1L2NA

Smt3 solution structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
b'ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Solution structure of a yeast ubiquitin-like protein Smt3: the role of structurally less defined sequences in protein-protein recognitions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 8
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l2nA00
1EO6A 2GBRA 4II3B 3UGBB 1IYFA 4HCPB 2K8HA 2GBMA 2MW5A 1A5RA 2D3GA 4GDKA 2L05A 3AI5A 2L0FA 2ZZPB 1WFYA 2G3QB 2OOBB 2J7QB 2LRWA 2AL6A 1WE7A 2LVOA 3QARA 4TUUA 4BBNF 1T0YA 2ZNVB 3ZRCA 4B9KA 3APFA 4G0NB 4AJWA 3UQAA 4LCDE 2IY0B 2GOWA 2M8SA 1WM2A 5DPRA 2KVRA 2JPHA 3WAMA 3KVFB 3IFWB 3V6CB 3GZNI 2WX0A 2K8BA 3A9JB 2JT4B 1WRDB 2OJRA 3NY5A 2ZVOA 3PLVA 2C60A 2ZCCA 3PPAA 3JSVB 4BKSA 1I35A 2MBEA 5JHAA 4KIKB 5C1ZA 2IO2B 2ZVNA 3TJPA 4IM3A 1RFAA 1FXTB 3DBRI 3PHXB 3ZW3A 4DHZE 5LXIB 2WX1A 2KQ7A 4WQOB 4K7UA 1P3QU 1E8XA 3HM6X 2DAJA 4CHKA 3ZDTA 2N1VA 4DBGA 2B3AA 3L0WB 2BKRB 5GMVA 4FLHA 2G4DB 3R66C 3B1LX 2KZRA 3APCA 2MBHA 4GGQA 1V86A 2MBBB 4FA6A 1SGHA 2JZ3B 2KOXA 3QIJA 5BO4B 3N30A 1WXMA 3H6NA 2MLBA 4KV2A 4F8CB 4HVBA 3QCAA 3VTWA 4BKTA 3PREA 4GDLB 4LJPB 4X57B 5DPSA 3ENEA 2N7EA 5D7GA 3UIOB 2J0KA 2KC2A 3A4SC 4KSKC 5JH5C 1YD8U 3D32A 3Q3FA 3ZRFA 4K7WA 2K6DB 3H7PB 3ONSA 4K7SA 4II2B 3VDZA 1WX9A 4HXDA 3WAOA 3L08A 4FN2A 2LUEA 1UBIA 2C7NB 2KD0A 1E8WA 3RZFA 4ANWA 5HKHA 1IP9A 1U4AA 4BBNC 2UWQA 4EKUA 3VUWA 2FCMA 4F7ZA 4FJYA 4I6LB 2JRIB 4NJ7A 1E7UA 3DQVA 4GN1A 5CX3A 1V5TA 4XC2A 2BKFA 2LGYA 4I6NB 2NPTB 5C23A 1GUAB 2O2VA 3A1QB 4HCNB 3B08A 3V6EB 1SE9A 1YX5B 2KK8A 1VCBA 3PV1A 3P2BA 5D94A 3ZNHB 1YX6B 4ASWC 5J2RA 2KTRA 1X1MA 2ZEQA 3PLUA 4LDTB 2I1JA 2LGXA 1WGYA 1C3TA 1E7VA 5LXHA 4KSLC 2JUOA 4GXBA 5J17A 4G11A 2HJ8A 2YLMA 4HK2A 4GU2A 4K1RB 2GBJA 1HE8A 2K25A 2Z59B 3WIMA 4HWIB 3U8ZA 4WWNA 2N9EB 4FULA 2CHXA 4JLCA 3A33B 2FUHB 3PZDA 4AWJA 1WJUA 2KJHB 5AZHA 2NBVB 1L7YA 3TCAA 1WZ3A 4CO7A 5E6OA 3PRMB 4PYZA 3W1SA 2DX5B 3UIPB 4AOFA 2D2QA 4OVVA 2IO3B 2KDBA 3ZNGC 4EZLA 4BFRA 1OEYJ 1UZXB 2MSED 3HM3A 4WWOA 2FCQA 3ZTCA 4W9GA 3VHTC 1V5OA 3PSEB 4AP4C 4DXAB 1Z2MA 1F9JA 3HHMA 3R7RA 1ZKHA 2KJRA 1VD2A 3QK0A 2KLCA 2AEHA 3K9PB 4NQKE 4NNJB 5AEKB 3WA0A 3DVNU 2PPHA 1PQSA 1UBQA 4B6WA 5D2MB 1WMHA 4GDKB 1EF5A 1WXAA 4HDQA 2AYOB 4ANVA 2KFKA 2XEWA 2BYFA 1P9DU 2KX3A 4GMVA 2GBKA 3VH4B 3VXWA 2O6VD 4GB9A 4PS8A 3SHQA 1YIWA 3DVGX 2RSUA 4XZ4A 2KMCA 1WH3A 4GIVA 4W9FA 3H7SA 3Q3JA 4J6IA 4MGYE 1OGWA 1SIFA 4IWOA 4W9KA 2K1FA 4AUQC 2KX0A 3EC8A 3PRZA 4TQ0A 2KQSA 2MBQA 1UELA 3L13A 3DPDA 5AZGA 2CHZA 3MHSD 4JL9A 1GC7A 4E74A 1GJZA 4KZ0A 2KWVB 3PT2B 4MSQB 5G55A 4DDID 4I6PA 1NI2A 1OEYA 2KMAA 2WYQA 1Q0WB 3L16A 3X0WA 4DDGD 4MGIE 1WGGA 3QC8B 2ZPNA 3X23A 4EEWA 3QWZB 5JZEB 3R7QA 1V49A 4A3OA 4N9F4 1LQBA 3QX1A 2BYVE 3JYUA 3C0RB 3WANA 4BOSC 2IYDB 4MGZE 2M4NA 2R2QA 3S2AA 3VTVA 4WAAA 3M63B 1TZ1A 2YVCA 3KUCB 3VTUA 3AU4A 2J0MA 2C5LC 2C9WB 1QZEA 1V6EA 2V4LA 1R4MI 3QJZA 4ZRKA 1WZ0A 3QHTA 5EDSA 4RMAA 2MRPA 4W9EA 3T8MA 2KXJA 3KUZA 4FHKA 2XBBC 1GC6A 2W9NA 1NDDA 3N3KB 5CHFA 4DHJB 4W9LA 4RM9A 4FBJB 2ZJDA 4W9JA 4BOZB 2RD0A 1WX8A 3R3MA 1E5WA 3GOEA 2O6VA 1WYWB 2CKHB 3DVNV 4A3PA 1ZW7A 2BYEA 2DHZA 3ALBA 3JVZX 4ZYNA 3OJ3A 2EMTA 3L54A 4LDTD 2O2VB 3ZKJC 5AZFA 3TIXA 2J0JA 2I1KA 4MSMB 4ANUA 1KJTA 1UH6A 1M94A 2BWFA 2QHOA 3TL5A 2JF5A 2KTRB 3IHPC 3PS6A 4TKNA 3V61A 2GBNA 2RGFA 2ZNVC 4G3XB 3EHVA 2NCNA 3ECIA 4ICUA 1J19A 4IM2A 3TMPB 2ASQA 5TR5A 1S1QB 2N1WA 2K6QA 1NBFC 4G50A 1OQYA 2CR5A 3VH3B 2FIFA 1EUVB 2MBOA 3IBEA 4MJSA 1Y8RC 2KN5A 3ML9A 1K8RB 2FIDA 1ZGUB 4MDKE 2XK5A 2RR9A 4MH0E 3HIZA 4ZRJA 3QA8A 1LFDA 3NS8A 4DHZB 4EFOA 1WJ4A 2LZ6A 5IAAC 4TQ1A 4DWFA 2CS4A 2REXA 2BGFA 3JW0X 4FADA 2KDFB 3KH0A 4FJZA 5KHOA 3V60A 2V1YA 5L95C 2KNBA 3A9KA 4MELA 1KM7A 2MP2A 4NAWB 1WJ6A 2A5UA 3MTNB 4IW0A 2ZCBA 3T9LA 2PE6B 2LGDA 2N9XA 4MGKE 3WALA 1WY8A 2BF8B 3RD2A 3M62B 4PYUA 3OAWA 1E8YA 1WMHB 1WM3A 1V81A 2KO3A 2M17A 3V62A 3UQBA 1WIAA 5E6NA 3L17A 2NR2A 3ZVVA 1KLVA 2KFKB 4HDOA 4NAWA 4M8NA 2LRUA 5CHWA 2IO1B 1XT9B 4BKGA 1WXVA 2KDEB 3HK0A 3VAWA 3DDCB 1J0GA 2Z0DB 4GOCA 4IC7B 4DK5A 5G2NA 4BKSD 4WJNA 1V9JA 2IBIB 3SDLC 1IPGA 2MWSB 2KFJA 3ZIMA 1V80A 5LLIA 1Q1OA 4IM0A 4IWQA 2IZVB 3PRPB 4JQWC 3DVGY 1Z5SB 4KZCA 3EECA 4WJPA 3CMMB 3W1YA 2IO0B 4M8MA 3IVFA 3U30A 2DZMA 3DCGA 4ZDVA 2N4FA 2KKCA 1MG8A 2NBUA 3VVWB 2KWUB 3DBSA 2PJHA 2JWZA 2FCSA 2LVQA 1WGRA 4E71A 3RCZA 3LDZE 4NQLB 2JZZA 2L00B 3M95A 3ZDMC 2DZKA 2K39A 1GG3A 4MEMA 1E90A 1ISNA 1RLFA 2CU1A 5CTRC 3IG3A 4HPLB 2LVPA 3RUIB 5DPWA 3NHEB 2K8CA 4WWPA 3RT3B 1GNUA 4E3CA 2MQJA 2Z0EB 3BY4B 4MM3A 4JGHB 2BPSA 4IG7B 4DHJD 1TGZB 3CSTA 3U7DA 5CHVC 4W9HA 4A20A 2G45B 1J8CA 4B95A 3ZNID 1WGHA 3ML8A 2D10A 1I42A 1E8ZA 3VUYA 2L76A 4XX5A 2DENB 4GSWA 5KHQA 3O65B 1WR6E 3PTFC 2IY1B 5E6PA 2O6VB 2FCNA 2PEAA 3DOWA 4M0WB 2L0TA 4WJOA 5DCNA 3QQ8B 3QAQA 3CSFA 1AARA 3M3JA 3PVLA 4TV3A 4W9CA 2D11A 3RULA 4F1SA 2EKEC 2N9PC 5IA7A 4K81A 3AU5A 1L2NA 2DZJA 3A9JA 3DBLI 1WF9A 1Q5WB 2NS5A 2N7DA 4KDIC 3RYTA 3VFKA 3WAPA 2L7RA 1WR1A 4ZRIA 3JSVA 1WXSA 4IUMB 4W9DA 2JVCA 2LJ5A 4RM8A 4KIKA 2KDIA 4FHJA 4JIOU 3ZUNA 3KYDD 3OLMD 1TTNA 2FNJB 2LWPA 3H1UA 3OJ4B 2KLGA 4PS7A 2R2OA 4ICVA 3DBHI 1CMXB 3K9OB 4KDLB 4MJSB 3KYCD 1H8CA 2DAFA 2EMSA 2XK5B 1RRBA 1UD7A 2Y5BB 1P1AA 2M0XA 4WJQA 2MCNB 2C7HA 2GMIC 2FAZA 3VUXA 5JHBA 3A4RA 2L3ZA 3VQIA 4GDLA 2L8JA 4FJVB 4URKA 2CHWA 3KUDB 3AULA 4LJOB 2A4ZA 3UINB 2MX2A 3A9KB 3PHWB 1XQQA 2LD9A 1JRUA 1P0RA 2MP2B 3H7PA 3KW5B 4CYEA 3ZO5B 1WE6A 1G6JA 2ZPYA 2HE7A 3RZWC 1LM8B 2V3SA 3NZUA 3SD5A 2KANA 4EZKA 2HTHA 1WX7A 2NBWB 2DYOA 4P7IA 4YL8A 1OTRB 2NVUI 4AJYB 4ANXA 3UF8A 1D3ZA 5FR6A 2WDTB 4NY0A 2DZIA 2RPQA 3H9DA 2JRHA 2NPTA 3APDA 2JY6A 3CF6E 1LXDA 3NZSA 3ZNZB 4BVUC 3A1QA 1WJNA 1R4NI 2PE9A 4IWPA 4HPMB 4HJKA 4NJ6A 2LXCA 5J18A 4NPNA 2LI5A 2KC1A 3TBLD 1C1YB 3ZTDA 1TBEA 1V2YA 2G4SA 3L10B 2D07B 3BINA 1S3SG 3SU8X 3ZLZA 4EOYA 4KVGB 3I3TB 3AXCA 3PGEA 2BWES 2JXXA 4OVUA 1WGDA 3N32A 1WI0A 2LXAA 3MJWA 1UGMA 2VRRB 2C7MB 3EFUA 3NOBA 1KOTA 5L83A 3B0AA 4EUTA 2KJ6A 1P98A 1EF1A 5DPTA 2DYMA 2HD5B 4EZJA 4W9IA 2MA9B 2M1MA 5D6JB 1RAXA 1YQBA 2LASA 2AWTA 4PS3A 2DYBA 4HLEA 1H4RA 3LJ3A 2UYZB 2KHWB 2KTFA 3W1SC 1BT0A 1YJ1A 2AL3A 2WWZA 1XD3B 2KWCA
chains in the Genus database with same CATH superfamily
2GBRA 4II3B 2MW5A 2INNE 2L05A 1WFYA 2G3QB 2CU3A 2AL6A 2LVOA 4BBNF 4B9KA 4LCDE 2M8SA 3WAMA 1VZ8A 3IFWB 3V6CB 2K8BA 1MVKA 2CJNA 1WRDB 2OJRA 3NY5A 2ZVOA 3AH7A 4BKSA 2WU2B 1I35A 5JHAA 1MHXA 4JPSA 2N9KA 1I4PA 2KACA 4BZAA 4YT0B 3DWGC 1P3QU 1TS4A 3I5JC 4CHKA 2N1VA 2BKRB 2KZRA 3APCA 2MBBB 2MLBA 3GE3C 4BKTA 3PREA 1QOAA 2INPE 3ENEA 2N7EA 2Y5CA 4KGTA 2VH2A 2QJLA 3V3XA 3EA6A 3WAOA 1KLGD 2J4XA 4BBNC 2HJ1A 3VUWA 2W55A 5IKCM 4FJYA 1NI3A 1NENB 5CX3A 2LGYA 4I6NB 1R4MB 5C23A 3A1QB 4P16A 3B08A 2KK8A 1JWSD 3PV1A 3ZNHB 5J2RA 2KTRA 1JWAD 1X1MA 1GPXA 5LXHA 2PTLA 1TIFA 4G11A 2YLMA 3RNAC 2GBJA 1HE8A 3AE2B 3WIMA 3U8ZA 4HKZE 1L6VA 2N9EB 2DWQA 4GLSC 1YJJA 3PZDA 1UGJA 1KTKA 5AZHA 3RNFC 3W1SA 3UIPB 4LNOA 2IO3B 1F77A 1ZE3D 2KDBA 4EZLA 4BFRA 2N0SB 1UZXB 5D3DA 2J52A 1V97A 3VHTC 5BMGA 2YEPF 4HEA1 5HG2A 4ZRPA 4NQKE 2PPHA 3AV8A 4OZCA 4B6WA 2K3UA 3Q6BA 4L1BA 3DHGC 2KFKA 2GBKA 2PLPA 2O6VD 4PS8A 1YIWA 3DVGX 4XZ4A 4PT5A 3Q3JA 1L4ZB 4YXDB 4IWOA 4W9KA 2K1FA 4AUQC 3PRZA 1WWTA 3MHSD 1IBXA 5G55A 2QC8A 2WYQA 4JWUC 3X0WA 1JQ4A 2HDEA 2LGIA 4EEWA 1TY0A 5IN7A 2ON8A 3JYUA 3WANA 2JWUA 1QLBB 4MGZE 1FFUA 1T5XD 3VTVA 2ZW0A 3NVZA 3C8YA 1RFKA 2J0MA 3AU4A 2LUMA 1AYFA 4OVZA 2WXGA 3GE8C 3NG0A 3AE4B 5EDSA 1TS3A 4OW0A 1D4BA 1GC6A 1NDDA 1FFVA 4W9JA 4BOZB 1CK1A 1IGCA 1ZW7A 2BYEA 3OJ3A 3L54A 4P6VF 5AZFA 3TIXA 2J0JA 1KJTA 3ECIA 2ASQA 5TR5A 1S1QB 2K6QA 1OQYA 2WXJA 3ZGZA 2MBOA 5E6JA 1Y8RC 2KN5A 3TSSA 1K8RB 1SE4A 2FIDA 4HKQA 3HIZA 5EE3A 1XEEA 3QA8A 3BVGA 4DHZB 1EWYC 1WJ4A 5IAAC 4DWFA 1TZOA 5IO9A 2VH1A 2BGFA 1I7HA 1V1OA 4XE0A 3KH0A 4FJZA 3RNGC 1CJEA 1WJ6A 2BYTA 4C4VA 2ZCBA 3T9LA 2PE6B 3RD2A 3M62B 1WMHB 4M01A 1WIAA 3MHZA 4XWWA 2NR2A 3ZVVA 4HDOA 2RMMA 4NAWA 2LMCA 2LRUA 5CHWA 4BKGA 1WXVA 1FCCC 4BKSD 3DHHC 1K50A 1JALA 2WNMA 1TT5B 3SDLC 3RFZB 1FPYA 3KWVA 1IUEA 3PRPB 3DVGY 2WDVB 1DYQA 4WJPA 1ZUD2 2IO0B 3IVFA 2N4FA 2KKCA 1MG8A 2PJHA 2L00B 3M95A 3ZDMC 2OJWA 2K39A 2W54A 1E90A 1MFWA 4RGNA 1JWMD 3IG3A 3RUIB 4WWPA 5BYQA 1XLQA 2MQJA 1WXQA 2BPSA 1TGZB 3U7DA 3BYYB 4B95A 3ZNID 1C4AA 3ML8A 2D10A 1I42A 1E8ZA 3VUYA 1NYQA 2DENB 1AWDA 2LFIA 4US8A 3DOWA 1HZ6A 2WXIA 4WJOA 1BXTA 1YMHE 3M3JA 4TV3A 2D11A 3Q69A 3AU5A 3DBLI 2NS5A 3WAPA 5BYSA 2L7RA 2LJ5A 3B2FA 3HRDD 3IT4B 2JYTA 2PW9A 4P1CC 3OJ4B 1JCKB 4PS7A 4RNAA 4K3BA 2R2OA 4ICVA 5EE0A 1CMXB 3NUHB 2XK5B 1PGAA 2XN9C 2M0XA 1RWSA 1N6ZA 4XDCA 1N5WA 2E3TA 3VUXA 3AE6B 3VQIA 4FJVB 4URKA 2ACZB 3KUDB 5AUIA 4A90A 1YN4A 1XQQA 2MP2B 1JRUA 1FO4A 3KW5B 1G6JA 3RZWC 2V3SA 2KANA 2OEDA 2HTHA 1KRHA 2NBWB 1MPEA 4YL8A 2XNAC 2RDGA 5FR6A 3H9DA 3AECB 3APDA 3CF6E 3NZSA 1FNUA 1BMLC 3IT6B 3A1QA 3Q3OC 2KMMA 3HVDA 4NJ6A 4NPNA 2LI5A 2KC1A 3ZTDA 1C1YB 2VZKD 2G4SA 3BINA 4HRSA 3ZLZA 4EOYA 3AXCA 4UDUC 2VRRB 2YEPB 1P98A 1EF1A 2DYMA 4W9IA 3E9SA 4PS3A 1XLPA 4MM3B 1HZ5A 3ZJUA 5H92C 3BVZA 2AL3A 2KWCA 4WIPA 3RN9C 1EO6A 3UGBB 2WXPA 3P42A 2L0FA 2LRWA 2ICIA 1YN5A 3APFA 4AJWA 1QKZA 2IY0B 2GOWA 5DPRA 2BS2B 3GZNI 2WX0A 3A9JB 2C60A 2ZCCA 3PPAA 1XLNA 3JSVB 3P63A 4KIKB 3H8HA 3RNBC 3AEEB 2WQYB 3DBRI 4DHZE 3Q8AA 2WX1A 4K7UA 1PYWD 2DAJA 1LGRA 4FLHA 2NTTA 3AE1B 3AMZA 2G1EA 2MBHA 4GGQA 1SGHA 2JZ3B 4ZRQA 4HVBA 4KV2A 4F8CB 3SR6A 5DPSA 2KC2A 2WP9B 5JH5C 1YD8U 3D32A 3Q3FA 2GLSA 1WX9A 4HXDA 4FN2A 1UBIA 1QF6A 3RZFA 4LNIA 1U4AA 3I57A 2WDQB 2UWQA 4EKUA 2FCMA 3P4PB 4F7ZA 2JRIB 2TSSA 3Q8BA 4XC2A 2NPTB 4HCNB 1SE9A 2MEKA 1YX6B 2UU7A 5BMIA 3FILB 2I1JA 3N9YC 1E7VA 3P4QB 4KSLC 2JUOA 4GXBA 5J17A 3CWIA 2HJ8A 4HK2A 2WLBA 2K25A 4WWNA 1HA5A 4FULA 2CHXA 1SF0A 4AWJA 1WJUA 1L7YA 3PRMB 4PYZA 3ZJVA 1F2RI 1YQ3B 4AOFA 1OEYJ 3ZTCA 2FCQA 1QT9A 2NTSA 4DXAB 1F9JA 4XYCA 3HHMA 3R7RA 4ARCA 3NJTA 2KJRA 1T0SC 3KWLA 3QK0A 2KLCA 3K9PB 3LB8C 2SAKA 5D2MB 4NJCA 1QOFA 1WMHA 3MFGA 1WXAA 1TS2A 1TYGB 3TEYA 4RF0A 1VZ7A 2KX3A 2DLBA 4GB9A 3RNCC 1E7PB 4MGYE 4J6IA 3OG5A 1SIFA 1FNVA 2WU5B 1SIJA 4HJGE 2MBQA 3L13A 3DPDA 1GJZA 4JL9A 1GC7A 4KZ0A 4M00A 3PO0A 1OEYA 1Q0WB 1WGGA 4LNKA 1UNSA 2ZPNA 3X23A 5JZEB 1HTQA 1YQ4B 3C0RB 2IYDB 4WAAA 4YSYB 1JRPA 2FE8A 2C9WB 4C7ZA 1V6EA 4ZRKA 1XCTL 1V1PB 1OFFA 3KUZA 4YWGG 1ET9A 1QQRA 3N3KB 5CHFA 4DHJB 4OHJA 3GP7A 4FBJB 2ZJDA 3W5UB 3R3MA 1ESFA 3DVNV 3ALBA 3AB5A 4ZYNA 3ZXVA 3Q2AC 1FXIA 1I4RA 4MSMB 2I1KA 4ANUA 3IHPC 4TKNA 3GZNB 3V61A 1MHHE 2GBNA 2MHJA 2RGFA 1AN8A 2GI9A 2ZNVC 3EHVA 3B2GA 4N59A 3VR8B 2QCZA 2N1WA 1UWXA 1NBFC 4LTUA 4JE3B 2BVCA 3VH3B 3IBEA 4LNNA 4RGOS 2XK5A 3Q3NC 2X8XX 1LFDA 1JWUD 2WGSA 1SE2A 3NVWA 2BW2A 1N61A 4WAFA 4FADA 3DBHB 5KHOA 3V60A 5MPOA 2V1YA 2MP2A 3NVYA 4IW0A 4RF1A 4MGKE 3RMKC 2KO3A 1T0RC 2M17A 5FKAC 4RGTA 5E6NA 1TS5A 2KDEB 1KF6B 3BWUD 3DDCB 4GOCA 4IC7B 4DK5A 3SFDB 4WJNA 2IBIB 4MH8A 3ZIMA 5LLIA 1Q1OA 4IWQA 2M0AA 3EECA 1DOYA 3U30A 2NBUA 2KWUB 1C78A 1XCQL 2JWZA 5FK9C 4E71A 1FRRA 1DOXA 2AQ1B 1GOZA 5DPWA 4A55A 3RI7C 4IDIA 1STEA 4MM3A 2KN4A 3CSTA 2AQ3B 4A20A 2G45B 1J8CA 1EWCA 1WGHA 2L76A 4XX5A 2V0GA 4GSWA 5KHQA 2O6VB 3W2DA 2FCNA 4M0WB 2L0TA 1AARA 4F1SA 3DHIC 2DZJA 3A9JA 1ZXIA 2N7DA 1P7EA 3RYTA 1WR1A 4ZRIA 3JSVA 4W9DA 4KIKA 2KDIA 4FHJA 3AEDB 3KYDD 2IPKD 3OLMD 2JSVX 2LWPA 4KDLB 2G9HD 2IJ0A 3KYCD 1D5XC 1H8CA 2DAFA 1P1AA 3AEBB 5C2TB 2I38A 2L3ZA 2L8JA 2CHWA 1NYRA 3AULA 3A9KB 3PHWB 3EFCA 1P0RA 2DNFA 4AS1A 1EU4A 2WHIA 1FIQA 2ZPYA 4KGRA 4N58A 2HE7A 3R2TA 1WGKA 1KFYB 4LNFA 1WX7A 2N7JA 4AJYB 4ANXA 1T0QC 2JRHA 2NPTA 2JY6A 2RDHA 3Q3MC 4L23A 1QOBA 1V8CA 3ZNZB 1PUTA 1R4NI 1SB3C 2LXCA 2PVGC 4KKIA 2KQ4X 3FILA 3ZYYX 1TBEA 4HROA 2IGHA 1YJIA 4KVGB 1ET6A 1C4CA 1Y56A 2BWES 2JXXA 4OVUA 1WGDA 4WQMA 4US9A 2RPVA 3NOBA 4QAYA 4L2YA 3N20C 3Q14C 2MA9B 1KLUD 3BK2A 2K5PA 2LASA 2AWTA 5LNK1 1GB1A 4HLEA 1H4RA 2KHWB 1SEBD 2EKIA 3HUIA 3OWEB 2LGSA 4LK0M 1IYFA 3R2IA 4HCPB 2INDC 4A8XC 2D3GA 3AI5A 2RDBC 2ZZPB 1TY2A 3NZ3A 3QARA 1T0YA 2ZNVB 2JX5A 1SBBB 1LO5D 1ZPSA 2WXKA 3BZDB 3UQAA 3P4SB 1SXTA 1WM2A 3EGRA 2JPHA 5HI1A 3T3NA 1WYGA 2W3SA 5C1ZA 2ZVNA 1RFAA 2MJ3A 4RFBA 4WQOB 5G5HA 1RYJA 2FUG1 3ZDTA 4DBGA 3MJ5A 4NZLB 1ZXHA 3L0WB 2AQ2B 3R66C 1V86A 4FA6A 1D5ZC 3N30A 3ZXRA 1WXMA 3H6NA 1D5MC 3QCAA 3VTWA 3ZQ4A 4X57B 1SSNA 5D7GA 2J0KA 3HVZA 4KSKC 1OQRA 3ZRFA 3H7PB 4K7SA 2QDFA 3R8BA 2FBWB 1TKEA 4II2B 1V1PA 3N1ZC 2BB6A 3L08A 2L32A 4TMAB 5HKHA 1ZP0B 1FEHA 4I6LB 1E7UA 1J7CA 4GN1A 1V5TA 3I63C 1WRIA 4S0RA 1I4QA 3V6EB 1YX5B 1PFDA 3P2BA 3AE9B 5D94A 2K9XA 3PLUA 4LDTB 2LGXA 1WGYA 3N1YC 1JWBD 1ZOYB 4K1RB 4PK1A 1UWMA 2Z59B 3SFEB 2KT7A 2W82A 2FUHB 3A33B 2KJHB 3TCAA 1FNWA 1WZ3A 4CO7A 3W9CB 2PIAA 2DX5B 2BBCA 4OVVA 2Y3AA 3ZNGC 3HM3A 2MSED 4WWOA 4W9GA 3AE3B 1Z2MA 1ZKHA 3WCQA 1VD2A 5AEKB 1GB4A 4NNJB 2Y5PA 3DVNU 2MJEA 2ZW1A 1PQSA 4GDKB 1YNTE 2XEWA 2BYFA 4GMVA 3T3OA 4JWSC 1FXAA 2RSUA 2KMCA 3PZ8A 4RH6A 1WH3A 4GIVA 4Q2JA 3N1XC 1OGWA 1R4NB 2KX0A 4M02A 2KQSA 5AZGA 1UELA 2CHZA 4DDID 2KMAA 4MGIE 1C76A 3QC8B 4ITKA 1LQBA 3QX1A 2BYVE 2LHEA 2M4NA 4USAA 5EE9A 3M63B 1TZ1A 2L1AA 3Q8CA 3AE5B 1ROEA 2D3BA 1R4MI 3QJZA 1A70A 3QHTA 2MRPA 1RM6C 2MJDA 4W9EA 2D5GA 4FHKA 2XBBC 2M19A 1Q10A 2W9NA 3AEAB 1E0ZA 3BIID 1WX8A 1E5WA 3GOEA 2O6VA 1WYWB 2CKHB 3GS2A 4A3PA 3AM9A 4DQOC 2DHZA 1F2RC 2EMTA 1T3QA 2O2VB 3ZKJC 1B9RA 1UH6A 1M94A 2BWFA 2QHOA 1PGXA 3TL5A 2WXHA 2NCNA 4IM2A 3TMPB 3IAS1 2AX5A 1EUVB 3DBLB 3ML9A 3U4EG 1ZGUB 1ENFA 4ZRJA 3NS8A 3GB1A 3TEWA 4EFOA 2LZ6A 4TQ1A 2CS4A 2W3RA 3JW0X 4OZBA 2KWDA 1QOGA 2KDFB 4MELA 3A9KA 1KM7A 4NAWB 2A5UA 5AUKA 4H2AA 2LGDA 3WALA 4MT5A 4PYUA 3OAWA 1E8YA 1WM3A 1V81A 3UQBA 2HTME 2LEKA 1OQQA 4M8NA 4NAMA 2IO1B 1XT9B 3HK0A 1J0GA 2MH7A 2JU6X 2MWSB 3B9JA 3Q8FA 2KFJA 5G5GA 1L6UA 2IZVB 1K53A 1Z5SB 3IAM1 1R7SA 3CMMB 2DZMA 3DCGA 3O13A 2R61A 2KYWA 2FCSA 2LVQA 4ARIA 3LDZE 2JZZA 1J7AA 1NVID 1ISNA 2CU1A 2LVPA 2SEBD 3NHEB 2K8CA 2L83A 4E3CA 3BY4B 1N5XA 2V3NA 4KGSA 5TSSA 4DHJD 4W9HA 2IDYA 5EE1A 2JYEA 3ETRA 4O1NA 1GAQB 3VRBB 1HEZE 1HQRD 2IY1B 2PEAA 2NMQA 1EU3A 1BUIC 2IGDA 1JROA 3QQ8B 5DCNA 4W9CA 3PVLA 3EUB2 1WF9A 1Q5WB 4KDIC 3VFKA 1VJKA 1WXSA 4IUMB 2JVCA 4RM8A 4JIOU 4MACA 3L4PA 3ZUNA 4D2KA 2DBYA 3SEBA 1EM7A 1F1HA 1TTNA 1JW9D 2KLGA 2BS3B 2OHFA 3K9OB 4MJSB 4C00A 3BYTB 2EMSA 1JMLA 2BB5A 3ABVB 1F52A 4RCOA 2QMTA 1L0XB 2MCNB 3BVMA 2H88B 3DBRB 5JHBA 2WXQA 1ZDXA 5IP4D 3P1MA 4LJOB 3UINB 3URYA 2MX2A 3H7PA 1VZ6A 1VR9A 1C77A 3I9V1 3AEGB 3ZO5B 2H89B 1LM8B 2WS3B 1CQVA 2WXFA 2GB1A 1FRDA 3UF8A 2D3AA 1D3ZA 2WDTB 1FM0D 4NY0A 1LXDA 1B1ZA 1WJNA 4IWPA 1MJDA 5J18A 2QSDA 3TBLD 2D3CA 3L10B 2D07B 3NS1A 3KQ4A 1D6EC 4JX1C 3MC9A 4TSSA 3PGEA 3N32A 3AEFB 1VLBA 3MJWA 1UGMA 4FXCA 2C7MB 5BYRA 5L83A 3B0AA 5DPTA 3W5VB 2M56B 3RPFC 1N60A 2HD5B 4DXGA 4EZJA 1YQBA 1DGJA 4OZAA 2UYZB 4EE2A 3W1SC 1BT0A 1YJ1A 1XD3B 3NVVA 2K8HA 2GBMA 1A5RA 4GDKA 2QIEB 2OOBB 2J7QB 4TUUA 1WE7A 4N6EB 1SE3A 4YTNB 3ZRCA 4G0NB 2IGGA 1TJEA 2V9HA 4ACFA 1CZPA 2KVRA 3KVFB 4DXFA 2JT4B 3PLVA 4REZA 2WDRB 1L0YB 2MBEA 2IO2B 3TJPA 4IM3A 1FXTB 3PHXB 3ZW3A 5LXIB 2KQ7A 1C4PA 1E8XA 3HM6X 2V4IB 2B3AA 5GMVA 2G4DB 3B1LX 2KOXA 3QIJA 5BO4B 1XXGA 2KDMA 1WSPA 3E56A 4GDLB 4LJPB 4YTPB 3FKYA 3UIOB 3A4SC 4B0EA 5HFYA 4K7WA 2K6DB 3ONSA 2JXTA 3VDZA 2LUEA 2C7NB 2KD0A 1E8WA 4WURA 2JQRB 4ANWA 3TEZA 1IP9A 1PDXA 2WXOA 4YSXB 3U52E 4NJ7A 3DQVA 1KH0A 2GRIA 1N62A 2BKFA 2LJIA 3VR9B 1GUAB 2O2VA 1VCBA 5T8IA 4ASWC 5FR3A 2ZEQA 1C3TA 1K51A 4WH4A 3NRZA 4GU2A 2BTEA 2BQQA 1XF5L 3PZ7A 4HWIB 2WXLA 4JLCA 3MP9A 4B0MA 2NBVB 5E6OA 1E10A 5C3JB 2D2QA 1I4GA 1V5OA 3PSEB 4AP4C 2K22A 5H8YE 3P4RB 1PGBA 2AEHA 3WA0A 4YSZB 1UBQA 3ZJTA 4KX6B 1EF5A 3LYYA 4HDQA 4KKJA 2AYOB 4ANVA 1P9DU 3VH4B 3VXWA 3SHQA 2N9LA 4J3OD 1SJHD 4W9FA 3H7SA 4TQ0A 3EC8A 4E74A 2KWVB 3PT2B 4MSQB 4I6PA 1NI2A 3L16A 2PMVA 4DDGD 3QWZB 3R7QA 1V49A 4A3OA 4N9F4 1AW7A 1N63A 3AE7B 4ZYSA 4BOSC 1I4HA 4IOIE 1XO3A 3VRAB 2R2QA 3S2AA 2YVCA 3KUCB 1VRAB 3C19A 3TEXA 3VTUA 2C5LC 1QZEA 4P1BC 2BT6A 1XLOA 2V4LA 3MC8A 1WZ0A 4RMAA 3T8MA 4C56C 2KXJA 2LHDA 4W9LA 4RM9A 2PVOD 3RNEC 2X38A 1L0VB 2RD0A 4BAXA 1QILA 2WXMA 4ZHPA 3JVZX 4XDDA 4AQ7A 4LDTD 3CIRB 1NEKB 3LXFA 2JF5A 2KTRB 3PS6A 1C9FA 4G3XB 4ZHOA 2CJOA 4ICUA 1J19A 4G50A 2QILA 1MG4A 2CR5A 2JZPA 2FIFA 1DOIA 1FD6A 3V05A 4MJSA 4MDKE 2RR9A 2PKOA 4MH0E 2REXA 5I4DA 2B76B 4A9AA 5L95C 2KNBA 4YTMB 5JXVA 3MTNB 2N9XA 2K0PA 1WY8A 2BF8B 1C79A 1YOVB 3V62A 3L17A 1K52A 1KLVA 2KFKB 4HPPA 3VAWA 4A6QA 2Z0DB 5G2NA 1IGDA 5GXGB 1E9MA 1V9JA 3FC4A 1IPGA 1ACCA 1V80A 1TKYA 2Z8LA 4IM0A 5IOIA 1IBXB 4JQWC 2V3PA 4KZCA 3W1YA 4M8MA 4ZDVA 2E6XA 3VVWB 2VZKB 3DBSA 4C7YA 2WXNA 1WGRA 3TUOA 3RCZA 4NQLB 3KLSX 2KVZA 4IKGA 2DZKA 1GG3A 4MEMA 1RLFA 5CTRC 4HPLB 4ZOHC 1VDVA 4CQNA 3RT3B 1GNUA 2KAJA 2ONQA 2Z0EB 4JGHB 4IG7B 5CHVC 3IXSA 4C80A 2I2YA 3Q8EA 4LLGM 2Q5WD 4S17A 1P7FA 1UF0A 3O65B 1WR6E 3PTFC 5E6PA 1HTOA 4RGMA 1MI0A 5BMHA 3QAQA 2WXRA 3CSFA 5IA7A 3RULA 2EKEC 2N9PC 4K81A 1L2NA 3AE8B 4M0WA 2L52A 4K3CA 3BK1A 2FNJB 3H1UA 1ZDVA 1T6BX 2QEJC 3DBHI 1SJED 3MC0B 1RRBA 2EELA 1UD7A 2Y5BB 1HXYD 4WJQA 2C7HA 2GMIC 2INCC 2FAZA 1L4DB 1E6EB 3A4RA 4GDLA 2A4ZA 2LD9A 4CYEA 4C4VB 1WE6A 3AN1A 3NZUA 3SD5A 4EZKA 2DYOA 4P7IA 1OTRB 2NVUI 3U7ZA 3UI3A 3DWMA 3J9CA 4R3DA 2DZIA 2RPQA 5HHDG 1YN3A 1L5PA 4BVUC 2PE9A 2J42A 4HPMB 4HJKA 5D3IB 2J53A 4XWTA 1FMAD 1V2YA 3U2SC 1S3SG 3SU8X 1TKGA 3I3TB 1F0ZA 3FAHA 1WI0A 2LXAA 3EFUA 1J7BA 1KOTA 4EUTA 1I4XA 2KJ6A 2M1MA 5D6JB 1RAXA 1FCLA 4XGAB 2DYBA 1M4VA 2BS4B 3LJ3A 1UUPA 2KTFA 2WWZA 4WWMA
chains in the Genus database with same CATH topology
1EO6A 2GBRA 4II3B 3UGBB 1IYFA 4HCPB 2K8HA 2GBMA 2MW5A 1A5RA 2D3GA 4GDKA 2L05A 3AI5A 2L0FA 2ZZPB 1WFYA 2G3QB 2OOBB 2J7QB 2LRWA 2AL6A 1WE7A 2LVOA 3QARA 4TUUA 4BBNF 1T0YA 2ZNVB 3ZRCA 4B9KA 3APFA 4G0NB 4AJWA 3UQAA 4LCDE 2IY0B 2GOWA 2M8SA 1WM2A 5DPRA 2KVRA 2JPHA 3WAMA 3KVFB 3IFWB 3V6CB 3GZNI 2WX0A 2K8BA 3A9JB 2JT4B 1WRDB 2OJRA 3NY5A 2ZVOA 3PLVA 2C60A 2ZCCA 3PPAA 3JSVB 4BKSA 1I35A 2MBEA 5JHAA 4KIKB 5C1ZA 2IO2B 2ZVNA 3TJPA 4IM3A 1RFAA 1FXTB 3DBRI 3PHXB 3ZW3A 4DHZE 5LXIB 2WX1A 2KQ7A 4WQOB 4K7UA 1P3QU 1E8XA 3HM6X 2DAJA 4CHKA 3ZDTA 2N1VA 4DBGA 2B3AA 3L0WB 2BKRB 5GMVA 4FLHA 2G4DB 3R66C 3B1LX 2KZRA 3APCA 2MBHA 4GGQA 1V86A 2MBBB 4FA6A 1SGHA 2JZ3B 2KOXA 3QIJA 5BO4B 3N30A 1WXMA 3H6NA 2MLBA 4KV2A 4F8CB 4HVBA 3QCAA 3VTWA 4BKTA 3PREA 4GDLB 4LJPB 4X57B 5DPSA 3ENEA 2N7EA 5D7GA 3UIOB 2J0KA 2KC2A 3A4SC 4KSKC 5JH5C 1YD8U 3D32A 3Q3FA 3ZRFA 4K7WA 2K6DB 3H7PB 3ONSA 4K7SA 4II2B 3VDZA 1WX9A 4HXDA 3WAOA 3L08A 4FN2A 2LUEA 1UBIA 2C7NB 2KD0A 1E8WA 3RZFA 4ANWA 5HKHA 1IP9A 1U4AA 4BBNC 2UWQA 4EKUA 3VUWA 2FCMA 4F7ZA 4FJYA 4I6LB 2JRIB 4NJ7A 1E7UA 3DQVA 4GN1A 5CX3A 1V5TA 4XC2A 2BKFA 2LGYA 4I6NB 2NPTB 5C23A 1GUAB 2O2VA 3A1QB 4HCNB 3B08A 3V6EB 1SE9A 1YX5B 2KK8A 1VCBA 3PV1A 3P2BA 5D94A 3ZNHB 1YX6B 4ASWC 5J2RA 2KTRA 1X1MA 2ZEQA 3PLUA 4LDTB 2I1JA 2LGXA 1WGYA 1C3TA 1E7VA 5LXHA 4KSLC 2JUOA 4GXBA 5J17A 4G11A 2HJ8A 2YLMA 4HK2A 4GU2A 4K1RB 2GBJA 1HE8A 2K25A 2Z59B 3WIMA 4HWIB 3U8ZA 4WWNA 2N9EB 4FULA 2CHXA 4JLCA 3A33B 2FUHB 3PZDA 4AWJA 1WJUA 2KJHB 5AZHA 2NBVB 1L7YA 3TCAA 1WZ3A 4CO7A 5E6OA 3PRMB 4PYZA 3W1SA 2DX5B 3UIPB 4AOFA 2D2QA 4OVVA 2IO3B 2KDBA 3ZNGC 4EZLA 4BFRA 1OEYJ 1UZXB 2MSED 3HM3A 4WWOA 2FCQA 3ZTCA 4W9GA 3VHTC 1V5OA 3PSEB 4AP4C 4DXAB 1Z2MA 1F9JA 3HHMA 3R7RA 1ZKHA 2KJRA 1VD2A 3QK0A 2KLCA 2AEHA 3K9PB 4NQKE 4NNJB 5AEKB 3WA0A 3DVNU 2PPHA 1PQSA 1UBQA 4B6WA 5D2MB 1WMHA 4GDKB 1EF5A 1WXAA 4HDQA 2AYOB 4ANVA 2KFKA 2XEWA 2BYFA 1P9DU 2KX3A 4GMVA 2GBKA 3VH4B 3VXWA 2O6VD 4GB9A 4PS8A 3SHQA 1YIWA 3DVGX 2RSUA 4XZ4A 2KMCA 1WH3A 4GIVA 4W9FA 3H7SA 3Q3JA 4J6IA 4MGYE 1OGWA 1SIFA 4IWOA 4W9KA 2K1FA 4AUQC 2KX0A 3EC8A 3PRZA 4TQ0A 2KQSA 2MBQA 1UELA 3L13A 3DPDA 5AZGA 2CHZA 3MHSD 4JL9A 1GC7A 4E74A 1GJZA 4KZ0A 2KWVB 3PT2B 4MSQB 5G55A 4DDID 4I6PA 1NI2A 1OEYA 2KMAA 2WYQA 1Q0WB 3L16A 3X0WA 4DDGD 4MGIE 1WGGA 3QC8B 2ZPNA 3X23A 4EEWA 3QWZB 5JZEB 3R7QA 1V49A 4A3OA 4N9F4 1LQBA 3QX1A 2BYVE 3JYUA 3C0RB 3WANA 4BOSC 2IYDB 4MGZE 2M4NA 2R2QA 3S2AA 3VTVA 4WAAA 3M63B 1TZ1A 2YVCA 3KUCB 3VTUA 3AU4A 2J0MA 2C5LC 2C9WB 1QZEA 1V6EA 2V4LA 1R4MI 3QJZA 4ZRKA 1WZ0A 3QHTA 5EDSA 4RMAA 2MRPA 4W9EA 3T8MA 2KXJA 3KUZA 4FHKA 2XBBC 1GC6A 2W9NA 1NDDA 3N3KB 5CHFA 4DHJB 4W9LA 4RM9A 4FBJB 2ZJDA 4W9JA 4BOZB 2RD0A 1WX8A 3R3MA 1E5WA 3GOEA 2O6VA 1WYWB 2CKHB 3DVNV 4A3PA 1ZW7A 2BYEA 2DHZA 3ALBA 3JVZX 4ZYNA 3OJ3A 2EMTA 3L54A 4LDTD 2O2VB 3ZKJC 5AZFA 3TIXA 2J0JA 2I1KA 4MSMB 4ANUA 1KJTA 1UH6A 1M94A 2BWFA 2QHOA 3TL5A 2JF5A 2KTRB 3IHPC 3PS6A 4TKNA 3V61A 2GBNA 2RGFA 2ZNVC 4G3XB 3EHVA 2NCNA 3ECIA 4ICUA 1J19A 4IM2A 3TMPB 2ASQA 5TR5A 1S1QB 2N1WA 2K6QA 1NBFC 4G50A 1OQYA 2CR5A 3VH3B 2FIFA 1EUVB 2MBOA 3IBEA 4MJSA 1Y8RC 2KN5A 3ML9A 1K8RB 2FIDA 1ZGUB 4MDKE 2XK5A 2RR9A 4MH0E 3HIZA 4ZRJA 3QA8A 1LFDA 3NS8A 4DHZB 4EFOA 1WJ4A 2LZ6A 5IAAC 4TQ1A 4DWFA 2CS4A 2REXA 2BGFA 3JW0X 4FADA 2KDFB 3KH0A 4FJZA 5KHOA 3V60A 2V1YA 5L95C 2KNBA 3A9KA 4MELA 1KM7A 2MP2A 4NAWB 1WJ6A 2A5UA 3MTNB 4IW0A 2ZCBA 3T9LA 2PE6B 2LGDA 2N9XA 4MGKE 3WALA 1WY8A 2BF8B 3RD2A 3M62B 4PYUA 3OAWA 1E8YA 1WMHB 1WM3A 1V81A 2KO3A 2M17A 3V62A 3UQBA 1WIAA 5E6NA 3L17A 2NR2A 3ZVVA 1KLVA 2KFKB 4HDOA 4NAWA 4M8NA 2LRUA 5CHWA 2IO1B 1XT9B 4BKGA 1WXVA 2KDEB 3HK0A 3VAWA 3DDCB 1J0GA 2Z0DB 4GOCA 4IC7B 4DK5A 5G2NA 4BKSD 4WJNA 1V9JA 2IBIB 3SDLC 1IPGA 2MWSB 2KFJA 3ZIMA 1V80A 5LLIA 1Q1OA 4IM0A 4IWQA 2IZVB 3PRPB 4JQWC 3DVGY 1Z5SB 4KZCA 3EECA 4WJPA 3CMMB 3W1YA 2IO0B 4M8MA 3IVFA 3U30A 2DZMA 3DCGA 4ZDVA 2N4FA 2KKCA 1MG8A 2NBUA 3VVWB 2KWUB 3DBSA 2PJHA 2JWZA 2FCSA 2LVQA 1WGRA 4E71A 3RCZA 3LDZE 4NQLB 2JZZA 2L00B 3M95A 3ZDMC 2DZKA 2K39A 1GG3A 4MEMA 1E90A 1ISNA 1RLFA 2CU1A 5CTRC 3IG3A 4HPLB 2LVPA 3RUIB 5DPWA 3NHEB 2K8CA 4WWPA 3RT3B 1GNUA 4E3CA 2MQJA 2Z0EB 3BY4B 4MM3A 4JGHB 2BPSA 4IG7B 4DHJD 1TGZB 3CSTA 3U7DA 5CHVC 4W9HA 4A20A 2G45B 1J8CA 4B95A 3ZNID 1WGHA 3ML8A 2D10A 1I42A 1E8ZA 3VUYA 2L76A 4XX5A 2DENB 4GSWA 5KHQA 3O65B 1WR6E 3PTFC 2IY1B 5E6PA 2O6VB 2FCNA 2PEAA 3DOWA 4M0WB 2L0TA 4WJOA 5DCNA 3QQ8B 3QAQA 3CSFA 1AARA 3M3JA 3PVLA 4TV3A 4W9CA 2D11A 3RULA 4F1SA 2EKEC 2N9PC 5IA7A 4K81A 3AU5A 1L2NA 2DZJA 3A9JA 3DBLI 1WF9A 1Q5WB 2NS5A 2N7DA 4KDIC 3RYTA 3VFKA 3WAPA 2L7RA 1WR1A 4ZRIA 3JSVA 1WXSA 4IUMB 4W9DA 2JVCA 2LJ5A 4RM8A 4KIKA 2KDIA 4FHJA 4JIOU 3ZUNA 3KYDD 3OLMD 1TTNA 2FNJB 2LWPA 3H1UA 3OJ4B 2KLGA 4PS7A 2R2OA 4ICVA 3DBHI 1CMXB 3K9OB 4KDLB 4MJSB 3KYCD 1H8CA 2DAFA 2EMSA 2XK5B 1RRBA 1UD7A 2Y5BB 1P1AA 2M0XA 4WJQA 2MCNB 2C7HA 2GMIC 2FAZA 3VUXA 5JHBA 3A4RA 2L3ZA 3VQIA 4GDLA 2L8JA 4FJVB 4URKA 2CHWA 3KUDB 3AULA 4LJOB 2A4ZA 3UINB 2MX2A 3A9KB 3PHWB 1XQQA 2LD9A 1JRUA 1P0RA 2MP2B 3H7PA 3KW5B 4CYEA 3ZO5B 1WE6A 1G6JA 2ZPYA 2HE7A 3RZWC 1LM8B 2V3SA 3NZUA 3SD5A 2KANA 4EZKA 2HTHA 1WX7A 2NBWB 2DYOA 4P7IA 4YL8A 1OTRB 2NVUI 4AJYB 4ANXA 3UF8A 1D3ZA 5FR6A 2WDTB 4NY0A 2DZIA 2RPQA 3H9DA 2JRHA 2NPTA 3APDA 2JY6A 3CF6E 1LXDA 3NZSA 3ZNZB 4BVUC 3A1QA 1WJNA 1R4NI 2PE9A 4IWPA 4HPMB 4HJKA 4NJ6A 2LXCA 5J18A 4NPNA 2LI5A 2KC1A 3TBLD 1C1YB 3ZTDA 1TBEA 1V2YA 2G4SA 3L10B 2D07B 3BINA 1S3SG 3SU8X 3ZLZA 4EOYA 4KVGB 3I3TB 3AXCA 3PGEA 2BWES 2JXXA 4OVUA 1WGDA 3N32A 1WI0A 2LXAA 3MJWA 1UGMA 2VRRB 2C7MB 3EFUA 3NOBA 1KOTA 5L83A 3B0AA 4EUTA 2KJ6A 1P98A 1EF1A 5DPTA 2DYMA 2HD5B 4EZJA 4W9IA 2MA9B 2M1MA 5D6JB 1RAXA 1YQBA 2LASA 2AWTA 4PS3A 2DYBA 4HLEA 1H4RA 3LJ3A 2UYZB 2KHWB 2KTFA 3W1SC 1BT0A 1YJ1A 2AL3A 2WWZA 1XD3B 2KWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EO6 A;  2GBR A;  4II3 B;  3UGB B;  1IYF A;  4HCP B;  2K8H A;  2GBM A;  2MW5 A;  1A5R A;  2D3G A;  4GDK A;  2L05 A;  3AI5 A;  2L0F A;  2ZZP B;  1WFY A;  2G3Q B;  2OOB B;  2J7Q B;  2LRW A;  2AL6 A;  1WE7 A;  2LVO A;  3QAR A;  4TUU A;  4BBN F;  1T0Y A;  2ZNV B;  3ZRC A;  4B9K A;  3APF A;  4G0N B;  4AJW A;  3UQA A;  4LCD E;  2IY0 B;  2GOW A;  2M8S A;  1WM2 A;  5DPR A;  2KVR A;  2JPH A;  3WAM A;  3KVF B;  3IFW B;  3V6C B;  3GZN I;  2WX0 A;  2K8B A;  3A9J B;  2JT4 B;  1WRD B;  2OJR A;  3NY5 A;  2ZVO A;  3PLV A;  2C60 A;  2ZCC A;  3PPA A;  3JSV B;  4BKS A;  1I35 A;  2MBE A;  5JHA A;  4KIK B;  5C1Z A;  2IO2 B;  2ZVN A;  3TJP A;  4IM3 A;  1RFA A;  1FXT B;  3DBR I;  3PHX B;  3ZW3 A;  4DHZ E;  5LXI B;  2WX1 A;  2KQ7 A;  4WQO B;  4K7U A;  1P3Q U;  1E8X A;  3HM6 X;  2DAJ A;  4CHK A;  3ZDT A;  2N1V A;  4DBG A;  2B3A A;  3L0W B;  2BKR B;  5GMV A;  4FLH A;  2G4D B;  3R66 C;  3B1L X;  2KZR A;  3APC A;  2MBH A;  4GGQ A;  1V86 A;  2MBB B;  4FA6 A;  1SGH A;  2JZ3 B;  2KOX A;  3QIJ A;  5BO4 B;  3N30 A;  1WXM A;  3H6N A;  2MLB A;  4KV2 A;  4F8C B;  4HVB A;  3QCA A;  3VTW A;  4BKT A;  3PRE A;  4GDL B;  4LJP B;  4X57 B;  5DPS A;  3ENE A;  2N7E A;  5D7G A;  3UIO B;  2J0K A;  2KC2 A;  3A4S C;  4KSK C;  5JH5 C;  1YD8 U;  3D32 A;  3Q3F A;  3ZRF A;  4K7W A;  2K6D B;  3H7P B;  3ONS A;  4K7S A;  4II2 B;  3VDZ A;  1WX9 A;  4HXD A;  3WAO A;  3L08 A;  4FN2 A;  2LUE A;  1UBI A;  2C7N B;  2KD0 A;  1E8W A;  3RZF A;  4ANW A;  5HKH A;  1IP9 A;  1U4A A;  4BBN C;  2UWQ A;  4EKU A;  3VUW A;  2FCM A;  4F7Z A;  4FJY A;  4I6L B;  2JRI B;  4NJ7 A;  1E7U A;  3DQV A;  4GN1 A;  5CX3 A;  1V5T A;  4XC2 A;  2BKF A;  2LGY A;  4I6N B;  2NPT B;  5C23 A;  1GUA B;  2O2V A;  3A1Q B;  4HCN B;  3B08 A;  3V6E B;  1SE9 A;  1YX5 B;  2KK8 A;  1VCB A;  3PV1 A;  3P2B A;  5D94 A;  3ZNH B;  1YX6 B;  4ASW C;  5J2R A;  2KTR A;  1X1M A;  2ZEQ A;  3PLU A;  4LDT B;  2I1J A;  2LGX A;  1WGY A;  1C3T A;  1E7V A;  5LXH A;  4KSL C;  2JUO A;  4GXB A;  5J17 A;  4G11 A;  2HJ8 A;  2YLM A;  4HK2 A;  4GU2 A;  4K1R B;  2GBJ A;  1HE8 A;  2K25 A;  2Z59 B;  3WIM A;  4HWI B;  3U8Z A;  4WWN A;  2N9E B;  4FUL A;  2CHX A;  4JLC A;  3A33 B;  2FUH B;  3PZD A;  4AWJ A;  1WJU A;  2KJH B;  5AZH A;  2NBV B;  1L7Y A;  3TCA A;  1WZ3 A;  4CO7 A;  5E6O A;  3PRM B;  4PYZ A;  3W1S A;  2DX5 B;  3UIP B;  4AOF A;  2D2Q A;  4OVV A;  2IO3 B;  2KDB A;  3ZNG C;  4EZL A;  4BFR A;  1OEY J;  1UZX B;  2MSE D;  3HM3 A;  4WWO A;  2FCQ A;  3ZTC A;  4W9G A;  3VHT C;  1V5O A;  3PSE B;  4AP4 C;  4DXA B;  1Z2M A;  1F9J A;  3HHM A;  3R7R A;  1ZKH A;  2KJR A;  1VD2 A;  3QK0 A;  2KLC A;  2AEH A;  3K9P B;  4NQK E;  4NNJ B;  5AEK B;  3WA0 A;  3DVN U;  2PPH A;  1PQS A;  1UBQ A;  4B6W A;  5D2M B;  1WMH A;  4GDK B;  1EF5 A;  1WXA A;  4HDQ A;  2AYO B;  4ANV A;  2KFK A;  2XEW A;  2BYF A;  1P9D U;  2KX3 A;  4GMV A;  2GBK A;  3VH4 B;  3VXW A;  2O6V D;  4GB9 A;  4PS8 A;  3SHQ A;  1YIW A;  3DVG X;  2RSU A;  4XZ4 A;  2KMC A;  1WH3 A;  4GIV A;  4W9F A;  3H7S A;  3Q3J A;  4J6I A;  4MGY E;  1OGW A;  1SIF A;  4IWO A;  4W9K A;  2K1F A;  4AUQ C;  2KX0 A;  3EC8 A;  3PRZ A;  4TQ0 A;  2KQS A;  2MBQ A;  1UEL A;  3L13 A;  3DPD A;  5AZG A;  2CHZ A;  3MHS D;  4JL9 A;  1GC7 A;  4E74 A;  1GJZ A;  4KZ0 A;  2KWV B;  3PT2 B;  4MSQ B;  5G55 A;  4DDI D;  4I6P A;  1NI2 A;  1OEY A;  2KMA A;  2WYQ A;  1Q0W B;  3L16 A;  3X0W A;  4DDG D;  4MGI E;  1WGG A;  3QC8 B;  2ZPN A;  3X23 A;  4EEW A;  3QWZ B;  5JZE B;  3R7Q A;  1V49 A;  4A3O A;  4N9F 4;  1LQB A;  3QX1 A;  2BYV E;  3JYU A;  3C0R B;  3WAN A;  4BOS C;  2IYD B;  4MGZ E;  2M4N A;  2R2Q A;  3S2A A;  3VTV A;  4WAA A;  3M63 B;  1TZ1 A;  2YVC A;  3KUC B;  3VTU A;  3AU4 A;  2J0M A;  2C5L C;  2C9W B;  1QZE A;  1V6E A;  2V4L A;  1R4M I;  3QJZ A;  4ZRK A;  1WZ0 A;  3QHT A;  5EDS A;  4RMA A;  2MRP A;  4W9E A;  3T8M A;  2KXJ A;  3KUZ A;  4FHK A;  2XBB C;  1GC6 A;  2W9N A;  1NDD A;  3N3K B;  5CHF A;  4DHJ B;  4W9L A;  4RM9 A;  4FBJ B;  2ZJD A;  4W9J A;  4BOZ B;  2RD0 A;  1WX8 A;  3R3M A;  1E5W A;  3GOE A;  2O6V A;  1WYW B;  2CKH B;  3DVN V;  4A3P A;  1ZW7 A;  2BYE A;  2DHZ A;  3ALB A;  3JVZ X;  4ZYN A;  3OJ3 A;  2EMT A;  3L54 A;  4LDT D;  2O2V B;  3ZKJ C;  5AZF A;  3TIX A;  2J0J A;  2I1K A;  4MSM B;  4ANU A;  1KJT A;  1UH6 A;  1M94 A;  2BWF A;  2QHO A;  3TL5 A;  2JF5 A;  2KTR B;  3IHP C;  3PS6 A;  4TKN A;  3V61 A;  2GBN A;  2RGF A;  2ZNV C;  4G3X B;  3EHV A;  2NCN A;  3ECI A;  4ICU A;  1J19 A;  4IM2 A;  3TMP B;  2ASQ A;  5TR5 A;  1S1Q B;  2N1W A;  2K6Q A;  1NBF C;  4G50 A;  1OQY A;  2CR5 A;  3VH3 B;  2FIF A;  1EUV B;  2MBO A;  3IBE A;  4MJS A;  1Y8R C;  2KN5 A;  3ML9 A;  1K8R B;  2FID A;  1ZGU B;  4MDK E;  2XK5 A;  2RR9 A;  4MH0 E;  3HIZ A;  4ZRJ A;  3QA8 A;  1LFD A;  3NS8 A;  4DHZ B;  4EFO A;  1WJ4 A;  2LZ6 A;  5IAA C;  4TQ1 A;  4DWF A;  2CS4 A;  2REX A;  2BGF A;  3JW0 X;  4FAD A;  2KDF B;  3KH0 A;  4FJZ A;  5KHO A;  3V60 A;  2V1Y A;  5L95 C;  2KNB A;  3A9K A;  4MEL A;  1KM7 A;  2MP2 A;  4NAW B;  1WJ6 A;  2A5U A;  3MTN B;  4IW0 A;  2ZCB A;  3T9L A;  2PE6 B;  2LGD A;  2N9X A;  4MGK E;  3WAL A;  1WY8 A;  2BF8 B;  3RD2 A;  3M62 B;  4PYU A;  3OAW A;  1E8Y A;  1WMH B;  1WM3 A;  1V81 A;  2KO3 A;  2M17 A;  3V62 A;  3UQB A;  1WIA A;  5E6N A;  3L17 A;  2NR2 A;  3ZVV A;  1KLV A;  2KFK B;  4HDO A;  4NAW A;  4M8N A;  2LRU A;  5CHW A;  2IO1 B;  1XT9 B;  4BKG A;  1WXV A;  2KDE B;  3HK0 A;  3VAW A;  3DDC B;  1J0G A;  2Z0D B;  4GOC A;  4IC7 B;  4DK5 A;  5G2N A;  4BKS D;  4WJN A;  1V9J A;  2IBI B;  3SDL C;  1IPG A;  2MWS B;  2KFJ A;  3ZIM A;  1V80 A;  5LLI A;  1Q1O A;  4IM0 A;  4IWQ A;  2IZV B;  3PRP B;  4JQW C;  3DVG Y;  1Z5S B;  4KZC A;  3EEC A;  4WJP A;  3CMM B;  3W1Y A;  2IO0 B;  4M8M A;  3IVF A;  3U30 A;  2DZM A;  3DCG A;  4ZDV A;  2N4F A;  2KKC A;  1MG8 A;  2NBU A;  3VVW B;  2KWU B;  3DBS A;  2PJH A;  2JWZ A;  2FCS A;  2LVQ A;  1WGR A;  4E71 A;  3RCZ A;  3LDZ E;  4NQL B;  2JZZ A;  2L00 B;  3M95 A;  3ZDM C;  2DZK A;  2K39 A;  1GG3 A;  4MEM A;  1E90 A;  1ISN A;  1RLF A;  2CU1 A;  5CTR C;  3IG3 A;  4HPL B;  2LVP A;  3RUI B;  5DPW A;  3NHE B;  2K8C A;  4WWP A;  3RT3 B;  1GNU A;  4E3C A;  2MQJ A;  2Z0E B;  3BY4 B;  4MM3 A;  4JGH B;  2BPS A;  4IG7 B;  4DHJ D;  1TGZ B;  3CST A;  3U7D A;  5CHV C;  4W9H A;  4A20 A;  2G45 B;  1J8C A;  4B95 A;  3ZNI D;  1WGH A;  3ML8 A;  2D10 A;  1I42 A;  1E8Z A;  3VUY A;  2L76 A;  4XX5 A;  2DEN B;  4GSW A;  5KHQ A;  3O65 B;  1WR6 E;  3PTF C;  2IY1 B;  5E6P A;  2O6V B;  2FCN A;  2PEA A;  3DOW A;  4M0W B;  2L0T A;  4WJO A;  5DCN A;  3QQ8 B;  3QAQ A;  3CSF A;  1AAR A;  3M3J A;  3PVL A;  4TV3 A;  4W9C A;  2D11 A;  3RUL A;  4F1S A;  2EKE C;  2N9P C;  5IA7 A;  4K81 A;  3AU5 A;  1L2N A;  2DZJ A;  3A9J A;  3DBL I;  1WF9 A;  1Q5W B;  2NS5 A;  2N7D A;  4KDI C;  3RYT A;  3VFK A;  3WAP A;  2L7R A;  1WR1 A;  4ZRI A;  3JSV A;  1WXS A;  4IUM B;  4W9D A;  2JVC A;  2LJ5 A;  4RM8 A;  4KIK A;  2KDI A;  4FHJ A;  4JIO U;  3ZUN A;  3KYD D;  3OLM D;  1TTN A;  2FNJ B;  2LWP A;  3H1U A;  3OJ4 B;  2KLG A;  4PS7 A;  2R2O A;  4ICV A;  3DBH I;  1CMX B;  3K9O B;  4KDL B;  4MJS B;  3KYC D;  1H8C A;  2DAF A;  2EMS A;  2XK5 B;  1RRB A;  1UD7 A;  2Y5B B;  1P1A A;  2M0X A;  4WJQ A;  2MCN B;  2C7H A;  2GMI C;  2FAZ A;  3VUX A;  5JHB A;  3A4R A;  2L3Z A;  3VQI A;  4GDL A;  2L8J A;  4FJV B;  4URK A;  2CHW A;  3KUD B;  3AUL A;  4LJO B;  2A4Z A;  3UIN B;  2MX2 A;  3A9K B;  3PHW B;  1XQQ A;  2LD9 A;  1JRU A;  1P0R A;  2MP2 B;  3H7P A;  3KW5 B;  4CYE A;  3ZO5 B;  1WE6 A;  1G6J A;  2ZPY A;  2HE7 A;  3RZW C;  1LM8 B;  2V3S A;  3NZU A;  3SD5 A;  2KAN A;  4EZK A;  2HTH A;  1WX7 A;  2NBW B;  2DYO A;  4P7I A;  4YL8 A;  1OTR B;  2NVU I;  4AJY B;  4ANX A;  3UF8 A;  1D3Z A;  5FR6 A;  2WDT B;  4NY0 A;  2DZI A;  2RPQ A;  3H9D A;  2JRH A;  2NPT A;  3APD A;  2JY6 A;  3CF6 E;  1LXD A;  3NZS A;  3ZNZ B;  4BVU C;  3A1Q A;  1WJN A;  1R4N I;  2PE9 A;  4IWP A;  4HPM B;  4HJK A;  4NJ6 A;  2LXC A;  5J18 A;  4NPN A;  2LI5 A;  2KC1 A;  3TBL D;  1C1Y B;  3ZTD A;  1TBE A;  1V2Y A;  2G4S A;  3L10 B;  2D07 B;  3BIN A;  1S3S G;  3SU8 X;  3ZLZ A;  4EOY A;  4KVG B;  3I3T B;  3AXC A;  3PGE A;  2BWE S;  2JXX A;  4OVU A;  1WGD A;  3N32 A;  1WI0 A;  2LXA A;  3MJW A;  1UGM A;  2VRR B;  2C7M B;  3EFU A;  3NOB A;  1KOT A;  5L83 A;  3B0A A;  4EUT A;  2KJ6 A;  1P98 A;  1EF1 A;  5DPT A;  2DYM A;  2HD5 B;  4EZJ A;  4W9I A;  2MA9 B;  2M1M A;  5D6J B;  1RAX A;  1YQB A;  2LAS A;  2AWT A;  4PS3 A;  2DYB A;  4HLE A;  1H4R A;  3LJ3 A;  2UYZ B;  2KHW B;  2KTF A;  3W1S C;  1BT0 A;  1YJ1 A;  2AL3 A;  2WWZ A;  1XD3 B;  2KWC A; 
#chains in the Genus database with same CATH topology
 2GBR A;  4II3 B;  2MW5 A;  2INN E;  2L05 A;  1WFY A;  2G3Q B;  2CU3 A;  2AL6 A;  2LVO A;  4BBN F;  4B9K A;  4LCD E;  2M8S A;  3WAM A;  1VZ8 A;  3IFW B;  3V6C B;  2K8B A;  1MVK A;  2CJN A;  1WRD B;  2OJR A;  3NY5 A;  2ZVO A;  3AH7 A;  4BKS A;  2WU2 B;  1I35 A;  5JHA A;  1MHX A;  4JPS A;  2N9K A;  1I4P A;  2KAC A;  4BZA A;  4YT0 B;  3DWG C;  1P3Q U;  1TS4 A;  3I5J C;  4CHK A;  2N1V A;  2BKR B;  2KZR A;  3APC A;  2MBB B;  2MLB A;  3GE3 C;  4BKT A;  3PRE A;  1QOA A;  2INP E;  3ENE A;  2N7E A;  2Y5C A;  4KGT A;  2VH2 A;  2QJL A;  3V3X A;  3EA6 A;  3WAO A;  1KLG D;  2J4X A;  4BBN C;  2HJ1 A;  3VUW A;  2W55 A;  5IKC M;  4FJY A;  1NI3 A;  1NEN B;  5CX3 A;  2LGY A;  4I6N B;  1R4M B;  5C23 A;  3A1Q B;  4P16 A;  3B08 A;  2KK8 A;  1JWS D;  3PV1 A;  3ZNH B;  5J2R A;  2KTR A;  1JWA D;  1X1M A;  1GPX A;  5LXH A;  2PTL A;  1TIF A;  4G11 A;  2YLM A;  3RNA C;  2GBJ A;  1HE8 A;  3AE2 B;  3WIM A;  3U8Z A;  4HKZ E;  1L6V A;  2N9E B;  2DWQ A;  4GLS C;  1YJJ A;  3PZD A;  1UGJ A;  1KTK A;  5AZH A;  3RNF C;  3W1S A;  3UIP B;  4LNO A;  2IO3 B;  1F77 A;  1ZE3 D;  2KDB A;  4EZL A;  4BFR A;  2N0S B;  1UZX B;  5D3D A;  2J52 A;  1V97 A;  3VHT C;  5BMG A;  2YEP F;  4HEA 1;  5HG2 A;  4ZRP A;  4NQK E;  2PPH A;  3AV8 A;  4OZC A;  4B6W A;  2K3U A;  3Q6B A;  4L1B A;  3DHG C;  2KFK A;  2GBK A;  2PLP A;  2O6V D;  4PS8 A;  1YIW A;  3DVG X;  4XZ4 A;  4PT5 A;  3Q3J A;  1L4Z B;  4YXD B;  4IWO A;  4W9K A;  2K1F A;  4AUQ C;  3PRZ A;  1WWT A;  3MHS D;  1IBX A;  5G55 A;  2QC8 A;  2WYQ A;  4JWU C;  3X0W A;  1JQ4 A;  2HDE A;  2LGI A;  4EEW A;  1TY0 A;  5IN7 A;  2ON8 A;  3JYU A;  3WAN A;  2JWU A;  1QLB B;  4MGZ E;  1FFU A;  1T5X D;  3VTV A;  2ZW0 A;  3NVZ A;  3C8Y A;  1RFK A;  2J0M A;  3AU4 A;  2LUM A;  1AYF A;  4OVZ A;  2WXG A;  3GE8 C;  3NG0 A;  3AE4 B;  5EDS A;  1TS3 A;  4OW0 A;  1D4B A;  1GC6 A;  1NDD A;  1FFV A;  4W9J A;  4BOZ B;  1CK1 A;  1IGC A;  1ZW7 A;  2BYE A;  3OJ3 A;  3L54 A;  4P6V F;  5AZF A;  3TIX A;  2J0J A;  1KJT A;  3ECI A;  2ASQ A;  5TR5 A;  1S1Q B;  2K6Q A;  1OQY A;  2WXJ A;  3ZGZ A;  2MBO A;  5E6J A;  1Y8R C;  2KN5 A;  3TSS A;  1K8R B;  1SE4 A;  2FID A;  4HKQ A;  3HIZ A;  5EE3 A;  1XEE A;  3QA8 A;  3BVG A;  4DHZ B;  1EWY C;  1WJ4 A;  5IAA C;  4DWF A;  1TZO A;  5IO9 A;  2VH1 A;  2BGF A;  1I7H A;  1V1O A;  4XE0 A;  3KH0 A;  4FJZ A;  3RNG C;  1CJE A;  1WJ6 A;  2BYT A;  4C4V A;  2ZCB A;  3T9L A;  2PE6 B;  3RD2 A;  3M62 B;  1WMH B;  4M01 A;  1WIA A;  3MHZ A;  4XWW A;  2NR2 A;  3ZVV A;  4HDO A;  2RMM A;  4NAW A;  2LMC A;  2LRU A;  5CHW A;  4BKG A;  1WXV A;  1FCC C;  4BKS D;  3DHH C;  1K50 A;  1JAL A;  2WNM A;  1TT5 B;  3SDL C;  3RFZ B;  1FPY A;  3KWV A;  1IUE A;  3PRP B;  3DVG Y;  2WDV B;  1DYQ A;  4WJP A;  1ZUD 2;  2IO0 B;  3IVF A;  2N4F A;  2KKC A;  1MG8 A;  2PJH A;  2L00 B;  3M95 A;  3ZDM C;  2OJW A;  2K39 A;  2W54 A;  1E90 A;  1MFW A;  4RGN A;  1JWM D;  3IG3 A;  3RUI B;  4WWP A;  5BYQ A;  1XLQ A;  2MQJ A;  1WXQ A;  2BPS A;  1TGZ B;  3U7D A;  3BYY B;  4B95 A;  3ZNI D;  1C4A A;  3ML8 A;  2D10 A;  1I42 A;  1E8Z A;  3VUY A;  1NYQ A;  2DEN B;  1AWD A;  2LFI A;  4US8 A;  3DOW A;  1HZ6 A;  2WXI A;  4WJO A;  1BXT A;  1YMH E;  3M3J A;  4TV3 A;  2D11 A;  3Q69 A;  3AU5 A;  3DBL I;  2NS5 A;  3WAP A;  5BYS A;  2L7R A;  2LJ5 A;  3B2F A;  3HRD D;  3IT4 B;  2JYT A;  2PW9 A;  4P1C C;  3OJ4 B;  1JCK B;  4PS7 A;  4RNA A;  4K3B A;  2R2O A;  4ICV A;  5EE0 A;  1CMX B;  3NUH B;  2XK5 B;  1PGA A;  2XN9 C;  2M0X A;  1RWS A;  1N6Z A;  4XDC A;  1N5W A;  2E3T A;  3VUX A;  3AE6 B;  3VQI A;  4FJV B;  4URK A;  2ACZ B;  3KUD B;  5AUI A;  4A90 A;  1YN4 A;  1XQQ A;  2MP2 B;  1JRU A;  1FO4 A;  3KW5 B;  1G6J A;  3RZW C;  2V3S A;  2KAN A;  2OED A;  2HTH A;  1KRH A;  2NBW B;  1MPE A;  4YL8 A;  2XNA C;  2RDG A;  5FR6 A;  3H9D A;  3AEC B;  3APD A;  3CF6 E;  3NZS A;  1FNU A;  1BML C;  3IT6 B;  3A1Q A;  3Q3O C;  2KMM A;  3HVD A;  4NJ6 A;  4NPN A;  2LI5 A;  2KC1 A;  3ZTD A;  1C1Y B;  2VZK D;  2G4S A;  3BIN A;  4HRS A;  3ZLZ A;  4EOY A;  3AXC A;  4UDU C;  2VRR B;  2YEP B;  1P98 A;  1EF1 A;  2DYM A;  4W9I A;  3E9S A;  4PS3 A;  1XLP A;  4MM3 B;  1HZ5 A;  3ZJU A;  5H92 C;  3BVZ A;  2AL3 A;  2KWC A;  4WIP A;  3RN9 C;  1EO6 A;  3UGB B;  2WXP A;  3P42 A;  2L0F A;  2LRW A;  2ICI A;  1YN5 A;  3APF A;  4AJW A;  1QKZ A;  2IY0 B;  2GOW A;  5DPR A;  2BS2 B;  3GZN I;  2WX0 A;  3A9J B;  2C60 A;  2ZCC A;  3PPA A;  1XLN A;  3JSV B;  3P63 A;  4KIK B;  3H8H A;  3RNB C;  3AEE B;  2WQY B;  3DBR I;  4DHZ E;  3Q8A A;  2WX1 A;  4K7U A;  1PYW D;  2DAJ A;  1LGR A;  4FLH A;  2NTT A;  3AE1 B;  3AMZ A;  2G1E A;  2MBH A;  4GGQ A;  1SGH A;  2JZ3 B;  4ZRQ A;  4HVB A;  4KV2 A;  4F8C B;  3SR6 A;  5DPS A;  2KC2 A;  2WP9 B;  5JH5 C;  1YD8 U;  3D32 A;  3Q3F A;  2GLS A;  1WX9 A;  4HXD A;  4FN2 A;  1UBI A;  1QF6 A;  3RZF A;  4LNI A;  1U4A A;  3I57 A;  2WDQ B;  2UWQ A;  4EKU A;  2FCM A;  3P4P B;  4F7Z A;  2JRI B;  2TSS A;  3Q8B A;  4XC2 A;  2NPT B;  4HCN B;  1SE9 A;  2MEK A;  1YX6 B;  2UU7 A;  5BMI A;  3FIL B;  2I1J A;  3N9Y C;  1E7V A;  3P4Q B;  4KSL C;  2JUO A;  4GXB A;  5J17 A;  3CWI A;  2HJ8 A;  4HK2 A;  2WLB A;  2K25 A;  4WWN A;  1HA5 A;  4FUL A;  2CHX A;  1SF0 A;  4AWJ A;  1WJU A;  1L7Y A;  3PRM B;  4PYZ A;  3ZJV A;  1F2R I;  1YQ3 B;  4AOF A;  1OEY J;  3ZTC A;  2FCQ A;  1QT9 A;  2NTS A;  4DXA B;  1F9J A;  4XYC A;  3HHM A;  3R7R A;  4ARC A;  3NJT A;  2KJR A;  1T0S C;  3KWL A;  3QK0 A;  2KLC A;  3K9P B;  3LB8 C;  2SAK A;  5D2M B;  4NJC A;  1QOF A;  1WMH A;  3MFG A;  1WXA A;  1TS2 A;  1TYG B;  3TEY A;  4RF0 A;  1VZ7 A;  2KX3 A;  2DLB A;  4GB9 A;  3RNC C;  1E7P B;  4MGY E;  4J6I A;  3OG5 A;  1SIF A;  1FNV A;  2WU5 B;  1SIJ A;  4HJG E;  2MBQ A;  3L13 A;  3DPD A;  1GJZ A;  4JL9 A;  1GC7 A;  4KZ0 A;  4M00 A;  3PO0 A;  1OEY A;  1Q0W B;  1WGG A;  4LNK A;  1UNS A;  2ZPN A;  3X23 A;  5JZE B;  1HTQ A;  1YQ4 B;  3C0R B;  2IYD B;  4WAA A;  4YSY B;  1JRP A;  2FE8 A;  2C9W B;  4C7Z A;  1V6E A;  4ZRK A;  1XCT L;  1V1P B;  1OFF A;  3KUZ A;  4YWG G;  1ET9 A;  1QQR A;  3N3K B;  5CHF A;  4DHJ B;  4OHJ A;  3GP7 A;  4FBJ B;  2ZJD A;  3W5U B;  3R3M A;  1ESF A;  3DVN V;  3ALB A;  3AB5 A;  4ZYN A;  3ZXV A;  3Q2A C;  1FXI A;  1I4R A;  4MSM B;  2I1K A;  4ANU A;  3IHP C;  4TKN A;  3GZN B;  3V61 A;  1MHH E;  2GBN A;  2MHJ A;  2RGF A;  1AN8 A;  2GI9 A;  2ZNV C;  3EHV A;  3B2G A;  4N59 A;  3VR8 B;  2QCZ A;  2N1W A;  1UWX A;  1NBF C;  4LTU A;  4JE3 B;  2BVC A;  3VH3 B;  3IBE A;  4LNN A;  4RGO S;  2XK5 A;  3Q3N C;  2X8X X;  1LFD A;  1JWU D;  2WGS A;  1SE2 A;  3NVW A;  2BW2 A;  1N61 A;  4WAF A;  4FAD A;  3DBH B;  5KHO A;  3V60 A;  5MPO A;  2V1Y A;  2MP2 A;  3NVY A;  4IW0 A;  4RF1 A;  4MGK E;  3RMK C;  2KO3 A;  1T0R C;  2M17 A;  5FKA C;  4RGT A;  5E6N A;  1TS5 A;  2KDE B;  1KF6 B;  3BWU D;  3DDC B;  4GOC A;  4IC7 B;  4DK5 A;  3SFD B;  4WJN A;  2IBI B;  4MH8 A;  3ZIM A;  5LLI A;  1Q1O A;  4IWQ A;  2M0A A;  3EEC A;  1DOY A;  3U30 A;  2NBU A;  2KWU B;  1C78 A;  1XCQ L;  2JWZ A;  5FK9 C;  4E71 A;  1FRR A;  1DOX A;  2AQ1 B;  1GOZ A;  5DPW A;  4A55 A;  3RI7 C;  4IDI A;  1STE A;  4MM3 A;  2KN4 A;  3CST A;  2AQ3 B;  4A20 A;  2G45 B;  1J8C A;  1EWC A;  1WGH A;  2L76 A;  4XX5 A;  2V0G A;  4GSW A;  5KHQ A;  2O6V B;  3W2D A;  2FCN A;  4M0W B;  2L0T A;  1AAR A;  4F1S A;  3DHI C;  2DZJ A;  3A9J A;  1ZXI A;  2N7D A;  1P7E A;  3RYT A;  1WR1 A;  4ZRI A;  3JSV A;  4W9D A;  4KIK A;  2KDI A;  4FHJ A;  3AED B;  3KYD D;  2IPK D;  3OLM D;  2JSV X;  2LWP A;  4KDL B;  2G9H D;  2IJ0 A;  3KYC D;  1D5X C;  1H8C A;  2DAF A;  1P1A A;  3AEB B;  5C2T B;  2I38 A;  2L3Z A;  2L8J A;  2CHW A;  1NYR A;  3AUL A;  3A9K B;  3PHW B;  3EFC A;  1P0R A;  2DNF A;  4AS1 A;  1EU4 A;  2WHI A;  1FIQ A;  2ZPY A;  4KGR A;  4N58 A;  2HE7 A;  3R2T A;  1WGK A;  1KFY B;  4LNF A;  1WX7 A;  2N7J A;  4AJY B;  4ANX A;  1T0Q C;  2JRH A;  2NPT A;  2JY6 A;  2RDH A;  3Q3M C;  4L23 A;  1QOB A;  1V8C A;  3ZNZ B;  1PUT A;  1R4N I;  1SB3 C;  2LXC A;  2PVG C;  4KKI A;  2KQ4 X;  3FIL A;  3ZYY X;  1TBE A;  4HRO A;  2IGH A;  1YJI A;  4KVG B;  1ET6 A;  1C4C A;  1Y56 A;  2BWE S;  2JXX A;  4OVU A;  1WGD A;  4WQM A;  4US9 A;  2RPV A;  3NOB A;  4QAY A;  4L2Y A;  3N20 C;  3Q14 C;  2MA9 B;  1KLU D;  3BK2 A;  2K5P A;  2LAS A;  2AWT A;  5LNK 1;  1GB1 A;  4HLE A;  1H4R A;  2KHW B;  1SEB D;  2EKI A;  3HUI A;  3OWE B;  2LGS A;  4LK0 M;  1IYF A;  3R2I A;  4HCP B;  2IND C;  4A8X C;  2D3G A;  3AI5 A;  2RDB C;  2ZZP B;  1TY2 A;  3NZ3 A;  3QAR A;  1T0Y A;  2ZNV B;  2JX5 A;  1SBB B;  1LO5 D;  1ZPS A;  2WXK A;  3BZD B;  3UQA A;  3P4S B;  1SXT A;  1WM2 A;  3EGR A;  2JPH A;  5HI1 A;  3T3N A;  1WYG A;  2W3S A;  5C1Z A;  2ZVN A;  1RFA A;  2MJ3 A;  4RFB A;  4WQO B;  5G5H A;  1RYJ A;  2FUG 1;  3ZDT A;  4DBG A;  3MJ5 A;  4NZL B;  1ZXH A;  3L0W B;  2AQ2 B;  3R66 C;  1V86 A;  4FA6 A;  1D5Z C;  3N30 A;  3ZXR A;  1WXM A;  3H6N A;  1D5M C;  3QCA A;  3VTW A;  3ZQ4 A;  4X57 B;  1SSN A;  5D7G A;  2J0K A;  3HVZ A;  4KSK C;  1OQR A;  3ZRF A;  3H7P B;  4K7S A;  2QDF A;  3R8B A;  2FBW B;  1TKE A;  4II2 B;  1V1P A;  3N1Z C;  2BB6 A;  3L08 A;  2L32 A;  4TMA B;  5HKH A;  1ZP0 B;  1FEH A;  4I6L B;  1E7U A;  1J7C A;  4GN1 A;  1V5T A;  3I63 C;  1WRI A;  4S0R A;  1I4Q A;  3V6E B;  1YX5 B;  1PFD A;  3P2B A;  3AE9 B;  5D94 A;  2K9X A;  3PLU A;  4LDT B;  2LGX A;  1WGY A;  3N1Y C;  1JWB D;  1ZOY B;  4K1R B;  4PK1 A;  1UWM A;  2Z59 B;  3SFE B;  2KT7 A;  2W82 A;  2FUH B;  3A33 B;  2KJH B;  3TCA A;  1FNW A;  1WZ3 A;  4CO7 A;  3W9C B;  2PIA A;  2DX5 B;  2BBC A;  4OVV A;  2Y3A A;  3ZNG C;  3HM3 A;  2MSE D;  4WWO A;  4W9G A;  3AE3 B;  1Z2M A;  1ZKH A;  3WCQ A;  1VD2 A;  5AEK B;  1GB4 A;  4NNJ B;  2Y5P A;  3DVN U;  2MJE A;  2ZW1 A;  1PQS A;  4GDK B;  1YNT E;  2XEW A;  2BYF A;  4GMV A;  3T3O A;  4JWS C;  1FXA A;  2RSU A;  2KMC A;  3PZ8 A;  4RH6 A;  1WH3 A;  4GIV A;  4Q2J A;  3N1X C;  1OGW A;  1R4N B;  2KX0 A;  4M02 A;  2KQS A;  5AZG A;  1UEL A;  2CHZ A;  4DDI D;  2KMA A;  4MGI E;  1C76 A;  3QC8 B;  4ITK A;  1LQB A;  3QX1 A;  2BYV E;  2LHE A;  2M4N A;  4USA A;  5EE9 A;  3M63 B;  1TZ1 A;  2L1A A;  3Q8C A;  3AE5 B;  1ROE A;  2D3B A;  1R4M I;  3QJZ A;  1A70 A;  3QHT A;  2MRP A;  1RM6 C;  2MJD A;  4W9E A;  2D5G A;  4FHK A;  2XBB C;  2M19 A;  1Q10 A;  2W9N A;  3AEA B;  1E0Z A;  3BII D;  1WX8 A;  1E5W A;  3GOE A;  2O6V A;  1WYW B;  2CKH B;  3GS2 A;  4A3P A;  3AM9 A;  4DQO C;  2DHZ A;  1F2R C;  2EMT A;  1T3Q A;  2O2V B;  3ZKJ C;  1B9R A;  1UH6 A;  1M94 A;  2BWF A;  2QHO A;  1PGX A;  3TL5 A;  2WXH A;  2NCN A;  4IM2 A;  3TMP B;  3IAS 1;  2AX5 A;  1EUV B;  3DBL B;  3ML9 A;  3U4E G;  1ZGU B;  1ENF A;  4ZRJ A;  3NS8 A;  3GB1 A;  3TEW A;  4EFO A;  2LZ6 A;  4TQ1 A;  2CS4 A;  2W3R A;  3JW0 X;  4OZB A;  2KWD A;  1QOG A;  2KDF B;  4MEL A;  3A9K A;  1KM7 A;  4NAW B;  2A5U A;  5AUK A;  4H2A A;  2LGD A;  3WAL A;  4MT5 A;  4PYU A;  3OAW A;  1E8Y A;  1WM3 A;  1V81 A;  3UQB A;  2HTM E;  2LEK A;  1OQQ A;  4M8N A;  4NAM A;  2IO1 B;  1XT9 B;  3HK0 A;  1J0G A;  2MH7 A;  2JU6 X;  2MWS B;  3B9J A;  3Q8F A;  2KFJ A;  5G5G A;  1L6U A;  2IZV B;  1K53 A;  1Z5S B;  3IAM 1;  1R7S A;  3CMM B;  2DZM A;  3DCG A;  3O13 A;  2R61 A;  2KYW A;  2FCS A;  2LVQ A;  4ARI A;  3LDZ E;  2JZZ A;  1J7A A;  1NVI D;  1ISN A;  2CU1 A;  2LVP A;  2SEB D;  3NHE B;  2K8C A;  2L83 A;  4E3C A;  3BY4 B;  1N5X A;  2V3N A;  4KGS A;  5TSS A;  4DHJ D;  4W9H A;  2IDY A;  5EE1 A;  2JYE A;  3ETR A;  4O1N A;  1GAQ B;  3VRB B;  1HEZ E;  1HQR D;  2IY1 B;  2PEA A;  2NMQ A;  1EU3 A;  1BUI C;  2IGD A;  1JRO A;  3QQ8 B;  5DCN A;  4W9C A;  3PVL A;  3EUB 2;  1WF9 A;  1Q5W B;  4KDI C;  3VFK A;  1VJK A;  1WXS A;  4IUM B;  2JVC A;  4RM8 A;  4JIO U;  4MAC A;  3L4P A;  3ZUN A;  4D2K A;  2DBY A;  3SEB A;  1EM7 A;  1F1H A;  1TTN A;  1JW9 D;  2KLG A;  2BS3 B;  2OHF A;  3K9O B;  4MJS B;  4C00 A;  3BYT B;  2EMS A;  1JML A;  2BB5 A;  3ABV B;  1F52 A;  4RCO A;  2QMT A;  1L0X B;  2MCN B;  3BVM A;  2H88 B;  3DBR B;  5JHB A;  2WXQ A;  1ZDX A;  5IP4 D;  3P1M A;  4LJO B;  3UIN B;  3URY A;  2MX2 A;  3H7P A;  1VZ6 A;  1VR9 A;  1C77 A;  3I9V 1;  3AEG B;  3ZO5 B;  2H89 B;  1LM8 B;  2WS3 B;  1CQV A;  2WXF A;  2GB1 A;  1FRD A;  3UF8 A;  2D3A A;  1D3Z A;  2WDT B;  1FM0 D;  4NY0 A;  1LXD A;  1B1Z A;  1WJN A;  4IWP A;  1MJD A;  5J18 A;  2QSD A;  3TBL D;  2D3C A;  3L10 B;  2D07 B;  3NS1 A;  3KQ4 A;  1D6E C;  4JX1 C;  3MC9 A;  4TSS A;  3PGE A;  3N32 A;  3AEF B;  1VLB A;  3MJW A;  1UGM A;  4FXC A;  2C7M B;  5BYR A;  5L83 A;  3B0A A;  5DPT A;  3W5V B;  2M56 B;  3RPF C;  1N60 A;  2HD5 B;  4DXG A;  4EZJ A;  1YQB A;  1DGJ A;  4OZA A;  2UYZ B;  4EE2 A;  3W1S C;  1BT0 A;  1YJ1 A;  1XD3 B;  3NVV A;  2K8H A;  2GBM A;  1A5R A;  4GDK A;  2QIE B;  2OOB B;  2J7Q B;  4TUU A;  1WE7 A;  4N6E B;  1SE3 A;  4YTN B;  3ZRC A;  4G0N B;  2IGG A;  1TJE A;  2V9H A;  4ACF A;  1CZP A;  2KVR A;  3KVF B;  4DXF A;  2JT4 B;  3PLV A;  4REZ A;  2WDR B;  1L0Y B;  2MBE A;  2IO2 B;  3TJP A;  4IM3 A;  1FXT B;  3PHX B;  3ZW3 A;  5LXI B;  2KQ7 A;  1C4P A;  1E8X A;  3HM6 X;  2V4I B;  2B3A A;  5GMV A;  2G4D B;  3B1L X;  2KOX A;  3QIJ A;  5BO4 B;  1XXG A;  2KDM A;  1WSP A;  3E56 A;  4GDL B;  4LJP B;  4YTP B;  3FKY A;  3UIO B;  3A4S C;  4B0E A;  5HFY A;  4K7W A;  2K6D B;  3ONS A;  2JXT A;  3VDZ A;  2LUE A;  2C7N B;  2KD0 A;  1E8W A;  4WUR A;  2JQR B;  4ANW A;  3TEZ A;  1IP9 A;  1PDX A;  2WXO A;  4YSX B;  3U52 E;  4NJ7 A;  3DQV A;  1KH0 A;  2GRI A;  1N62 A;  2BKF A;  2LJI A;  3VR9 B;  1GUA B;  2O2V A;  1VCB A;  5T8I A;  4ASW C;  5FR3 A;  2ZEQ A;  1C3T A;  1K51 A;  4WH4 A;  3NRZ A;  4GU2 A;  2BTE A;  2BQQ A;  1XF5 L;  3PZ7 A;  4HWI B;  2WXL A;  4JLC A;  3MP9 A;  4B0M A;  2NBV B;  5E6O A;  1E10 A;  5C3J B;  2D2Q A;  1I4G A;  1V5O A;  3PSE B;  4AP4 C;  2K22 A;  5H8Y E;  3P4R B;  1PGB A;  2AEH A;  3WA0 A;  4YSZ B;  1UBQ A;  3ZJT A;  4KX6 B;  1EF5 A;  3LYY A;  4HDQ A;  4KKJ A;  2AYO B;  4ANV A;  1P9D U;  3VH4 B;  3VXW A;  3SHQ A;  2N9L A;  4J3O D;  1SJH D;  4W9F A;  3H7S A;  4TQ0 A;  3EC8 A;  4E74 A;  2KWV B;  3PT2 B;  4MSQ B;  4I6P A;  1NI2 A;  3L16 A;  2PMV A;  4DDG D;  3QWZ B;  3R7Q A;  1V49 A;  4A3O A;  4N9F 4;  1AW7 A;  1N63 A;  3AE7 B;  4ZYS A;  4BOS C;  1I4H A;  4IOI E;  1XO3 A;  3VRA B;  2R2Q A;  3S2A A;  2YVC A;  3KUC B;  1VRA B;  3C19 A;  3TEX A;  3VTU A;  2C5L C;  1QZE A;  4P1B C;  2BT6 A;  1XLO A;  2V4L A;  3MC8 A;  1WZ0 A;  4RMA A;  3T8M A;  4C56 C;  2KXJ A;  2LHD A;  4W9L A;  4RM9 A;  2PVO D;  3RNE C;  2X38 A;  1L0V B;  2RD0 A;  4BAX A;  1QIL A;  2WXM A;  4ZHP A;  3JVZ X;  4XDD A;  4AQ7 A;  4LDT D;  3CIR B;  1NEK B;  3LXF A;  2JF5 A;  2KTR B;  3PS6 A;  1C9F A;  4G3X B;  4ZHO A;  2CJO A;  4ICU A;  1J19 A;  4G50 A;  2QIL A;  1MG4 A;  2CR5 A;  2JZP A;  2FIF A;  1DOI A;  1FD6 A;  3V05 A;  4MJS A;  4MDK E;  2RR9 A;  2PKO A;  4MH0 E;  2REX A;  5I4D A;  2B76 B;  4A9A A;  5L95 C;  2KNB A;  4YTM B;  5JXV A;  3MTN B;  2N9X A;  2K0P A;  1WY8 A;  2BF8 B;  1C79 A;  1YOV B;  3V62 A;  3L17 A;  1K52 A;  1KLV A;  2KFK B;  4HPP A;  3VAW A;  4A6Q A;  2Z0D B;  5G2N A;  1IGD A;  5GXG B;  1E9M A;  1V9J A;  3FC4 A;  1IPG A;  1ACC A;  1V80 A;  1TKY A;  2Z8L A;  4IM0 A;  5IOI A;  1IBX B;  4JQW C;  2V3P A;  4KZC A;  3W1Y A;  4M8M A;  4ZDV A;  2E6X A;  3VVW B;  2VZK B;  3DBS A;  4C7Y A;  2WXN A;  1WGR A;  3TUO A;  3RCZ A;  4NQL B;  3KLS X;  2KVZ A;  4IKG A;  2DZK A;  1GG3 A;  4MEM A;  1RLF A;  5CTR C;  4HPL B;  4ZOH C;  1VDV A;  4CQN A;  3RT3 B;  1GNU A;  2KAJ A;  2ONQ A;  2Z0E B;  4JGH B;  4IG7 B;  5CHV C;  3IXS A;  4C80 A;  2I2Y A;  3Q8E A;  4LLG M;  2Q5W D;  4S17 A;  1P7F A;  1UF0 A;  3O65 B;  1WR6 E;  3PTF C;  5E6P A;  1HTO A;  4RGM A;  1MI0 A;  5BMH A;  3QAQ A;  2WXR A;  3CSF A;  5IA7 A;  3RUL A;  2EKE C;  2N9P C;  4K81 A;  1L2N A;  3AE8 B;  4M0W A;  2L52 A;  4K3C A;  3BK1 A;  2FNJ B;  3H1U A;  1ZDV A;  1T6B X;  2QEJ C;  3DBH I;  1SJE D;  3MC0 B;  1RRB A;  2EEL A;  1UD7 A;  2Y5B B;  1HXY D;  4WJQ A;  2C7H A;  2GMI C;  2INC C;  2FAZ A;  1L4D B;  1E6E B;  3A4R A;  4GDL A;  2A4Z A;  2LD9 A;  4CYE A;  4C4V B;  1WE6 A;  3AN1 A;  3NZU A;  3SD5 A;  4EZK A;  2DYO A;  4P7I A;  1OTR B;  2NVU I;  3U7Z A;  3UI3 A;  3DWM A;  3J9C A;  4R3D A;  2DZI A;  2RPQ A;  5HHD G;  1YN3 A;  1L5P A;  4BVU C;  2PE9 A;  2J42 A;  4HPM B;  4HJK A;  5D3I B;  2J53 A;  4XWT A;  1FMA D;  1V2Y A;  3U2S C;  1S3S G;  3SU8 X;  1TKG A;  3I3T B;  1F0Z A;  3FAH A;  1WI0 A;  2LXA A;  3EFU A;  1J7B A;  1KOT A;  4EUT A;  1I4X A;  2KJ6 A;  2M1M A;  5D6J B;  1RAX A;  1FCL A;  4XGA B;  2DYB A;  1M4V A;  2BS4 B;  3LJ3 A;  1UUP A;  2KTF A;  2WWZ A;  4WWM A; 
#chains in the Genus database with same CATH homology
 1EO6 A;  2GBR A;  4II3 B;  3UGB B;  1IYF A;  4HCP B;  2K8H A;  2GBM A;  2MW5 A;  1A5R A;  2D3G A;  4GDK A;  2L05 A;  3AI5 A;  2L0F A;  2ZZP B;  1WFY A;  2G3Q B;  2OOB B;  2J7Q B;  2LRW A;  2AL6 A;  1WE7 A;  2LVO A;  3QAR A;  4TUU A;  4BBN F;  1T0Y A;  2ZNV B;  3ZRC A;  4B9K A;  3APF A;  4G0N B;  4AJW A;  3UQA A;  4LCD E;  2IY0 B;  2GOW A;  2M8S A;  1WM2 A;  5DPR A;  2KVR A;  2JPH A;  3WAM A;  3KVF B;  3IFW B;  3V6C B;  3GZN I;  2WX0 A;  2K8B A;  3A9J B;  2JT4 B;  1WRD B;  2OJR A;  3NY5 A;  2ZVO A;  3PLV A;  2C60 A;  2ZCC A;  3PPA A;  3JSV B;  4BKS A;  1I35 A;  2MBE A;  5JHA A;  4KIK B;  5C1Z A;  2IO2 B;  2ZVN A;  3TJP A;  4IM3 A;  1RFA A;  1FXT B;  3DBR I;  3PHX B;  3ZW3 A;  4DHZ E;  5LXI B;  2WX1 A;  2KQ7 A;  4WQO B;  4K7U A;  1P3Q U;  1E8X A;  3HM6 X;  2DAJ A;  4CHK A;  3ZDT A;  2N1V A;  4DBG A;  2B3A A;  3L0W B;  2BKR B;  5GMV A;  4FLH A;  2G4D B;  3R66 C;  3B1L X;  2KZR A;  3APC A;  2MBH A;  4GGQ A;  1V86 A;  2MBB B;  4FA6 A;  1SGH A;  2JZ3 B;  2KOX A;  3QIJ A;  5BO4 B;  3N30 A;  1WXM A;  3H6N A;  2MLB A;  4KV2 A;  4F8C B;  4HVB A;  3QCA A;  3VTW A;  4BKT A;  3PRE A;  4GDL B;  4LJP B;  4X57 B;  5DPS A;  3ENE A;  2N7E A;  5D7G A;  3UIO B;  2J0K A;  2KC2 A;  3A4S C;  4KSK C;  5JH5 C;  1YD8 U;  3D32 A;  3Q3F A;  3ZRF A;  4K7W A;  2K6D B;  3H7P B;  3ONS A;  4K7S A;  4II2 B;  3VDZ A;  1WX9 A;  4HXD A;  3WAO A;  3L08 A;  4FN2 A;  2LUE A;  1UBI A;  2C7N B;  2KD0 A;  1E8W A;  3RZF A;  4ANW A;  5HKH A;  1IP9 A;  1U4A A;  4BBN C;  2UWQ A;  4EKU A;  3VUW A;  2FCM A;  4F7Z A;  4FJY A;  4I6L B;  2JRI B;  4NJ7 A;  1E7U A;  3DQV A;  4GN1 A;  5CX3 A;  1V5T A;  4XC2 A;  2BKF A;  2LGY A;  4I6N B;  2NPT B;  5C23 A;  1GUA B;  2O2V A;  3A1Q B;  4HCN B;  3B08 A;  3V6E B;  1SE9 A;  1YX5 B;  2KK8 A;  1VCB A;  3PV1 A;  3P2B A;  5D94 A;  3ZNH B;  1YX6 B;  4ASW C;  5J2R A;  2KTR A;  1X1M A;  2ZEQ A;  3PLU A;  4LDT B;  2I1J A;  2LGX A;  1WGY A;  1C3T A;  1E7V A;  5LXH A;  4KSL C;  2JUO A;  4GXB A;  5J17 A;  4G11 A;  2HJ8 A;  2YLM A;  4HK2 A;  4GU2 A;  4K1R B;  2GBJ A;  1HE8 A;  2K25 A;  2Z59 B;  3WIM A;  4HWI B;  3U8Z A;  4WWN A;  2N9E B;  4FUL A;  2CHX A;  4JLC A;  3A33 B;  2FUH B;  3PZD A;  4AWJ A;  1WJU A;  2KJH B;  5AZH A;  2NBV B;  1L7Y A;  3TCA A;  1WZ3 A;  4CO7 A;  5E6O A;  3PRM B;  4PYZ A;  3W1S A;  2DX5 B;  3UIP B;  4AOF A;  2D2Q A;  4OVV A;  2IO3 B;  2KDB A;  3ZNG C;  4EZL A;  4BFR A;  1OEY J;  1UZX B;  2MSE D;  3HM3 A;  4WWO A;  2FCQ A;  3ZTC A;  4W9G A;  3VHT C;  1V5O A;  3PSE B;  4AP4 C;  4DXA B;  1Z2M A;  1F9J A;  3HHM A;  3R7R A;  1ZKH A;  2KJR A;  1VD2 A;  3QK0 A;  2KLC A;  2AEH A;  3K9P B;  4NQK E;  4NNJ B;  5AEK B;  3WA0 A;  3DVN U;  2PPH A;  1PQS A;  1UBQ A;  4B6W A;  5D2M B;  1WMH A;  4GDK B;  1EF5 A;  1WXA A;  4HDQ A;  2AYO B;  4ANV A;  2KFK A;  2XEW A;  2BYF A;  1P9D U;  2KX3 A;  4GMV A;  2GBK A;  3VH4 B;  3VXW A;  2O6V D;  4GB9 A;  4PS8 A;  3SHQ A;  1YIW A;  3DVG X;  2RSU A;  4XZ4 A;  2KMC A;  1WH3 A;  4GIV A;  4W9F A;  3H7S A;  3Q3J A;  4J6I A;  4MGY E;  1OGW A;  1SIF A;  4IWO A;  4W9K A;  2K1F A;  4AUQ C;  2KX0 A;  3EC8 A;  3PRZ A;  4TQ0 A;  2KQS A;  2MBQ A;  1UEL A;  3L13 A;  3DPD A;  5AZG A;  2CHZ A;  3MHS D;  4JL9 A;  1GC7 A;  4E74 A;  1GJZ A;  4KZ0 A;  2KWV B;  3PT2 B;  4MSQ B;  5G55 A;  4DDI D;  4I6P A;  1NI2 A;  1OEY A;  2KMA A;  2WYQ A;  1Q0W B;  3L16 A;  3X0W A;  4DDG D;  4MGI E;  1WGG A;  3QC8 B;  2ZPN A;  3X23 A;  4EEW A;  3QWZ B;  5JZE B;  3R7Q A;  1V49 A;  4A3O A;  4N9F 4;  1LQB A;  3QX1 A;  2BYV E;  3JYU A;  3C0R B;  3WAN A;  4BOS C;  2IYD B;  4MGZ E;  2M4N A;  2R2Q A;  3S2A A;  3VTV A;  4WAA A;  3M63 B;  1TZ1 A;  2YVC A;  3KUC B;  3VTU A;  3AU4 A;  2J0M A;  2C5L C;  2C9W B;  1QZE A;  1V6E A;  2V4L A;  1R4M I;  3QJZ A;  4ZRK A;  1WZ0 A;  3QHT A;  5EDS A;  4RMA A;  2MRP A;  4W9E A;  3T8M A;  2KXJ A;  3KUZ A;  4FHK A;  2XBB C;  1GC6 A;  2W9N A;  1NDD A;  3N3K B;  5CHF A;  4DHJ B;  4W9L A;  4RM9 A;  4FBJ B;  2ZJD A;  4W9J A;  4BOZ B;  2RD0 A;  1WX8 A;  3R3M A;  1E5W A;  3GOE A;  2O6V A;  1WYW B;  2CKH B;  3DVN V;  4A3P A;  1ZW7 A;  2BYE A;  2DHZ A;  3ALB A;  3JVZ X;  4ZYN A;  3OJ3 A;  2EMT A;  3L54 A;  4LDT D;  2O2V B;  3ZKJ C;  5AZF A;  3TIX A;  2J0J A;  2I1K A;  4MSM B;  4ANU A;  1KJT A;  1UH6 A;  1M94 A;  2BWF A;  2QHO A;  3TL5 A;  2JF5 A;  2KTR B;  3IHP C;  3PS6 A;  4TKN A;  3V61 A;  2GBN A;  2RGF A;  2ZNV C;  4G3X B;  3EHV A;  2NCN A;  3ECI A;  4ICU A;  1J19 A;  4IM2 A;  3TMP B;  2ASQ A;  5TR5 A;  1S1Q B;  2N1W A;  2K6Q A;  1NBF C;  4G50 A;  1OQY A;  2CR5 A;  3VH3 B;  2FIF A;  1EUV B;  2MBO A;  3IBE A;  4MJS A;  1Y8R C;  2KN5 A;  3ML9 A;  1K8R B;  2FID A;  1ZGU B;  4MDK E;  2XK5 A;  2RR9 A;  4MH0 E;  3HIZ A;  4ZRJ A;  3QA8 A;  1LFD A;  3NS8 A;  4DHZ B;  4EFO A;  1WJ4 A;  2LZ6 A;  5IAA C;  4TQ1 A;  4DWF A;  2CS4 A;  2REX A;  2BGF A;  3JW0 X;  4FAD A;  2KDF B;  3KH0 A;  4FJZ A;  5KHO A;  3V60 A;  2V1Y A;  5L95 C;  2KNB A;  3A9K A;  4MEL A;  1KM7 A;  2MP2 A;  4NAW B;  1WJ6 A;  2A5U A;  3MTN B;  4IW0 A;  2ZCB A;  3T9L A;  2PE6 B;  2LGD A;  2N9X A;  4MGK E;  3WAL A;  1WY8 A;  2BF8 B;  3RD2 A;  3M62 B;  4PYU A;  3OAW A;  1E8Y A;  1WMH B;  1WM3 A;  1V81 A;  2KO3 A;  2M17 A;  3V62 A;  3UQB A;  1WIA A;  5E6N A;  3L17 A;  2NR2 A;  3ZVV A;  1KLV A;  2KFK B;  4HDO A;  4NAW A;  4M8N A;  2LRU A;  5CHW A;  2IO1 B;  1XT9 B;  4BKG A;  1WXV A;  2KDE B;  3HK0 A;  3VAW A;  3DDC B;  1J0G A;  2Z0D B;  4GOC A;  4IC7 B;  4DK5 A;  5G2N A;  4BKS D;  4WJN A;  1V9J A;  2IBI B;  3SDL C;  1IPG A;  2MWS B;  2KFJ A;  3ZIM A;  1V80 A;  5LLI A;  1Q1O A;  4IM0 A;  4IWQ A;  2IZV B;  3PRP B;  4JQW C;  3DVG Y;  1Z5S B;  4KZC A;  3EEC A;  4WJP A;  3CMM B;  3W1Y A;  2IO0 B;  4M8M A;  3IVF A;  3U30 A;  2DZM A;  3DCG A;  4ZDV A;  2N4F A;  2KKC A;  1MG8 A;  2NBU A;  3VVW B;  2KWU B;  3DBS A;  2PJH A;  2JWZ A;  2FCS A;  2LVQ A;  1WGR A;  4E71 A;  3RCZ A;  3LDZ E;  4NQL B;  2JZZ A;  2L00 B;  3M95 A;  3ZDM C;  2DZK A;  2K39 A;  1GG3 A;  4MEM A;  1E90 A;  1ISN A;  1RLF A;  2CU1 A;  5CTR C;  3IG3 A;  4HPL B;  2LVP A;  3RUI B;  5DPW A;  3NHE B;  2K8C A;  4WWP A;  3RT3 B;  1GNU A;  4E3C A;  2MQJ A;  2Z0E B;  3BY4 B;  4MM3 A;  4JGH B;  2BPS A;  4IG7 B;  4DHJ D;  1TGZ B;  3CST A;  3U7D A;  5CHV C;  4W9H A;  4A20 A;  2G45 B;  1J8C A;  4B95 A;  3ZNI D;  1WGH A;  3ML8 A;  2D10 A;  1I42 A;  1E8Z A;  3VUY A;  2L76 A;  4XX5 A;  2DEN B;  4GSW A;  5KHQ A;  3O65 B;  1WR6 E;  3PTF C;  2IY1 B;  5E6P A;  2O6V B;  2FCN A;  2PEA A;  3DOW A;  4M0W B;  2L0T A;  4WJO A;  5DCN A;  3QQ8 B;  3QAQ A;  3CSF A;  1AAR A;  3M3J A;  3PVL A;  4TV3 A;  4W9C A;  2D11 A;  3RUL A;  4F1S A;  2EKE C;  2N9P C;  5IA7 A;  4K81 A;  3AU5 A;  1L2N A;  2DZJ A;  3A9J A;  3DBL I;  1WF9 A;  1Q5W B;  2NS5 A;  2N7D A;  4KDI C;  3RYT A;  3VFK A;  3WAP A;  2L7R A;  1WR1 A;  4ZRI A;  3JSV A;  1WXS A;  4IUM B;  4W9D A;  2JVC A;  2LJ5 A;  4RM8 A;  4KIK A;  2KDI A;  4FHJ A;  4JIO U;  3ZUN A;  3KYD D;  3OLM D;  1TTN A;  2FNJ B;  2LWP A;  3H1U A;  3OJ4 B;  2KLG A;  4PS7 A;  2R2O A;  4ICV A;  3DBH I;  1CMX B;  3K9O B;  4KDL B;  4MJS B;  3KYC D;  1H8C A;  2DAF A;  2EMS A;  2XK5 B;  1RRB A;  1UD7 A;  2Y5B B;  1P1A A;  2M0X A;  4WJQ A;  2MCN B;  2C7H A;  2GMI C;  2FAZ A;  3VUX A;  5JHB A;  3A4R A;  2L3Z A;  3VQI A;  4GDL A;  2L8J A;  4FJV B;  4URK A;  2CHW A;  3KUD B;  3AUL A;  4LJO B;  2A4Z A;  3UIN B;  2MX2 A;  3A9K B;  3PHW B;  1XQQ A;  2LD9 A;  1JRU A;  1P0R A;  2MP2 B;  3H7P A;  3KW5 B;  4CYE A;  3ZO5 B;  1WE6 A;  1G6J A;  2ZPY A;  2HE7 A;  3RZW C;  1LM8 B;  2V3S A;  3NZU A;  3SD5 A;  2KAN A;  4EZK A;  2HTH A;  1WX7 A;  2NBW B;  2DYO A;  4P7I A;  4YL8 A;  1OTR B;  2NVU I;  4AJY B;  4ANX A;  3UF8 A;  1D3Z A;  5FR6 A;  2WDT B;  4NY0 A;  2DZI A;  2RPQ A;  3H9D A;  2JRH A;  2NPT A;  3APD A;  2JY6 A;  3CF6 E;  1LXD A;  3NZS A;  3ZNZ B;  4BVU C;  3A1Q A;  1WJN A;  1R4N I;  2PE9 A;  4IWP A;  4HPM B;  4HJK A;  4NJ6 A;  2LXC A;  5J18 A;  4NPN A;  2LI5 A;  2KC1 A;  3TBL D;  1C1Y B;  3ZTD A;  1TBE A;  1V2Y A;  2G4S A;  3L10 B;  2D07 B;  3BIN A;  1S3S G;  3SU8 X;  3ZLZ A;  4EOY A;  4KVG B;  3I3T B;  3AXC A;  3PGE A;  2BWE S;  2JXX A;  4OVU A;  1WGD A;  3N32 A;  1WI0 A;  2LXA A;  3MJW A;  1UGM A;  2VRR B;  2C7M B;  3EFU A;  3NOB A;  1KOT A;  5L83 A;  3B0A A;  4EUT A;  2KJ6 A;  1P98 A;  1EF1 A;  5DPT A;  2DYM A;  2HD5 B;  4EZJ A;  4W9I A;  2MA9 B;  2M1M A;  5D6J B;  1RAX A;  1YQB A;  2LAS A;  2AWT A;  4PS3 A;  2DYB A;  4HLE A;  1H4R A;  3LJ3 A;  2UYZ B;  2KHW B;  2KTF A;  3W1S C;  1BT0 A;  1YJ1 A;  2AL3 A;  2WWZ A;  1XD3 B;  2KWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...