1L2NA

Smt3 solution structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a yeast ubiquitin-like protein Smt3: the role of structurally less defined sequences in protein-protein recognitions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Ubiquitin-like protein SMT3
total genus 8
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l2nA00
4KSLC 3QCAA 3L08A 4G3XB 4FLHA 2AEHA 1WXAA 3WAOA 4CHKA 4F8CB 2L3ZA 4GDLA 4GOCA 1S3SG 2R2OA 1CMXB 1RLFA 4W9HA 3VUXA 2M4NA 5DPRA 3ZRCA 3V61A 4HVBA 2PEAA 2KFJA 3APCA 5DCNA 1JRUA 3L0WB 3OAWA 1BT0A 3KUDB 4MGIE 1WE7A 3PZDA 2GBMA 2LGDA 4W9CA 5AEKB 2KTFA 5CHFA 2CKHB 1YD8U 1C3TA 4IM3A 4BBNC 4DHJD 3GOEA 1E8WA 2DAJA 3M63B 4WJQA 2XBBC 5FR6A 1EF5A 1K8RB 1WM2A 1GG3A 4TQ0A 1XD3B 2MBBB 4K1RB 2V1YA 4DXAB 3A1QB 4J6IA 3A4RA 2GBJA 4K7UA 4GIVA 3WA0A 3PPAA 3B08A 1P9DU 2PE6B 3DVGX 1LXDA 2ZEQA 4DHZB 2LXAA 3Q3JA 4BFRA 4E3CA 5DPWA 4BOSC 3GZNI 2N9PC 1GUAB 3NHEB 2K39A 3LDZE 5AZHA 5LXIB 2MWSB 3W1SA 4GB9A 1OQYA 1TTNA 2Z0EB 3QK0A 3PSEB 2KHWB 1E7VA 2LGYA 4HLEA 3DBRI 3UQBA 3TIXA 3T9LA 2J0JA 3NS8A 4EEWA 1WX8A 2KC1A 4EUTA 1OGWA 2BPSA 1UBIA 2J0KA 2ZCBA 2XK5A 2MP2B 4EKUA 2FNJB 4BKGA 4XX5A 3VH3B 3A9KA 4LDTB 5G55A 2M0XA 3MTNB 3ZVVA 2LRWA 2JZ3B 3R7RA 4KV2A 2K1FA 3V60A 1OEYJ 1ZW7A 4HCPB 3ZNGC 3TL5A 3H9DA 3JW0X 2KWUB 3PGEA 1EUVB 1FXTB 2O6VD 1KLVA 1YX5B 2KWCA 2JF5A 4P7IA 3DQVA 2DZJA 2NPTB 4ZRKA 3Q3FA 2RR9A 3PHWB 1S1QB 4ASWC 4FULA 3A1QA 1IYFA 4M8NA 3NZSA 2BKFA 3PS6A 2B3AA 4G0NB 3V62A 2UWQA 4WWPA 2KZRA 2KLCA 5E6NA 3AXCA 2J0MA 2KMCA 4AUQC 1WXVA 2EMSA 1WJ6A 5KHQA 3VQIA 4DWFA 5TR5A 2ZCCA 4II3B 1KOTA 3ML8A 3PV1A 4JGHB 2AYOB 2KMAA 3QWZB 4DHJB 2LJ5A 3A9JA 2KX0A 3KW5B 1Q1OA 4IC7B 4W9FA 3WANA 4ICVA 4X57B 1WM3A 2YLMA 1Z2MA 1Z5SB 3B0AA 4PYUA 1WJUA 3N30A 4HCNB 3D32A 3RD2A 2L0TA 1WX9A 4BBNF 2MQJA 2C5LC 4W9DA 5GMVA 4DHZE 4W9IA 2KQ7A 2FUHB 3OJ3A 5JHBA 2D10A 2MP2A 2JUOA 3KYDD 3ZO5B 1TGZB 2BWFA 3QHTA 2CHZA 2L0FA 1M94A 2KFKB 4AJYB 1J19A 4ICUA 4MGYE 4FA6A 4W9EA 4EOYA 2MW5A 3KUZA 1J8CA 4NPNA 2DYOA 3ZIMA 2IO3B 4PS8A 2DZIA 2W9NA 2KO3A 1QZEA 2GMIC 3RUIB 3NY5A 3U7DA 1OEYA 1U4AA 2KTRA 3UF8A 4B95A 2D3GA 3WAMA 3IVFA 4MM3A 3ZTDA 4F1SA 2ZPYA 3ZKJC 3SU8X 2KKCA 2NVUI 3UIOB 3ZDMC 3LJ3A 2WX1A 4AP4C 4HDOA 2M8SA 1ZGUB 2R2QA 4NNJB 1WX7A 4W9LA 4DDGD 1G6JA 1L7YA 3ENEA 5CX3A 2LVOA 3V6EB 2JRHA 1WF9A 2M17A 3VAWA 4IWQA 2BKRB 2L76A 3VUWA 3PT2B 5L95C 4MJSA 3A4SC 1YQBA 1VD2A 3R7QA 2LWPA 2DYBA 2C7HA 5C23A 3L16A 4G11A 4KSKC 3WAPA 1XQQA 3PRZA 4ZRJA 2OOBB 3VTUA 2JZZA 3ZNHB 4A3PA 4OVUA 3NZUA 1RRBA 5AZGA 3VTWA 3ZRFA 3UQAA 1D3ZA 3HK0A 2KDEB 4I6PA 3HM6X 2HE7A 2I1KA 3DVGY 1KM7A 2O6VB 3L17A 3VTVA 3VXWA 3SDLC 2LGXA 3TBLD 2DYMA 5E6PA 2XK5B 4NY0A 2M1MA 2FIFA 1WY8A 3TJPA 4E74A 3EFUA 3TMPB 1C1YB 1P0RA 3W1SC 3ZDTA 2MA9B 2ZJDA 2GOWA 1UH6A 2EMTA 2C60A 4OVVA 1XT9B 2KANA 2MRPA 2WDTB 1V5OA 3MJWA 1E8YA 1TZ1A 4FJVB 4MH0E 1WGRA 4IW0A 4JLCA 4HPMB 4MEMA 4CO7A 1H4RA 3ZNZB 4IWOA 3QIJA 3T8MA 1WGHA 2L05A 2RD0A 2L7RA 3DBLI 3VHTC 3M62B 4GN1A 3ALBA 4WWNA 4IM2A 2C7NB 3JSVB 4JL9A 4ANUA 5CTRC 3EHVA 2A5UA 3NOBA 4HWIB 2FCSA 2KN5A 4WJOA 3IG3A 1LFDA 1WYWB 1NDDA 2WWZA 2KD0A 1V81A 4LCDE 2N7EA 3ZLZA 1ZKHA 1WFYA 3A9KB 2MCNB 4TQ1A 4BKSA 1R4NI 2HD5B 3CSTA 3QARA 4LDTD 3SD5A 2C7MB 4WJPA 5D94A 5D6JB 2JPHA 4NJ6A 4E71A 2O6VA 2Y5BB 3L54A 3QA8A 2NS5A 3PVLA 3JVZX 4IM0A 2LD9A 4JQWC 2KK8A 1VCBA 1WE6A 3U8ZA 2KJRA 4EZKA 4A20A 1WR6E 2YVCA 4HK2A 1E90A 4LJOB 1WXMA 1WI0A 3VFKA 2NPTA 4HJKA 3SHQA 2LVQA 2G3QB 2C9WB 2PE9A 2OJRA 2RPQA 3KH0A 1AARA 1RFAA 1V9JA 3HIZA 4HPLB 3L10B 5HKHA 2KLGA 2K6QA 2BGFA 2LUEA 1GC7A 1A5RA 2BWES 2ZNVC 2CHXA 2XEWA 2VRRB 2MSED 2JY6A 2WYQA 3ZTCA 2KDFB 4AJWA 1WJNA 3RCZA 4W9KA 2LXCA 3M3JA 2KC2A 4N9F4 3DBSA 2CR5A 2KOXA 1SIFA 2NBWB 3OJ4B 4M0WB 1I42A 4GGQA 5L83A 1UBQA 2HTHA 3BY4B 5E6OA 3AU5A 3CSFA 1L2NA 2LASA 4NQLB 2JVCA 1KJTA 2NBVB 2LVPA 3I3TB 4DBGA 1ISNA 4FJYA 4EZLA 5CHVC 5G2NA 3DOWA 2LZ6A 2DX5B 4NQKE 3H7SA 3V6CB 1Y8RC 3A33B 1SGHA 3VH4B 2L00B 4WWOA 2REXA 1WH3A 1RAXA 2GBNA 1LM8B 4MELA 2KVRA 3KUCB 4IWPA 2IO2B 3IBEA 3W1YA 5KHOA 2Z59B 3ZUNA 1P98A 3IHPC 1YIWA 2MBEA 1HE8A 2KQSA 3PLUA 4GDKB 3UINB 3VUYA 5LXHA 2GBKA 2G4SA 4TUUA 2AWTA 2DZMA 2KJ6A 2KTRB 2K8CA 2NCNA 3U30A 4A3OA 3H7PB 3ML9A 2JT4B 3EC8A 1V86A 1UELA 3H1UA 2MBQA 2D07B 3VVWB 2RGFA 1WMHA 4ANXA 4AOFA 2QHOA 2KX3A 5J17A 1I35A 4YL8A 4FJZA 2ZZPB 2A4ZA 4BKSD 2ZVOA 3QAQA 3DDCB 3N32A 3UIPB 3KYCD 1V5TA 4HXDA 2IZVB 4MJSB 4B6WA 3DVNU 2NBUA 3WIMA 4GU2A 5DPSA 3CF6E 4KVGB 4KIKB 4FHJA 3EECA 2DZKA 2MLBA 2N4FA 4LJPB 4RMAA 1GNUA 1WXSA 1WR1A 2V3SA 2FAZA 3C0RB 4TKNA 4IG7B 2D2QA 4KZCA 3JSVA 3APFA 2DHZA 3QQ8B 4DDID 2MBOA 4CYEA 1Q0WB 2J7QB 3ZW3A 5JHAA 4RM8A 2KNBA 3PHXB 3BINA 3PLVA 1WRDB 2GBRA 3K9OB 5IAAC 3VDZA 3HM3A 3H6NA 2G45B 4FADA 2KWVB 4I6LB 4WQOB 5C1ZA 1SE9A 4GDKA 3PRPB 2PJHA 1V2YA 3S2AA 4RM9A 4GDLB 2KJHB 1TBEA 1WIAA 1EO6A 3RYTA 4GSWA 4DK5A 2KXJA 4FBJB 3H7PA 3HHMA 1YX6B 3QJZA 2RSUA 2CS4A 4KDLB 2CU1A 1PQSA 4F7ZA 3WALA 2BYVE 2NR2A 4BOZB 1WGGA 1WGYA 2K6DB 3CMMB 4MDKE 1WZ0A 4XC2A 3KVFB 3ONSA 1WGDA 1R4MI 2N1VA 2LRUA 4NAWB 4M8MA 1UGMA 1EF1A 2V4LA 2CHWA 1LQBA 5CHWA 3RZWC 4EZJA 2JRIB 5AZFA 1T0YA 2N7DA 3M95A 2IY1B 3QX1A 4MSMB 4W9GA 3RZFA 5IA7A 1E8XA 2FIDA 2LI5A 5DPTA 3X23A 4FN2A 4KDIC 2ZVNA 4NAWA 2IO0B 2G4DB 1P3QU 1MG8A 4ZDVA 5BO4B 1WJ4A 1IPGA 2FCMA 3AI5A 4HDQA 2BYEA 4NJ7A 3DVNV 1OTRB 2IYDB 5EDSA 2WX0A 1GJZA 3TCAA 2N9EB 2O2VA 2AL3A 1YJ1A 2IBIB 4ANVA 3AU4A 4PYZA 1E5WA 5J18A 4MSQB 2FCQA 3RULA 2IY0B 1NI2A 3X0WA 2JXXA 3ECIA 1IP9A 4K7SA 2HJ8A 2K8BA 3K9PB 5D7GA 1P1AA 1UD7A 4W9JA 3PRMB 4WAAA 3N3KB 1V49A 3IFWB 4WJNA 2K8HA 5JZEB 2N1WA 2N9XA 3PTFC 3R3MA 4TV3A 4B9KA 2ZNVB 2KDBA 4XZ4A 4ZYNA 4BKTA 1V80A 2MX2A 2PPHA 2BYFA 3APDA 5JH5C 4KZ0A 1E7UA 1NBFC 2KFKA 3R66C 1J0GA 1WMHB 2MBHA 4G50A 4PS3A 4II2B 4FHKA 1Q5WB 1GC6A 2BF8B 3QC8B 3DPDA 4IUMB 3AULA 2EKEC 3DCGA 5LLIA 2ZPNA 4AWJA 2DENB 4ANWA 4BVUC 2I1JA 4MGZE 4ZRIA 1E8ZA 5D2MB 2ASQA 5J2RA 2L8JA 2IO1B 2Z0DB 1X1MA 4K81A 4KIKA 1WZ3A 3O65B 4GMVA 4I6NB 3RT3B 4GXBA 2D11A 3DBHI 4JIOU 4URKA 2KDIA 1V6EA 2DAFA 1UZXB 2AL6A 2FCNA 2O2VB 3A9JB 3JYUA 3PREA 4K7WA 4PS7A 3OLMD 3ZNID 2UYZB 4EFOA 2JWZA 3B1LX 4MGKE 2K25A 1H8CA 1F9JA 3P2BA 3MHSD 3L13A 3UGBB
chains in the Genus database with same CATH superfamily
4A6QA 4KSLC 3L08A 4WQMA 4CHKA 4HKZE 4GDLA 4GOCA 2R2OA 5G5GA 4W9HA 1IGDA 4OVZA 3BK1A 1JRUA 1WE7A 2GLSA 5AEKB 4W9CA 3BVGA 2KTFA 1FCLA 4DHJD 2K22A 3M63B 1L6VA 1RWSA 4M01A 5IKCM 1K8RB 4US8A 3A4RA 2GBJA 4NJCA 4GIVA 2PE6B 2LXAA 3Q3JA 2INNE 2BS2B 4UDUC 5DPWA 4BOSC 1NVID 3NHEB 2K39A 1ET6A 4C00A 1TTNA 1OQRA 3I57A 4HLEA 4ARIA 1HTOA 4S0RA 2MH7A 3NS8A 1OGWA 2BPSA 1UBIA 2J0KA 2ZCBA 2FNJB 4BKGA 4XX5A 3VH3B 3A9KA 2GRIA 3TEYA 4WWMA 3J9CA 4NAMA 1ZW7A 3Q3OC 3DBRB 5TSSA 2QEJC 3TL5A 3H9DA 1XLQA 2KWUB 3PGEA 1EUVB 2J52A 1KLVA 2JF5A 2DZJA 2NPTB 4MM3B 3PHWB 1F1HA 4ASWC 3NZSA 1WSPA 2BKFA 3ZJTA 2UWQA 4WWPA 2KZRA 4YTNB 2KMCA 3KLSX 1WXVA 2EMSA 1WJ6A 5KHQA 3VQIA 4DWFA 4II3B 4XWTA 1KOTA 3SFEB 2AYOB 2KMAA 3EUB2 2LJ5A 3KW5B 3DBHB 1Z2MA 4HCNB 3UI3A 1ZUD2 1JWBD 1EU3A 3D32A 1JALA 4W9DA 5GMVA 4QAYA 5JHBA 4XGAB 1TGZB 3QHTA 4RNAA 2KFKB 4AJYB 4MGYE 1F2RC 4NPNA 4RF1A 5FK9C 2DZIA 2W9NA 3T3OA 2ONQA 1NEKB 1U4AA 4B95A 2JXTA 3WAMA 1GAQB 3IVFA 4MM3A 3Q6BA 2KKCA 3R8BA 1XCTL 2R2QA 1SIJA 4NNJB 1L0XB 2LVOA 3V6EB 3LXFA 2WP9B 3VAWA 2L76A 1VZ6A 3VUWA 3PT2B 3AEAB 1YNTE 3L16A 4KSKC 1VZ8A 1SB3C 1D3ZA 1RRBA 3HK0A 3HM6X 2I1KA 4GLSC 4E74A 1C1YB 3W1SC 2AQ2B 1VR9A 3PZ7A 3AE4B 2EMTA 2KANA 2PVOD 1HZ6A 4MH0E 4YXDB 3ZNZB 2OJWA 4WAFA 1B1ZA 3DBLI 1KF6B 4IM2A 1SJED 2DNFA 2A5UA 3NOBA 5IN7A 4LLGM 1NDDA 2WWZA 2KD0A 3TEWA 1MFWA 1ZKHA 2MCNB 2FUG1 2HD5B 3QARA 3IAS1 1D5MC 2C7MB 4WJPA 4HEA1 2JPHA 4NJ6A 1PGXA 3L54A 3N9YC 1V8CA 4ZRQA 1WR6E 3CWIA 2TSSA 1WXMA 3W2DA 2R61A 5EE3A 2LVQA 2WXQA 2C9WB 2PE9A 2OJRA 1AARA 3HIZA 2G9HD 5HKHA 1CK1A 5BYQA 2M0AA 2LUEA 1IBXA 2NTSA 2XEWA 4AJWA 2LJIA 3RCZA 2KACA 3M3JA 4YSXB 3DBSA 5L83A 1YQ3B 4HPPA 3CSFA 1L2NA 2LASA 2JVCA 5IO9A 1ISNA 4EZLA 3AB5A 5G2NA 3R2TA 3H7SA 3OG5A 2H88B 2WDVB 1K51A 4WWOA 2WXFA 2REXA 4AQ7A 3NZ3A 1WH3A 2INCC 2GBNA 2QIEB 3IBEA 3ZUNA 3U7ZA 4B0EA 1WWTA 2WXGA 3U2SC 1BMLC 3GB1A 3VUYA 5LXHA 2ACZB 4A3OA 4KKIA 3ML9A 2HTME 3H1UA 3VVWB 1UWXA 4IOIE 2QHOA 5J17A 1I35A 4YL8A 2WXNA 4HXDA 1KLUD 4B6WA 3DVNU 3WIMA 4YSYB 3CIRB 3FKYA 2N4FA 1E6EB 4TKNA 3R2IA 3ZGZA 1UUPA 4KZCA 3APFA 4DDID 2MBOA 2PKOA 3ZW3A 3NS1A 2BS4B 3NVWA 1YJJA 5IAAC 3BINA 2GBRA 4IKGA 3B2FA 3H6NA 2KWVB 4I6LB 3S2AA 3EGRA 1EO6A 1SJHD 3MC9A 3H7PA 1YQ4B 3MP9A 3WALA 1WGGA 3CMMB 1QOGA 4USAA 3ONSA 2LRUA 4NAWB 4M8MA 1UGMA 4MH8A 1LQBA 5CHWA 1PGBA 5EE1A 3RZWC 2JX5A 1YOVB 4W9GA 2FIDA 5DPTA 4FN2A 2ZVNA 2E6XA 1QLBB 2W3SA 5BO4B 5EDSA 1TY0A 1GJZA 2B76B 4N58A 2O2VA 2IBIB 3GS2A 1TKYA 3AU4A 4WH4A 1YJIA 5J18A 2W54A 4K3BA 1ZDVA 3ECIA 3NJTA 1SEBD 1I7HA 3K9PB 3FAHA 3PRMB 2ZW1A 5JZEB 2N1WA 2ZNVB 1MHXA 4ZYNA 4BKTA 1V80A 2J53A 4KZ0A 1WMHB 4G50A 4PS3A 4II2B 1Q5WB 1GC6A 2BF8B 2BT6A 3DCGA 2ZPNA 1E8ZA 2ASQA 2WGSA 3FILA 1HA5A 1XF5L 5J2RA 1FO4A 3HUIA 4IDIA 3O65B 1TS2A 1ZXHA 4C4VB 2DAFA 3JYUA 4PS7A 1FNWA 3ZNID 3MJ5A 4NZLB 1FRDA 1F9JA 3P2BA 1JWMD 3MHSD 1JROA 2RDHA 3QCAA 2AEHA 1WXAA 1S3SG 1T5XD 3VUXA 4L2YA 1FPYA 5EE9A 1B9RA 3V61A 1QOFA 2PEAA 5DCNA 3L0WB 4AS1A 3EA6A 1BT0A 4MGIE 2L32A 4XDCA 1YMHE 5CHFA 4IM3A 3GOEA 2PLPA 4WJQA 3P4RB 3A1QB 4K7UA 1QOAA 1P9DU 3DVGX 3DHHC 4DHZB 3URYA 5AZHA 5I4DA 3QK0A 3DBRI 3UQBA 3TIXA 3T9LA 1EWYC 4EUTA 1GB1A 2XK5A 3KWVA 1ZP0B 2QC8A 5G55A 3DWMA 2LFIA 5H8YE 2LRWA 1SE2A 2HDEA 1OEYJ 4HCPB 2WXRA 1F2RI 1MVKA 1FXTB 3I9V1 2Z8LA 2WXJA 3DQVA 1NYQA 3DHGC 2RR9A 3KQ4A 1S1QB 3AE1B 3A1QA 2K9XA 1L6UA 3OWEB 2GI9A 4KKJA 3ML8A 4LNOA 1C4CA 1UWMA 2KX0A 1LGRA 1Q1OA 4X57B 1TKEA 1V1OA 1WM3A 4PYUA 2V3PA 4BBNF 2H89B 4DHZE 3RNEC 2L1AA 3HVZA 3OJ3A 1E10A 4ICUA 4EOYA 2MW5A 1J8CA 2DYOA 2IO3B 4PS8A 2KO3A 4HRSA 2GMIC 3RUIB 3BWUD 2I2YA 3BYYB 1SBBB 4HJGE 4RCOA 2JZPA 1N61A 4F1SA 4PT5A 3ZYYX 3LJ3A 4AP4C 3BVZA 4RF0A 2M8SA 1C77A 1ZGUB 2JWUA 1L7YA 3ENEA 2WU2B 5CX3A 2M17A 1FNUA 1DOYA 1FFUA 1XQQA 2JZZA 3ZNHB 3NZUA 2WQYB 1I4HA 2LEKA 2HE7A 2AQ1B 3L17A 4P16A 3SDLC 3H8HA 2XK5B 3RN9C 4NY0A 1QILA 1WY8A 3ZQ4A 1P0RA 2IPKD 2MA9B 4P1CC 3N20C 2C60A 4OZBA 1TS5A 2N9KA 5HFYA 1F52A 2MRPA 1AW7A 1E8YA 1HEZE 1L0VB 1C4AA 4HPMB 2ICIA 3QIJA 2L05A 2L7RA 3VHTC 3M62B 3TUOA 3ALBA 4JL9A 5CTRC 3EHVA 4HWIB 4WJOA 2KN5A 4YT0B 5JXVA 1V81A 4BKSA 4K3CA 4RFBA 5D94A 4C7YA 5D6JB 2KMMA 2O6VA 2Y5BB 1PUTA 3PVLA 1YN4A 3WCQA 4JQWC 1GPXA 1WE6A 2YVCA 4HK2A 1E90A 4LJOB 2NPTA 3SHQA 1FEHA 2XN9C 1A70A 3MC8A 1WYGA 5BMIA 2D3BA 2BGFA 3NRZA 1PYWD 3ZTCA 3NVYA 2CR5A 3P4SB 1QOBA 3OJ4B 2HTHA 3ZJUA 3I3TB 1FRRA 4M02A 2PMVA 4MACA 5CHVC 3DOWA 1L5PA 2L00B 3HRDD 3AE7B 1LM8B 3P4QB 2KVRA 3KUCB 1I4QA 4IWPA 2EELA 3ZXVA 1HE8A 2KQSA 4GDKB 3UINB 2GBKA 4TUUA 2AWTA 2DZMA 2KTRB 2K8CA 1FFVA 2JT4B 1UELA 2MBQA 2D07B 3IT6B 1SE3A 1JW9D 2HJ1A 4BKSD 1V5TA 1UNSA 2IZVB 4MJSB 2NBUA 4GU2A 3CF6E 2PW9A 2DZKA 4RMAA 1GNUA 1WXSA 2D2QA 2DHZA 3QQ8B 2K5PA 2J7QB 5JHAA 5H92C 2RDBC 2XNAC 1WRDB 3K9OB 4FADA 5C1ZA 3P4PB 3PRPB 2LGIA 2PJHA 4RM9A 4GDLB 4P6VF 3RYTA 5BMHA 5GXGB 4O1NA 1FMAD 2CU1A 3TEZA 2QDFA 1WZ0A 4XC2A 4YSZB 3KVFB 1WGDA 1R4MI 2VZKD 1N5XA 4ZHPA 2CHWA 1HXYD 2V0GA 1T0YA 2V4IB 4YWGG 2N7DA 4MSMB 2WDRB 4OW0A 3RNCC 2LI5A 1XEEA 2RPVA 2IO0B 4RGOS 3W5VB 4ZDVA 1WJ4A 4HDQA 1C78A 3AEEB 2N9EB 3TCAA 2AL3A 5BYSA 4XE0A 1N63A 4K7SA 2HJ8A 2K8BA 1P1AA 3VRAB 1FCCC 2KVZA 3O13A 3IFWB 2QCZA 1IBXB 2K8HA 4XZ4A 1E7UA 1VDVA 1HZ5A 4BAXA 4IUMB 2EKEC 5LLIA 4ANWA 4BVUC 4MGZE 3AM9A 2OEDA 4ZHOA 3TEXA 2IO1B 5MPOA 1X1MA 2M19A 4GMVA 4I6NB 2D11A 2EKIA 2KDIA 1UZXB 4K7WA 3A9JB 4RGNA 2CU3A 1FXAA 4EFOA 3P42A 2DLBA 2V3NA 1MI0A 4G3XB 4ZOHC 4F8CB 4XWWA 2OHFA 1CMXB 3RMKC 2N9LA 1D4BA 1QF6A 1FD6A 3APCA 5C2TB 3SEBA 2GBMA 2LGDA 2CKHB 3Q3MC 1EF5A 1XD3B 2MBBB 2V1YA 3N1ZC 2VH2A 4J6IA 4KGTA 1P7FA 1LXDA 2N7JA 2ZEQA 1F0ZA 1GB4A 3GZNI 4JPSA 2N9PC 1GUAB 5AUIA 2L52A 4GB9A 1TS3A 1OQYA 2KHWB 1E7VA 2LGYA 1I4PA 1DYQA 2PVGC 4DQOC 1ZOYB 2J0JA 4EEWA 1WX8A 2QSDA 1VRAB 4EKUA 5FKAC 5HG2A 2INDC 2M0XA 3MTNB 2JZ3B 2K1FA 3V60A 3ZNGC 1N6ZA 3C19A 3ZXRA 2MJ3A 2O6VD 1YX5B 2KWCA 4P7IA 4MT5A 3Q3FA 1FIQA 4P1BC 1IYFA 4A55A 3PS6A 1SF0A 2KLCA 5E6NA 3AXCA 1D5XC 1K52A 1OFFA 2JSVX 4AUQC 2ZCCA 3QWZB 2NMQA 3A9JA 4DHJB 4IC7B 4W9FA 3WANA 1KTKA 4S17A 4ACFA 3B0AA 3RD2A 2L0TA 1WX9A 2MQJA 4WURA 4W9IA 2FUHB 2D10A 1JQ4A 1M94A 1J7AA 4W9EA 3KUZA 1XLPA 3NY5A 2V9HA 2BYTA 2KTRA 3UF8A 3BIID 3ZTDA 1Q10A 4RGMA 1CQVA 2NVUI 3DWGC 4JWSC 1RFKA 1T0RC 2KN4A 4HDOA 4M0WA 2WXHA 4ZRPA 1WX7A 4DDGD 1I4GA 1SE4A 4IWQA 4MJSA 3A4SC 1YQBA 1VD2A 5C23A 4B0MA 4G11A 2Y3AA 2OOBB 1ESFA 4A3PA 2YEPB 5AZGA 3ZRFA 1R7SA 3LB8C 3VTVA 2DYMA 5E6PA 1MPEA 2M1MA 2FIFA 3TJPA 2ZW0A 3EFUA 3TMPB 1AWDA 1TKGA 2ZJDA 3LYYA 1UH6A 4OVVA 1GOZA 2WDTB 1V5OA 2WDQB 2BB5A 1TZ1A 4FJVB 4IW0A 4JLCA 4CO7A 3I63C 2J4XA 1EU4A 3T8MA 2FBWB 2WXMA 4GN1A 4J3OD 1AN8A 2KDMA 2BW2A 2FCSA 1QQRA 4JX1C 1K53A 4HROA 1ACCA 4LCDE 1WFYA 4TQ1A 1R4NI 4LDTD 3SD5A 1V97A 3QA8A 3P63A 1KH0A 1VCBA 1ENFA 3VR9B 3U8ZA 1FNVA 4A20A 1PFDA 2WS3B 1WXQA 3GE8C 2MHJA 2G3QB 2WHIA 3KH0A 1C79A 1RFAA 3L10B 1TIFA 1GC7A 4R3DA 2BQQA 2BWES 2MSED 2JY6A 2WYQA 3C8YA 2ON8A 3AEFB 4W9KA 1VLBA 5T8IA 4M0WB 1N60A 1I42A 1UBQA 1WGKA 3BY4B 2KYWA 4JE3B 3AE6B 3L4PA 4XDDA 4NQKE 2LHDA 1JWSD 2LZ6A 3V6CB 1TYGB 1SGHA 3VH4B 3Q8EA 3NUHB 2IO2B 3W1YA 2Z59B 3Q2AC 1P98A 3IHPC 1YIWA 1NENB 1MJDA 2MBEA 3PLUA 2G4SA 1TY2A 3H7PB 3EC8A 5IOIA 1V86A 4ZYSA 1WMHA 1RM6C 4FJZA 2ZZPB 3QAQA 3N32A 1EWCA 1YN3A 3VRBB 4KIKB 4KVGB 2LHEA 2LUMA 4FHJA 3EECA 1VJKA 2MLBA 4LJPB 4YTMB 4C4VA 1WR1A 2WLBA 3C0RB 4IG7B 1KLGD 3AH7A 3DBLB 4CYEA 1Q0WB 2Y5CA 1E9MA 3PHXB 2G45B 2WXLA 4WQOB 4CQNA 1V2YA 2KJHB 1N5WA 1TBEA 3Q8BA 2CJOA 4RH6A 4FBJB 3I5JC 3HHMA 2RSUA 2CS4A 1DOIA 1PQSA 3KWLA 4F7ZA 3VR8B 2PTLA 4N59A 2BYVE 3Q8FA 1MG4A 1XXGA 3IXSA 1WGYA 4EE2A 4KGSA 3RNGC 2JQRB 4OZAA 2V4LA 3Q3NC 2W82A 3V3XA 2IY1B 3QX1A 1C9FA 4C56C 3RZFA 5IA7A 1E8XA 3X23A 4KDIC 3IAM1 1JWUD 2G4DB 5EE0A 1MG8A 1IPGA 2FCMA 3AI5A 2BYEA 1C76A 1XCQL 2IYDB 1KFYB 3MHZA 3FC4A 1E5WA 3P1MA 2AX5A 1IUEA 1NI2A 1I4XA 3Q14C 4LNNA 3X0WA 2IJ0A 1IP9A 1FM0D 2RMMA 4W9JA 4WAAA 3N3KB 1V49A 2N9XA 3E9SA 3PTFC 4TV3A 4B9KA 2WXIA 2WXKA 2PPHA 4H2AA 3APDA 1V1PA 3Q8CA 5JH5C 1BXTA 2KFKA 1UF0A 3T3NA 5D3DA 2BS3B 4FHKA 3DPDA 2DENB 4ZRIA 3PO0A 2L8JA 2Z0DB 3E56A 4K81A 4KIKA 3ETRA 2MEKA 1L4DB 3DBHI 4JIOU 4URKA 1V6EA 1PGAA 2Y5PA 1OQQA 2D3CA 2O2VB 3OLMD 2UYZB 2CJNA 4A90A 2JWZA 3B1LX 3NG0A 1H8CA 1ZPSA 3V05A 1TJEA 3PZ8A 2PIAA 4FLHA 3WAOA 2L3ZA 1RLFA 2M4NA 5DPRA 3SFDB 5LNK1 3ZRCA 4HVBA 1T0SC 2KFJA 3OAWA 3DHIC 3KUDB 3PZDA 1C3TA 1YD8U 4BBNC 3NVVA 1E8WA 2DAJA 2XBBC 5FR6A 1WM2A 3RFZB 1GG3A 4LTUA 4TQ0A 4K1RB 1L0YB 2MJDA 4DXAB 1YN5A 3WA0A 3PPAA 3B08A 3BZDB 2WNMA 4BFRA 4E3CA 4LNKA 3LDZE 3AECB 1RYJA 5LXIB 2MWSB 3W1SA 2J42A 2Z0EB 3PSEB 4TSSA 1NYRA 1TS4A 4OZCA 1XLOA 2KC1A 2W55A 3MFGA 3GZNB 2G1EA 5BYRA 5D3IB 2MP2B 4LDTB 4L1BA 4Q2JA 2IDYA 3IT4B 4LNIA 3ZVVA 3ABVB 4KX6B 3R7RA 4KV2A 1XO3A 1EM7A 3JW0X 3GP7A 2LMCA 1Y56A 4ZRKA 4FULA 4M8NA 1HQRD 2VH1A 2B3AA 3FILB 4G0NB 3V62A 2VZKB 4KGRA 2SAKA 3BK2A 2J0MA 4N6EB 3NVZA 2FE8A 5C3JB 1HTQA 5TR5A 3B2GA 4PK1A 3PV1A 4JGHB 4C80A 2QMTA 2BBCA 3RNBC 2QILA 2YEPF 4ICVA 2YLMA 4A8XC 1Z5SB 2UU7A 1WJUA 3N30A 5E6JA 4JWUC 3EFCA 2C5LC 3TSSA 2KQ7A 3AE3B 2MP2A 3KYDD 2JUOA 3ZO5B 2BWFA 2CHZA 2L0FA 1SXTA 2BB6A 1J19A 3AE8B 4FA6A 3ZIMA 1CJEA 3Q69A 1QZEA 4M00A 3U7DA 1OEYA 3RNFC 2D3GA 2ZPYA 3ZKJC 3SU8X 3UIOB 2KQ4X 3ZDMC 2WX1A 4US9A 4REZA 1JWAD 5HI1A 4W9LA 1D5ZC 2JRHA 1WF9A 1KRHA 2BKRB 5L95C 2KAJA 3R7QA 1WRIA 2LWPA 2DYBA 2C7HA 3WAPA 3ZJVA 3SR6A 2JYTA 4ZRJA 3PRZA 3VTUA 4OVUA 1G6JA 3VTWA 3UQAA 4I6PA 2KDEB 3DVGY 1KM7A 2O6VB 1L4ZB 3VXWA 2LGXA 3TBLD 4HKQA 2MJEA 2IGGA 1MHHE 2INPE 2JU6X 4L23A 3ZDTA 1CZPA 2GOWA 1ZXIA 1ET9A 1M4VA 1XT9B 1D6EC 4RGTA 2E3TA 3MJWA 5FR3A 4XYCA 1WGRA 3W5UB 4MEMA 1H4RA 4IWOA 2M56B 2X38A 1P7EA 1WGHA 3U52E 2RD0A 2LGSA 4WWNA 2C7NB 3JSVB 4ANUA 1NI3A 3AEDB 3IG3A 1LFDA 1WYWB 1BUIC 1QT9A 5HHDG 2N7EA 3ZLZA 3A9KB 1SSNA 1AYFA 3CSTA 1XLNA 4E71A 1C4PA 1N62A 1ZE3D 2NS5A 4IM0A 3JVZX 2LD9A 2KK8A 4ITKA 2KJRA 4EZKA 1E0ZA 1WI0A 3AE9B 3VFKA 4HJKA 3U4EG 1R4NB 2RPQA 1R4MB 4TMAB 1V9JA 4HPLB 2KLGA 2K6QA 1A5RA 2ZNVC 2CHXA 2VRRB 2KDFB 4C7ZA 1WJNA 3HVDA 1V1PB 1J7CA 2LXCA 2KC2A 4N9F4 2KOXA 1SIFA 2NBWB 2KT7A 4GGQA 5E6OA 3AU5A 4NQLB 1KJTA 2NBVB 1F77A 2LVPA 4BZAA 4DBGA 4FJYA 2L83A 3GE3C 1IGCA 2DX5B 2JYEA 1Y8RC 3A33B 3N1YC 1J7BA 1RAXA 4YTPB 4MELA 3N1XC 2BVCA 5KHOA 2K0PA 2Q5WD 1T6BX 3BYTB 3Q8AA 1FXIA 1TT5B 2KJ6A 1PDXA 2NCNA 3U30A 3AEGB 1TZOA 2RGFA 4ANXA 4AOFA 4DXGA 1ROEA 2KX3A 3AE2B 3AMZA 2SEBD 2A4ZA 2ZVOA 3DDCB 3UIPB 3KYCD 3RI7C 1T3QA 5DPSA 1K50A 5IP4D 2V3SA 4DXFA 2FAZA 2D5GA 4OHJA 3JSVA 1VZ7A 2NTTA 5AUKA 4ARCA 4RM8A 2KNBA 2GB1A 4LNFA 3PLVA 3AE5B 3VDZA 3HM3A 1T0QC 1JCKB 1SE9A 4GDKA 5G5HA 1WIAA 4GSWA 4DK5A 2DBYA 2KXJA 1YX6B 3QJZA 2DWQA 4KDLB 2NR2A 4BOZB 2K6DB 4MDKE 1UGJA 3AN1A 1DGJA 1JMLA 3B9JA 2N1VA 1EF1A 4EZJA 2JRIB 5AZFA 3M95A 2RDGA 1E7PB 4NAWA 2BTEA 1P3QU 3AEBB 4NJ7A 3DVNV 1OTRB 3W9CB 2WX0A 2K3UA 4A9AA 1YJ1A 4ANVA 2W3RA 4PYZA 4MSQB 5BMGA 2FCQA 1STEA 3RULA 2IY0B 3BVMA 3RNAC 2IGDA 2JXXA 5D7GA 3RPFC 1UD7A 2WXPA 2WXOA 4WJNA 2KWDA 3R3MA 2KDBA 2MX2A 4LK0M 2BYFA 1LO5D 3R66C 1NBFC 1J0GA 2MBHA 2N0SB 4WIPA 3QC8B 3AULA 4AWJA 3AV8A 2I1JA 5D2MB 2IGHA 4D2KA 2I38A 1WZ3A 2QJLA 2AQ3B 4FXCA 3RT3B 4GXBA 1I4RA 2AL6A 2FCNA 3PREA 2D3AA 2WU5B 1JRPA 2X8XX 4MGKE 2K25A 1QKZA 1ZDXA 3L13A 1DOXA 3MC0B 3UGBB
chains in the Genus database with same CATH topology
4KSLC 3QCAA 3L08A 4G3XB 4FLHA 2AEHA 1WXAA 3WAOA 4CHKA 4F8CB 2L3ZA 4GDLA 4GOCA 1S3SG 2R2OA 1CMXB 1RLFA 4W9HA 3VUXA 2M4NA 5DPRA 3ZRCA 3V61A 4HVBA 2PEAA 2KFJA 3APCA 5DCNA 1JRUA 3L0WB 3OAWA 1BT0A 3KUDB 4MGIE 1WE7A 3PZDA 2GBMA 2LGDA 4W9CA 5AEKB 2KTFA 5CHFA 2CKHB 1YD8U 1C3TA 4IM3A 4BBNC 4DHJD 3GOEA 1E8WA 2DAJA 3M63B 4WJQA 2XBBC 5FR6A 1EF5A 1K8RB 1WM2A 1GG3A 4TQ0A 1XD3B 2MBBB 4K1RB 2V1YA 4DXAB 3A1QB 4J6IA 3A4RA 2GBJA 4K7UA 4GIVA 3WA0A 3PPAA 3B08A 1P9DU 2PE6B 3DVGX 1LXDA 2ZEQA 4DHZB 2LXAA 3Q3JA 4BFRA 4E3CA 5DPWA 4BOSC 3GZNI 2N9PC 1GUAB 3NHEB 2K39A 3LDZE 5AZHA 5LXIB 2MWSB 3W1SA 4GB9A 1OQYA 1TTNA 2Z0EB 3QK0A 3PSEB 2KHWB 1E7VA 2LGYA 4HLEA 3DBRI 3UQBA 3TIXA 3T9LA 2J0JA 3NS8A 4EEWA 1WX8A 2KC1A 4EUTA 1OGWA 2BPSA 1UBIA 2J0KA 2ZCBA 2XK5A 2MP2B 4EKUA 2FNJB 4BKGA 4XX5A 3VH3B 3A9KA 4LDTB 5G55A 2M0XA 3MTNB 3ZVVA 2LRWA 2JZ3B 3R7RA 4KV2A 2K1FA 3V60A 1OEYJ 1ZW7A 4HCPB 3ZNGC 3TL5A 3H9DA 3JW0X 2KWUB 3PGEA 1EUVB 1FXTB 2O6VD 1KLVA 1YX5B 2KWCA 2JF5A 4P7IA 3DQVA 2DZJA 2NPTB 4ZRKA 3Q3FA 2RR9A 3PHWB 1S1QB 4ASWC 4FULA 3A1QA 1IYFA 4M8NA 3NZSA 2BKFA 3PS6A 2B3AA 4G0NB 3V62A 2UWQA 4WWPA 2KZRA 2KLCA 5E6NA 3AXCA 2J0MA 2KMCA 4AUQC 1WXVA 2EMSA 1WJ6A 5KHQA 3VQIA 4DWFA 5TR5A 2ZCCA 4II3B 1KOTA 3ML8A 3PV1A 4JGHB 2AYOB 2KMAA 3QWZB 4DHJB 2LJ5A 3A9JA 2KX0A 3KW5B 1Q1OA 4IC7B 4W9FA 3WANA 4ICVA 4X57B 1WM3A 2YLMA 1Z2MA 1Z5SB 3B0AA 4PYUA 1WJUA 3N30A 4HCNB 3D32A 3RD2A 2L0TA 1WX9A 4BBNF 2MQJA 2C5LC 4W9DA 5GMVA 4DHZE 4W9IA 2KQ7A 2FUHB 3OJ3A 5JHBA 2D10A 2MP2A 2JUOA 3KYDD 3ZO5B 1TGZB 2BWFA 3QHTA 2CHZA 2L0FA 1M94A 2KFKB 4AJYB 1J19A 4ICUA 4MGYE 4FA6A 4W9EA 4EOYA 2MW5A 3KUZA 1J8CA 4NPNA 2DYOA 3ZIMA 2IO3B 4PS8A 2DZIA 2W9NA 2KO3A 1QZEA 2GMIC 3RUIB 3NY5A 3U7DA 1OEYA 1U4AA 2KTRA 3UF8A 4B95A 2D3GA 3WAMA 3IVFA 4MM3A 3ZTDA 4F1SA 2ZPYA 3ZKJC 3SU8X 2KKCA 2NVUI 3UIOB 3ZDMC 3LJ3A 2WX1A 4AP4C 4HDOA 2M8SA 1ZGUB 2R2QA 4NNJB 1WX7A 4W9LA 4DDGD 1G6JA 1L7YA 3ENEA 5CX3A 2LVOA 3V6EB 2JRHA 1WF9A 2M17A 3VAWA 4IWQA 2BKRB 2L76A 3VUWA 3PT2B 5L95C 4MJSA 3A4SC 1YQBA 1VD2A 3R7QA 2LWPA 2DYBA 2C7HA 5C23A 3L16A 4G11A 4KSKC 3WAPA 1XQQA 3PRZA 4ZRJA 2OOBB 3VTUA 2JZZA 3ZNHB 4A3PA 4OVUA 3NZUA 1RRBA 5AZGA 3VTWA 3ZRFA 3UQAA 1D3ZA 3HK0A 2KDEB 4I6PA 3HM6X 2HE7A 2I1KA 3DVGY 1KM7A 2O6VB 3L17A 3VTVA 3VXWA 3SDLC 2LGXA 3TBLD 2DYMA 5E6PA 2XK5B 4NY0A 2M1MA 2FIFA 1WY8A 3TJPA 4E74A 3EFUA 3TMPB 1C1YB 1P0RA 3W1SC 3ZDTA 2MA9B 2ZJDA 2GOWA 1UH6A 2EMTA 2C60A 4OVVA 1XT9B 2KANA 2MRPA 2WDTB 1V5OA 3MJWA 1E8YA 1TZ1A 4FJVB 4MH0E 1WGRA 4IW0A 4JLCA 4HPMB 4MEMA 4CO7A 1H4RA 3ZNZB 4IWOA 3QIJA 3T8MA 1WGHA 2L05A 2RD0A 2L7RA 3DBLI 3VHTC 3M62B 4GN1A 3ALBA 4WWNA 4IM2A 2C7NB 3JSVB 4JL9A 4ANUA 5CTRC 3EHVA 2A5UA 3NOBA 4HWIB 2FCSA 2KN5A 4WJOA 3IG3A 1LFDA 1WYWB 1NDDA 2WWZA 2KD0A 1V81A 4LCDE 2N7EA 3ZLZA 1ZKHA 1WFYA 3A9KB 2MCNB 4TQ1A 4BKSA 1R4NI 2HD5B 3CSTA 3QARA 4LDTD 3SD5A 2C7MB 4WJPA 5D94A 5D6JB 2JPHA 4NJ6A 4E71A 2O6VA 2Y5BB 3L54A 3QA8A 2NS5A 3PVLA 3JVZX 4IM0A 2LD9A 4JQWC 2KK8A 1VCBA 1WE6A 3U8ZA 2KJRA 4EZKA 4A20A 1WR6E 2YVCA 4HK2A 1E90A 4LJOB 1WXMA 1WI0A 3VFKA 2NPTA 4HJKA 3SHQA 2LVQA 2G3QB 2C9WB 2PE9A 2OJRA 2RPQA 3KH0A 1AARA 1RFAA 1V9JA 3HIZA 4HPLB 3L10B 5HKHA 2KLGA 2K6QA 2BGFA 2LUEA 1GC7A 1A5RA 2BWES 2ZNVC 2CHXA 2XEWA 2VRRB 2MSED 2JY6A 2WYQA 3ZTCA 2KDFB 4AJWA 1WJNA 3RCZA 4W9KA 2LXCA 3M3JA 2KC2A 4N9F4 3DBSA 2CR5A 2KOXA 1SIFA 2NBWB 3OJ4B 4M0WB 1I42A 4GGQA 5L83A 1UBQA 2HTHA 3BY4B 5E6OA 3AU5A 3CSFA 1L2NA 2LASA 4NQLB 2JVCA 1KJTA 2NBVB 2LVPA 3I3TB 4DBGA 1ISNA 4FJYA 4EZLA 5CHVC 5G2NA 3DOWA 2LZ6A 2DX5B 4NQKE 3H7SA 3V6CB 1Y8RC 3A33B 1SGHA 3VH4B 2L00B 4WWOA 2REXA 1WH3A 1RAXA 2GBNA 1LM8B 4MELA 2KVRA 3KUCB 4IWPA 2IO2B 3IBEA 3W1YA 5KHOA 2Z59B 3ZUNA 1P98A 3IHPC 1YIWA 2MBEA 1HE8A 2KQSA 3PLUA 4GDKB 3UINB 3VUYA 5LXHA 2GBKA 2G4SA 4TUUA 2AWTA 2DZMA 2KJ6A 2KTRB 2K8CA 2NCNA 3U30A 4A3OA 3H7PB 3ML9A 2JT4B 3EC8A 1V86A 1UELA 3H1UA 2MBQA 2D07B 3VVWB 2RGFA 1WMHA 4ANXA 4AOFA 2QHOA 2KX3A 5J17A 1I35A 4YL8A 4FJZA 2ZZPB 2A4ZA 4BKSD 2ZVOA 3QAQA 3DDCB 3N32A 3UIPB 3KYCD 1V5TA 4HXDA 2IZVB 4MJSB 4B6WA 3DVNU 2NBUA 3WIMA 4GU2A 5DPSA 3CF6E 4KVGB 4KIKB 4FHJA 3EECA 2DZKA 2MLBA 2N4FA 4LJPB 4RMAA 1GNUA 1WXSA 1WR1A 2V3SA 2FAZA 3C0RB 4TKNA 4IG7B 2D2QA 4KZCA 3JSVA 3APFA 2DHZA 3QQ8B 4DDID 2MBOA 4CYEA 1Q0WB 2J7QB 3ZW3A 5JHAA 4RM8A 2KNBA 3PHXB 3BINA 3PLVA 1WRDB 2GBRA 3K9OB 5IAAC 3VDZA 3HM3A 3H6NA 2G45B 4FADA 2KWVB 4I6LB 4WQOB 5C1ZA 1SE9A 4GDKA 3PRPB 2PJHA 1V2YA 3S2AA 4RM9A 4GDLB 2KJHB 1TBEA 1WIAA 1EO6A 3RYTA 4GSWA 4DK5A 2KXJA 4FBJB 3H7PA 3HHMA 1YX6B 3QJZA 2RSUA 2CS4A 4KDLB 2CU1A 1PQSA 4F7ZA 3WALA 2BYVE 2NR2A 4BOZB 1WGGA 1WGYA 2K6DB 3CMMB 4MDKE 1WZ0A 4XC2A 3KVFB 3ONSA 1WGDA 1R4MI 2N1VA 2LRUA 4NAWB 4M8MA 1UGMA 1EF1A 2V4LA 2CHWA 1LQBA 5CHWA 3RZWC 4EZJA 2JRIB 5AZFA 1T0YA 2N7DA 3M95A 2IY1B 3QX1A 4MSMB 4W9GA 3RZFA 5IA7A 1E8XA 2FIDA 2LI5A 5DPTA 3X23A 4FN2A 4KDIC 2ZVNA 4NAWA 2IO0B 2G4DB 1P3QU 1MG8A 4ZDVA 5BO4B 1WJ4A 1IPGA 2FCMA 3AI5A 4HDQA 2BYEA 4NJ7A 3DVNV 1OTRB 2IYDB 5EDSA 2WX0A 1GJZA 3TCAA 2N9EB 2O2VA 2AL3A 1YJ1A 2IBIB 4ANVA 3AU4A 4PYZA 1E5WA 5J18A 4MSQB 2FCQA 3RULA 2IY0B 1NI2A 3X0WA 2JXXA 3ECIA 1IP9A 4K7SA 2HJ8A 2K8BA 3K9PB 5D7GA 1P1AA 1UD7A 4W9JA 3PRMB 4WAAA 3N3KB 1V49A 3IFWB 4WJNA 2K8HA 5JZEB 2N1WA 2N9XA 3PTFC 3R3MA 4TV3A 4B9KA 2ZNVB 2KDBA 4XZ4A 4ZYNA 4BKTA 1V80A 2MX2A 2PPHA 2BYFA 3APDA 5JH5C 4KZ0A 1E7UA 1NBFC 2KFKA 3R66C 1J0GA 1WMHB 2MBHA 4G50A 4PS3A 4II2B 4FHKA 1Q5WB 1GC6A 2BF8B 3QC8B 3DPDA 4IUMB 3AULA 2EKEC 3DCGA 5LLIA 2ZPNA 4AWJA 2DENB 4ANWA 4BVUC 2I1JA 4MGZE 4ZRIA 1E8ZA 5D2MB 2ASQA 5J2RA 2L8JA 2IO1B 2Z0DB 1X1MA 4K81A 4KIKA 1WZ3A 3O65B 4GMVA 4I6NB 3RT3B 4GXBA 2D11A 3DBHI 4JIOU 4URKA 2KDIA 1V6EA 2DAFA 1UZXB 2AL6A 2FCNA 2O2VB 3A9JB 3JYUA 3PREA 4K7WA 4PS7A 3OLMD 3ZNID 2UYZB 4EFOA 2JWZA 3B1LX 4MGKE 2K25A 1H8CA 1F9JA 3P2BA 3MHSD 3L13A 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSL C;  3QCA A;  3L08 A;  4G3X B;  4FLH A;  2AEH A;  1WXA A;  3WAO A;  4CHK A;  4F8C B;  2L3Z A;  4GDL A;  4GOC A;  1S3S G;  2R2O A;  1CMX B;  1RLF A;  4W9H A;  3VUX A;  2M4N A;  5DPR A;  3ZRC A;  3V61 A;  4HVB A;  2PEA A;  2KFJ A;  3APC A;  5DCN A;  1JRU A;  3L0W B;  3OAW A;  1BT0 A;  3KUD B;  4MGI E;  1WE7 A;  3PZD A;  2GBM A;  2LGD A;  4W9C A;  5AEK B;  2KTF A;  5CHF A;  2CKH B;  1YD8 U;  1C3T A;  4IM3 A;  4BBN C;  4DHJ D;  3GOE A;  1E8W A;  2DAJ A;  3M63 B;  4WJQ A;  2XBB C;  5FR6 A;  1EF5 A;  1K8R B;  1WM2 A;  1GG3 A;  4TQ0 A;  1XD3 B;  2MBB B;  4K1R B;  2V1Y A;  4DXA B;  3A1Q B;  4J6I A;  3A4R A;  2GBJ A;  4K7U A;  4GIV A;  3WA0 A;  3PPA A;  3B08 A;  1P9D U;  2PE6 B;  3DVG X;  1LXD A;  2ZEQ A;  4DHZ B;  2LXA A;  3Q3J A;  4BFR A;  4E3C A;  5DPW A;  4BOS C;  3GZN I;  2N9P C;  1GUA B;  3NHE B;  2K39 A;  3LDZ E;  5AZH A;  5LXI B;  2MWS B;  3W1S A;  4GB9 A;  1OQY A;  1TTN A;  2Z0E B;  3QK0 A;  3PSE B;  2KHW B;  1E7V A;  2LGY A;  4HLE A;  3DBR I;  3UQB A;  3TIX A;  3T9L A;  2J0J A;  3NS8 A;  4EEW A;  1WX8 A;  2KC1 A;  4EUT A;  1OGW A;  2BPS A;  1UBI A;  2J0K A;  2ZCB A;  2XK5 A;  2MP2 B;  4EKU A;  2FNJ B;  4BKG A;  4XX5 A;  3VH3 B;  3A9K A;  4LDT B;  5G55 A;  2M0X A;  3MTN B;  3ZVV A;  2LRW A;  2JZ3 B;  3R7R A;  4KV2 A;  2K1F A;  3V60 A;  1OEY J;  1ZW7 A;  4HCP B;  3ZNG C;  3TL5 A;  3H9D A;  3JW0 X;  2KWU B;  3PGE A;  1EUV B;  1FXT B;  2O6V D;  1KLV A;  1YX5 B;  2KWC A;  2JF5 A;  4P7I A;  3DQV A;  2DZJ A;  2NPT B;  4ZRK A;  3Q3F A;  2RR9 A;  3PHW B;  1S1Q B;  4ASW C;  4FUL A;  3A1Q A;  1IYF A;  4M8N A;  3NZS A;  2BKF A;  3PS6 A;  2B3A A;  4G0N B;  3V62 A;  2UWQ A;  4WWP A;  2KZR A;  2KLC A;  5E6N A;  3AXC A;  2J0M A;  2KMC A;  4AUQ C;  1WXV A;  2EMS A;  1WJ6 A;  5KHQ A;  3VQI A;  4DWF A;  5TR5 A;  2ZCC A;  4II3 B;  1KOT A;  3ML8 A;  3PV1 A;  4JGH B;  2AYO B;  2KMA A;  3QWZ B;  4DHJ B;  2LJ5 A;  3A9J A;  2KX0 A;  3KW5 B;  1Q1O A;  4IC7 B;  4W9F A;  3WAN A;  4ICV A;  4X57 B;  1WM3 A;  2YLM A;  1Z2M A;  1Z5S B;  3B0A A;  4PYU A;  1WJU A;  3N30 A;  4HCN B;  3D32 A;  3RD2 A;  2L0T A;  1WX9 A;  4BBN F;  2MQJ A;  2C5L C;  4W9D A;  5GMV A;  4DHZ E;  4W9I A;  2KQ7 A;  2FUH B;  3OJ3 A;  5JHB A;  2D10 A;  2MP2 A;  2JUO A;  3KYD D;  3ZO5 B;  1TGZ B;  2BWF A;  3QHT A;  2CHZ A;  2L0F A;  1M94 A;  2KFK B;  4AJY B;  1J19 A;  4ICU A;  4MGY E;  4FA6 A;  4W9E A;  4EOY A;  2MW5 A;  3KUZ A;  1J8C A;  4NPN A;  2DYO A;  3ZIM A;  2IO3 B;  4PS8 A;  2DZI A;  2W9N A;  2KO3 A;  1QZE A;  2GMI C;  3RUI B;  3NY5 A;  3U7D A;  1OEY A;  1U4A A;  2KTR A;  3UF8 A;  4B95 A;  2D3G A;  3WAM A;  3IVF A;  4MM3 A;  3ZTD A;  4F1S A;  2ZPY A;  3ZKJ C;  3SU8 X;  2KKC A;  2NVU I;  3UIO B;  3ZDM C;  3LJ3 A;  2WX1 A;  4AP4 C;  4HDO A;  2M8S A;  1ZGU B;  2R2Q A;  4NNJ B;  1WX7 A;  4W9L A;  4DDG D;  1G6J A;  1L7Y A;  3ENE A;  5CX3 A;  2LVO A;  3V6E B;  2JRH A;  1WF9 A;  2M17 A;  3VAW A;  4IWQ A;  2BKR B;  2L76 A;  3VUW A;  3PT2 B;  5L95 C;  4MJS A;  3A4S C;  1YQB A;  1VD2 A;  3R7Q A;  2LWP A;  2DYB A;  2C7H A;  5C23 A;  3L16 A;  4G11 A;  4KSK C;  3WAP A;  1XQQ A;  3PRZ A;  4ZRJ A;  2OOB B;  3VTU A;  2JZZ A;  3ZNH B;  4A3P A;  4OVU A;  3NZU A;  1RRB A;  5AZG A;  3VTW A;  3ZRF A;  3UQA A;  1D3Z A;  3HK0 A;  2KDE B;  4I6P A;  3HM6 X;  2HE7 A;  2I1K A;  3DVG Y;  1KM7 A;  2O6V B;  3L17 A;  3VTV A;  3VXW A;  3SDL C;  2LGX A;  3TBL D;  2DYM A;  5E6P A;  2XK5 B;  4NY0 A;  2M1M A;  2FIF A;  1WY8 A;  3TJP A;  4E74 A;  3EFU A;  3TMP B;  1C1Y B;  1P0R A;  3W1S C;  3ZDT A;  2MA9 B;  2ZJD A;  2GOW A;  1UH6 A;  2EMT A;  2C60 A;  4OVV A;  1XT9 B;  2KAN A;  2MRP A;  2WDT B;  1V5O A;  3MJW A;  1E8Y A;  1TZ1 A;  4FJV B;  4MH0 E;  1WGR A;  4IW0 A;  4JLC A;  4HPM B;  4MEM A;  4CO7 A;  1H4R A;  3ZNZ B;  4IWO A;  3QIJ A;  3T8M A;  1WGH A;  2L05 A;  2RD0 A;  2L7R A;  3DBL I;  3VHT C;  3M62 B;  4GN1 A;  3ALB A;  4WWN A;  4IM2 A;  2C7N B;  3JSV B;  4JL9 A;  4ANU A;  5CTR C;  3EHV A;  2A5U A;  3NOB A;  4HWI B;  2FCS A;  2KN5 A;  4WJO A;  3IG3 A;  1LFD A;  1WYW B;  1NDD A;  2WWZ A;  2KD0 A;  1V81 A;  4LCD E;  2N7E A;  3ZLZ A;  1ZKH A;  1WFY A;  3A9K B;  2MCN B;  4TQ1 A;  4BKS A;  1R4N I;  2HD5 B;  3CST A;  3QAR A;  4LDT D;  3SD5 A;  2C7M B;  4WJP A;  5D94 A;  5D6J B;  2JPH A;  4NJ6 A;  4E71 A;  2O6V A;  2Y5B B;  3L54 A;  3QA8 A;  2NS5 A;  3PVL A;  3JVZ X;  4IM0 A;  2LD9 A;  4JQW C;  2KK8 A;  1VCB A;  1WE6 A;  3U8Z A;  2KJR A;  4EZK A;  4A20 A;  1WR6 E;  2YVC A;  4HK2 A;  1E90 A;  4LJO B;  1WXM A;  1WI0 A;  3VFK A;  2NPT A;  4HJK A;  3SHQ A;  2LVQ A;  2G3Q B;  2C9W B;  2PE9 A;  2OJR A;  2RPQ A;  3KH0 A;  1AAR A;  1RFA A;  1V9J A;  3HIZ A;  4HPL B;  3L10 B;  5HKH A;  2KLG A;  2K6Q A;  2BGF A;  2LUE A;  1GC7 A;  1A5R A;  2BWE S;  2ZNV C;  2CHX A;  2XEW A;  2VRR B;  2MSE D;  2JY6 A;  2WYQ A;  3ZTC A;  2KDF B;  4AJW A;  1WJN A;  3RCZ A;  4W9K A;  2LXC A;  3M3J A;  2KC2 A;  4N9F 4;  3DBS A;  2CR5 A;  2KOX A;  1SIF A;  2NBW B;  3OJ4 B;  4M0W B;  1I42 A;  4GGQ A;  5L83 A;  1UBQ A;  2HTH A;  3BY4 B;  5E6O A;  3AU5 A;  3CSF A;  1L2N A;  2LAS A;  4NQL B;  2JVC A;  1KJT A;  2NBV B;  2LVP A;  3I3T B;  4DBG A;  1ISN A;  4FJY A;  4EZL A;  5CHV C;  5G2N A;  3DOW A;  2LZ6 A;  2DX5 B;  4NQK E;  3H7S A;  3V6C B;  1Y8R C;  3A33 B;  1SGH A;  3VH4 B;  2L00 B;  4WWO A;  2REX A;  1WH3 A;  1RAX A;  2GBN A;  1LM8 B;  4MEL A;  2KVR A;  3KUC B;  4IWP A;  2IO2 B;  3IBE A;  3W1Y A;  5KHO A;  2Z59 B;  3ZUN A;  1P98 A;  3IHP C;  1YIW A;  2MBE A;  1HE8 A;  2KQS A;  3PLU A;  4GDK B;  3UIN B;  3VUY A;  5LXH A;  2GBK A;  2G4S A;  4TUU A;  2AWT A;  2DZM A;  2KJ6 A;  2KTR B;  2K8C A;  2NCN A;  3U30 A;  4A3O A;  3H7P B;  3ML9 A;  2JT4 B;  3EC8 A;  1V86 A;  1UEL A;  3H1U A;  2MBQ A;  2D07 B;  3VVW B;  2RGF A;  1WMH A;  4ANX A;  4AOF A;  2QHO A;  2KX3 A;  5J17 A;  1I35 A;  4YL8 A;  4FJZ A;  2ZZP B;  2A4Z A;  4BKS D;  2ZVO A;  3QAQ A;  3DDC B;  3N32 A;  3UIP B;  3KYC D;  1V5T A;  4HXD A;  2IZV B;  4MJS B;  4B6W A;  3DVN U;  2NBU A;  3WIM A;  4GU2 A;  5DPS A;  3CF6 E;  4KVG B;  4KIK B;  4FHJ A;  3EEC A;  2DZK A;  2MLB A;  2N4F A;  4LJP B;  4RMA A;  1GNU A;  1WXS A;  1WR1 A;  2V3S A;  2FAZ A;  3C0R B;  4TKN A;  4IG7 B;  2D2Q A;  4KZC A;  3JSV A;  3APF A;  2DHZ A;  3QQ8 B;  4DDI D;  2MBO A;  4CYE A;  1Q0W B;  2J7Q B;  3ZW3 A;  5JHA A;  4RM8 A;  2KNB A;  3PHX B;  3BIN A;  3PLV A;  1WRD B;  2GBR A;  3K9O B;  5IAA C;  3VDZ A;  3HM3 A;  3H6N A;  2G45 B;  4FAD A;  2KWV B;  4I6L B;  4WQO B;  5C1Z A;  1SE9 A;  4GDK A;  3PRP B;  2PJH A;  1V2Y A;  3S2A A;  4RM9 A;  4GDL B;  2KJH B;  1TBE A;  1WIA A;  1EO6 A;  3RYT A;  4GSW A;  4DK5 A;  2KXJ A;  4FBJ B;  3H7P A;  3HHM A;  1YX6 B;  3QJZ A;  2RSU A;  2CS4 A;  4KDL B;  2CU1 A;  1PQS A;  4F7Z A;  3WAL A;  2BYV E;  2NR2 A;  4BOZ B;  1WGG A;  1WGY A;  2K6D B;  3CMM B;  4MDK E;  1WZ0 A;  4XC2 A;  3KVF B;  3ONS A;  1WGD A;  1R4M I;  2N1V A;  2LRU A;  4NAW B;  4M8M A;  1UGM A;  1EF1 A;  2V4L A;  2CHW A;  1LQB A;  5CHW A;  3RZW C;  4EZJ A;  2JRI B;  5AZF A;  1T0Y A;  2N7D A;  3M95 A;  2IY1 B;  3QX1 A;  4MSM B;  4W9G A;  3RZF A;  5IA7 A;  1E8X A;  2FID A;  2LI5 A;  5DPT A;  3X23 A;  4FN2 A;  4KDI C;  2ZVN A;  4NAW A;  2IO0 B;  2G4D B;  1P3Q U;  1MG8 A;  4ZDV A;  5BO4 B;  1WJ4 A;  1IPG A;  2FCM A;  3AI5 A;  4HDQ A;  2BYE A;  4NJ7 A;  3DVN V;  1OTR B;  2IYD B;  5EDS A;  2WX0 A;  1GJZ A;  3TCA A;  2N9E B;  2O2V A;  2AL3 A;  1YJ1 A;  2IBI B;  4ANV A;  3AU4 A;  4PYZ A;  1E5W A;  5J18 A;  4MSQ B;  2FCQ A;  3RUL A;  2IY0 B;  1NI2 A;  3X0W A;  2JXX A;  3ECI A;  1IP9 A;  4K7S A;  2HJ8 A;  2K8B A;  3K9P B;  5D7G A;  1P1A A;  1UD7 A;  4W9J A;  3PRM B;  4WAA A;  3N3K B;  1V49 A;  3IFW B;  4WJN A;  2K8H A;  5JZE B;  2N1W A;  2N9X A;  3PTF C;  3R3M A;  4TV3 A;  4B9K A;  2ZNV B;  2KDB A;  4XZ4 A;  4ZYN A;  4BKT A;  1V80 A;  2MX2 A;  2PPH A;  2BYF A;  3APD A;  5JH5 C;  4KZ0 A;  1E7U A;  1NBF C;  2KFK A;  3R66 C;  1J0G A;  1WMH B;  2MBH A;  4G50 A;  4PS3 A;  4II2 B;  4FHK A;  1Q5W B;  1GC6 A;  2BF8 B;  3QC8 B;  3DPD A;  4IUM B;  3AUL A;  2EKE C;  3DCG A;  5LLI A;  2ZPN A;  4AWJ A;  2DEN B;  4ANW A;  4BVU C;  2I1J A;  4MGZ E;  4ZRI A;  1E8Z A;  5D2M B;  2ASQ A;  5J2R A;  2L8J A;  2IO1 B;  2Z0D B;  1X1M A;  4K81 A;  4KIK A;  1WZ3 A;  3O65 B;  4GMV A;  4I6N B;  3RT3 B;  4GXB A;  2D11 A;  3DBH I;  4JIO U;  4URK A;  2KDI A;  1V6E A;  2DAF A;  1UZX B;  2AL6 A;  2FCN A;  2O2V B;  3A9J B;  3JYU A;  3PRE A;  4K7W A;  4PS7 A;  3OLM D;  3ZNI D;  2UYZ B;  4EFO A;  2JWZ A;  3B1L X;  4MGK E;  2K25 A;  1H8C A;  1F9J A;  3P2B A;  3MHS D;  3L13 A;  3UGB B; 
#chains in the Genus database with same CATH topology
 4A6Q A;  4KSL C;  3L08 A;  4WQM A;  4CHK A;  4HKZ E;  4GDL A;  4GOC A;  2R2O A;  5G5G A;  4W9H A;  1IGD A;  4OVZ A;  3BK1 A;  1JRU A;  1WE7 A;  2GLS A;  5AEK B;  4W9C A;  3BVG A;  2KTF A;  1FCL A;  4DHJ D;  2K22 A;  3M63 B;  1L6V A;  1RWS A;  4M01 A;  5IKC M;  1K8R B;  4US8 A;  3A4R A;  2GBJ A;  4NJC A;  4GIV A;  2PE6 B;  2LXA A;  3Q3J A;  2INN E;  2BS2 B;  4UDU C;  5DPW A;  4BOS C;  1NVI D;  3NHE B;  2K39 A;  1ET6 A;  4C00 A;  1TTN A;  1OQR A;  3I57 A;  4HLE A;  4ARI A;  1HTO A;  4S0R A;  2MH7 A;  3NS8 A;  1OGW A;  2BPS A;  1UBI A;  2J0K A;  2ZCB A;  2FNJ B;  4BKG A;  4XX5 A;  3VH3 B;  3A9K A;  2GRI A;  3TEY A;  4WWM A;  3J9C A;  4NAM A;  1ZW7 A;  3Q3O C;  3DBR B;  5TSS A;  2QEJ C;  3TL5 A;  3H9D A;  1XLQ A;  2KWU B;  3PGE A;  1EUV B;  2J52 A;  1KLV A;  2JF5 A;  2DZJ A;  2NPT B;  4MM3 B;  3PHW B;  1F1H A;  4ASW C;  3NZS A;  1WSP A;  2BKF A;  3ZJT A;  2UWQ A;  4WWP A;  2KZR A;  4YTN B;  2KMC A;  3KLS X;  1WXV A;  2EMS A;  1WJ6 A;  5KHQ A;  3VQI A;  4DWF A;  4II3 B;  4XWT A;  1KOT A;  3SFE B;  2AYO B;  2KMA A;  3EUB 2;  2LJ5 A;  3KW5 B;  3DBH B;  1Z2M A;  4HCN B;  3UI3 A;  1ZUD 2;  1JWB D;  1EU3 A;  3D32 A;  1JAL A;  4W9D A;  5GMV A;  4QAY A;  5JHB A;  4XGA B;  1TGZ B;  3QHT A;  4RNA A;  2KFK B;  4AJY B;  4MGY E;  1F2R C;  4NPN A;  4RF1 A;  5FK9 C;  2DZI A;  2W9N A;  3T3O A;  2ONQ A;  1NEK B;  1U4A A;  4B95 A;  2JXT A;  3WAM A;  1GAQ B;  3IVF A;  4MM3 A;  3Q6B A;  2KKC A;  3R8B A;  1XCT L;  2R2Q A;  1SIJ A;  4NNJ B;  1L0X B;  2LVO A;  3V6E B;  3LXF A;  2WP9 B;  3VAW A;  2L76 A;  1VZ6 A;  3VUW A;  3PT2 B;  3AEA B;  1YNT E;  3L16 A;  4KSK C;  1VZ8 A;  1SB3 C;  1D3Z A;  1RRB A;  3HK0 A;  3HM6 X;  2I1K A;  4GLS C;  4E74 A;  1C1Y B;  3W1S C;  2AQ2 B;  1VR9 A;  3PZ7 A;  3AE4 B;  2EMT A;  2KAN A;  2PVO D;  1HZ6 A;  4MH0 E;  4YXD B;  3ZNZ B;  2OJW A;  4WAF A;  1B1Z A;  3DBL I;  1KF6 B;  4IM2 A;  1SJE D;  2DNF A;  2A5U A;  3NOB A;  5IN7 A;  4LLG M;  1NDD A;  2WWZ A;  2KD0 A;  3TEW A;  1MFW A;  1ZKH A;  2MCN B;  2FUG 1;  2HD5 B;  3QAR A;  3IAS 1;  1D5M C;  2C7M B;  4WJP A;  4HEA 1;  2JPH A;  4NJ6 A;  1PGX A;  3L54 A;  3N9Y C;  1V8C A;  4ZRQ A;  1WR6 E;  3CWI A;  2TSS A;  1WXM A;  3W2D A;  2R61 A;  5EE3 A;  2LVQ A;  2WXQ A;  2C9W B;  2PE9 A;  2OJR A;  1AAR A;  3HIZ A;  2G9H D;  5HKH A;  1CK1 A;  5BYQ A;  2M0A A;  2LUE A;  1IBX A;  2NTS A;  2XEW A;  4AJW A;  2LJI A;  3RCZ A;  2KAC A;  3M3J A;  4YSX B;  3DBS A;  5L83 A;  1YQ3 B;  4HPP A;  3CSF A;  1L2N A;  2LAS A;  2JVC A;  5IO9 A;  1ISN A;  4EZL A;  3AB5 A;  5G2N A;  3R2T A;  3H7S A;  3OG5 A;  2H88 B;  2WDV B;  1K51 A;  4WWO A;  2WXF A;  2REX A;  4AQ7 A;  3NZ3 A;  1WH3 A;  2INC C;  2GBN A;  2QIE B;  3IBE A;  3ZUN A;  3U7Z A;  4B0E A;  1WWT A;  2WXG A;  3U2S C;  1BML C;  3GB1 A;  3VUY A;  5LXH A;  2ACZ B;  4A3O A;  4KKI A;  3ML9 A;  2HTM E;  3H1U A;  3VVW B;  1UWX A;  4IOI E;  2QHO A;  5J17 A;  1I35 A;  4YL8 A;  2WXN A;  4HXD A;  1KLU D;  4B6W A;  3DVN U;  3WIM A;  4YSY B;  3CIR B;  3FKY A;  2N4F A;  1E6E B;  4TKN A;  3R2I A;  3ZGZ A;  1UUP A;  4KZC A;  3APF A;  4DDI D;  2MBO A;  2PKO A;  3ZW3 A;  3NS1 A;  2BS4 B;  3NVW A;  1YJJ A;  5IAA C;  3BIN A;  2GBR A;  4IKG A;  3B2F A;  3H6N A;  2KWV B;  4I6L B;  3S2A A;  3EGR A;  1EO6 A;  1SJH D;  3MC9 A;  3H7P A;  1YQ4 B;  3MP9 A;  3WAL A;  1WGG A;  3CMM B;  1QOG A;  4USA A;  3ONS A;  2LRU A;  4NAW B;  4M8M A;  1UGM A;  4MH8 A;  1LQB A;  5CHW A;  1PGB A;  5EE1 A;  3RZW C;  2JX5 A;  1YOV B;  4W9G A;  2FID A;  5DPT A;  4FN2 A;  2ZVN A;  2E6X A;  1QLB B;  2W3S A;  5BO4 B;  5EDS A;  1TY0 A;  1GJZ A;  2B76 B;  4N58 A;  2O2V A;  2IBI B;  3GS2 A;  1TKY A;  3AU4 A;  4WH4 A;  1YJI A;  5J18 A;  2W54 A;  4K3B A;  1ZDV A;  3ECI A;  3NJT A;  1SEB D;  1I7H A;  3K9P B;  3FAH A;  3PRM B;  2ZW1 A;  5JZE B;  2N1W A;  2ZNV B;  1MHX A;  4ZYN A;  4BKT A;  1V80 A;  2J53 A;  4KZ0 A;  1WMH B;  4G50 A;  4PS3 A;  4II2 B;  1Q5W B;  1GC6 A;  2BF8 B;  2BT6 A;  3DCG A;  2ZPN A;  1E8Z A;  2ASQ A;  2WGS A;  3FIL A;  1HA5 A;  1XF5 L;  5J2R A;  1FO4 A;  3HUI A;  4IDI A;  3O65 B;  1TS2 A;  1ZXH A;  4C4V B;  2DAF A;  3JYU A;  4PS7 A;  1FNW A;  3ZNI D;  3MJ5 A;  4NZL B;  1FRD A;  1F9J A;  3P2B A;  1JWM D;  3MHS D;  1JRO A;  2RDH A;  3QCA A;  2AEH A;  1WXA A;  1S3S G;  1T5X D;  3VUX A;  4L2Y A;  1FPY A;  5EE9 A;  1B9R A;  3V61 A;  1QOF A;  2PEA A;  5DCN A;  3L0W B;  4AS1 A;  3EA6 A;  1BT0 A;  4MGI E;  2L32 A;  4XDC A;  1YMH E;  5CHF A;  4IM3 A;  3GOE A;  2PLP A;  4WJQ A;  3P4R B;  3A1Q B;  4K7U A;  1QOA A;  1P9D U;  3DVG X;  3DHH C;  4DHZ B;  3URY A;  5AZH A;  5I4D A;  3QK0 A;  3DBR I;  3UQB A;  3TIX A;  3T9L A;  1EWY C;  4EUT A;  1GB1 A;  2XK5 A;  3KWV A;  1ZP0 B;  2QC8 A;  5G55 A;  3DWM A;  2LFI A;  5H8Y E;  2LRW A;  1SE2 A;  2HDE A;  1OEY J;  4HCP B;  2WXR A;  1F2R I;  1MVK A;  1FXT B;  3I9V 1;  2Z8L A;  2WXJ A;  3DQV A;  1NYQ A;  3DHG C;  2RR9 A;  3KQ4 A;  1S1Q B;  3AE1 B;  3A1Q A;  2K9X A;  1L6U A;  3OWE B;  2GI9 A;  4KKJ A;  3ML8 A;  4LNO A;  1C4C A;  1UWM A;  2KX0 A;  1LGR A;  1Q1O A;  4X57 B;  1TKE A;  1V1O A;  1WM3 A;  4PYU A;  2V3P A;  4BBN F;  2H89 B;  4DHZ E;  3RNE C;  2L1A A;  3HVZ A;  3OJ3 A;  1E10 A;  4ICU A;  4EOY A;  2MW5 A;  1J8C A;  2DYO A;  2IO3 B;  4PS8 A;  2KO3 A;  4HRS A;  2GMI C;  3RUI B;  3BWU D;  2I2Y A;  3BYY B;  1SBB B;  4HJG E;  4RCO A;  2JZP A;  1N61 A;  4F1S A;  4PT5 A;  3ZYY X;  3LJ3 A;  4AP4 C;  3BVZ A;  4RF0 A;  2M8S A;  1C77 A;  1ZGU B;  2JWU A;  1L7Y A;  3ENE A;  2WU2 B;  5CX3 A;  2M17 A;  1FNU A;  1DOY A;  1FFU A;  1XQQ A;  2JZZ A;  3ZNH B;  3NZU A;  2WQY B;  1I4H A;  2LEK A;  2HE7 A;  2AQ1 B;  3L17 A;  4P16 A;  3SDL C;  3H8H A;  2XK5 B;  3RN9 C;  4NY0 A;  1QIL A;  1WY8 A;  3ZQ4 A;  1P0R A;  2IPK D;  2MA9 B;  4P1C C;  3N20 C;  2C60 A;  4OZB A;  1TS5 A;  2N9K A;  5HFY A;  1F52 A;  2MRP A;  1AW7 A;  1E8Y A;  1HEZ E;  1L0V B;  1C4A A;  4HPM B;  2ICI A;  3QIJ A;  2L05 A;  2L7R A;  3VHT C;  3M62 B;  3TUO A;  3ALB A;  4JL9 A;  5CTR C;  3EHV A;  4HWI B;  4WJO A;  2KN5 A;  4YT0 B;  5JXV A;  1V81 A;  4BKS A;  4K3C A;  4RFB A;  5D94 A;  4C7Y A;  5D6J B;  2KMM A;  2O6V A;  2Y5B B;  1PUT A;  3PVL A;  1YN4 A;  3WCQ A;  4JQW C;  1GPX A;  1WE6 A;  2YVC A;  4HK2 A;  1E90 A;  4LJO B;  2NPT A;  3SHQ A;  1FEH A;  2XN9 C;  1A70 A;  3MC8 A;  1WYG A;  5BMI A;  2D3B A;  2BGF A;  3NRZ A;  1PYW D;  3ZTC A;  3NVY A;  2CR5 A;  3P4S B;  1QOB A;  3OJ4 B;  2HTH A;  3ZJU A;  3I3T B;  1FRR A;  4M02 A;  2PMV A;  4MAC A;  5CHV C;  3DOW A;  1L5P A;  2L00 B;  3HRD D;  3AE7 B;  1LM8 B;  3P4Q B;  2KVR A;  3KUC B;  1I4Q A;  4IWP A;  2EEL A;  3ZXV A;  1HE8 A;  2KQS A;  4GDK B;  3UIN B;  2GBK A;  4TUU A;  2AWT A;  2DZM A;  2KTR B;  2K8C A;  1FFV A;  2JT4 B;  1UEL A;  2MBQ A;  2D07 B;  3IT6 B;  1SE3 A;  1JW9 D;  2HJ1 A;  4BKS D;  1V5T A;  1UNS A;  2IZV B;  4MJS B;  2NBU A;  4GU2 A;  3CF6 E;  2PW9 A;  2DZK A;  4RMA A;  1GNU A;  1WXS A;  2D2Q A;  2DHZ A;  3QQ8 B;  2K5P A;  2J7Q B;  5JHA A;  5H92 C;  2RDB C;  2XNA C;  1WRD B;  3K9O B;  4FAD A;  5C1Z A;  3P4P B;  3PRP B;  2LGI A;  2PJH A;  4RM9 A;  4GDL B;  4P6V F;  3RYT A;  5BMH A;  5GXG B;  4O1N A;  1FMA D;  2CU1 A;  3TEZ A;  2QDF A;  1WZ0 A;  4XC2 A;  4YSZ B;  3KVF B;  1WGD A;  1R4M I;  2VZK D;  1N5X A;  4ZHP A;  2CHW A;  1HXY D;  2V0G A;  1T0Y A;  2V4I B;  4YWG G;  2N7D A;  4MSM B;  2WDR B;  4OW0 A;  3RNC C;  2LI5 A;  1XEE A;  2RPV A;  2IO0 B;  4RGO S;  3W5V B;  4ZDV A;  1WJ4 A;  4HDQ A;  1C78 A;  3AEE B;  2N9E B;  3TCA A;  2AL3 A;  5BYS A;  4XE0 A;  1N63 A;  4K7S A;  2HJ8 A;  2K8B A;  1P1A A;  3VRA B;  1FCC C;  2KVZ A;  3O13 A;  3IFW B;  2QCZ A;  1IBX B;  2K8H A;  4XZ4 A;  1E7U A;  1VDV A;  1HZ5 A;  4BAX A;  4IUM B;  2EKE C;  5LLI A;  4ANW A;  4BVU C;  4MGZ E;  3AM9 A;  2OED A;  4ZHO A;  3TEX A;  2IO1 B;  5MPO A;  1X1M A;  2M19 A;  4GMV A;  4I6N B;  2D11 A;  2EKI A;  2KDI A;  1UZX B;  4K7W A;  3A9J B;  4RGN A;  2CU3 A;  1FXA A;  4EFO A;  3P42 A;  2DLB A;  2V3N A;  1MI0 A;  4G3X B;  4ZOH C;  4F8C B;  4XWW A;  2OHF A;  1CMX B;  3RMK C;  2N9L A;  1D4B A;  1QF6 A;  1FD6 A;  3APC A;  5C2T B;  3SEB A;  2GBM A;  2LGD A;  2CKH B;  3Q3M C;  1EF5 A;  1XD3 B;  2MBB B;  2V1Y A;  3N1Z C;  2VH2 A;  4J6I A;  4KGT A;  1P7F A;  1LXD A;  2N7J A;  2ZEQ A;  1F0Z A;  1GB4 A;  3GZN I;  4JPS A;  2N9P C;  1GUA B;  5AUI A;  2L52 A;  4GB9 A;  1TS3 A;  1OQY A;  2KHW B;  1E7V A;  2LGY A;  1I4P A;  1DYQ A;  2PVG C;  4DQO C;  1ZOY B;  2J0J A;  4EEW A;  1WX8 A;  2QSD A;  1VRA B;  4EKU A;  5FKA C;  5HG2 A;  2IND C;  2M0X A;  3MTN B;  2JZ3 B;  2K1F A;  3V60 A;  3ZNG C;  1N6Z A;  3C19 A;  3ZXR A;  2MJ3 A;  2O6V D;  1YX5 B;  2KWC A;  4P7I A;  4MT5 A;  3Q3F A;  1FIQ A;  4P1B C;  1IYF A;  4A55 A;  3PS6 A;  1SF0 A;  2KLC A;  5E6N A;  3AXC A;  1D5X C;  1K52 A;  1OFF A;  2JSV X;  4AUQ C;  2ZCC A;  3QWZ B;  2NMQ A;  3A9J A;  4DHJ B;  4IC7 B;  4W9F A;  3WAN A;  1KTK A;  4S17 A;  4ACF A;  3B0A A;  3RD2 A;  2L0T A;  1WX9 A;  2MQJ A;  4WUR A;  4W9I A;  2FUH B;  2D10 A;  1JQ4 A;  1M94 A;  1J7A A;  4W9E A;  3KUZ A;  1XLP A;  3NY5 A;  2V9H A;  2BYT A;  2KTR A;  3UF8 A;  3BII D;  3ZTD A;  1Q10 A;  4RGM A;  1CQV A;  2NVU I;  3DWG C;  4JWS C;  1RFK A;  1T0R C;  2KN4 A;  4HDO A;  4M0W A;  2WXH A;  4ZRP A;  1WX7 A;  4DDG D;  1I4G A;  1SE4 A;  4IWQ A;  4MJS A;  3A4S C;  1YQB A;  1VD2 A;  5C23 A;  4B0M A;  4G11 A;  2Y3A A;  2OOB B;  1ESF A;  4A3P A;  2YEP B;  5AZG A;  3ZRF A;  1R7S A;  3LB8 C;  3VTV A;  2DYM A;  5E6P A;  1MPE A;  2M1M A;  2FIF A;  3TJP A;  2ZW0 A;  3EFU A;  3TMP B;  1AWD A;  1TKG A;  2ZJD A;  3LYY A;  1UH6 A;  4OVV A;  1GOZ A;  2WDT B;  1V5O A;  2WDQ B;  2BB5 A;  1TZ1 A;  4FJV B;  4IW0 A;  4JLC A;  4CO7 A;  3I63 C;  2J4X A;  1EU4 A;  3T8M A;  2FBW B;  2WXM A;  4GN1 A;  4J3O D;  1AN8 A;  2KDM A;  2BW2 A;  2FCS A;  1QQR A;  4JX1 C;  1K53 A;  4HRO A;  1ACC A;  4LCD E;  1WFY A;  4TQ1 A;  1R4N I;  4LDT D;  3SD5 A;  1V97 A;  3QA8 A;  3P63 A;  1KH0 A;  1VCB A;  1ENF A;  3VR9 B;  3U8Z A;  1FNV A;  4A20 A;  1PFD A;  2WS3 B;  1WXQ A;  3GE8 C;  2MHJ A;  2G3Q B;  2WHI A;  3KH0 A;  1C79 A;  1RFA A;  3L10 B;  1TIF A;  1GC7 A;  4R3D A;  2BQQ A;  2BWE S;  2MSE D;  2JY6 A;  2WYQ A;  3C8Y A;  2ON8 A;  3AEF B;  4W9K A;  1VLB A;  5T8I A;  4M0W B;  1N60 A;  1I42 A;  1UBQ A;  1WGK A;  3BY4 B;  2KYW A;  4JE3 B;  3AE6 B;  3L4P A;  4XDD A;  4NQK E;  2LHD A;  1JWS D;  2LZ6 A;  3V6C B;  1TYG B;  1SGH A;  3VH4 B;  3Q8E A;  3NUH B;  2IO2 B;  3W1Y A;  2Z59 B;  3Q2A C;  1P98 A;  3IHP C;  1YIW A;  1NEN B;  1MJD A;  2MBE A;  3PLU A;  2G4S A;  1TY2 A;  3H7P B;  3EC8 A;  5IOI A;  1V86 A;  4ZYS A;  1WMH A;  1RM6 C;  4FJZ A;  2ZZP B;  3QAQ A;  3N32 A;  1EWC A;  1YN3 A;  3VRB B;  4KIK B;  4KVG B;  2LHE A;  2LUM A;  4FHJ A;  3EEC A;  1VJK A;  2MLB A;  4LJP B;  4YTM B;  4C4V A;  1WR1 A;  2WLB A;  3C0R B;  4IG7 B;  1KLG D;  3AH7 A;  3DBL B;  4CYE A;  1Q0W B;  2Y5C A;  1E9M A;  3PHX B;  2G45 B;  2WXL A;  4WQO B;  4CQN A;  1V2Y A;  2KJH B;  1N5W A;  1TBE A;  3Q8B A;  2CJO A;  4RH6 A;  4FBJ B;  3I5J C;  3HHM A;  2RSU A;  2CS4 A;  1DOI A;  1PQS A;  3KWL A;  4F7Z A;  3VR8 B;  2PTL A;  4N59 A;  2BYV E;  3Q8F A;  1MG4 A;  1XXG A;  3IXS A;  1WGY A;  4EE2 A;  4KGS A;  3RNG C;  2JQR B;  4OZA A;  2V4L A;  3Q3N C;  2W82 A;  3V3X A;  2IY1 B;  3QX1 A;  1C9F A;  4C56 C;  3RZF A;  5IA7 A;  1E8X A;  3X23 A;  4KDI C;  3IAM 1;  1JWU D;  2G4D B;  5EE0 A;  1MG8 A;  1IPG A;  2FCM A;  3AI5 A;  2BYE A;  1C76 A;  1XCQ L;  2IYD B;  1KFY B;  3MHZ A;  3FC4 A;  1E5W A;  3P1M A;  2AX5 A;  1IUE A;  1NI2 A;  1I4X A;  3Q14 C;  4LNN A;  3X0W A;  2IJ0 A;  1IP9 A;  1FM0 D;  2RMM A;  4W9J A;  4WAA A;  3N3K B;  1V49 A;  2N9X A;  3E9S A;  3PTF C;  4TV3 A;  4B9K A;  2WXI A;  2WXK A;  2PPH A;  4H2A A;  3APD A;  1V1P A;  3Q8C A;  5JH5 C;  1BXT A;  2KFK A;  1UF0 A;  3T3N A;  5D3D A;  2BS3 B;  4FHK A;  3DPD A;  2DEN B;  4ZRI A;  3PO0 A;  2L8J A;  2Z0D B;  3E56 A;  4K81 A;  4KIK A;  3ETR A;  2MEK A;  1L4D B;  3DBH I;  4JIO U;  4URK A;  1V6E A;  1PGA A;  2Y5P A;  1OQQ A;  2D3C A;  2O2V B;  3OLM D;  2UYZ B;  2CJN A;  4A90 A;  2JWZ A;  3B1L X;  3NG0 A;  1H8C A;  1ZPS A;  3V05 A;  1TJE A;  3PZ8 A;  2PIA A;  4FLH A;  3WAO A;  2L3Z A;  1RLF A;  2M4N A;  5DPR A;  3SFD B;  5LNK 1;  3ZRC A;  4HVB A;  1T0S C;  2KFJ A;  3OAW A;  3DHI C;  3KUD B;  3PZD A;  1C3T A;  1YD8 U;  4BBN C;  3NVV A;  1E8W A;  2DAJ A;  2XBB C;  5FR6 A;  1WM2 A;  3RFZ B;  1GG3 A;  4LTU A;  4TQ0 A;  4K1R B;  1L0Y B;  2MJD A;  4DXA B;  1YN5 A;  3WA0 A;  3PPA A;  3B08 A;  3BZD B;  2WNM A;  4BFR A;  4E3C A;  4LNK A;  3LDZ E;  3AEC B;  1RYJ A;  5LXI B;  2MWS B;  3W1S A;  2J42 A;  2Z0E B;  3PSE B;  4TSS A;  1NYR A;  1TS4 A;  4OZC A;  1XLO A;  2KC1 A;  2W55 A;  3MFG A;  3GZN B;  2G1E A;  5BYR A;  5D3I B;  2MP2 B;  4LDT B;  4L1B A;  4Q2J A;  2IDY A;  3IT4 B;  4LNI A;  3ZVV A;  3ABV B;  4KX6 B;  3R7R A;  4KV2 A;  1XO3 A;  1EM7 A;  3JW0 X;  3GP7 A;  2LMC A;  1Y56 A;  4ZRK A;  4FUL A;  4M8N A;  1HQR D;  2VH1 A;  2B3A A;  3FIL B;  4G0N B;  3V62 A;  2VZK B;  4KGR A;  2SAK A;  3BK2 A;  2J0M A;  4N6E B;  3NVZ A;  2FE8 A;  5C3J B;  1HTQ A;  5TR5 A;  3B2G A;  4PK1 A;  3PV1 A;  4JGH B;  4C80 A;  2QMT A;  2BBC A;  3RNB C;  2QIL A;  2YEP F;  4ICV A;  2YLM A;  4A8X C;  1Z5S B;  2UU7 A;  1WJU A;  3N30 A;  5E6J A;  4JWU C;  3EFC A;  2C5L C;  3TSS A;  2KQ7 A;  3AE3 B;  2MP2 A;  3KYD D;  2JUO A;  3ZO5 B;  2BWF A;  2CHZ A;  2L0F A;  1SXT A;  2BB6 A;  1J19 A;  3AE8 B;  4FA6 A;  3ZIM A;  1CJE A;  3Q69 A;  1QZE A;  4M00 A;  3U7D A;  1OEY A;  3RNF C;  2D3G A;  2ZPY A;  3ZKJ C;  3SU8 X;  3UIO B;  2KQ4 X;  3ZDM C;  2WX1 A;  4US9 A;  4REZ A;  1JWA D;  5HI1 A;  4W9L A;  1D5Z C;  2JRH A;  1WF9 A;  1KRH A;  2BKR B;  5L95 C;  2KAJ A;  3R7Q A;  1WRI A;  2LWP A;  2DYB A;  2C7H A;  3WAP A;  3ZJV A;  3SR6 A;  2JYT A;  4ZRJ A;  3PRZ A;  3VTU A;  4OVU A;  1G6J A;  3VTW A;  3UQA A;  4I6P A;  2KDE B;  3DVG Y;  1KM7 A;  2O6V B;  1L4Z B;  3VXW A;  2LGX A;  3TBL D;  4HKQ A;  2MJE A;  2IGG A;  1MHH E;  2INP E;  2JU6 X;  4L23 A;  3ZDT A;  1CZP A;  2GOW A;  1ZXI A;  1ET9 A;  1M4V A;  1XT9 B;  1D6E C;  4RGT A;  2E3T A;  3MJW A;  5FR3 A;  4XYC A;  1WGR A;  3W5U B;  4MEM A;  1H4R A;  4IWO A;  2M56 B;  2X38 A;  1P7E A;  1WGH A;  3U52 E;  2RD0 A;  2LGS A;  4WWN A;  2C7N B;  3JSV B;  4ANU A;  1NI3 A;  3AED B;  3IG3 A;  1LFD A;  1WYW B;  1BUI C;  1QT9 A;  5HHD G;  2N7E A;  3ZLZ A;  3A9K B;  1SSN A;  1AYF A;  3CST A;  1XLN A;  4E71 A;  1C4P A;  1N62 A;  1ZE3 D;  2NS5 A;  4IM0 A;  3JVZ X;  2LD9 A;  2KK8 A;  4ITK A;  2KJR A;  4EZK A;  1E0Z A;  1WI0 A;  3AE9 B;  3VFK A;  4HJK A;  3U4E G;  1R4N B;  2RPQ A;  1R4M B;  4TMA B;  1V9J A;  4HPL B;  2KLG A;  2K6Q A;  1A5R A;  2ZNV C;  2CHX A;  2VRR B;  2KDF B;  4C7Z A;  1WJN A;  3HVD A;  1V1P B;  1J7C A;  2LXC A;  2KC2 A;  4N9F 4;  2KOX A;  1SIF A;  2NBW B;  2KT7 A;  4GGQ A;  5E6O A;  3AU5 A;  4NQL B;  1KJT A;  2NBV B;  1F77 A;  2LVP A;  4BZA A;  4DBG A;  4FJY A;  2L83 A;  3GE3 C;  1IGC A;  2DX5 B;  2JYE A;  1Y8R C;  3A33 B;  3N1Y C;  1J7B A;  1RAX A;  4YTP B;  4MEL A;  3N1X C;  2BVC A;  5KHO A;  2K0P A;  2Q5W D;  1T6B X;  3BYT B;  3Q8A A;  1FXI A;  1TT5 B;  2KJ6 A;  1PDX A;  2NCN A;  3U30 A;  3AEG B;  1TZO A;  2RGF A;  4ANX A;  4AOF A;  4DXG A;  1ROE A;  2KX3 A;  3AE2 B;  3AMZ A;  2SEB D;  2A4Z A;  2ZVO A;  3DDC B;  3UIP B;  3KYC D;  3RI7 C;  1T3Q A;  5DPS A;  1K50 A;  5IP4 D;  2V3S A;  4DXF A;  2FAZ A;  2D5G A;  4OHJ A;  3JSV A;  1VZ7 A;  2NTT A;  5AUK A;  4ARC A;  4RM8 A;  2KNB A;  2GB1 A;  4LNF A;  3PLV A;  3AE5 B;  3VDZ A;  3HM3 A;  1T0Q C;  1JCK B;  1SE9 A;  4GDK A;  5G5H A;  1WIA A;  4GSW A;  4DK5 A;  2DBY A;  2KXJ A;  1YX6 B;  3QJZ A;  2DWQ A;  4KDL B;  2NR2 A;  4BOZ B;  2K6D B;  4MDK E;  1UGJ A;  3AN1 A;  1DGJ A;  1JML A;  3B9J A;  2N1V A;  1EF1 A;  4EZJ A;  2JRI B;  5AZF A;  3M95 A;  2RDG A;  1E7P B;  4NAW A;  2BTE A;  1P3Q U;  3AEB B;  4NJ7 A;  3DVN V;  1OTR B;  3W9C B;  2WX0 A;  2K3U A;  4A9A A;  1YJ1 A;  4ANV A;  2W3R A;  4PYZ A;  4MSQ B;  5BMG A;  2FCQ A;  1STE A;  3RUL A;  2IY0 B;  3BVM A;  3RNA C;  2IGD A;  2JXX A;  5D7G A;  3RPF C;  1UD7 A;  2WXP A;  2WXO A;  4WJN A;  2KWD A;  3R3M A;  2KDB A;  2MX2 A;  4LK0 M;  2BYF A;  1LO5 D;  3R66 C;  1NBF C;  1J0G A;  2MBH A;  2N0S B;  4WIP A;  3QC8 B;  3AUL A;  4AWJ A;  3AV8 A;  2I1J A;  5D2M B;  2IGH A;  4D2K A;  2I38 A;  1WZ3 A;  2QJL A;  2AQ3 B;  4FXC A;  3RT3 B;  4GXB A;  1I4R A;  2AL6 A;  2FCN A;  3PRE A;  2D3A A;  2WU5 B;  1JRP A;  2X8X X;  4MGK E;  2K25 A;  1QKZ A;  1ZDX A;  3L13 A;  1DOX A;  3MC0 B;  3UGB B; 
#chains in the Genus database with same CATH homology
 4KSL C;  3QCA A;  3L08 A;  4G3X B;  4FLH A;  2AEH A;  1WXA A;  3WAO A;  4CHK A;  4F8C B;  2L3Z A;  4GDL A;  4GOC A;  1S3S G;  2R2O A;  1CMX B;  1RLF A;  4W9H A;  3VUX A;  2M4N A;  5DPR A;  3ZRC A;  3V61 A;  4HVB A;  2PEA A;  2KFJ A;  3APC A;  5DCN A;  1JRU A;  3L0W B;  3OAW A;  1BT0 A;  3KUD B;  4MGI E;  1WE7 A;  3PZD A;  2GBM A;  2LGD A;  4W9C A;  5AEK B;  2KTF A;  5CHF A;  2CKH B;  1YD8 U;  1C3T A;  4IM3 A;  4BBN C;  4DHJ D;  3GOE A;  1E8W A;  2DAJ A;  3M63 B;  4WJQ A;  2XBB C;  5FR6 A;  1EF5 A;  1K8R B;  1WM2 A;  1GG3 A;  4TQ0 A;  1XD3 B;  2MBB B;  4K1R B;  2V1Y A;  4DXA B;  3A1Q B;  4J6I A;  3A4R A;  2GBJ A;  4K7U A;  4GIV A;  3WA0 A;  3PPA A;  3B08 A;  1P9D U;  2PE6 B;  3DVG X;  1LXD A;  2ZEQ A;  4DHZ B;  2LXA A;  3Q3J A;  4BFR A;  4E3C A;  5DPW A;  4BOS C;  3GZN I;  2N9P C;  1GUA B;  3NHE B;  2K39 A;  3LDZ E;  5AZH A;  5LXI B;  2MWS B;  3W1S A;  4GB9 A;  1OQY A;  1TTN A;  2Z0E B;  3QK0 A;  3PSE B;  2KHW B;  1E7V A;  2LGY A;  4HLE A;  3DBR I;  3UQB A;  3TIX A;  3T9L A;  2J0J A;  3NS8 A;  4EEW A;  1WX8 A;  2KC1 A;  4EUT A;  1OGW A;  2BPS A;  1UBI A;  2J0K A;  2ZCB A;  2XK5 A;  2MP2 B;  4EKU A;  2FNJ B;  4BKG A;  4XX5 A;  3VH3 B;  3A9K A;  4LDT B;  5G55 A;  2M0X A;  3MTN B;  3ZVV A;  2LRW A;  2JZ3 B;  3R7R A;  4KV2 A;  2K1F A;  3V60 A;  1OEY J;  1ZW7 A;  4HCP B;  3ZNG C;  3TL5 A;  3H9D A;  3JW0 X;  2KWU B;  3PGE A;  1EUV B;  1FXT B;  2O6V D;  1KLV A;  1YX5 B;  2KWC A;  2JF5 A;  4P7I A;  3DQV A;  2DZJ A;  2NPT B;  4ZRK A;  3Q3F A;  2RR9 A;  3PHW B;  1S1Q B;  4ASW C;  4FUL A;  3A1Q A;  1IYF A;  4M8N A;  3NZS A;  2BKF A;  3PS6 A;  2B3A A;  4G0N B;  3V62 A;  2UWQ A;  4WWP A;  2KZR A;  2KLC A;  5E6N A;  3AXC A;  2J0M A;  2KMC A;  4AUQ C;  1WXV A;  2EMS A;  1WJ6 A;  5KHQ A;  3VQI A;  4DWF A;  5TR5 A;  2ZCC A;  4II3 B;  1KOT A;  3ML8 A;  3PV1 A;  4JGH B;  2AYO B;  2KMA A;  3QWZ B;  4DHJ B;  2LJ5 A;  3A9J A;  2KX0 A;  3KW5 B;  1Q1O A;  4IC7 B;  4W9F A;  3WAN A;  4ICV A;  4X57 B;  1WM3 A;  2YLM A;  1Z2M A;  1Z5S B;  3B0A A;  4PYU A;  1WJU A;  3N30 A;  4HCN B;  3D32 A;  3RD2 A;  2L0T A;  1WX9 A;  4BBN F;  2MQJ A;  2C5L C;  4W9D A;  5GMV A;  4DHZ E;  4W9I A;  2KQ7 A;  2FUH B;  3OJ3 A;  5JHB A;  2D10 A;  2MP2 A;  2JUO A;  3KYD D;  3ZO5 B;  1TGZ B;  2BWF A;  3QHT A;  2CHZ A;  2L0F A;  1M94 A;  2KFK B;  4AJY B;  1J19 A;  4ICU A;  4MGY E;  4FA6 A;  4W9E A;  4EOY A;  2MW5 A;  3KUZ A;  1J8C A;  4NPN A;  2DYO A;  3ZIM A;  2IO3 B;  4PS8 A;  2DZI A;  2W9N A;  2KO3 A;  1QZE A;  2GMI C;  3RUI B;  3NY5 A;  3U7D A;  1OEY A;  1U4A A;  2KTR A;  3UF8 A;  4B95 A;  2D3G A;  3WAM A;  3IVF A;  4MM3 A;  3ZTD A;  4F1S A;  2ZPY A;  3ZKJ C;  3SU8 X;  2KKC A;  2NVU I;  3UIO B;  3ZDM C;  3LJ3 A;  2WX1 A;  4AP4 C;  4HDO A;  2M8S A;  1ZGU B;  2R2Q A;  4NNJ B;  1WX7 A;  4W9L A;  4DDG D;  1G6J A;  1L7Y A;  3ENE A;  5CX3 A;  2LVO A;  3V6E B;  2JRH A;  1WF9 A;  2M17 A;  3VAW A;  4IWQ A;  2BKR B;  2L76 A;  3VUW A;  3PT2 B;  5L95 C;  4MJS A;  3A4S C;  1YQB A;  1VD2 A;  3R7Q A;  2LWP A;  2DYB A;  2C7H A;  5C23 A;  3L16 A;  4G11 A;  4KSK C;  3WAP A;  1XQQ A;  3PRZ A;  4ZRJ A;  2OOB B;  3VTU A;  2JZZ A;  3ZNH B;  4A3P A;  4OVU A;  3NZU A;  1RRB A;  5AZG A;  3VTW A;  3ZRF A;  3UQA A;  1D3Z A;  3HK0 A;  2KDE B;  4I6P A;  3HM6 X;  2HE7 A;  2I1K A;  3DVG Y;  1KM7 A;  2O6V B;  3L17 A;  3VTV A;  3VXW A;  3SDL C;  2LGX A;  3TBL D;  2DYM A;  5E6P A;  2XK5 B;  4NY0 A;  2M1M A;  2FIF A;  1WY8 A;  3TJP A;  4E74 A;  3EFU A;  3TMP B;  1C1Y B;  1P0R A;  3W1S C;  3ZDT A;  2MA9 B;  2ZJD A;  2GOW A;  1UH6 A;  2EMT A;  2C60 A;  4OVV A;  1XT9 B;  2KAN A;  2MRP A;  2WDT B;  1V5O A;  3MJW A;  1E8Y A;  1TZ1 A;  4FJV B;  4MH0 E;  1WGR A;  4IW0 A;  4JLC A;  4HPM B;  4MEM A;  4CO7 A;  1H4R A;  3ZNZ B;  4IWO A;  3QIJ A;  3T8M A;  1WGH A;  2L05 A;  2RD0 A;  2L7R A;  3DBL I;  3VHT C;  3M62 B;  4GN1 A;  3ALB A;  4WWN A;  4IM2 A;  2C7N B;  3JSV B;  4JL9 A;  4ANU A;  5CTR C;  3EHV A;  2A5U A;  3NOB A;  4HWI B;  2FCS A;  2KN5 A;  4WJO A;  3IG3 A;  1LFD A;  1WYW B;  1NDD A;  2WWZ A;  2KD0 A;  1V81 A;  4LCD E;  2N7E A;  3ZLZ A;  1ZKH A;  1WFY A;  3A9K B;  2MCN B;  4TQ1 A;  4BKS A;  1R4N I;  2HD5 B;  3CST A;  3QAR A;  4LDT D;  3SD5 A;  2C7M B;  4WJP A;  5D94 A;  5D6J B;  2JPH A;  4NJ6 A;  4E71 A;  2O6V A;  2Y5B B;  3L54 A;  3QA8 A;  2NS5 A;  3PVL A;  3JVZ X;  4IM0 A;  2LD9 A;  4JQW C;  2KK8 A;  1VCB A;  1WE6 A;  3U8Z A;  2KJR A;  4EZK A;  4A20 A;  1WR6 E;  2YVC A;  4HK2 A;  1E90 A;  4LJO B;  1WXM A;  1WI0 A;  3VFK A;  2NPT A;  4HJK A;  3SHQ A;  2LVQ A;  2G3Q B;  2C9W B;  2PE9 A;  2OJR A;  2RPQ A;  3KH0 A;  1AAR A;  1RFA A;  1V9J A;  3HIZ A;  4HPL B;  3L10 B;  5HKH A;  2KLG A;  2K6Q A;  2BGF A;  2LUE A;  1GC7 A;  1A5R A;  2BWE S;  2ZNV C;  2CHX A;  2XEW A;  2VRR B;  2MSE D;  2JY6 A;  2WYQ A;  3ZTC A;  2KDF B;  4AJW A;  1WJN A;  3RCZ A;  4W9K A;  2LXC A;  3M3J A;  2KC2 A;  4N9F 4;  3DBS A;  2CR5 A;  2KOX A;  1SIF A;  2NBW B;  3OJ4 B;  4M0W B;  1I42 A;  4GGQ A;  5L83 A;  1UBQ A;  2HTH A;  3BY4 B;  5E6O A;  3AU5 A;  3CSF A;  1L2N A;  2LAS A;  4NQL B;  2JVC A;  1KJT A;  2NBV B;  2LVP A;  3I3T B;  4DBG A;  1ISN A;  4FJY A;  4EZL A;  5CHV C;  5G2N A;  3DOW A;  2LZ6 A;  2DX5 B;  4NQK E;  3H7S A;  3V6C B;  1Y8R C;  3A33 B;  1SGH A;  3VH4 B;  2L00 B;  4WWO A;  2REX A;  1WH3 A;  1RAX A;  2GBN A;  1LM8 B;  4MEL A;  2KVR A;  3KUC B;  4IWP A;  2IO2 B;  3IBE A;  3W1Y A;  5KHO A;  2Z59 B;  3ZUN A;  1P98 A;  3IHP C;  1YIW A;  2MBE A;  1HE8 A;  2KQS A;  3PLU A;  4GDK B;  3UIN B;  3VUY A;  5LXH A;  2GBK A;  2G4S A;  4TUU A;  2AWT A;  2DZM A;  2KJ6 A;  2KTR B;  2K8C A;  2NCN A;  3U30 A;  4A3O A;  3H7P B;  3ML9 A;  2JT4 B;  3EC8 A;  1V86 A;  1UEL A;  3H1U A;  2MBQ A;  2D07 B;  3VVW B;  2RGF A;  1WMH A;  4ANX A;  4AOF A;  2QHO A;  2KX3 A;  5J17 A;  1I35 A;  4YL8 A;  4FJZ A;  2ZZP B;  2A4Z A;  4BKS D;  2ZVO A;  3QAQ A;  3DDC B;  3N32 A;  3UIP B;  3KYC D;  1V5T A;  4HXD A;  2IZV B;  4MJS B;  4B6W A;  3DVN U;  2NBU A;  3WIM A;  4GU2 A;  5DPS A;  3CF6 E;  4KVG B;  4KIK B;  4FHJ A;  3EEC A;  2DZK A;  2MLB A;  2N4F A;  4LJP B;  4RMA A;  1GNU A;  1WXS A;  1WR1 A;  2V3S A;  2FAZ A;  3C0R B;  4TKN A;  4IG7 B;  2D2Q A;  4KZC A;  3JSV A;  3APF A;  2DHZ A;  3QQ8 B;  4DDI D;  2MBO A;  4CYE A;  1Q0W B;  2J7Q B;  3ZW3 A;  5JHA A;  4RM8 A;  2KNB A;  3PHX B;  3BIN A;  3PLV A;  1WRD B;  2GBR A;  3K9O B;  5IAA C;  3VDZ A;  3HM3 A;  3H6N A;  2G45 B;  4FAD A;  2KWV B;  4I6L B;  4WQO B;  5C1Z A;  1SE9 A;  4GDK A;  3PRP B;  2PJH A;  1V2Y A;  3S2A A;  4RM9 A;  4GDL B;  2KJH B;  1TBE A;  1WIA A;  1EO6 A;  3RYT A;  4GSW A;  4DK5 A;  2KXJ A;  4FBJ B;  3H7P A;  3HHM A;  1YX6 B;  3QJZ A;  2RSU A;  2CS4 A;  4KDL B;  2CU1 A;  1PQS A;  4F7Z A;  3WAL A;  2BYV E;  2NR2 A;  4BOZ B;  1WGG A;  1WGY A;  2K6D B;  3CMM B;  4MDK E;  1WZ0 A;  4XC2 A;  3KVF B;  3ONS A;  1WGD A;  1R4M I;  2N1V A;  2LRU A;  4NAW B;  4M8M A;  1UGM A;  1EF1 A;  2V4L A;  2CHW A;  1LQB A;  5CHW A;  3RZW C;  4EZJ A;  2JRI B;  5AZF A;  1T0Y A;  2N7D A;  3M95 A;  2IY1 B;  3QX1 A;  4MSM B;  4W9G A;  3RZF A;  5IA7 A;  1E8X A;  2FID A;  2LI5 A;  5DPT A;  3X23 A;  4FN2 A;  4KDI C;  2ZVN A;  4NAW A;  2IO0 B;  2G4D B;  1P3Q U;  1MG8 A;  4ZDV A;  5BO4 B;  1WJ4 A;  1IPG A;  2FCM A;  3AI5 A;  4HDQ A;  2BYE A;  4NJ7 A;  3DVN V;  1OTR B;  2IYD B;  5EDS A;  2WX0 A;  1GJZ A;  3TCA A;  2N9E B;  2O2V A;  2AL3 A;  1YJ1 A;  2IBI B;  4ANV A;  3AU4 A;  4PYZ A;  1E5W A;  5J18 A;  4MSQ B;  2FCQ A;  3RUL A;  2IY0 B;  1NI2 A;  3X0W A;  2JXX A;  3ECI A;  1IP9 A;  4K7S A;  2HJ8 A;  2K8B A;  3K9P B;  5D7G A;  1P1A A;  1UD7 A;  4W9J A;  3PRM B;  4WAA A;  3N3K B;  1V49 A;  3IFW B;  4WJN A;  2K8H A;  5JZE B;  2N1W A;  2N9X A;  3PTF C;  3R3M A;  4TV3 A;  4B9K A;  2ZNV B;  2KDB A;  4XZ4 A;  4ZYN A;  4BKT A;  1V80 A;  2MX2 A;  2PPH A;  2BYF A;  3APD A;  5JH5 C;  4KZ0 A;  1E7U A;  1NBF C;  2KFK A;  3R66 C;  1J0G A;  1WMH B;  2MBH A;  4G50 A;  4PS3 A;  4II2 B;  4FHK A;  1Q5W B;  1GC6 A;  2BF8 B;  3QC8 B;  3DPD A;  4IUM B;  3AUL A;  2EKE C;  3DCG A;  5LLI A;  2ZPN A;  4AWJ A;  2DEN B;  4ANW A;  4BVU C;  2I1J A;  4MGZ E;  4ZRI A;  1E8Z A;  5D2M B;  2ASQ A;  5J2R A;  2L8J A;  2IO1 B;  2Z0D B;  1X1M A;  4K81 A;  4KIK A;  1WZ3 A;  3O65 B;  4GMV A;  4I6N B;  3RT3 B;  4GXB A;  2D11 A;  3DBH I;  4JIO U;  4URK A;  2KDI A;  1V6E A;  2DAF A;  1UZX B;  2AL6 A;  2FCN A;  2O2V B;  3A9J B;  3JYU A;  3PRE A;  4K7W A;  4PS7 A;  3OLM D;  3ZNI D;  2UYZ B;  4EFO A;  2JWZ A;  3B1L X;  4MGK E;  2K25 A;  1H8C A;  1F9J A;  3P2B A;  3MHS D;  3L13 A;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...