G4D B;  2CU1 A;  3EGR A;  5D3I B;  2M0A A;  4KDL B;  5DPT A;  2L0F A;  4USA A;  5CHW A;  3DHH C;  2IYD B;  2LXC A;  5JH5 C;  1TIF A;  4NQL B;  3X0W A;  4W9L A;  5IOI A;  1K51 A;  2JWZ A;  4IM3 A;  5TR5 A;  3U8Z A;  3PPA A;  2Z59 B;  4G0N B;  3UIP B;  5J18 A;  1V9J A;  1L4D B;  2WXG A;  4MEL A;  5LXI B;  3DWM A;  2JPH A;  1P7E A;  5D2M B;  2W3R A;  1OEY J;  1KFY B;  4IDI A;  5JXV A;  2JUO A;  4GMV A;  1TY0 A;  4IWP A;  1ZXI A;  2WDR B;  1PDX A;  1YQ4 B;  1F2R I;  1WE7 A;  3EEC A;  4K3B A;  2JQR B;  3SEB A;  1J7A A;  3B08 A;  2EKE C;  1N5X A;  3PZ7 A;  2LFI A;  3A9K B;  4KDI C;  3ZVV A;  2LJ5 A;  1CJE A;  2KDE B;  1MG8 A;  1VR9 A;  1MVK A;  4L2Y A;  4F1S A;  3P4S B;  3H7P B;  4HWI B;  2FE8 A;  1NYR A;  4W9G A;  1SBB B;  1WGR A;  2K1F A;  4LJO B;  3ZXR A;  1WR6 E;  3MJ5 A;  1XCT L;  3GZN I;  3W1S A;  3HRD D;  3TCA A;  4CO7 A;  1XXG A;  4RGM A;  2EEL A;  3U2S C;  3AEC B;  2IGG A;  1Q0W B;  2QIL A;  1M4V A;  2KWD A;  2DZJ A;  1JRO A;  3NVW A;  2WU2 B;  2AL3 A;  2MBO A;  4M8M A;  4PT5 A;  4MAC A;  4DDI D;  1LXD A;  3OJ4 B;  2DAF A;  2VZK B;  2N0S B;  2KK8 A;  4JWU C;  1QKZ A;  1CQV A;  3L08 A;  3T3O A;  3NVV A;  2GBN A;  3Q3F A;  4BOS C;  1P1A A;  2XEW A;  2WXL A;  2J53 A;  4N58 A;  4WQO B;  2L0T A;  4YSX B;  1WSP A;  4RGT A;  4IWO A;  3KYD D;  5IAA C;  3GOE A;  1YN5 A;  3TEY A;  3NS8 A;  4OW0 A;  1QOB A;  2ICI A;  3C19 A;  4US9 A;  3KWV A;  1NYQ A;  4W9J A;  1GPX A;  1FRD A;  1PYW D;  2M17 A;  2I1J A;  2AQ1 B;  3ZTD A;  2AWT A;  1R4N I;  4NPN A;  3FKY A;  3TUO A;  3FC4 A;  2V4I B;  2NVU I;  2FIF A;  2JZP A;  4P6V F;  1L0Y B;  4ZRJ A;  4C7Y A;  4KGS A;  3DVG Y;  2ZCC A;  1T5X D;  3KVF B;  3O13 A;  2LGI A;  3BK2 A;  3VHT C;  1WYW B;  1TBE A;  3OAW A;  1SXT A;  2BQQ A;  3ABV B;  3DPD A;  4LCD E;  4IC7 B;  3P2B A;  2NMQ A;  1D4B A;  2ONQ A;  5GMV A;  1YQ3 B;  1ZE3 D;  2MBQ A;  2UU7 A;  3Q14 C;  4EE2 A;  1IGC A;  1FMA D;  1TS5 A;  1VLB A;  1YMH E;  3MP9 A;  4GSW A;  3M95 A;  5BMI A;  5IA7 A;  2JXX A;  2KNB A;  1ZP0 B;  2KWC A;  4E74 A;  4P1B C;  1F1H A;  2EMT A;  1JML A;  4PYU A;  1D5Z C;  3VDZ A;  1DGJ A;  3NZ3 A;  3WA0 A;  4W9E A;  1TS4 A;  1EF5 A;  1YQB A;  5CHV C;  1KF6 B;  1V8C A;  3CF6 E;  2HTH A;  3KH0 A;  2K3U A;  1NEN B;  2LRU A;  1R7S A;  1PUT A;  1F2R C;  3N32 A;  2MH7 A;  5DPR A;  3UIO B;  3H8H A;  4M8N A;  4W9I A;  1F52 A;  1GB1 A;  1HZ6 A;  3AEE B;  3ZTC A;  1BUI C;  3DBS A;  4XDC A;  1RFA A;  4CYE A;  4ARI A;  1FPY A;  4TSS A;  1TZO A;  2BS3 B;  4I6L B;  3AN1 A;  1V6E A;  4BKS A;  3KYC D;  3CMM B;  1BXT A;  4HK2 A;  1FFV A;  3T3N A;  4OZB A;  5KHQ A;  3QX1 A;  1IGD A;  2KC1 A;  4RGN A;  3N3K B;  3QQ8 B;  3RNB C;  4HKQ A;  3JW0 X;  3SHQ A;  4NQK E;  1EWY C;  1T0S C;  2RSU A;  5D6J B;  3ZNZ B;  1XO3 A;  2KFK A;  5JHB A;  2DYO A;  2K9X A;  3MFG A;  4B6W A;  3VUX A;  2KD0 A;  2BTE A;  2BYV E;  3CSF A;  1LM8 B;  3RNC C;  3PV1 A;  1WX9 A;  2V3P A;  1FFU A;  2SEB D;  4JWS C;  1IP9 A;  2V0G A;  2AQ3 B;  1VRA B;  2RR9 A;  1V5O A;  1WM3 A;  2FUH B;  2D3B A;  3MJW A;  3UQA A;  1I4H A;  1MJD A;  2NPT A;  4NJ7 A;  1WGY A;  3PRZ A;  1U4A A;  1SIJ A;  3A33 B;  1ZKH A;  2QCZ A;  3ML9 A;  2R61 A;  2C9W B;  3L0W B;  1F9J A;  2C60 A;  4KGT A;  1FEH A;  4MH0 E;  5AEK B;  3ZRC A;  1PGA A;  2PE6 B;  3OLM D;  2WXN A;  4C56 C;  1NDD A;  3DOW A;  2BGF A;  2JXT A;  3GE8 C;  1L5P A;  4FHJ A;  4WIP A;  1T0Q C;  4GDL A;  3R2I A;  4OVV A;  5DCN A;  1KRH A;  1RM6 C;  3NVZ A;  1H8C A;  4MEM A;  1V81 A;  2KFK B;  2PJH A;  3RNA C;  2QIE B;  4DK5 A;  2PVO D;  1V86 A;  1HEZ E;  2J7Q B;  3NRZ A;  4D2K A;  3UI3 A;  5E6O A;  3AE5 B;  3AEF B;  4OZA A;  3Q8E A;  2XN9 C;  5AUI A;  2KX3 A;  1V2Y A;  3JSV A;  3AE9 B;  1V1P A;  2D3A A;  3P4R B;  2PE9 A;  4P1C C;  4AJW A;  1QOF A;  5HKH A;  1VZ6 A;  3RMK C;  2BKF A;  2VZK D;  3K9P B;  2D3C A;  1VZ7 A;  1HTO A;  2KLC A;  2KT7 A;  3D32 A;  3DBL B;  3PZD A;  3SFD B;  4GOC A;  1PFD A;  1C3T A;  4J6I A;  3N1Y C;  2K22 A;  3ENE A;  4ICU A;  4ZRK A;  1WR1 A;  3EA6 A;  3U52 E;  3AB5 A;  4A90 A;  3DHG C;  1FCC C;  5EE9 A;  3LYY A;  3IT4 B;  4YSY B;  2MQJ A;  1UBQ A;  5EE1 A;  4P16 A;  1I42 A;  2IY1 B;  3RCZ A;  4K7S A;  2ZZP B;  4ZRI A;  3ONS A;  3K9O B;  4XX5 A;  1WYG A;  3AE3 B;  2IDY A;  4XWW A;  2WDT B;  2LI5 A;  3ZNI D;  3JSV B;  1N6Z A;  3DBH I;  1V1P B;  5T8I A;  1B9R A;  4REZ A;  1NBF C;  3I63 C;  3HIZ A;  2MCN B;  2WDV B;  3I3T B;  5TSS A;  4FHK A;  4M0W A;  3I57 A;  4A9A A;  3AE1 B;  4XDD A;  3HHM A;  1GC6 A;  4K1R B;  3P4P B;  1N62 A;  3P42 A;  4IKG A;  4ANV A;  4OVU A;  1C78 A;  3LJ3 A;  1RAX A;  3QA8 A;  1FO4 A;  3U7D A;  3BVM A;  2H88 B;  2HTM E;  2J0J A;  2KN5 A;  2Y5C A;  1WGD A;  4EZL A;  1SE2 A;  3TEW A;  3NJT A;  2MP2 A;  3AED B;  2J0K A;  3PVL A;  4CQN A;  4IM0 A;  2UWQ A;  2PPH A;  1KM7 A;  3RNE C;  2X38 A;  5BYR A;  5DPW A;  1C4A A;  2IGD A;  1HXY D;  4JGH B;  1SSN A;  2HJ8 A;  1AAR A;  3DVN V;  5FR6 A;  2L3Z A;  3T9L A;  2INP E;  5AUK A;  1ZGU B;  1E8X A;  3PLU A;  3QAQ A;  3O65 B;  1WGG A;  1M94 A;  3E56 A;  2BVC A;  4FAD A;  1XD3 B;  5JHA A;  2DLB A;  2MLB A;  1GOZ A;  2FBW B;  4LNK A;  3ZUN A;  2M1M A;  2WDQ B;  4M0W B;  3RYT A;  3BIN A;  1L7Y A;  3AUL A;  2GBK A;  4N9F 4;  2KFJ A;  3WAO A;  5EDS A;  2WXP A;  2BB6 A;  4II3 B;  1E90 A;  1WZ3 A;  3Q3O C;  4M02 A;  2G9H D;  2BKR B;  4GDK A;  3WIM A;  2ZW0 A;  1HQR D;  2KVZ A;  2FID A;  2WP9 B;  4LNF A;  1FD6 A;  3IAM 1;  1XLP A;  4NAW B;  3R66 C;  2KMC A;  2LD9 A;  2LXA A;  4RM9 A;  4DXA B;  3LB8 C;  1E8W A;  4KGR A;  2EKI A;  3GS2 A;  3R7Q A;  3QWZ B;  1FXT B;  3AU4 A;  4JE3 B;  3RZW C;  4EKU A;  3Q2A C;  2NBV B;  1UWX A;  1YIW A;  2OOB B;  3RN9 C;  3VH4 B;  1T6B X;  4WQM A;  2N7J A;  2M0X A;  2K8B A;  3AM9 A;  4NAM A;  3U7Z A;  2BWF A;  4RFB A;  5E6P A;  3VRA B;  4FLH A;  2PTL A;  2WXJ A;  4EZK A;  2NR2 A;  2KQ7 A;  1V5T A;  1WFY A;  3V6C B;  4PS3 A;  3W5V B;  5AZG A;  2ACZ B;  1GNU A;  2V9H A;  2LVQ A;  3KUD B;  4WUR A;  3BZD B;  1FXI A;  3T8M A;  5BMH A;  3WAM A;  2KAN A;  3PT2 B;  3PS6 A;  3WAN A;  4I6P A;  3ZDM C;  2E6X A;  1WJ4 A;  3KUC B;  3ZKJ C;  1WGH A;  1QF6 A;  1V97 A;  4US8 A;  1I4G A;  1XT9 B;  2JYT A;  4RCO A;  1I35 A;  4TUU A;  2MHJ A;  2JF5 A;  2YVC A;  1MHH E;  2H89 B;  5LNK 1;  1E7U A;  2K39 A;  1PQS A;  2LVP A;  4C4V A;  2J4X A;  3Q6B A;  2D2Q A;  4JL9 A;  1JQ4 A;  1YN3 A;  4DXG A;  3M63 B;  2JY6 A;  2MEK A;  2CHW A;  4DHJ B;  2A5U A;  1QIL A;  3VR9 B;  2RPV A;  2QSD A;  3HM3 A;  4IW0 A;  4MGI E;  3PTF C;  2IO0 B;  1QLB B;  2MBE A;  4L1B A;  1KJT A;  3VTW A;  3EHV A;  4AS1 A;  1KOT A;  3Q69 A;  1AW7 A;  1YJJ A;  4WAF A;  4MSM B;  2RPQ A;  2IZV B;  3L17 A;  1C77 A;  1YJI A;  2KQS A;  2R2Q A;  2KDF B;  1RRB A;  4PK1 A;  5H8Y E;  2VRR B;  2WXH A;  4BKT A;  3IHP C;  2O6V D;  1FNV A;  3ZO5 B;  1GG3 A;  4AJY B;  2CR5 A;  2ZVO A;  1DYQ A;  1V49 A;  5L83 A;  3KLS X;  2ZW1 A;  3WCQ A;  5DPS A;  3Q3N C;  1NI2 A;  3DQV A;  1KLV A;  4B9K A;  2BF8 B;  4C4V B;  3Q8F A;  2N1W A;  3FAH A;  4LLG M;  1SE3 A;  3ZW3 A;  1UH6 A;  2LGY A;  2KO3 A;  3B0A A;  4MT5 A;  1VCB A;  4G50 A;  1XLO A;  2GBJ A;  3IVF A;  1ENF A;  1OQQ A;  2JYE A;  1GAQ B;  1R4N B;  2N7D A;  3ZGZ A;  3B2F A;  4ASW C;  2KOX A;  4WJO A;  2MW5 A;  2NCN A;  4K7W A;  2YEP B;  2IO1 B;  1ZXH A;  2WGS A;  1YNT E;  4E71 A;  3H7S A;  1K8R B;  4PS8 A;  4HPM B;  4AQ7 A;  1D6E C;  2O2V A;  1ZOY B;  4MGK E;  4AOF A;  4BFR A;  3VTV A;  2N9E B;  2XNA C;  4ZRQ A;  4JX1 C;  1BML C;  1T0R C;  3RZF A;  3L13 A;  4J3O D;  1J0G A;  2L83 A;  4TKN A;  1N63 A;  3TEZ A;  3L54 A;  1TGZ B;  4NY0 A;  1UF0 A;  3KQ4 A;  2LWP A;  4NNJ B;  3PRE A;  1J8C A;  2L32 A;  2BS4 B;  2BT6 A;  3B2G A;  3SDL C;  4HXD A;  3DBR B;  3AMZ A;  1F77 A;  3BY4 B;  5BMG A;  2C7H A;  4KIK A;  3BYY B;  3TIX A;  2W55 A;  2CHX A;  4MDK E;  4LDT B;  4PS7 A;  1S1Q B;  4HPL B;  4A8X C;  2CKH B;  2SAK A;  1C4P A;  4YXD B;  2V4L A;  2N4F A;  3ETR A;  1QQR A;  4W9D A; 
#chains in the Genus database with same CATH homology
 1C3T A;  1E8Z A;  2M8S A;  4J6I A;  3VTU A;  1EO6 A;  1P3Q U;  3L10 B;  3ZNH B;  2IO3 B;  2KDI A;  3ENE A;  1E5W A;  4ICU A;  4ICV A;  1XQQ A;  1WR1 A;  2K6D B;  4ZRK A;  3VAW A;  3KUZ A;  2ZEQ A;  4K81 A;  4JQW C;  1TTN A;  2NS5 A;  2ZJD A;  2KTR A;  1WMH A;  2KKC A;  2ASQ A;  2BYE A;  1VD2 A;  3A9K A;  2KC2 A;  3PSE B;  4WWP A;  3EFU A;  3C0R B;  1OEY A;  4FJY A;  1UBI A;  3WAP A;  2K8H A;  1GJZ A;  3DDC B;  4IWQ A;  3VVW B;  2MQJ A;  2WX1 A;  2G4D B;  1UBQ A;  4GGQ A;  2CU1 A;  2DX5 B;  3QC8 B;  1WI0 A;  2CHZ A;  4KDL B;  3ECI A;  5DPT A;  1I42 A;  2B3A A;  2L0F A;  5G2N A;  2IY1 B;  5CHW A;  2IYD B;  2D3G A;  3RCZ A;  2J0M A;  2LXC A;  5JH5 C;  1WE6 A;  4NQL B;  1WH3 A;  4K7S A;  2ZZP B;  2Z0E B;  3X0W A;  3M62 B;  1WIA A;  2DAJ A;  4ZRI A;  4W9L A;  3ONS A;  4URK A;  3APD A;  3UGB B;  2C7N B;  3K9O B;  4GB9 A;  4XX5 A;  2JWZ A;  2WDT B;  2FNJ B;  2LI5 A;  3ZNI D;  3JSV B;  3DBH I;  4IM3 A;  2Y5B B;  5TR5 A;  1P98 A;  3PPA A;  3U8Z A;  4KIK B;  2Z59 B;  4G0N B;  3UIP B;  5J18 A;  1V9J A;  1G6J A;  1NBF C;  2MBB B;  4MEL A;  4HDQ A;  3HIZ A;  2MCN B;  5LXI B;  3I3T B;  2JPH A;  4FHK A;  3DVN U;  4KZ0 A;  1S3S G;  5D2M B;  1WJN A;  1OEY J;  3HHM A;  1GC6 A;  2JUO A;  2FCN A;  4GMV A;  4IWP A;  4ANX A;  3QK0 A;  3RUL A;  4BBN F;  4K1R B;  4F7Z A;  4AUQ C;  5G55 A;  4FBJ B;  3RUI B;  1WE7 A;  3EEC A;  4EFO A;  1UEL A;  2LVO A;  4E3C A;  2LZ6 A;  4NJ6 A;  1X1M A;  4ANV A;  4OVU A;  2XBB C;  3LJ3 A;  1RAX A;  3QA8 A;  1CMX B;  3H9D A;  2L7R A;  3U7D A;  2KTR B;  1BT0 A;  2J0J A;  1WMH B;  2KN5 A;  2EKE C;  3B08 A;  1Z2M A;  1WGD A;  3CST A;  4AWJ A;  4EZL A;  4W9K A;  3A9K B;  3QIJ A;  4KDI C;  3W1S C;  2MP2 A;  3ZVV A;  2J0K A;  3PVL A;  2LJ5 A;  2KDE B;  4IM0 A;  1MG8 A;  2UWQ A;  3NHE B;  4FA6 A;  3APF A;  1TZ1 A;  3PLV A;  2PPH A;  3A4R A;  4F1S A;  2DHZ A;  1KM7 A;  2N9P C;  3H7P B;  4HWI B;  1JRU A;  1WZ0 A;  2REX A;  2WYQ A;  5DPW A;  1L2N A;  1UZX B;  4W9G A;  3APC A;  1WGR A;  4EOY A;  2K1F A;  4LJO B;  1UGM A;  2MWS B;  4JGH B;  2DZI A;  5AZH A;  1WR6 E;  2CS4 A;  5LXH A;  1SE9 A;  2HJ8 A;  1AAR A;  3DVN V;  3DVG X;  3GZN I;  3W1S A;  3KW5 B;  5FR6 A;  3V62 A;  2FCS A;  2UYZ B;  3TCA A;  4CO7 A;  2JRH A;  2L3Z A;  3DBR I;  2NPT B;  3T9L A;  4ZYN A;  4MGY E;  3EC8 A;  1ZGU B;  3V6E B;  1E8X A;  3PLU A;  2ZVN A;  1UD7 A;  2KLG A;  3QAQ A;  1Q0W B;  1YD8 U;  2BYF A;  4IM2 A;  2N9X A;  3O65 B;  1WGG A;  1M94 A;  1OGW A;  4FAD A;  1XD3 B;  5JHA A;  4A3P A;  4XC2 A;  2L05 A;  2MLB A;  2DZJ A;  4LJP B;  2IBI B;  2NBW B;  3PHX B;  1Q5W B;  4HVB A;  3ZUN A;  4KZC A;  2M1M A;  4M0W B;  3RYT A;  2BWE S;  3BIN A;  2AL3 A;  2M4N A;  1Z5S B;  3IFW B;  1L7Y A;  1H4R A;  2MBO A;  3AUL A;  4M8M A;  3VQI A;  1Q1O A;  2DZK A;  3JVZ X;  1V80 A;  2GBK A;  4N9F 4;  4WWO A;  4DDI D;  1LXD A;  1WXV A;  2GOW A;  2KFJ A;  3WAO A;  4TQ0 A;  5EDS A;  3OJ4 B;  2DAF A;  3RD2 A;  2C7M B;  4II3 B;  1IYF A;  1E90 A;  1WZ3 A;  2KK8 A;  4GDL B;  2OJR A;  4WJQ A;  4GDK A;  2BKR B;  3WIM A;  3R7R A;  2WWZ A;  3L08 A;  2FID A;  2O2V B;  2KJ6 A;  4W9C A;  2GBN A;  3Q3F A;  4BOS C;  4MJS A;  1P1A A;  2XEW A;  3AI5 A;  4PYZ A;  4NAW B;  3R66 C;  4P7I A;  4WQO B;  2MBH A;  2L0T A;  2KMC A;  2LD9 A;  1LQB A;  2LXA A;  4IWO A;  3KYD D;  2KHW B;  1YX6 B;  4RM9 A;  2IO2 B;  2EMS A;  3GOE A;  5IAA C;  4DXA B;  1SIF A;  1E8W A;  4BVU C;  3VH3 B;  3R7Q A;  4HDO A;  3QWZ B;  3NS8 A;  1FXT B;  3PRP B;  3AU4 A;  3RZW C;  4EKU A;  3A9J A;  3QHT A;  3ZDT A;  3IG3 A;  2NBV B;  3UIN B;  1YIW A;  2OOB B;  3R3M A;  4W9J A;  1EUV B;  3JYU A;  3VH4 B;  3A1Q A;  2M17 A;  2N1V A;  2I1J A;  2V3S A;  2MA9 B;  1OTR B;  4KSL C;  4WJN A;  3TBL D;  3ZTD A;  4DBG A;  4BBN C;  2M0X A;  2K8B A;  5CHF A;  2AWT A;  1R4N I;  4NPN A;  1ISN A;  2BWF A;  2ZNV C;  2NVU I;  5E6P A;  2FIF A;  3NOB A;  4ZRJ A;  2KJR A;  3QJZ A;  4BOZ B;  3H6N A;  3DVG Y;  2ZCC A;  1EF1 A;  4FLH A;  4EZK A;  3KVF B;  2NR2 A;  2KQ7 A;  1ZW7 A;  1V5T A;  1WXA A;  1WFY A;  1WY8 A;  2MRP A;  4YL8 A;  3V6C B;  3RT3 B;  1D3Z A;  4PS3 A;  4JLC A;  5KHO A;  3VHT C;  1WYW B;  1TBE A;  4MGZ E;  5AZG A;  2JVC A;  3OAW A;  4JIO U;  3DPD A;  4LCD E;  4IC7 B;  3P2B A;  1GNU A;  2LVQ A;  3HK0 A;  3H1U A;  3KUD B;  4F8C B;  5GMV A;  1RLF A;  2MBQ A;  1HE8 A;  3T8M A;  4EUT A;  3ZLZ A;  3DCG A;  3OJ3 A;  4FJZ A;  3ZNG C;  4A3O A;  4MJS B;  4DHZ B;  4GSW A;  3WAM A;  2D07 B;  2KAN A;  3M95 A;  4ZDV A;  2GBM A;  3LDZ E;  3PT2 B;  3PS6 A;  4HCP B;  4I6P A;  3WAN A;  3ZDM C;  5IA7 A;  1GUA B;  1WJ4 A;  2ZPY A;  3KUC B;  2JXX A;  1WGH A;  3ZKJ C;  2I1K A;  2KNB A;  3V61 A;  3UQB A;  5J17 A;  4DDG D;  1XT9 B;  2KWC A;  4E74 A;  1J19 A;  2KDB A;  1I35 A;  2EMT A;  4TQ1 A;  2YLM A;  4DHJ D;  4TUU A;  2WX0 A;  1SGH A;  4BKG A;  4PYU A;  2LGD A;  3VDZ A;  2JF5 A;  2YVC A;  4K7U A;  2L76 A;  4W9F A;  3WA0 A;  4W9E A;  3A9J B;  1E7U A;  1EF5 A;  1YQB A;  2K39 A;  2C5L C;  2BPS A;  5E6N A;  4KSK C;  1YJ1 A;  5CHV C;  2O6V A;  1PQS A;  2DYM A;  2LVP A;  2MSE D;  3A1Q B;  5BO4 B;  2RGF A;  4I6N B;  3CF6 E;  2D2Q A;  4JL9 A;  5CX3 A;  2HTH A;  3PHW B;  4LDT D;  3ZRF A;  3KH0 A;  3M63 B;  2JY6 A;  2CHW A;  4DHJ B;  2A5U A;  2LRU A;  4IG7 B;  3X23 A;  3TJP A;  1WXS A;  3QAR A;  5DPR A;  3N32 A;  3SD5 A;  2KWU B;  3UIO B;  3L16 A;  4M8N A;  4W9I A;  2LGX A;  3ZTC A;  4EEW A;  2AL6 A;  3HM3 A;  3DBS A;  4IW0 A;  1RFA A;  2DYB A;  3M3J A;  5C23 A;  3DBL I;  1WJ6 A;  1WX8 A;  4CYE A;  4MGI E;  3PTF C;  1GC7 A;  2IO0 B;  1WF9 A;  2MBE A;  4I6L B;  3TL5 A;  1KJT A;  1V6E A;  2KWV B;  3KYC D;  3NZS A;  4G11 A;  3EHV A;  3CMM B;  3U30 A;  3VTW A;  4BKS A;  4HK2 A;  1KOT A;  1P0R A;  2IY0 B;  2D11 A;  2L00 B;  4GU2 A;  1E8Y A;  5KHQ A;  4II2 B;  4WAA A;  3QX1 A;  4MSM B;  5D94 A;  2N7E A;  2RPQ A;  2IZV B;  3L17 A;  4DHZ E;  2KC1 A;  2KQS A;  3VFK A;  3N3K B;  3Q3J A;  2LUE A;  2KDF B;  2R2Q A;  1RRB A;  2MP2 B;  3QQ8 B;  2L8J A;  2RD0 A;  3A4S C;  2KTF A;  2VRR B;  1OQY A;  2G45 B;  4BKT A;  3IHP C;  3JW0 X;  2O6V D;  3SHQ A;  2FCQ A;  4B95 A;  2PEA A;  4NQK E;  3ZO5 B;  1GG3 A;  5JHB A;  2RSU A;  5D6J B;  3ZNZ B;  2KFK A;  2CR5 A;  2ZVO A;  4GXB A;  4RMA A;  4AJY B;  2DYO A;  4ANU A;  3MTN B;  3VXW A;  2AEH A;  1V49 A;  4B6W A;  3VUX A;  5L83 A;  2JZ3 B;  1WJU A;  1WXM A;  3PRM B;  2V1Y A;  4TV3 A;  2GBR A;  5DPS A;  2KD0 A;  2BYV E;  3CSF A;  3H7P A;  1LM8 B;  2O6V B;  1NI2 A;  3DQV A;  1KLV A;  3PV1 A;  4B9K A;  2BF8 B;  3N30 A;  4W9H A;  1WX9 A;  4GIV A;  2N1W A;  4CHK A;  2MX2 A;  1A5R A;  4ANW A;  1IP9 A;  2GMI C;  2KX0 A;  2RR9 A;  2A4Z A;  1V5O A;  1WM3 A;  2DZM A;  2JT4 B;  4HLE A;  2FUH B;  4BKS D;  3ZW3 A;  1UH6 A;  2LGY A;  5D7G A;  2KO3 A;  2K6Q A;  3B0A A;  2XK5 A;  3AXC A;  2KMA A;  3MJW A;  4FN2 A;  1VCB A;  2KJH B;  4XZ4 A;  1WM2 A;  4G50 A;  4NJ7 A;  2NPT A;  3UQA A;  1WGY A;  1P9D U;  2DEN B;  2GBJ A;  3IVF A;  4GN1 A;  4MSQ B;  3PRZ A;  1U4A A;  1C1Y B;  3SU8 X;  3A33 B;  2N7D A;  1ZKH A;  3ML9 A;  4FUL A;  4IUM B;  5AZF A;  2Z0D B;  2KZR A;  5CTR C;  2C9W B;  3L0W B;  1F9J A;  5J2R A;  2C60 A;  2KVR A;  4KV2 A;  4MH0 E;  5AEK B;  2G3Q B;  3ZRC A;  4ASW C;  4WJP A;  1WX7 A;  2KOX A;  3IBE A;  2MW5 A;  4WJO A;  1R4M I;  2NCN A;  4K7W A;  4GDK B;  4EZJ A;  2K8C A;  2PE6 B;  4X57 B;  2IO1 B;  3OLM D;  4E71 A;  2QHO A;  3ML8 A;  4MM3 A;  2HE7 A;  3H7S A;  1NDD A;  3DOW A;  3VUY A;  1K8R B;  4PS8 A;  5C1Z A;  2BGF A;  4FHJ A;  4HPM B;  3TMP B;  4GDL A;  1LFD A;  1E7V A;  3V60 A;  4OVV A;  5DCN A;  5L95 C;  3W1Y A;  2LAS A;  2O2V A;  3S2A A;  1H8C A;  4MEM A;  4MGK E;  2KXJ A;  3QCA A;  3WAL A;  4AOF A;  3AU5 A;  1V81 A;  4BFR A;  3VTV A;  2KFK B;  1T0Y A;  2JZZ A;  2N9E B;  1IPG A;  2PJH A;  4NAW A;  4RM8 A;  5JZE B;  1Y8R C;  4DK5 A;  1V86 A;  3RZF A;  2J7Q B;  3L13 A;  1J0G A;  2FCM A;  2FAZ A;  2W9N A;  2K25 A;  4TKN A;  2JRI B;  5E6O A;  2G4S A;  2NBU A;  3L54 A;  4G3X B;  1TGZ B;  4NY0 A;  4NNJ B;  3VUW A;  2LWP A;  4FJV B;  3PRE A;  1J8C A;  4HJK A;  2D10 A;  3PGE A;  3SDL C;  1WRD B;  4HXD A;  4KVG B;  3BY4 B;  2KX3 A;  3MHS D;  1V2Y A;  4HCN B;  3JSV A;  3ZIM A;  2XK5 B;  3NZU A;  2PE9 A;  2HD5 B;  2C7H A;  4KIK A;  4AJW A;  3B1L X;  1YX5 B;  4WWN A;  5HKH A;  3TIX A;  2CHX A;  4A20 A;  3HM6 X;  4MDK E;  4LDT B;  3NY5 A;  3UF8 A;  4AP4 C;  4PS7 A;  1S1Q B;  3ALB A;  4DWF A;  2BKF A;  2R2O A;  4HPL B;  2CKH B;  3K9P B;  5LLI A;  1QZE A;  2V4L A;  2N4F A;  2AYO B;  2ZPN A;  2ZNV B;  2KLC A;  3D32 A;  2ZCB A;  2LRW A;  3PZD A;  4GOC A;  4W9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...