1L2NA

Smt3 solution structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Solution structure of a yeast ubiquitin-like protein Smt3: the role of structurally less defined sequences in protein-protein recognitions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 8
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l2nA00
4MM3A 2M4NA 5C1ZA 4RMAA 2KDBA 3QARA 2ZCBA 2KC2A 3DQVA 3OAWA 4FHJA 1IPGA 3JYUA 1YX5B 5E6PA 1V81A 3A4SC 3A9JA 2MBQA 2LJ5A 2ZJDA 1JRUA 3DBRI 4HVBA 5J17A 4W9FA 2CS4A 2N4FA 1WXMA 2LI5A 2GBMA 2ZVOA 3PRPB 5CTRC 1NI2A 2KC1A 3H6NA 3T9LA 3AU5A 1WXAA 2O6VA 2L76A 1WI0A 3A1QB 2V4LA 4W9KA 2A4ZA 4DHZE 1OEYA 1YQBA 3CMMB 3Q3JA 4MSMB 3T8MA 1G6JA 1Q0WB 2IO0B 2MW5A 1WGHA 1WR1A 1SIFA 4ZRJA 2BWFA 1RFAA 2WWZA 1X1MA 3CF6E 3QK0A 4MH0E 3M63B 4HWIB 1ZW7A 1WJ4A 3NY5A 4FULA 3X0WA 3R7RA 2NPTA 1D3ZA 2GOWA 3PRMB 4AWJA 4URKA 2ZZPB 1V5TA 5HKHA 1H4RA 3SHQA 3VTVA 2O6VD 3C0RB 4KIKB 5JHBA 3DVNV 4HXDA 3L13A 3V60A 3SU8X 3ZRCA 1WF9A 2NVUI 3V6EB 3H7SA 3MHSD 2LGXA 4GIVA 2NS5A 2HD5B 1R4MI 2Z59B 2KWVB 3HHMA 4WAAA 1V86A 1WR6E 4BOZB 4ASWC 4DHJB 3PGEA 2V3SA 5AZHA 4MJSB 5TR5A 3VFKA 2N9XA 2Y5BB 2FUHB 2Z0DB 2LUEA 2LVPA 4NNJB 4XZ4A 2KJHB 4XC2A 4E3CA 1V49A 5CHVC 3QWZB 2CHXA 2C7HA 2L3ZA 2LXCA 3L17A 4WJOA 4ZRIA 2M0XA 2R2OA 3ZLZA 4BKGA 1P9DU 1P98A 2KK8A 1Q5WB 3PZDA 3MJWA 4WWPA 1IP9A 2ZNVB 2LRWA 1XT9B 3IHPC 3DBHI 1OTRB 3AU4A 1WZ0A 1CMXB 1F9JA 3KH0A 3ZNID 1ISNA 2IO3B 2N9EB 2JPHA 2YLMA 1WIAA 2IO1B 2PPHA 4FHKA 3UF8A 5JZEB 3PV1A 2C7NB 2LGDA 2DZMA 3AULA 3HIZA 4JQWC 5IAAC 4FA6A 4PS7A 4AJWA 3W1SC 1WX8A 2FIDA 1SGHA 4G50A 4KSKC 4X57B 4EKUA 3W1SA 4HDQA 3KYCD 5J18A 2ZPYA 3PRZA 2JUOA 2JZZA 1MG8A 1WM2A 1V5OA 2KHWB 2NBWB 2RSUA 3IBEA 1WRDB 4G11A 2QHOA 4TQ0A 2K8HA 2JF5A 2MLBA 4MSQB 3HK0A 1NDDA 3R66C 2JXXA 4GN1A 1E8WA 3UQAA 1E7VA 1WXSA 2BPSA 4CYEA 3M62B 4NPNA 4KDLB 4WJQA 3RUIB 2FCQA 2MSED 2J0KA 2IY1B 3EECA 2N7EA 1WYWB 1P0RA 3PTFC 3PS6A 5DPRA 1E90A 2JT4B 3DVGX 3V61A 3CSFA 4OVVA 2MA9B 3UIPB 3TIXA 3RYTA 1WE6A 2KOXA 4EUTA 2KTRA 2DHZA 4A3OA 2KZRA 3PSEB 4ZRKA 3ZUNA 1EUVB 3B0AA 4K7UA 4MGZE 4NQLB 4TQ1A 4FBJB 5DPWA 1GJZA 2AEHA 2J0MA 2J7QB 2G3QB 4BFRA 1E8YA 2AWTA 2N7DA 2K25A 4AP4C 2KD0A 4M8NA 3QCAA 1WZ3A 1EF1A 2N1VA 2KJRA 4FJYA 3RT3B 2KX3A 2ZCCA 4LJOB 2D11A 2IZVB 3ENEA 4DXAB 4ZDVA 3QJZA 2D07B 3TL5A 4MEMA 2M8SA 2WDTB 3U30A 4IC7B 4HLEA 1J0GA 1WJUA 2KDFB 5D7GA 3SDLC 4AJYB 3QHTA 4W9EA 2MBHA 5G55A 1I35A 4WQOB 1LM8B 2IYDB 3UIOB 3VUXA 2GMIC 3B08A 1TZ1A 5D2MB 2MCNB 4I6LB 1WMHB 2FNJB 3H9DA 4BKTA 4DK5A 2C5LC 4BKSD 2B3AA 2EMTA 2MBBB 3V6CB 5D6JB 2DYMA 1WGYA 2L7RA 1FXTB 2ASQA 3BY4B 3DCGA 4FLHA 2KLGA 2L8JA 1HE8A 4WWOA 1E8ZA 2DENB 3VUYA 4G0NB 2KFKB 4PS3A 4K81A 2KO3A 1EF5A 1Z2MA 1WGRA 3KUDB 4W9LA 3KUZA 3DPDA 5IA7A 2W9NA 2KDEB 3VTUA 4B6WA 3DVGY 2M1MA 4NJ7A 1WGDA 3GZNI 4ANXA 5L83A 4NAWA 5J2RA 4IM2A 3NZUA 4A20A 2JRHA 2UYZB 2KQSA 2JY6A 2GBKA 2XK5B 3NOBA 5AZFA 2I1JA 2VRRB 3K9PB 3N32A 4ZYNA 3KUCB 2DZJA 3AI5A 2K8CA 3D32A 3ZRFA 4IWPA 1WFYA 2OJRA 3VUWA 3TMPB 3ZNZB 1RRBA 3NS8A 3HM3A 5GMVA 3GOEA 4FN2A 4II2B 2BKFA 2EMSA 3AXCA 4W9GA 1OQYA 3PHWB 1E7UA 2BKRB 3ZNHB 3PPAA 4E71A 4HDOA 3ML8A 3A9JB 1WXVA 2K39A 3U7DA 4GDKA 2MQJA 3WAMA 1UBIA 2O2VA 1YD8U 4NY0A 4LDTD 4ANVA 2JZ3B 1V80A 2MBEA 3ZTCA 3R3MA 5LLIA 2O6VB 4KZCA 3ZO5B 4PYZA 3H7PA 4M8MA 3PREA 3QIJA 2LVQA 3ZNGC 2KANA 1AARA 2LXAA 5E6NA 2UWQA 2BGFA 3M95A 2HE7A 2KN5A 3I3TB 3VH4B 2L0FA 1LQBA 1YIWA 2FCNA 3X23A 4MGKE 4B9KA 2I1KA 2IBIB 3A9KA 2G45B 3RCZA 5JH5C 4TUUA 2K6QA 2NPTB 3DBLI 5LXIB 3WIMA 1E8XA 2KFJA 1TTNA 4IWQA 2KMAA 4ANUA 3PLUA 2OOBB 2ZPNA 2KVRA 4K7WA 5L95C 4FJVB 2KX0A 3ONSA 3KYDD 4MGIE 4HPMB 2JVCA 3ZKJC 1C3TA 2Z0EB 1KM7A 3JW0X 3RULA 2DX5B 2CU1A 5CHFA 4MELA 4E74A 2J0JA 2RGFA 3QAQA 4W9IA 5DPTA 3QX1A 1RAXA 2AYOB 3IG3A 4DDID 4FADA 4EZLA 2C9WB 2V1YA 3UGBB 1KJTA 3WAOA 2KXJA 1EO6A 1YJ1A 2D10A 3K9OB 5D94A 2MBOA 3DOWA 3VH3B 1IYFA 1ZGUB 2MP2A 1QZEA 2C7MB 2HJ8A 2IO2B 4HJKA 2L05A 4KIKA 3TJPA 4ANWA 4KVGB 3V62A 2RD0A 5DPSA 3ML9A 4DWFA 4GXBA 3S2AA 5LXHA 4DDGD 3H1UA 2D3GA 2FIFA 1GNUA 2NBVB 2KWCA 5CX3A 3PHXB 3PLVA 4IW0A 3W1YA 4BKSA 3ZDTA 4GDLA 4MJSA 2JWZA 3DDCB 2RR9A 3H7PB 4GMVA 4TKNA 3VVWB 4BBNF 2DZKA 3ALBA 2WX1A 3VAWA 1WX9A 3QC8B 2ZNVC 2WYQA 1YX6B 1T0YA 1GC6A 1V9JA 2BF8B 2MX2A 5FR6A 3TCAA 2LZ6A 1E5WA 1M94A 1S1QB 3A9KB 3PVLA 2BYVE 4CO7A 1XQQA 5E6OA 2CHZA 4EOYA 2PE6B 2RPQA 4DHJD 4AUQC 3LDZE 1GG3A 3N30A 4HCNB 4BBNC 2XEWA 1A5RA 1TBEA 1L2NA 4I6PA 2LRUA 4F1SA 2PEAA 2LWPA 3N3KB 3PT2B 3VHTC 4BVUC 4P7IA 4DBGA 3UINB 2MRPA 1WM3A 2HTHA 1UD7A 4HK2A 3APCA 3BINA 1VD2A 2DZIA 1KLVA 4FJZA 1SE9A 3KW5B 4W9HA 2MWSB 1C1YB 3L10B 3IVFA 4A3PA 2N1WA 2EKEC 4AOFA 2KTRB 1ZKHA 2L0TA 2R2QA 3WAPA 1Y8RC 3O65B 3ZW3A 2PJHA 4RM9A 1V2YA 2K1FA 3WA0A 1LFDA 2MP2B 1GC7A 2KKCA 4W9CA 4WJPA 2FCSA 4M0WB 2XBBC 3P2BA 1K8RB 2BYEA 4W9DA 4EEWA 4I6NB 5AEKB 1P3QU 1R4NI 1V6EA 4IWOA 3A4RA 3OLMD 3ZIMA 4CHKA 1GUAB 4ICUA 3VXWA 1BT0A 2LGYA 3VQIA 3APDA 3JSVA 2LASA 2KDIA 4GDLB 4JLCA 2CKHB 1WH3A 2DYOA 4MGYE 5CHWA 1WY8A 5DCNA 5BO4B 4KZ0A 2KWUB 2BYFA 1WE7A 2REXA 3U8ZA 2L00B 4HPLB 2GBJA 4GGQA 2AL3A 4II3B 2DYBA 3WALA 1S3SG 1TGZB 1VCBA 2KLCA 3DVNU 1WX7A 4ICVA 4IM3A 4JGHB 4WJNA 1PQSA 2FCMA 4GU2A 2JRIB 4BOSC 3WANA 2KQ7A 5AZGA 4DHZB 4OVUA 3L16A 2A5UA 3Q3FA 3RZWC 2G4DB 3ZTDA 4TV3A 2GBRA 4F7ZA 1WGGA 4LJPB 3DBSA 3EFUA 1OEYJ 4XX5A 4IG7B 2YVCA 3HM6X 4K1RB 4EZJA 4F8CB 3B1LX 5EDSA 1UH6A 4MDKE 2K6DB 2DAJA 3QA8A 4N9F4 1J8CA 2K8BA 3KVFB 3L54A 4GOCA 3A1QA 2NBUA 1U4AA 4G3XB 4IUMB 3LJ3A 2GBNA 3APFA 3SD5A 3VTWA 1RLFA 1J19A 1UELA 2C60A 2IY0B 1KOTA 2ZVNA 3RZFA 1UBQA 2KMCA 4RM8A 3QQ8B 3OJ4B 3TBLD 3VDZA 2CR5A 1NBFC 1LXDA 4KSLC 3ZVVA 4NJ6A 5KHOA 1WJNA 1Q1OA 1XD3B 3JVZX 3ECIA 1WMHA 4PS8A 4NAWB 2LD9A 3EHVA 2CHWA 1WJ6A 3M3JA 4LDTB 4EFOA 4J6IA 3A33B 1UZXB 2AL6A 2KTFA 2NR2A 4K7SA 4PYUA 3RD2A 2DAFA 2FAZA 2M17A 4KV2A 1P1AA 2KJ6A 4KDIC 4IM0A 5JHAA 1I42A 2ZEQA 3NHEB 2D2QA 1L7YA 2KNBA 3OJ3A 3UQBA 4JL9A 2N9PC 2WX0A 2KFKA 5C23A 1UGMA 2NCNA 4EZKA 4HCPB 4YL8A 3MTNB 4JIOU 1H8CA 3NZSA 2BWES 2LVOA 2PE9A 3CSTA 4GDKB 4LCDE 5G2NA 5KHQA 4B95A 3JSVB 2O2VB 3IFWB 3L08A 4NQKE 3ZDMC 3R7QA 4WWNA 4GB9A 3L0WB 2XK5A 1Z5SB 1OGWA 4W9JA 3EC8A 4GSWA 2G4SA
chains in the Genus database with same CATH superfamily
2N9LA 2ZCBA 3DQVA 3RFZB 1V8CA 2K0PA 2AQ3B 3JYUA 3TEZA 5E6PA 3A4SC 2MBQA 2LJ5A 1YQ3B 2ZJDA 1JRUA 3DBRI 1LGRA 1WXMA 3T9LA 2KC1A 3H6NA 1XLNA 2X38A 2L76A 2V4LA 2A4ZA 3Q8CA 3T8MA 1G6JA 1WR1A 1SIFA 2BWFA 1X1MA 3Q3NC 3BYTB 1ZW7A 3X0WA 2GOWA 4AWJA 2AQ2B 3ZJTA 3VTVA 4KIKB 4HXDA 4P1BC 2CJOA 2NVUI 3V6EB 4OZBA 3MHSD 2I2YA 2LGXA 4WAAA 1GAQB 1SSNA 1WR6E 4BOZB 4ASWC 5G5GA 4JWSC 4RGTA 4NNJB 5CHVC 3HVDA 2C7HA 4ZRIA 3ZLZA 2V3PA 2KK8A 1FM0D 2QSDA 2LRWA 1XT9B 1WZ0A 1T5XD 2PPHA 3PV1A 2C7NB 2LGDA 2DBYA 2QMTA 3HIZA 4JQWC 3Q14C 4PS7A 4AJWA 1BXTA 1EM7A 4X57B 1FFVA 3AH7A 2LMCA 2JZZA 1MG8A 1WM2A 1ZXHA 4ARIA 3L4PA 1IBXB 1WRDB 3EFCA 3KWVA 3HK0A 4YTPB 1TKYA 3C19A 4NPNA 1EU4A 2MSED 2N7EA 1WYWB 1P0RA 1QQRA 3V61A 3CSFA 2L32A 2EKIA 4OHJA 4XYCA 4UDUC 1EUVB 2WXPA 3B0AA 3RNFC 5DPWA 4JE3B 2G3QB 3IXSA 2K25A 4M8NA 2KMMA 1STEA 1Q10A 1LO5D 4LJOB 4DXAB 1VJKA 4ZDVA 3QJZA 3TL5A 3R8BA 3OWEB 4C00A 2M8SA 3U30A 1NI3A 1VZ6A 1FPYA 5D7GA 2J52A 1I35A 5G55A 2MBHA 1N63A 1LM8B 3UIOB 1TZ1A 5D2MB 1WMHB 2L83A 3H9DA 4EE2A 1SB3C 5BYQA 4BKSD 3ZNID 2L7RA 2ASQA 4FLHA 1HE8A 3AEDB 2VZKD 1E8ZA 3VUYA 2CJNA 4K81A 1QILA 4RH6A 3FC4A 3DPDA 1WYGA 2W9NA 3VTUA 4NJ7A 2WXLA 3CWIA 4NAWA 3WCQA 3NZUA 2UYZB 3VR8B 3K9PB 3AI5A 2WXRA 2K8CA 1I4RA 4IWPA 2DLBA 2OJRA 3TMPB 4JWUC 1RRBA 2D3BA 3HM3A 4FN2A 2BKFA 1E7UA 3N1YC 3PPAA 4HDOA 3ML8A 5TSSA 4WURA 2FBWB 1FO4A 3DHIC 4NY0A 2QILA 3I63C 4NAMA 3ZTCA 2MHJA 4KZCA 1VDVA 2LVQA 2KANA 2LXAA 5E6NA 1FFUA 3M95A 3BK1A 3AV8A 2I1KA 2W82A 3RCZA 3PZ7A 2K6QA 5LXIB 2KFJA 2D5GA 4IWQA 3PLUA 4YWGG 3ONSA 4MT5A 5HG2A 2EELA 3SEBA 1TYGB 3ZKJC 2Z0EB 1KM7A 2DX5B 2M19A 2SAKA 3RN9C 4W9IA 3QX1A 1HZ5A 4FADA 4EZLA 2V1YA 3RMKC 2BTEA 3VH3B 1IYFA 4HPPA 4HRSA 1QZEA 4P1CC 2WXJA 2L05A 4ANWA 1FXIA 1VZ7A 5E6JA 5DPSA 5HFYA 4GXBA 4DDGD 2KWCA 5CX3A 2KAJA 3ZDTA 4RCOA 3P4PB 5JXVA 2BBCA 2RR9A 5H8YE 4GMVA 2WX1A 1UWXA 1WX9A 3NJTA 1GOZA 3QC8B 1T0YA 4LK0M 2BF8B 5FR6A 3TCAA 5BMIA 2LZ6A 1M94A 1VR9A 1L0VB 3PVLA 1C9FA 4CO7A 1XQQA 2CHZA 4EOYA 2QDFA 2RPQA 4H2AA 4DHJD 3N30A 1A5RA 1TBEA 5G5HA 4I6PA 1JWMD 3DHHC 2LWPA 4KGTA 4BVUC 2HTHA 3AE9B 3BINA 2DZIA 2KYWA 4XWTA 3IT6B 1C1YB 2INDC 3MP9A 3IVFA 4A3PA 1UF0A 2EKEC 1E6EB 2L0TA 4IDIA 1R7SA 3AM9A 1V2YA 2K1FA 1GC7A 4W9CA 4M0WB 2XBBC 3ABVB 2Q5WD 2V4IB 2AX5A 3OLMD 4CHKA 4ARCA 1SJED 2KQ4X 4ICUA 2LASA 5CHWA 2BYTA 2REXA 3U8ZA 1KRHA 1TGZB 1VCBA 2WXIA 4ICVA 1PQSA 3BVGA 4KKIA 3B2GA 2INCC 5AZGA 3L16A 2A5UA 3Q3FA 3RZWC 4USAA 2YVCA 4K1RB 5EDSA 1UH6A 2K6DB 1R4MB 3L54A 4G3XB 3VTWA 1DOIA 1K52A 1RLFA 2C60A 2IY0B 4PK1A 1KOTA 3RZFA 1UBQA 2KMCA 4S0RA 4MACA 2B76B 3Q8AA 3ECIA 3MHZA 1JROA 3M3JA 4EFOA 4KGSA 2W3SA 3RD2A 2M17A 4KV2A 1FRDA 4KDIC 1I42A 2D2QA 2QIEB 5C23A 1UGMA 4HCPB 4YSYB 1TT5B 1UUPA 5KHQA 4B95A 1FRRA 1T3QA 3IFWB 1FEHA 4NQKE 4WWNA 1FIQA 3EC8A 3DWGC 2G4SA 4MM3A 1WXQA 3QARA 3OAWA 3ZYYX 1JCKB 3A9JA 1VZ8A 4HVBA 2BB6A 2GBMA 2ZVOA 2W54A 5EE1A 1WXAA 2O6VA 1WI0A 1EWCA 3NVZA 1KTKA 2WU5B 4DHZE 4LNIA 2KACA 2MW5A 1WGHA 4ZRJA 2JSVX 2NMQA 2WWZA 4MH0E 3NY5A 1C4PA 3R7RA 1SE2A 1D3ZA 4YSXB 5HKHA 1H4RA 4RF0A 3DBRB 2O6VD 3C0RB 3DVNV 5HI1A 3ZRCA 2NS5A 4LNFA 1R4MI 2Z59B 2ICIA 3HHMA 1V86A 1JW9D 2V9HA 4MJSB 3VFKA 2N9XA 2Y5BB 1MG4A 4XC2A 2CHXA 4WJOA 4MM3B 2M0XA 2XNAC 4HROA 1P98A 1JWAD 2ZNVB 1JRPA 3HVZA 1NEKB 1OTRB 3AU4A 1FCLA 3AE8B 1PDXA 2JPHA 1C4CA 3UF8A 2BS3B 2DZMA 5IAAC 4FA6A 2OHFA 1WX8A 2FIDA 2WGSA 4EKUA 4HDQA 3KYCD 4JX1C 1E10A 5IKCM 2WXNA 1TJEA 2KHWB 2JU6X 4MH8A 3IBEA 4XE0A 2QHOA 2SEBD 2MLBA 1NENB 4Q2JA 2JXXA 2MEKA 1E8WA 4GN1A 1E7VA 2JQRB 1WXSA 4KDLB 4WJQA 3RUIB 3UI3A 1RFKA 3PS6A 5DPRA 3I9V1 5H92C 2JX5A 3VRBB 3KQ4A 3N1XC 4EUTA 2KTRA 2KZRA 3ZUNA 3E56A 1P7EA 4K7UA 4MGZE 4PT5A 4LLGM 2AEHA 2J0MA 4BFRA 3AEGB 3PZ8A 4ACFA 3DWMA 5D3DA 2Z8LA 1XLPA 3BK2A 3RT3B 2CU3A 3W9CB 2PKOA 4YSZB 2IZVB 1GB1A 1PGAA 4MEMA 1NYQA 4W9EA 4WQOB 1N62A 3RNCC 3B08A 1V1PA 5BMGA 3LXFA 4BKTA 2FNJB 1PUTA 3U4EG 3RI7C 2C5LC 3AEAB 2B3AA 3V6CB 2DYMA 1WGYA 3BY4B 4YTNB 1OFFA 2L8JA 1F2RI 4L23A 1HQRD 5IP4D 1YOVB 1K50A 1B9RA 4B6WA 1SJHD 3DVGY 1PYWD 4OVZA 2JYEA 1SXTA 5HHDG 5J2RA 2WXFA 3NZ3A 2JRHA 2XK5B 3NOBA 2I1JA 1OQRA 3KUCB 3D32A 3NS8A 1L0YB 4II2B 2EMSA 3ZNHB 3U7DA 2PVOD 4GDKA 1UBIA 1YD8U 4LDTD 2HTME 2J42A 4ANVA 1GB4A 1N5WA 3MC0B 3ZGZA 4PYZA 4M8MA 1M4VA 1JQ4A 4BAXA 2LHDA 2UWQA 2INNE 2FE8A 3VH4B 1LQBA 1TY0A 2FCNA 1DOXA 1KH0A 1QOGA 2PLPA 3Q8EA 2IBIB 4B9KA 4TUUA 1B1ZA 3P1MA 1FMAD 2IPKD 4DQOC 2LGSA 1JWUD 2KVRA 4K7WA 5L95C 2KX0A 1D5ZC 4MGIE 4HPMB 1C3TA 1T6BX 3JW0X 4JPSA 4M01A 2JXTA 1ZE3D 5DPTA 3Q2AC 1RAXA 2AYOB 3IG3A 2LFIA 4C56C 4C4VA 2KXJA 3K9OB 2MBOA 3DOWA 2OJWA 2MP2A 1AN8A 2IDYA 3V62A 3S2AA 5LXHA 3EUB2 2I38A 2D3GA 2FIFA 1GNUA 3PHXB 3W1YA 4WQMA 4BKSA 4BBNF 2DZKA 2VH1A 2WYQA 3RNAC 3J9CA 1YN4A 1V9JA 1J7CA 1E5WA 2OEDA 5E6OA 5EE9A 3TEYA 2LGIA 3LDZE 4HCNB 4BBNC 1D5XC 3AE5B 1DGJA 3N3KB 3VHTC 4DBGA 3UINB 4US8A 3I5JC 4W9HA 4R3DA 1AWDA 2GB1A 1MI0A 3MC9A 1ZKHA 3WAPA 1Y8RC 2MP2B 2KKCA 3N1ZC 2FCSA 3P2BA 1K8RB 4I6NB 1V6EA 1WGKA 2BW2A 3W5UB 1ACCA 1GUAB 2ON8A 1BT0A 2LGYA 4ZRQA 4MGYE 1WH3A 5DCNA 5BO4B 2RDBC 2BYFA 1MPEA 2L00B 4N58A 2GBJA 4HKZE 4ZHOA 2ZW1A 4A90A 4II3B 3WALA 2KLCA 3DVNU 1SIJA 1TS4A 4JGHB 2QEJC 3VR9B 2G4DB 4TV3A 3DBSA 3EFUA 3RNGC 3P63A 1T0SC 4IG7B 3HM6X 2GLSA 3GS2A 4MDKE 3QA8A 2DAJA 2K8BA 4GOCA 3A1QA 1L6VA 4TMAB 4RM8A 3MC8A 3QQ8B 4K3BA 1NBFC 3U52E 4NAWB 2LD9A 3A33B 1UZXB 4K7SA 2KTFA 2NR2A 5AUIA 1ZDVA 2DAFA 2FAZA 4KGRA 1P1AA 1N6ZA 2NTTA 5FR3A 3AMZA 5JHAA 3NHEB 3NRZA 1L7YA 3OJ3A 3UQBA 2N9PC 4A55A 2KFKA 1MHXA 3MTNB 2LUMA 4JIOU 1E0ZA 1H8CA 4HKQA 1KFYB 2PE9A 2LVOA 1IGCA 3CSTA 4LCDE 3VRAB 1C78A 1Z5SB 2WXQA 3MJWA 4GSWA 4HEA1 2LEKA 2M4NA 2E3TA 2KC2A 1TS5A 4FHJA 1IPGA 3AE1B 1V81A 2GRIA 3AE4B 2CS4A 2MH7A 2LI5A 5CTRC 1NVID 3A1QB 5BYRA 4W9KA 5AUKA 4MSMB 2IO0B 2ZW0A 1NYRA 1RFAA 3BVMA 3CF6E 1SF0A 4HWIB 1WJ4A 2NPTA 1I7HA 3PRMB 4URKA 1BMLC 3SHQA 2WDVB 1C79A 3BVZA 3L13A 3V60A 3SU8X 3H7SA 1Y56A 3BIID 2K9XA 4DHJB 4RGOS 3PGEA 2V3SA 5AZHA 4XZ4A 2FUHB 4YT0B 2LVPA 4E3CA 2L3ZA 3L17A 2R2OA 2RDHA 1C76A 1Q5WB 1YN5A 1ZOYB 3PZDA 4WWPA 1IP9A 1F77A 1A70A 1BUIC 1D4BA 4P6VF 2AQ1B 3P4RB 1OQQA 3KH0A 1GPXA 3NVWA 2N9EB 4FHKA 3GZNB 1MJDA 3O13A 3W1SC 4XGAB 4KSKC 1I4QA 3FKYA 2HJ1A 5J18A 3PRZA 4QAYA 1RYJA 3AE7B 1UWMA 2IGDA 4TQ0A 2K8HA 1XLQA 2WLBA 4MSQB 3NVYA 3R66C 1AW7A 3TEXA 4US9A 2J0KA 3PTFC 2Y5CA 2KVZA 2JT4B 3DVGX 2JWUA 3V05A 3TIXA 1C77A 3RYTA 2KOXA 4A3OA 3DHGC 3PSEB 1VLBA 5FKAC 4TQ1A 2AWTA 2KD0A 4FXCA 4L1BA 2N1VA 4L2YA 4RGMA 2G1EA 3ENEA 4A6QA 1TIFA 2WDTB 3V3XA 4WIPA 1J0GA 1WJUA 3SDLC 3QHTA 2H89B 3VUXA 3HRDD 3AB5A 4RNAA 1CK1A 2MJ3A 2MCNB 4DK5A 4OZCA 5D6JB 3DCGA 1FXTB 2KLGA 3OG5A 3KLSX 2DENB 1ROEA 4PS3A 4O1NA 2Y5PA 3RNEC 1Z2MA 1WGRA 4ZRPA 2ONQA 3Q6BA 4WWMA 1IUEA 2KDEB 2M1MA 3GZNI 1N60A 2PTLA 4ZYSA 1XF5L 2KN4A 3ZXVA 4A20A 2M0AA 2KQSA 2JY6A 2GBKA 1KF6B 2YEPB 4ZYNA 3VUWA 3ZNZB 5GMVA 3GOEA 2D3AA 4LNKA 3AXCA 3ZJUA 1TS3A 1WXVA 3A9JB 3NVVA 2BS4B 2O2VA 3AN1A 2JZ3B 3PO0A 5LLIA 2O6VB 3ZO5B 3PREA 2KDMA 1HZ6A 3QIJA 4J3OD 5EE0A 4OZAA 4LTUA 3URYA 2N0SB 1ET9A 3I3TB 4M02A 4A8XC 2L0FA 4IKGA 3FILA 2QCZA 3HUIA 4MGKE 2E6XA 3A9KA 1YN3A 3Q3OC 1ET6A 1JMLA 1R4NB 3Q8FA 3BYYB 3MFGA 2M56B 3WIMA 4N6EB 1TTNA 2WXOA 4ANUA 2KMAA 1CZPA 2YEPF 3KYDD 4RFBA 1K53A 4MELA 2J0JA 2RGFA 2K22A 3QAQA 2C9WB 1KJTA 1TKGA 3P4QB 1EO6A 4WH4A 2D10A 5D94A 4RF1A 1ZGUB 4C7YA 4KIKA 5BMHA 4KVGB 1ZXIA 1YNTE 2R61A 3AECB 2RD0A 2J53A 3ML9A 4AQ7A 2BS2B 2PVGC 3H1UA 4A9AA 2NBVB 4IOIE 4IW0A 1QF6A 5EE3A 1JALA 4GDLA 4WAFA 2KT7A 2JWZA 4TKNA 1MVKA 3ALBA 3TUOA 2WXHA 2ZNVC 2L1AA 3FILB 2MJEA 1F2RC 1GC6A 1S1QB 3A9KB 1ESFA 1L5PA 2WDQB 4ZOHC 4AUQC 2XEWA 1QOBA 2QJLA 2LRUA 4F1SA 2PEAA 3IAS1 1WM3A 1QOFA 4HK2A 3APCA 4S17A 1KLVA 1SE9A 3KW5B 5C2TB 1IBXA 3L10B 2RDGA 4AOFA 2KTRB 3AE2B 3ZW3A 3O65B 2PJHA 4RM9A 1KLUD 3NG0A 4W9DA 5AEKB 1P3QU 1R4NI 3A4RA 2L52A 3AEEB 1RM6C 1RWSA 3ZIMA 5IN7A 3VXWA 3VQIA 3JSVA 4GDLB 2KDIA 2VH2A 3ZQ4A 2DYOA 1WY8A 2K5PA 3T3NA 4HPLB 4GGQA 2AL3A 1S3SG 1VRAB 4TSSA 2PW9A 4WJNA 2FCMA 1V1PB 4GU2A 2JRIB 4BOSC 1MHHE 4OVUA 4GLSC 2X8XX 1DYQA 2GBRA 4LJPB 1OEYJ 4XX5A 4F8CB 3B1LX 2NBUA 4IUMB 1HTQA 1J19A 1UELA 3E9SA 1EU3A 1YMHE 3OJ4B 3VDZA 1QT9A 4BZAA 1LXDA 4NJ6A 1WJNA 3JVZX 1WMHA 4PS8A 4LDTB 2CHWA 4P16A 4J6IA 2MJDA 4PYUA 2KJ6A 3DBHB 1WWTA 1YJJA 2ZEQA 4ITKA 2RPVA 1XEEA 4JL9A 4EZKA 1N5XA 3I57A 4YL8A 4AS1A 3RNBC 3IAM1 3NZSA 2BWES 3Q8BA 4GDKB 5G2NA 3GP7A 3JSVB 3ZDMC 3R7QA 1XLOA 3L0WB 1QLBB 1OGWA 4W9JA 4KKJA 5C1ZA 4RMAA 2KDBA 3AEBB 3N9YC 1SE4A 1YX5B 3T3OA 5J17A 4W9FA 2N4FA 1TKEA 3PRPB 1NI2A 3AU5A 2WU2B 2N9KA 2PMVA 1OEYA 1JWBD 1YQBA 3CMMB 3Q3JA 3KWLA 1Q0WB 2WXGA 3R2TA 5FK9C 3QK0A 3M63B 5T8IA 4FULA 4C4VB 3Q69A 2ZZPB 1V5TA 2J4XA 1L4ZB 2UU7A 5JHBA 1HEZE 5MPOA 1WF9A 3H8HA 4GIVA 3U2SC 2HD5B 2KWVB 5I4DA 5TR5A 2Z0DB 1D6EC 2LUEA 1FXAA 2KJHB 2VZKB 1V49A 2IJ0A 3QWZB 2LXCA 4BKGA 1F1HA 1P9DU 1AYFA 1V97A 3FAHA 2BT6A 3IHPC 3DBHI 4C80A 1FNVA 1CMXB 1F9JA 1L0XB 3P42A 2IGHA 1ISNA 2IO3B 2YLMA 1WIAA 1ENFA 2IO1B 5JZEB 3BWUD 3AULA 2TSSA 1XCTL 1SGHA 4G50A 3W1SA 2INPE 3U7ZA 1I4PA 2ZPYA 2JUOA 1V5OA 5C3JB 2NBWB 2RSUA 2PIAA 1TS2A 4G11A 4REZA 2JF5A 1XXGA 1NDDA 1KLGD 1XO3A 3BZDB 3UQAA 2BPSA 4CYEA 3M62B 2FCQA 1PFDA 2IY1B 3EECA 1ZP0B 1P7FA 1E90A 1UGJA 3W5VB 4OVVA 1I4HA 2JYTA 3P4SB 2MA9B 3UIPB 1ZPSA 2WDRB 1I4GA 1WE6A 1ZDXA 4M00A 2XN9C 2DHZA 4ZRKA 1DOYA 4NQLB 4FBJB 1CJEA 1GJZA 1FNWA 2J7QB 4M0WA 1E8YA 2N7DA 1WSPA 3DBLB 4XDDA 4AP4C 3N20C 3QCAA 1SEBD 1WZ3A 1EF1A 2W3RA 4LNOA 1I4XA 2KJRA 4FJYA 2KX3A 1J7BA 2ZCCA 2D11A 2D07B 2FUG1 4IC7B 4HLEA 2KDFB 4AJYB 2IYDB 1J7AA 3SFDB 2GMIC 1CQVA 4I6LB 1PGXA 2EMTA 2MBBB 4WWOA 2N7JA 4HJGE 2GI9A 3B9JA 4G0NB 2KFKB 2KO3A 3LYYA 1EF5A 3KUDB 4W9LA 3KUZA 5IA7A 1JWSD 1WGDA 4ANXA 2RMMA 5L83A 4LNNA 1WRIA 4IM2A 1IGDA 5AZFA 2VRRB 3N32A 1TZOA 2DZJA 3ZRFA 1WFYA 1QKZA 3ZJVA 1SBBB 2K3UA 4W9GA 1OQYA 3PHWB 5LNK1 2BKRB 4D2KA 4E71A 4NZLB 2K39A 3SR6A 2WHIA 2MQJA 2WXMA 3WAMA 1E7PB 3CIRB 2MBEA 1V80A 3R3MA 3H7PA 2LHEA 4N59A 2BB5A 2D3CA 3ZNGC 4DXFA 1AARA 3R2IA 2BGFA 1YQ4B 2HE7A 2DWQA 2KN5A 4B0EA 1YIWA 3X23A 2WP9B 2G9HD 1HTOA 2KWDA 2G45B 2IGGA 5JH5C 2NPTB 3DBLI 1E9MA 1E8XA 5GXGB 3RPFC 2OOBB 2ZPNA 3EA6A 4DXGA 4FJVB 2BVCA 2WNMA 2JVCA 5IOIA 1FNUA 3RULA 2CU1A 5CHFA 4E74A 1FD6A 3ZXRA 3Q3MC 4RGNA 1V1OA 4DDID 3SFEB 1ZUD2 3UGBB 3WAOA 1YJ1A 2H88B 3B2FA 2C7MB 2HJ8A 3EGRA 2IO2B 3NUHB 2V0GA 4HJKA 1N61A 3TJPA 4B0MA 4DWFA 3PLVA 2ACZB 3NS1A 4MJSA 4KX6B 3DDCB 3H7PB 3VVWB 3AE3B 3W2DA 5D3IB 2DNFA 4XDCA 3IT4B 3VAWA 4XWWA 1YX6B 1YJIA 4C7ZA 2MX2A 1TY2A 1HXYD 2BYVE 2PE6B 1QOAA 1PGBA 1D5MC 1GG3A 1L2NA 3PT2B 3LB8C 3AE6B 4P7IA 3ETRA 2MRPA 4YTMB 1UD7A 1VD2A 2W55A 4FJZA 2MWSB 2LJIA 4K3CA 2N1WA 2R2QA 4YXDB 3WA0A 1LFDA 3TEWA 4WJPA 2BYEA 3TSSA 4EEWA 1F52A 1MFWA 2NTSA 4IWOA 1XCQL 3GE8C 1L6UA 3APDA 4JLCA 3AEFB 2CKHB 1T0RC 1F0ZA 4KZ0A 2KWUB 1WE7A 3C8YA 2DYBA 1WX7A 4IM3A 2V3NA 3WANA 2Y3AA 2KQ7A 4DHZB 1T0QC 2QC8A 3ZTDA 1SE3A 4F7ZA 2WQYB 1UNSA 1WGGA 3MJ5A 4EZJA 4N9F4 1J8CA 3KVFB 1U4AA 3LJ3A 2GBNA 3APFA 3SD5A 2ZVNA 5IO9A 2WS3B 3TBLD 2CR5A 4KSLC 3ZVVA 5KHOA 1Q1OA 1XD3B 1HA5A 3EHVA 1WJ6A 2BQQA 2AL6A 2JZPA 1EWYC 1K51A 4IM0A 2WXKA 4NJCA 3GE3C 2KNBA 2WX0A 2NCNA 4CQNA 4OW0A 5BYSA 1C4AA 4ZHPA 3GB1A 2HDEA 1FCCC 2O2VB 3L08A 1L4DB 4GB9A 2XK5A
chains in the Genus database with same CATH topology
4MM3A 2M4NA 5C1ZA 4RMAA 2KDBA 3QARA 2ZCBA 2KC2A 3DQVA 3OAWA 4FHJA 1IPGA 3JYUA 1YX5B 5E6PA 1V81A 3A4SC 3A9JA 2MBQA 2LJ5A 2ZJDA 1JRUA 3DBRI 4HVBA 5J17A 4W9FA 2CS4A 2N4FA 1WXMA 2LI5A 2GBMA 2ZVOA 3PRPB 5CTRC 1NI2A 2KC1A 3H6NA 3T9LA 3AU5A 1WXAA 2O6VA 2L76A 1WI0A 3A1QB 2V4LA 4W9KA 2A4ZA 4DHZE 1OEYA 1YQBA 3CMMB 3Q3JA 4MSMB 3T8MA 1G6JA 1Q0WB 2IO0B 2MW5A 1WGHA 1WR1A 1SIFA 4ZRJA 2BWFA 1RFAA 2WWZA 1X1MA 3CF6E 3QK0A 4MH0E 3M63B 4HWIB 1ZW7A 1WJ4A 3NY5A 4FULA 3X0WA 3R7RA 2NPTA 1D3ZA 2GOWA 3PRMB 4AWJA 4URKA 2ZZPB 1V5TA 5HKHA 1H4RA 3SHQA 3VTVA 2O6VD 3C0RB 4KIKB 5JHBA 3DVNV 4HXDA 3L13A 3V60A 3SU8X 3ZRCA 1WF9A 2NVUI 3V6EB 3H7SA 3MHSD 2LGXA 4GIVA 2NS5A 2HD5B 1R4MI 2Z59B 2KWVB 3HHMA 4WAAA 1V86A 1WR6E 4BOZB 4ASWC 4DHJB 3PGEA 2V3SA 5AZHA 4MJSB 5TR5A 3VFKA 2N9XA 2Y5BB 2FUHB 2Z0DB 2LUEA 2LVPA 4NNJB 4XZ4A 2KJHB 4XC2A 4E3CA 1V49A 5CHVC 3QWZB 2CHXA 2C7HA 2L3ZA 2LXCA 3L17A 4WJOA 4ZRIA 2M0XA 2R2OA 3ZLZA 4BKGA 1P9DU 1P98A 2KK8A 1Q5WB 3PZDA 3MJWA 4WWPA 1IP9A 2ZNVB 2LRWA 1XT9B 3IHPC 3DBHI 1OTRB 3AU4A 1WZ0A 1CMXB 1F9JA 3KH0A 3ZNID 1ISNA 2IO3B 2N9EB 2JPHA 2YLMA 1WIAA 2IO1B 2PPHA 4FHKA 3UF8A 5JZEB 3PV1A 2C7NB 2LGDA 2DZMA 3AULA 3HIZA 4JQWC 5IAAC 4FA6A 4PS7A 4AJWA 3W1SC 1WX8A 2FIDA 1SGHA 4G50A 4KSKC 4X57B 4EKUA 3W1SA 4HDQA 3KYCD 5J18A 2ZPYA 3PRZA 2JUOA 2JZZA 1MG8A 1WM2A 1V5OA 2KHWB 2NBWB 2RSUA 3IBEA 1WRDB 4G11A 2QHOA 4TQ0A 2K8HA 2JF5A 2MLBA 4MSQB 3HK0A 1NDDA 3R66C 2JXXA 4GN1A 1E8WA 3UQAA 1E7VA 1WXSA 2BPSA 4CYEA 3M62B 4NPNA 4KDLB 4WJQA 3RUIB 2FCQA 2MSED 2J0KA 2IY1B 3EECA 2N7EA 1WYWB 1P0RA 3PTFC 3PS6A 5DPRA 1E90A 2JT4B 3DVGX 3V61A 3CSFA 4OVVA 2MA9B 3UIPB 3TIXA 3RYTA 1WE6A 2KOXA 4EUTA 2KTRA 2DHZA 4A3OA 2KZRA 3PSEB 4ZRKA 3ZUNA 1EUVB 3B0AA 4K7UA 4MGZE 4NQLB 4TQ1A 4FBJB 5DPWA 1GJZA 2AEHA 2J0MA 2J7QB 2G3QB 4BFRA 1E8YA 2AWTA 2N7DA 2K25A 4AP4C 2KD0A 4M8NA 3QCAA 1WZ3A 1EF1A 2N1VA 2KJRA 4FJYA 3RT3B 2KX3A 2ZCCA 4LJOB 2D11A 2IZVB 3ENEA 4DXAB 4ZDVA 3QJZA 2D07B 3TL5A 4MEMA 2M8SA 2WDTB 3U30A 4IC7B 4HLEA 1J0GA 1WJUA 2KDFB 5D7GA 3SDLC 4AJYB 3QHTA 4W9EA 2MBHA 5G55A 1I35A 4WQOB 1LM8B 2IYDB 3UIOB 3VUXA 2GMIC 3B08A 1TZ1A 5D2MB 2MCNB 4I6LB 1WMHB 2FNJB 3H9DA 4BKTA 4DK5A 2C5LC 4BKSD 2B3AA 2EMTA 2MBBB 3V6CB 5D6JB 2DYMA 1WGYA 2L7RA 1FXTB 2ASQA 3BY4B 3DCGA 4FLHA 2KLGA 2L8JA 1HE8A 4WWOA 1E8ZA 2DENB 3VUYA 4G0NB 2KFKB 4PS3A 4K81A 2KO3A 1EF5A 1Z2MA 1WGRA 3KUDB 4W9LA 3KUZA 3DPDA 5IA7A 2W9NA 2KDEB 3VTUA 4B6WA 3DVGY 2M1MA 4NJ7A 1WGDA 3GZNI 4ANXA 5L83A 4NAWA 5J2RA 4IM2A 3NZUA 4A20A 2JRHA 2UYZB 2KQSA 2JY6A 2GBKA 2XK5B 3NOBA 5AZFA 2I1JA 2VRRB 3K9PB 3N32A 4ZYNA 3KUCB 2DZJA 3AI5A 2K8CA 3D32A 3ZRFA 4IWPA 1WFYA 2OJRA 3VUWA 3TMPB 3ZNZB 1RRBA 3NS8A 3HM3A 5GMVA 3GOEA 4FN2A 4II2B 2BKFA 2EMSA 3AXCA 4W9GA 1OQYA 3PHWB 1E7UA 2BKRB 3ZNHB 3PPAA 4E71A 4HDOA 3ML8A 3A9JB 1WXVA 2K39A 3U7DA 4GDKA 2MQJA 3WAMA 1UBIA 2O2VA 1YD8U 4NY0A 4LDTD 4ANVA 2JZ3B 1V80A 2MBEA 3ZTCA 3R3MA 5LLIA 2O6VB 4KZCA 3ZO5B 4PYZA 3H7PA 4M8MA 3PREA 3QIJA 2LVQA 3ZNGC 2KANA 1AARA 2LXAA 5E6NA 2UWQA 2BGFA 3M95A 2HE7A 2KN5A 3I3TB 3VH4B 2L0FA 1LQBA 1YIWA 2FCNA 3X23A 4MGKE 4B9KA 2I1KA 2IBIB 3A9KA 2G45B 3RCZA 5JH5C 4TUUA 2K6QA 2NPTB 3DBLI 5LXIB 3WIMA 1E8XA 2KFJA 1TTNA 4IWQA 2KMAA 4ANUA 3PLUA 2OOBB 2ZPNA 2KVRA 4K7WA 5L95C 4FJVB 2KX0A 3ONSA 3KYDD 4MGIE 4HPMB 2JVCA 3ZKJC 1C3TA 2Z0EB 1KM7A 3JW0X 3RULA 2DX5B 2CU1A 5CHFA 4MELA 4E74A 2J0JA 2RGFA 3QAQA 4W9IA 5DPTA 3QX1A 1RAXA 2AYOB 3IG3A 4DDID 4FADA 4EZLA 2C9WB 2V1YA 3UGBB 1KJTA 3WAOA 2KXJA 1EO6A 1YJ1A 2D10A 3K9OB 5D94A 2MBOA 3DOWA 3VH3B 1IYFA 1ZGUB 2MP2A 1QZEA 2C7MB 2HJ8A 2IO2B 4HJKA 2L05A 4KIKA 3TJPA 4ANWA 4KVGB 3V62A 2RD0A 5DPSA 3ML9A 4DWFA 4GXBA 3S2AA 5LXHA 4DDGD 3H1UA 2D3GA 2FIFA 1GNUA 2NBVB 2KWCA 5CX3A 3PHXB 3PLVA 4IW0A 3W1YA 4BKSA 3ZDTA 4GDLA 4MJSA 2JWZA 3DDCB 2RR9A 3H7PB 4GMVA 4TKNA 3VVWB 4BBNF 2DZKA 3ALBA 2WX1A 3VAWA 1WX9A 3QC8B 2ZNVC 2WYQA 1YX6B 1T0YA 1GC6A 1V9JA 2BF8B 2MX2A 5FR6A 3TCAA 2LZ6A 1E5WA 1M94A 1S1QB 3A9KB 3PVLA 2BYVE 4CO7A 1XQQA 5E6OA 2CHZA 4EOYA 2PE6B 2RPQA 4DHJD 4AUQC 3LDZE 1GG3A 3N30A 4HCNB 4BBNC 2XEWA 1A5RA 1TBEA 1L2NA 4I6PA 2LRUA 4F1SA 2PEAA 2LWPA 3N3KB 3PT2B 3VHTC 4BVUC 4P7IA 4DBGA 3UINB 2MRPA 1WM3A 2HTHA 1UD7A 4HK2A 3APCA 3BINA 1VD2A 2DZIA 1KLVA 4FJZA 1SE9A 3KW5B 4W9HA 2MWSB 1C1YB 3L10B 3IVFA 4A3PA 2N1WA 2EKEC 4AOFA 2KTRB 1ZKHA 2L0TA 2R2QA 3WAPA 1Y8RC 3O65B 3ZW3A 2PJHA 4RM9A 1V2YA 2K1FA 3WA0A 1LFDA 2MP2B 1GC7A 2KKCA 4W9CA 4WJPA 2FCSA 4M0WB 2XBBC 3P2BA 1K8RB 2BYEA 4W9DA 4EEWA 4I6NB 5AEKB 1P3QU 1R4NI 1V6EA 4IWOA 3A4RA 3OLMD 3ZIMA 4CHKA 1GUAB 4ICUA 3VXWA 1BT0A 2LGYA 3VQIA 3APDA 3JSVA 2LASA 2KDIA 4GDLB 4JLCA 2CKHB 1WH3A 2DYOA 4MGYE 5CHWA 1WY8A 5DCNA 5BO4B 4KZ0A 2KWUB 2BYFA 1WE7A 2REXA 3U8ZA 2L00B 4HPLB 2GBJA 4GGQA 2AL3A 4II3B 2DYBA 3WALA 1S3SG 1TGZB 1VCBA 2KLCA 3DVNU 1WX7A 4ICVA 4IM3A 4JGHB 4WJNA 1PQSA 2FCMA 4GU2A 2JRIB 4BOSC 3WANA 2KQ7A 5AZGA 4DHZB 4OVUA 3L16A 2A5UA 3Q3FA 3RZWC 2G4DB 3ZTDA 4TV3A 2GBRA 4F7ZA 1WGGA 4LJPB 3DBSA 3EFUA 1OEYJ 4XX5A 4IG7B 2YVCA 3HM6X 4K1RB 4EZJA 4F8CB 3B1LX 5EDSA 1UH6A 4MDKE 2K6DB 2DAJA 3QA8A 4N9F4 1J8CA 2K8BA 3KVFB 3L54A 4GOCA 3A1QA 2NBUA 1U4AA 4G3XB 4IUMB 3LJ3A 2GBNA 3APFA 3SD5A 3VTWA 1RLFA 1J19A 1UELA 2C60A 2IY0B 1KOTA 2ZVNA 3RZFA 1UBQA 2KMCA 4RM8A 3QQ8B 3OJ4B 3TBLD 3VDZA 2CR5A 1NBFC 1LXDA 4KSLC 3ZVVA 4NJ6A 5KHOA 1WJNA 1Q1OA 1XD3B 3JVZX 3ECIA 1WMHA 4PS8A 4NAWB 2LD9A 3EHVA 2CHWA 1WJ6A 3M3JA 4LDTB 4EFOA 4J6IA 3A33B 1UZXB 2AL6A 2KTFA 2NR2A 4K7SA 4PYUA 3RD2A 2DAFA 2FAZA 2M17A 4KV2A 1P1AA 2KJ6A 4KDIC 4IM0A 5JHAA 1I42A 2ZEQA 3NHEB 2D2QA 1L7YA 2KNBA 3OJ3A 3UQBA 4JL9A 2N9PC 2WX0A 2KFKA 5C23A 1UGMA 2NCNA 4EZKA 4HCPB 4YL8A 3MTNB 4JIOU 1H8CA 3NZSA 2BWES 2LVOA 2PE9A 3CSTA 4GDKB 4LCDE 5G2NA 5KHQA 4B95A 3JSVB 2O2VB 3IFWB 3L08A 4NQKE 3ZDMC 3R7QA 4WWNA 4GB9A 3L0WB 2XK5A 1Z5SB 1OGWA 4W9JA 3EC8A 4GSWA 2G4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 A;  2M4N A;  5C1Z A;  4RMA A;  2KDB A;  3QAR A;  2ZCB A;  2KC2 A;  3DQV A;  3OAW A;  4FHJ A;  1IPG A;  3JYU A;  1YX5 B;  5E6P A;  1V81 A;  3A4S C;  3A9J A;  2MBQ A;  2LJ5 A;  2ZJD A;  1JRU A;  3DBR I;  4HVB A;  5J17 A;  4W9F A;  2CS4 A;  2N4F A;  1WXM A;  2LI5 A;  2GBM A;  2ZVO A;  3PRP B;  5CTR C;  1NI2 A;  2KC1 A;  3H6N A;  3T9L A;  3AU5 A;  1WXA A;  2O6V A;  2L76 A;  1WI0 A;  3A1Q B;  2V4L A;  4W9K A;  2A4Z A;  4DHZ E;  1OEY A;  1YQB A;  3CMM B;  3Q3J A;  4MSM B;  3T8M A;  1G6J A;  1Q0W B;  2IO0 B;  2MW5 A;  1WGH A;  1WR1 A;  1SIF A;  4ZRJ A;  2BWF A;  1RFA A;  2WWZ A;  1X1M A;  3CF6 E;  3QK0 A;  4MH0 E;  3M63 B;  4HWI B;  1ZW7 A;  1WJ4 A;  3NY5 A;  4FUL A;  3X0W A;  3R7R A;  2NPT A;  1D3Z A;  2GOW A;  3PRM B;  4AWJ A;  4URK A;  2ZZP B;  1V5T A;  5HKH A;  1H4R A;  3SHQ A;  3VTV A;  2O6V D;  3C0R B;  4KIK B;  5JHB A;  3DVN V;  4HXD A;  3L13 A;  3V60 A;  3SU8 X;  3ZRC A;  1WF9 A;  2NVU I;  3V6E B;  3H7S A;  3MHS D;  2LGX A;  4GIV A;  2NS5 A;  2HD5 B;  1R4M I;  2Z59 B;  2KWV B;  3HHM A;  4WAA A;  1V86 A;  1WR6 E;  4BOZ B;  4ASW C;  4DHJ B;  3PGE A;  2V3S A;  5AZH A;  4MJS B;  5TR5 A;  3VFK A;  2N9X A;  2Y5B B;  2FUH B;  2Z0D B;  2LUE A;  2LVP A;  4NNJ B;  4XZ4 A;  2KJH B;  4XC2 A;  4E3C A;  1V49 A;  5CHV C;  3QWZ B;  2CHX A;  2C7H A;  2L3Z A;  2LXC A;  3L17 A;  4WJO A;  4ZRI A;  2M0X A;  2R2O A;  3ZLZ A;  4BKG A;  1P9D U;  1P98 A;  2KK8 A;  1Q5W B;  3PZD A;  3MJW A;  4WWP A;  1IP9 A;  2ZNV B;  2LRW A;  1XT9 B;  3IHP C;  3DBH I;  1OTR B;  3AU4 A;  1WZ0 A;  1CMX B;  1F9J A;  3KH0 A;  3ZNI D;  1ISN A;  2IO3 B;  2N9E B;  2JPH A;  2YLM A;  1WIA A;  2IO1 B;  2PPH A;  4FHK A;  3UF8 A;  5JZE B;  3PV1 A;  2C7N B;  2LGD A;  2DZM A;  3AUL A;  3HIZ A;  4JQW C;  5IAA C;  4FA6 A;  4PS7 A;  4AJW A;  3W1S C;  1WX8 A;  2FID A;  1SGH A;  4G50 A;  4KSK C;  4X57 B;  4EKU A;  3W1S A;  4HDQ A;  3KYC D;  5J18 A;  2ZPY A;  3PRZ A;  2JUO A;  2JZZ A;  1MG8 A;  1WM2 A;  1V5O A;  2KHW B;  2NBW B;  2RSU A;  3IBE A;  1WRD B;  4G11 A;  2QHO A;  4TQ0 A;  2K8H A;  2JF5 A;  2MLB A;  4MSQ B;  3HK0 A;  1NDD A;  3R66 C;  2JXX A;  4GN1 A;  1E8W A;  3UQA A;  1E7V A;  1WXS A;  2BPS A;  4CYE A;  3M62 B;  4NPN A;  4KDL B;  4WJQ A;  3RUI B;  2FCQ A;  2MSE D;  2J0K A;  2IY1 B;  3EEC A;  2N7E A;  1WYW B;  1P0R A;  3PTF C;  3PS6 A;  5DPR A;  1E90 A;  2JT4 B;  3DVG X;  3V61 A;  3CSF A;  4OVV A;  2MA9 B;  3UIP B;  3TIX A;  3RYT A;  1WE6 A;  2KOX A;  4EUT A;  2KTR A;  2DHZ A;  4A3O A;  2KZR A;  3PSE B;  4ZRK A;  3ZUN A;  1EUV B;  3B0A A;  4K7U A;  4MGZ E;  4NQL B;  4TQ1 A;  4FBJ B;  5DPW A;  1GJZ A;  2AEH A;  2J0M A;  2J7Q B;  2G3Q B;  4BFR A;  1E8Y A;  2AWT A;  2N7D A;  2K25 A;  4AP4 C;  2KD0 A;  4M8N A;  3QCA A;  1WZ3 A;  1EF1 A;  2N1V A;  2KJR A;  4FJY A;  3RT3 B;  2KX3 A;  2ZCC A;  4LJO B;  2D11 A;  2IZV B;  3ENE A;  4DXA B;  4ZDV A;  3QJZ A;  2D07 B;  3TL5 A;  4MEM A;  2M8S A;  2WDT B;  3U30 A;  4IC7 B;  4HLE A;  1J0G A;  1WJU A;  2KDF B;  5D7G A;  3SDL C;  4AJY B;  3QHT A;  4W9E A;  2MBH A;  5G55 A;  1I35 A;  4WQO B;  1LM8 B;  2IYD B;  3UIO B;  3VUX A;  2GMI C;  3B08 A;  1TZ1 A;  5D2M B;  2MCN B;  4I6L B;  1WMH B;  2FNJ B;  3H9D A;  4BKT A;  4DK5 A;  2C5L C;  4BKS D;  2B3A A;  2EMT A;  2MBB B;  3V6C B;  5D6J B;  2DYM A;  1WGY A;  2L7R A;  1FXT B;  2ASQ A;  3BY4 B;  3DCG A;  4FLH A;  2KLG A;  2L8J A;  1HE8 A;  4WWO A;  1E8Z A;  2DEN B;  3VUY A;  4G0N B;  2KFK B;  4PS3 A;  4K81 A;  2KO3 A;  1EF5 A;  1Z2M A;  1WGR A;  3KUD B;  4W9L A;  3KUZ A;  3DPD A;  5IA7 A;  2W9N A;  2KDE B;  3VTU A;  4B6W A;  3DVG Y;  2M1M A;  4NJ7 A;  1WGD A;  3GZN I;  4ANX A;  5L83 A;  4NAW A;  5J2R A;  4IM2 A;  3NZU A;  4A20 A;  2JRH A;  2UYZ B;  2KQS A;  2JY6 A;  2GBK A;  2XK5 B;  3NOB A;  5AZF A;  2I1J A;  2VRR B;  3K9P B;  3N32 A;  4ZYN A;  3KUC B;  2DZJ A;  3AI5 A;  2K8C A;  3D32 A;  3ZRF A;  4IWP A;  1WFY A;  2OJR A;  3VUW A;  3TMP B;  3ZNZ B;  1RRB A;  3NS8 A;  3HM3 A;  5GMV A;  3GOE A;  4FN2 A;  4II2 B;  2BKF A;  2EMS A;  3AXC A;  4W9G A;  1OQY A;  3PHW B;  1E7U A;  2BKR B;  3ZNH B;  3PPA A;  4E71 A;  4HDO A;  3ML8 A;  3A9J B;  1WXV A;  2K39 A;  3U7D A;  4GDK A;  2MQJ A;  3WAM A;  1UBI A;  2O2V A;  1YD8 U;  4NY0 A;  4LDT D;  4ANV A;  2JZ3 B;  1V80 A;  2MBE A;  3ZTC A;  3R3M A;  5LLI A;  2O6V B;  4KZC A;  3ZO5 B;  4PYZ A;  3H7P A;  4M8M A;  3PRE A;  3QIJ A;  2LVQ A;  3ZNG C;  2KAN A;  1AAR A;  2LXA A;  5E6N A;  2UWQ A;  2BGF A;  3M95 A;  2HE7 A;  2KN5 A;  3I3T B;  3VH4 B;  2L0F A;  1LQB A;  1YIW A;  2FCN A;  3X23 A;  4MGK E;  4B9K A;  2I1K A;  2IBI B;  3A9K A;  2G45 B;  3RCZ A;  5JH5 C;  4TUU A;  2K6Q A;  2NPT B;  3DBL I;  5LXI B;  3WIM A;  1E8X A;  2KFJ A;  1TTN A;  4IWQ A;  2KMA A;  4ANU A;  3PLU A;  2OOB B;  2ZPN A;  2KVR A;  4K7W A;  5L95 C;  4FJV B;  2KX0 A;  3ONS A;  3KYD D;  4MGI E;  4HPM B;  2JVC A;  3ZKJ C;  1C3T A;  2Z0E B;  1KM7 A;  3JW0 X;  3RUL A;  2DX5 B;  2CU1 A;  5CHF A;  4MEL A;  4E74 A;  2J0J A;  2RGF A;  3QAQ A;  4W9I A;  5DPT A;  3QX1 A;  1RAX A;  2AYO B;  3IG3 A;  4DDI D;  4FAD A;  4EZL A;  2C9W B;  2V1Y A;  3UGB B;  1KJT A;  3WAO A;  2KXJ A;  1EO6 A;  1YJ1 A;  2D10 A;  3K9O B;  5D94 A;  2MBO A;  3DOW A;  3VH3 B;  1IYF A;  1ZGU B;  2MP2 A;  1QZE A;  2C7M B;  2HJ8 A;  2IO2 B;  4HJK A;  2L05 A;  4KIK A;  3TJP A;  4ANW A;  4KVG B;  3V62 A;  2RD0 A;  5DPS A;  3ML9 A;  4DWF A;  4GXB A;  3S2A A;  5LXH A;  4DDG D;  3H1U A;  2D3G A;  2FIF A;  1GNU A;  2NBV B;  2KWC A;  5CX3 A;  3PHX B;  3PLV A;  4IW0 A;  3W1Y A;  4BKS A;  3ZDT A;  4GDL A;  4MJS A;  2JWZ A;  3DDC B;  2RR9 A;  3H7P B;  4GMV A;  4TKN A;  3VVW B;  4BBN F;  2DZK A;  3ALB A;  2WX1 A;  3VAW A;  1WX9 A;  3QC8 B;  2ZNV C;  2WYQ A;  1YX6 B;  1T0Y A;  1GC6 A;  1V9J A;  2BF8 B;  2MX2 A;  5FR6 A;  3TCA A;  2LZ6 A;  1E5W A;  1M94 A;  1S1Q B;  3A9K B;  3PVL A;  2BYV E;  4CO7 A;  1XQQ A;  5E6O A;  2CHZ A;  4EOY A;  2PE6 B;  2RPQ A;  4DHJ D;  4AUQ C;  3LDZ E;  1GG3 A;  3N30 A;  4HCN B;  4BBN C;  2XEW A;  1A5R A;  1TBE A;  1L2N A;  4I6P A;  2LRU A;  4F1S A;  2PEA A;  2LWP A;  3N3K B;  3PT2 B;  3VHT C;  4BVU C;  4P7I A;  4DBG A;  3UIN B;  2MRP A;  1WM3 A;  2HTH A;  1UD7 A;  4HK2 A;  3APC A;  3BIN A;  1VD2 A;  2DZI A;  1KLV A;  4FJZ A;  1SE9 A;  3KW5 B;  4W9H A;  2MWS B;  1C1Y B;  3L10 B;  3IVF A;  4A3P A;  2N1W A;  2EKE C;  4AOF A;  2KTR B;  1ZKH A;  2L0T A;  2R2Q A;  3WAP A;  1Y8R C;  3O65 B;  3ZW3 A;  2PJH A;  4RM9 A;  1V2Y A;  2K1F A;  3WA0 A;  1LFD A;  2MP2 B;  1GC7 A;  2KKC A;  4W9C A;  4WJP A;  2FCS A;  4M0W B;  2XBB C;  3P2B A;  1K8R B;  2BYE A;  4W9D A;  4EEW A;  4I6N B;  5AEK B;  1P3Q U;  1R4N I;  1V6E A;  4IWO A;  3A4R A;  3OLM D;  3ZIM A;  4CHK A;  1GUA B;  4ICU A;  3VXW A;  1BT0 A;  2LGY A;  3VQI A;  3APD A;  3JSV A;  2LAS A;  2KDI A;  4GDL B;  4JLC A;  2CKH B;  1WH3 A;  2DYO A;  4MGY E;  5CHW A;  1WY8 A;  5DCN A;  5BO4 B;  4KZ0 A;  2KWU B;  2BYF A;  1WE7 A;  2REX A;  3U8Z A;  2L00 B;  4HPL B;  2GBJ A;  4GGQ A;  2AL3 A;  4II3 B;  2DYB A;  3WAL A;  1S3S G;  1TGZ B;  1VCB A;  2KLC A;  3DVN U;  1WX7 A;  4ICV A;  4IM3 A;  4JGH B;  4WJN A;  1PQS A;  2FCM A;  4GU2 A;  2JRI B;  4BOS C;  3WAN A;  2KQ7 A;  5AZG A;  4DHZ B;  4OVU A;  3L16 A;  2A5U A;  3Q3F A;  3RZW C;  2G4D B;  3ZTD A;  4TV3 A;  2GBR A;  4F7Z A;  1WGG A;  4LJP B;  3DBS A;  3EFU A;  1OEY J;  4XX5 A;  4IG7 B;  2YVC A;  3HM6 X;  4K1R B;  4EZJ A;  4F8C B;  3B1L X;  5EDS A;  1UH6 A;  4MDK E;  2K6D B;  2DAJ A;  3QA8 A;  4N9F 4;  1J8C A;  2K8B A;  3KVF B;  3L54 A;  4GOC A;  3A1Q A;  2NBU A;  1U4A A;  4G3X B;  4IUM B;  3LJ3 A;  2GBN A;  3APF A;  3SD5 A;  3VTW A;  1RLF A;  1J19 A;  1UEL A;  2C60 A;  2IY0 B;  1KOT A;  2ZVN A;  3RZF A;  1UBQ A;  2KMC A;  4RM8 A;  3QQ8 B;  3OJ4 B;  3TBL D;  3VDZ A;  2CR5 A;  1NBF C;  1LXD A;  4KSL C;  3ZVV A;  4NJ6 A;  5KHO A;  1WJN A;  1Q1O A;  1XD3 B;  3JVZ X;  3ECI A;  1WMH A;  4PS8 A;  4NAW B;  2LD9 A;  3EHV A;  2CHW A;  1WJ6 A;  3M3J A;  4LDT B;  4EFO A;  4J6I A;  3A33 B;  1UZX B;  2AL6 A;  2KTF A;  2NR2 A;  4K7S A;  4PYU A;  3RD2 A;  2DAF A;  2FAZ A;  2M17 A;  4KV2 A;  1P1A A;  2KJ6 A;  4KDI C;  4IM0 A;  5JHA A;  1I42 A;  2ZEQ A;  3NHE B;  2D2Q A;  1L7Y A;  2KNB A;  3OJ3 A;  3UQB A;  4JL9 A;  2N9P C;  2WX0 A;  2KFK A;  5C23 A;  1UGM A;  2NCN A;  4EZK A;  4HCP B;  4YL8 A;  3MTN B;  4JIO U;  1H8C A;  3NZS A;  2BWE S;  2LVO A;  2PE9 A;  3CST A;  4GDK B;  4LCD E;  5G2N A;  5KHQ A;  4B95 A;  3JSV B;  2O2V B;  3IFW B;  3L08 A;  4NQK E;  3ZDM C;  3R7Q A;  4WWN A;  4GB9 A;  3L0W B;  2XK5 A;  1Z5S B;  1OGW A;  4W9J A;  3EC8 A;  4GSW A;  2G4S A; 
#chains in the Genus database with same CATH topology
 2N9L A;  2ZCB A;  3DQV A;  3RFZ B;  1V8C A;  2K0P A;  2AQ3 B;  3JYU A;  3TEZ A;  5E6P A;  3A4S C;  2MBQ A;  2LJ5 A;  1YQ3 B;  2ZJD A;  1JRU A;  3DBR I;  1LGR A;  1WXM A;  3T9L A;  2KC1 A;  3H6N A;  1XLN A;  2X38 A;  2L76 A;  2V4L A;  2A4Z A;  3Q8C A;  3T8M A;  1G6J A;  1WR1 A;  1SIF A;  2BWF A;  1X1M A;  3Q3N C;  3BYT B;  1ZW7 A;  3X0W A;  2GOW A;  4AWJ A;  2AQ2 B;  3ZJT A;  3VTV A;  4KIK B;  4HXD A;  4P1B C;  2CJO A;  2NVU I;  3V6E B;  4OZB A;  3MHS D;  2I2Y A;  2LGX A;  4WAA A;  1GAQ B;  1SSN A;  1WR6 E;  4BOZ B;  4ASW C;  5G5G A;  4JWS C;  4RGT A;  4NNJ B;  5CHV C;  3HVD A;  2C7H A;  4ZRI A;  3ZLZ A;  2V3P A;  2KK8 A;  1FM0 D;  2QSD A;  2LRW A;  1XT9 B;  1WZ0 A;  1T5X D;  2PPH A;  3PV1 A;  2C7N B;  2LGD A;  2DBY A;  2QMT A;  3HIZ A;  4JQW C;  3Q14 C;  4PS7 A;  4AJW A;  1BXT A;  1EM7 A;  4X57 B;  1FFV A;  3AH7 A;  2LMC A;  2JZZ A;  1MG8 A;  1WM2 A;  1ZXH A;  4ARI A;  3L4P A;  1IBX B;  1WRD B;  3EFC A;  3KWV A;  3HK0 A;  4YTP B;  1TKY A;  3C19 A;  4NPN A;  1EU4 A;  2MSE D;  2N7E A;  1WYW B;  1P0R A;  1QQR A;  3V61 A;  3CSF A;  2L32 A;  2EKI A;  4OHJ A;  4XYC A;  4UDU C;  1EUV B;  2WXP A;  3B0A A;  3RNF C;  5DPW A;  4JE3 B;  2G3Q B;  3IXS A;  2K25 A;  4M8N A;  2KMM A;  1STE A;  1Q10 A;  1LO5 D;  4LJO B;  4DXA B;  1VJK A;  4ZDV A;  3QJZ A;  3TL5 A;  3R8B A;  3OWE B;  4C00 A;  2M8S A;  3U30 A;  1NI3 A;  1VZ6 A;  1FPY A;  5D7G A;  2J52 A;  1I35 A;  5G55 A;  2MBH A;  1N63 A;  1LM8 B;  3UIO B;  1TZ1 A;  5D2M B;  1WMH B;  2L83 A;  3H9D A;  4EE2 A;  1SB3 C;  5BYQ A;  4BKS D;  3ZNI D;  2L7R A;  2ASQ A;  4FLH A;  1HE8 A;  3AED B;  2VZK D;  1E8Z A;  3VUY A;  2CJN A;  4K81 A;  1QIL A;  4RH6 A;  3FC4 A;  3DPD A;  1WYG A;  2W9N A;  3VTU A;  4NJ7 A;  2WXL A;  3CWI A;  4NAW A;  3WCQ A;  3NZU A;  2UYZ B;  3VR8 B;  3K9P B;  3AI5 A;  2WXR A;  2K8C A;  1I4R A;  4IWP A;  2DLB A;  2OJR A;  3TMP B;  4JWU C;  1RRB A;  2D3B A;  3HM3 A;  4FN2 A;  2BKF A;  1E7U A;  3N1Y C;  3PPA A;  4HDO A;  3ML8 A;  5TSS A;  4WUR A;  2FBW B;  1FO4 A;  3DHI C;  4NY0 A;  2QIL A;  3I63 C;  4NAM A;  3ZTC A;  2MHJ A;  4KZC A;  1VDV A;  2LVQ A;  2KAN A;  2LXA A;  5E6N A;  1FFU A;  3M95 A;  3BK1 A;  3AV8 A;  2I1K A;  2W82 A;  3RCZ A;  3PZ7 A;  2K6Q A;  5LXI B;  2KFJ A;  2D5G A;  4IWQ A;  3PLU A;  4YWG G;  3ONS A;  4MT5 A;  5HG2 A;  2EEL A;  3SEB A;  1TYG B;  3ZKJ C;  2Z0E B;  1KM7 A;  2DX5 B;  2M19 A;  2SAK A;  3RN9 C;  4W9I A;  3QX1 A;  1HZ5 A;  4FAD A;  4EZL A;  2V1Y A;  3RMK C;  2BTE A;  3VH3 B;  1IYF A;  4HPP A;  4HRS A;  1QZE A;  4P1C C;  2WXJ A;  2L05 A;  4ANW A;  1FXI A;  1VZ7 A;  5E6J A;  5DPS A;  5HFY A;  4GXB A;  4DDG D;  2KWC A;  5CX3 A;  2KAJ A;  3ZDT A;  4RCO A;  3P4P B;  5JXV A;  2BBC A;  2RR9 A;  5H8Y E;  4GMV A;  2WX1 A;  1UWX A;  1WX9 A;  3NJT A;  1GOZ A;  3QC8 B;  1T0Y A;  4LK0 M;  2BF8 B;  5FR6 A;  3TCA A;  5BMI A;  2LZ6 A;  1M94 A;  1VR9 A;  1L0V B;  3PVL A;  1C9F A;  4CO7 A;  1XQQ A;  2CHZ A;  4EOY A;  2QDF A;  2RPQ A;  4H2A A;  4DHJ D;  3N30 A;  1A5R A;  1TBE A;  5G5H A;  4I6P A;  1JWM D;  3DHH C;  2LWP A;  4KGT A;  4BVU C;  2HTH A;  3AE9 B;  3BIN A;  2DZI A;  2KYW A;  4XWT A;  3IT6 B;  1C1Y B;  2IND C;  3MP9 A;  3IVF A;  4A3P A;  1UF0 A;  2EKE C;  1E6E B;  2L0T A;  4IDI A;  1R7S A;  3AM9 A;  1V2Y A;  2K1F A;  1GC7 A;  4W9C A;  4M0W B;  2XBB C;  3ABV B;  2Q5W D;  2V4I B;  2AX5 A;  3OLM D;  4CHK A;  4ARC A;  1SJE D;  2KQ4 X;  4ICU A;  2LAS A;  5CHW A;  2BYT A;  2REX A;  3U8Z A;  1KRH A;  1TGZ B;  1VCB A;  2WXI A;  4ICV A;  1PQS A;  3BVG A;  4KKI A;  3B2G A;  2INC C;  5AZG A;  3L16 A;  2A5U A;  3Q3F A;  3RZW C;  4USA A;  2YVC A;  4K1R B;  5EDS A;  1UH6 A;  2K6D B;  1R4M B;  3L54 A;  4G3X B;  3VTW A;  1DOI A;  1K52 A;  1RLF A;  2C60 A;  2IY0 B;  4PK1 A;  1KOT A;  3RZF A;  1UBQ A;  2KMC A;  4S0R A;  4MAC A;  2B76 B;  3Q8A A;  3ECI A;  3MHZ A;  1JRO A;  3M3J A;  4EFO A;  4KGS A;  2W3S A;  3RD2 A;  2M17 A;  4KV2 A;  1FRD A;  4KDI C;  1I42 A;  2D2Q A;  2QIE B;  5C23 A;  1UGM A;  4HCP B;  4YSY B;  1TT5 B;  1UUP A;  5KHQ A;  4B95 A;  1FRR A;  1T3Q A;  3IFW B;  1FEH A;  4NQK E;  4WWN A;  1FIQ A;  3EC8 A;  3DWG C;  2G4S A;  4MM3 A;  1WXQ A;  3QAR A;  3OAW A;  3ZYY X;  1JCK B;  3A9J A;  1VZ8 A;  4HVB A;  2BB6 A;  2GBM A;  2ZVO A;  2W54 A;  5EE1 A;  1WXA A;  2O6V A;  1WI0 A;  1EWC A;  3NVZ A;  1KTK A;  2WU5 B;  4DHZ E;  4LNI A;  2KAC A;  2MW5 A;  1WGH A;  4ZRJ A;  2JSV X;  2NMQ A;  2WWZ A;  4MH0 E;  3NY5 A;  1C4P A;  3R7R A;  1SE2 A;  1D3Z A;  4YSX B;  5HKH A;  1H4R A;  4RF0 A;  3DBR B;  2O6V D;  3C0R B;  3DVN V;  5HI1 A;  3ZRC A;  2NS5 A;  4LNF A;  1R4M I;  2Z59 B;  2ICI A;  3HHM A;  1V86 A;  1JW9 D;  2V9H A;  4MJS B;  3VFK A;  2N9X A;  2Y5B B;  1MG4 A;  4XC2 A;  2CHX A;  4WJO A;  4MM3 B;  2M0X A;  2XNA C;  4HRO A;  1P98 A;  1JWA D;  2ZNV B;  1JRP A;  3HVZ A;  1NEK B;  1OTR B;  3AU4 A;  1FCL A;  3AE8 B;  1PDX A;  2JPH A;  1C4C A;  3UF8 A;  2BS3 B;  2DZM A;  5IAA C;  4FA6 A;  2OHF A;  1WX8 A;  2FID A;  2WGS A;  4EKU A;  4HDQ A;  3KYC D;  4JX1 C;  1E10 A;  5IKC M;  2WXN A;  1TJE A;  2KHW B;  2JU6 X;  4MH8 A;  3IBE A;  4XE0 A;  2QHO A;  2SEB D;  2MLB A;  1NEN B;  4Q2J A;  2JXX A;  2MEK A;  1E8W A;  4GN1 A;  1E7V A;  2JQR B;  1WXS A;  4KDL B;  4WJQ A;  3RUI B;  3UI3 A;  1RFK A;  3PS6 A;  5DPR A;  3I9V 1;  5H92 C;  2JX5 A;  3VRB B;  3KQ4 A;  3N1X C;  4EUT A;  2KTR A;  2KZR A;  3ZUN A;  3E56 A;  1P7E A;  4K7U A;  4MGZ E;  4PT5 A;  4LLG M;  2AEH A;  2J0M A;  4BFR A;  3AEG B;  3PZ8 A;  4ACF A;  3DWM A;  5D3D A;  2Z8L A;  1XLP A;  3BK2 A;  3RT3 B;  2CU3 A;  3W9C B;  2PKO A;  4YSZ B;  2IZV B;  1GB1 A;  1PGA A;  4MEM A;  1NYQ A;  4W9E A;  4WQO B;  1N62 A;  3RNC C;  3B08 A;  1V1P A;  5BMG A;  3LXF A;  4BKT A;  2FNJ B;  1PUT A;  3U4E G;  3RI7 C;  2C5L C;  3AEA B;  2B3A A;  3V6C B;  2DYM A;  1WGY A;  3BY4 B;  4YTN B;  1OFF A;  2L8J A;  1F2R I;  4L23 A;  1HQR D;  5IP4 D;  1YOV B;  1K50 A;  1B9R A;  4B6W A;  1SJH D;  3DVG Y;  1PYW D;  4OVZ A;  2JYE A;  1SXT A;  5HHD G;  5J2R A;  2WXF A;  3NZ3 A;  2JRH A;  2XK5 B;  3NOB A;  2I1J A;  1OQR A;  3KUC B;  3D32 A;  3NS8 A;  1L0Y B;  4II2 B;  2EMS A;  3ZNH B;  3U7D A;  2PVO D;  4GDK A;  1UBI A;  1YD8 U;  4LDT D;  2HTM E;  2J42 A;  4ANV A;  1GB4 A;  1N5W A;  3MC0 B;  3ZGZ A;  4PYZ A;  4M8M A;  1M4V A;  1JQ4 A;  4BAX A;  2LHD A;  2UWQ A;  2INN E;  2FE8 A;  3VH4 B;  1LQB A;  1TY0 A;  2FCN A;  1DOX A;  1KH0 A;  1QOG A;  2PLP A;  3Q8E A;  2IBI B;  4B9K A;  4TUU A;  1B1Z A;  3P1M A;  1FMA D;  2IPK D;  4DQO C;  2LGS A;  1JWU D;  2KVR A;  4K7W A;  5L95 C;  2KX0 A;  1D5Z C;  4MGI E;  4HPM B;  1C3T A;  1T6B X;  3JW0 X;  4JPS A;  4M01 A;  2JXT A;  1ZE3 D;  5DPT A;  3Q2A C;  1RAX A;  2AYO B;  3IG3 A;  2LFI A;  4C56 C;  4C4V A;  2KXJ A;  3K9O B;  2MBO A;  3DOW A;  2OJW A;  2MP2 A;  1AN8 A;  2IDY A;  3V62 A;  3S2A A;  5LXH A;  3EUB 2;  2I38 A;  2D3G A;  2FIF A;  1GNU A;  3PHX B;  3W1Y A;  4WQM A;  4BKS A;  4BBN F;  2DZK A;  2VH1 A;  2WYQ A;  3RNA C;  3J9C A;  1YN4 A;  1V9J A;  1J7C A;  1E5W A;  2OED A;  5E6O A;  5EE9 A;  3TEY A;  2LGI A;  3LDZ E;  4HCN B;  4BBN C;  1D5X C;  3AE5 B;  1DGJ A;  3N3K B;  3VHT C;  4DBG A;  3UIN B;  4US8 A;  3I5J C;  4W9H A;  4R3D A;  1AWD A;  2GB1 A;  1MI0 A;  3MC9 A;  1ZKH A;  3WAP A;  1Y8R C;  2MP2 B;  2KKC A;  3N1Z C;  2FCS A;  3P2B A;  1K8R B;  4I6N B;  1V6E A;  1WGK A;  2BW2 A;  3W5U B;  1ACC A;  1GUA B;  2ON8 A;  1BT0 A;  2LGY A;  4ZRQ A;  4MGY E;  1WH3 A;  5DCN A;  5BO4 B;  2RDB C;  2BYF A;  1MPE A;  2L00 B;  4N58 A;  2GBJ A;  4HKZ E;  4ZHO A;  2ZW1 A;  4A90 A;  4II3 B;  3WAL A;  2KLC A;  3DVN U;  1SIJ A;  1TS4 A;  4JGH B;  2QEJ C;  3VR9 B;  2G4D B;  4TV3 A;  3DBS A;  3EFU A;  3RNG C;  3P63 A;  1T0S C;  4IG7 B;  3HM6 X;  2GLS A;  3GS2 A;  4MDK E;  3QA8 A;  2DAJ A;  2K8B A;  4GOC A;  3A1Q A;  1L6V A;  4TMA B;  4RM8 A;  3MC8 A;  3QQ8 B;  4K3B A;  1NBF C;  3U52 E;  4NAW B;  2LD9 A;  3A33 B;  1UZX B;  4K7S A;  2KTF A;  2NR2 A;  5AUI A;  1ZDV A;  2DAF A;  2FAZ A;  4KGR A;  1P1A A;  1N6Z A;  2NTT A;  5FR3 A;  3AMZ A;  5JHA A;  3NHE B;  3NRZ A;  1L7Y A;  3OJ3 A;  3UQB A;  2N9P C;  4A55 A;  2KFK A;  1MHX A;  3MTN B;  2LUM A;  4JIO U;  1E0Z A;  1H8C A;  4HKQ A;  1KFY B;  2PE9 A;  2LVO A;  1IGC A;  3CST A;  4LCD E;  3VRA B;  1C78 A;  1Z5S B;  2WXQ A;  3MJW A;  4GSW A;  4HEA 1;  2LEK A;  2M4N A;  2E3T A;  2KC2 A;  1TS5 A;  4FHJ A;  1IPG A;  3AE1 B;  1V81 A;  2GRI A;  3AE4 B;  2CS4 A;  2MH7 A;  2LI5 A;  5CTR C;  1NVI D;  3A1Q B;  5BYR A;  4W9K A;  5AUK A;  4MSM B;  2IO0 B;  2ZW0 A;  1NYR A;  1RFA A;  3BVM A;  3CF6 E;  1SF0 A;  4HWI B;  1WJ4 A;  2NPT A;  1I7H A;  3PRM B;  4URK A;  1BML C;  3SHQ A;  2WDV B;  1C79 A;  3BVZ A;  3L13 A;  3V60 A;  3SU8 X;  3H7S A;  1Y56 A;  3BII D;  2K9X A;  4DHJ B;  4RGO S;  3PGE A;  2V3S A;  5AZH A;  4XZ4 A;  2FUH B;  4YT0 B;  2LVP A;  4E3C A;  2L3Z A;  3L17 A;  2R2O A;  2RDH A;  1C76 A;  1Q5W B;  1YN5 A;  1ZOY B;  3PZD A;  4WWP A;  1IP9 A;  1F77 A;  1A70 A;  1BUI C;  1D4B A;  4P6V F;  2AQ1 B;  3P4R B;  1OQQ A;  3KH0 A;  1GPX A;  3NVW A;  2N9E B;  4FHK A;  3GZN B;  1MJD A;  3O13 A;  3W1S C;  4XGA B;  4KSK C;  1I4Q A;  3FKY A;  2HJ1 A;  5J18 A;  3PRZ A;  4QAY A;  1RYJ A;  3AE7 B;  1UWM A;  2IGD A;  4TQ0 A;  2K8H A;  1XLQ A;  2WLB A;  4MSQ B;  3NVY A;  3R66 C;  1AW7 A;  3TEX A;  4US9 A;  2J0K A;  3PTF C;  2Y5C A;  2KVZ A;  2JT4 B;  3DVG X;  2JWU A;  3V05 A;  3TIX A;  1C77 A;  3RYT A;  2KOX A;  4A3O A;  3DHG C;  3PSE B;  1VLB A;  5FKA C;  4TQ1 A;  2AWT A;  2KD0 A;  4FXC A;  4L1B A;  2N1V A;  4L2Y A;  4RGM A;  2G1E A;  3ENE A;  4A6Q A;  1TIF A;  2WDT B;  3V3X A;  4WIP A;  1J0G A;  1WJU A;  3SDL C;  3QHT A;  2H89 B;  3VUX A;  3HRD D;  3AB5 A;  4RNA A;  1CK1 A;  2MJ3 A;  2MCN B;  4DK5 A;  4OZC A;  5D6J B;  3DCG A;  1FXT B;  2KLG A;  3OG5 A;  3KLS X;  2DEN B;  1ROE A;  4PS3 A;  4O1N A;  2Y5P A;  3RNE C;  1Z2M A;  1WGR A;  4ZRP A;  2ONQ A;  3Q6B A;  4WWM A;  1IUE A;  2KDE B;  2M1M A;  3GZN I;  1N60 A;  2PTL A;  4ZYS A;  1XF5 L;  2KN4 A;  3ZXV A;  4A20 A;  2M0A A;  2KQS A;  2JY6 A;  2GBK A;  1KF6 B;  2YEP B;  4ZYN A;  3VUW A;  3ZNZ B;  5GMV A;  3GOE A;  2D3A A;  4LNK A;  3AXC A;  3ZJU A;  1TS3 A;  1WXV A;  3A9J B;  3NVV A;  2BS4 B;  2O2V A;  3AN1 A;  2JZ3 B;  3PO0 A;  5LLI A;  2O6V B;  3ZO5 B;  3PRE A;  2KDM A;  1HZ6 A;  3QIJ A;  4J3O D;  5EE0 A;  4OZA A;  4LTU A;  3URY A;  2N0S B;  1ET9 A;  3I3T B;  4M02 A;  4A8X C;  2L0F A;  4IKG A;  3FIL A;  2QCZ A;  3HUI A;  4MGK E;  2E6X A;  3A9K A;  1YN3 A;  3Q3O C;  1ET6 A;  1JML A;  1R4N B;  3Q8F A;  3BYY B;  3MFG A;  2M56 B;  3WIM A;  4N6E B;  1TTN A;  2WXO A;  4ANU A;  2KMA A;  1CZP A;  2YEP F;  3KYD D;  4RFB A;  1K53 A;  4MEL A;  2J0J A;  2RGF A;  2K22 A;  3QAQ A;  2C9W B;  1KJT A;  1TKG A;  3P4Q B;  1EO6 A;  4WH4 A;  2D10 A;  5D94 A;  4RF1 A;  1ZGU B;  4C7Y A;  4KIK A;  5BMH A;  4KVG B;  1ZXI A;  1YNT E;  2R61 A;  3AEC B;  2RD0 A;  2J53 A;  3ML9 A;  4AQ7 A;  2BS2 B;  2PVG C;  3H1U A;  4A9A A;  2NBV B;  4IOI E;  4IW0 A;  1QF6 A;  5EE3 A;  1JAL A;  4GDL A;  4WAF A;  2KT7 A;  2JWZ A;  4TKN A;  1MVK A;  3ALB A;  3TUO A;  2WXH A;  2ZNV C;  2L1A A;  3FIL B;  2MJE A;  1F2R C;  1GC6 A;  1S1Q B;  3A9K B;  1ESF A;  1L5P A;  2WDQ B;  4ZOH C;  4AUQ C;  2XEW A;  1QOB A;  2QJL A;  2LRU A;  4F1S A;  2PEA A;  3IAS 1;  1WM3 A;  1QOF A;  4HK2 A;  3APC A;  4S17 A;  1KLV A;  1SE9 A;  3KW5 B;  5C2T B;  1IBX A;  3L10 B;  2RDG A;  4AOF A;  2KTR B;  3AE2 B;  3ZW3 A;  3O65 B;  2PJH A;  4RM9 A;  1KLU D;  3NG0 A;  4W9D A;  5AEK B;  1P3Q U;  1R4N I;  3A4R A;  2L52 A;  3AEE B;  1RM6 C;  1RWS A;  3ZIM A;  5IN7 A;  3VXW A;  3VQI A;  3JSV A;  4GDL B;  2KDI A;  2VH2 A;  3ZQ4 A;  2DYO A;  1WY8 A;  2K5P A;  3T3N A;  4HPL B;  4GGQ A;  2AL3 A;  1S3S G;  1VRA B;  4TSS A;  2PW9 A;  4WJN A;  2FCM A;  1V1P B;  4GU2 A;  2JRI B;  4BOS C;  1MHH E;  4OVU A;  4GLS C;  2X8X X;  1DYQ A;  2GBR A;  4LJP B;  1OEY J;  4XX5 A;  4F8C B;  3B1L X;  2NBU A;  4IUM B;  1HTQ A;  1J19 A;  1UEL A;  3E9S A;  1EU3 A;  1YMH E;  3OJ4 B;  3VDZ A;  1QT9 A;  4BZA A;  1LXD A;  4NJ6 A;  1WJN A;  3JVZ X;  1WMH A;  4PS8 A;  4LDT B;  2CHW A;  4P16 A;  4J6I A;  2MJD A;  4PYU A;  2KJ6 A;  3DBH B;  1WWT A;  1YJJ A;  2ZEQ A;  4ITK A;  2RPV A;  1XEE A;  4JL9 A;  4EZK A;  1N5X A;  3I57 A;  4YL8 A;  4AS1 A;  3RNB C;  3IAM 1;  3NZS A;  2BWE S;  3Q8B A;  4GDK B;  5G2N A;  3GP7 A;  3JSV B;  3ZDM C;  3R7Q A;  1XLO A;  3L0W B;  1QLB B;  1OGW A;  4W9J A;  4KKJ A;  5C1Z A;  4RMA A;  2KDB A;  3AEB B;  3N9Y C;  1SE4 A;  1YX5 B;  3T3O A;  5J17 A;  4W9F A;  2N4F A;  1TKE A;  3PRP B;  1NI2 A;  3AU5 A;  2WU2 B;  2N9K A;  2PMV A;  1OEY A;  1JWB D;  1YQB A;  3CMM B;  3Q3J A;  3KWL A;  1Q0W B;  2WXG A;  3R2T A;  5FK9 C;  3QK0 A;  3M63 B;  5T8I A;  4FUL A;  4C4V B;  3Q69 A;  2ZZP B;  1V5T A;  2J4X A;  1L4Z B;  2UU7 A;  5JHB A;  1HEZ E;  5MPO A;  1WF9 A;  3H8H A;  4GIV A;  3U2S C;  2HD5 B;  2KWV B;  5I4D A;  5TR5 A;  2Z0D B;  1D6E C;  2LUE A;  1FXA A;  2KJH B;  2VZK B;  1V49 A;  2IJ0 A;  3QWZ B;  2LXC A;  4BKG A;  1F1H A;  1P9D U;  1AYF A;  1V97 A;  3FAH A;  2BT6 A;  3IHP C;  3DBH I;  4C80 A;  1FNV A;  1CMX B;  1F9J A;  1L0X B;  3P42 A;  2IGH A;  1ISN A;  2IO3 B;  2YLM A;  1WIA A;  1ENF A;  2IO1 B;  5JZE B;  3BWU D;  3AUL A;  2TSS A;  1XCT L;  1SGH A;  4G50 A;  3W1S A;  2INP E;  3U7Z A;  1I4P A;  2ZPY A;  2JUO A;  1V5O A;  5C3J B;  2NBW B;  2RSU A;  2PIA A;  1TS2 A;  4G11 A;  4REZ A;  2JF5 A;  1XXG A;  1NDD A;  1KLG D;  1XO3 A;  3BZD B;  3UQA A;  2BPS A;  4CYE A;  3M62 B;  2FCQ A;  1PFD A;  2IY1 B;  3EEC A;  1ZP0 B;  1P7F A;  1E90 A;  1UGJ A;  3W5V B;  4OVV A;  1I4H A;  2JYT A;  3P4S B;  2MA9 B;  3UIP B;  1ZPS A;  2WDR B;  1I4G A;  1WE6 A;  1ZDX A;  4M00 A;  2XN9 C;  2DHZ A;  4ZRK A;  1DOY A;  4NQL B;  4FBJ B;  1CJE A;  1GJZ A;  1FNW A;  2J7Q B;  4M0W A;  1E8Y A;  2N7D A;  1WSP A;  3DBL B;  4XDD A;  4AP4 C;  3N20 C;  3QCA A;  1SEB D;  1WZ3 A;  1EF1 A;  2W3R A;  4LNO A;  1I4X A;  2KJR A;  4FJY A;  2KX3 A;  1J7B A;  2ZCC A;  2D11 A;  2D07 B;  2FUG 1;  4IC7 B;  4HLE A;  2KDF B;  4AJY B;  2IYD B;  1J7A A;  3SFD B;  2GMI C;  1CQV A;  4I6L B;  1PGX A;  2EMT A;  2MBB B;  4WWO A;  2N7J A;  4HJG E;  2GI9 A;  3B9J A;  4G0N B;  2KFK B;  2KO3 A;  3LYY A;  1EF5 A;  3KUD B;  4W9L A;  3KUZ A;  5IA7 A;  1JWS D;  1WGD A;  4ANX A;  2RMM A;  5L83 A;  4LNN A;  1WRI A;  4IM2 A;  1IGD A;  5AZF A;  2VRR B;  3N32 A;  1TZO A;  2DZJ A;  3ZRF A;  1WFY A;  1QKZ A;  3ZJV A;  1SBB B;  2K3U A;  4W9G A;  1OQY A;  3PHW B;  5LNK 1;  2BKR B;  4D2K A;  4E71 A;  4NZL B;  2K39 A;  3SR6 A;  2WHI A;  2MQJ A;  2WXM A;  3WAM A;  1E7P B;  3CIR B;  2MBE A;  1V80 A;  3R3M A;  3H7P A;  2LHE A;  4N59 A;  2BB5 A;  2D3C A;  3ZNG C;  4DXF A;  1AAR A;  3R2I A;  2BGF A;  1YQ4 B;  2HE7 A;  2DWQ A;  2KN5 A;  4B0E A;  1YIW A;  3X23 A;  2WP9 B;  2G9H D;  1HTO A;  2KWD A;  2G45 B;  2IGG A;  5JH5 C;  2NPT B;  3DBL I;  1E9M A;  1E8X A;  5GXG B;  3RPF C;  2OOB B;  2ZPN A;  3EA6 A;  4DXG A;  4FJV B;  2BVC A;  2WNM A;  2JVC A;  5IOI A;  1FNU A;  3RUL A;  2CU1 A;  5CHF A;  4E74 A;  1FD6 A;  3ZXR A;  3Q3M C;  4RGN A;  1V1O A;  4DDI D;  3SFE B;  1ZUD 2;  3UGB B;  3WAO A;  1YJ1 A;  2H88 B;  3B2F A;  2C7M B;  2HJ8 A;  3EGR A;  2IO2 B;  3NUH B;  2V0G A;  4HJK A;  1N61 A;  3TJP A;  4B0M A;  4DWF A;  3PLV A;  2ACZ B;  3NS1 A;  4MJS A;  4KX6 B;  3DDC B;  3H7P B;  3VVW B;  3AE3 B;  3W2D A;  5D3I B;  2DNF A;  4XDC A;  3IT4 B;  3VAW A;  4XWW A;  1YX6 B;  1YJI A;  4C7Z A;  2MX2 A;  1TY2 A;  1HXY D;  2BYV E;  2PE6 B;  1QOA A;  1PGB A;  1D5M C;  1GG3 A;  1L2N A;  3PT2 B;  3LB8 C;  3AE6 B;  4P7I A;  3ETR A;  2MRP A;  4YTM B;  1UD7 A;  1VD2 A;  2W55 A;  4FJZ A;  2MWS B;  2LJI A;  4K3C A;  2N1W A;  2R2Q A;  4YXD B;  3WA0 A;  1LFD A;  3TEW A;  4WJP A;  2BYE A;  3TSS A;  4EEW A;  1F52 A;  1MFW A;  2NTS A;  4IWO A;  1XCQ L;  3GE8 C;  1L6U A;  3APD A;  4JLC A;  3AEF B;  2CKH B;  1T0R C;  1F0Z A;  4KZ0 A;  2KWU B;  1WE7 A;  3C8Y A;  2DYB A;  1WX7 A;  4IM3 A;  2V3N A;  3WAN A;  2Y3A A;  2KQ7 A;  4DHZ B;  1T0Q C;  2QC8 A;  3ZTD A;  1SE3 A;  4F7Z A;  2WQY B;  1UNS A;  1WGG A;  3MJ5 A;  4EZJ A;  4N9F 4;  1J8C A;  3KVF B;  1U4A A;  3LJ3 A;  2GBN A;  3APF A;  3SD5 A;  2ZVN A;  5IO9 A;  2WS3 B;  3TBL D;  2CR5 A;  4KSL C;  3ZVV A;  5KHO A;  1Q1O A;  1XD3 B;  1HA5 A;  3EHV A;  1WJ6 A;  2BQQ A;  2AL6 A;  2JZP A;  1EWY C;  1K51 A;  4IM0 A;  2WXK A;  4NJC A;  3GE3 C;  2KNB A;  2WX0 A;  2NCN A;  4CQN A;  4OW0 A;  5BYS A;  1C4A A;  4ZHP A;  3GB1 A;  2HDE A;  1FCC C;  2O2V B;  3L08 A;  1L4D B;  4GB9 A;  2XK5 A; 
#chains in the Genus database with same CATH homology
 4MM3 A;  2M4N A;  5C1Z A;  4RMA A;  2KDB A;  3QAR A;  2ZCB A;  2KC2 A;  3DQV A;  3OAW A;  4FHJ A;  1IPG A;  3JYU A;  1YX5 B;  5E6P A;  1V81 A;  3A4S C;  3A9J A;  2MBQ A;  2LJ5 A;  2ZJD A;  1JRU A;  3DBR I;  4HVB A;  5J17 A;  4W9F A;  2CS4 A;  2N4F A;  1WXM A;  2LI5 A;  2GBM A;  2ZVO A;  3PRP B;  5CTR C;  1NI2 A;  2KC1 A;  3H6N A;  3T9L A;  3AU5 A;  1WXA A;  2O6V A;  2L76 A;  1WI0 A;  3A1Q B;  2V4L A;  4W9K A;  2A4Z A;  4DHZ E;  1OEY A;  1YQB A;  3CMM B;  3Q3J A;  4MSM B;  3T8M A;  1G6J A;  1Q0W B;  2IO0 B;  2MW5 A;  1WGH A;  1WR1 A;  1SIF A;  4ZRJ A;  2BWF A;  1RFA A;  2WWZ A;  1X1M A;  3CF6 E;  3QK0 A;  4MH0 E;  3M63 B;  4HWI B;  1ZW7 A;  1WJ4 A;  3NY5 A;  4FUL A;  3X0W A;  3R7R A;  2NPT A;  1D3Z A;  2GOW A;  3PRM B;  4AWJ A;  4URK A;  2ZZP B;  1V5T A;  5HKH A;  1H4R A;  3SHQ A;  3VTV A;  2O6V D;  3C0R B;  4KIK B;  5JHB A;  3DVN V;  4HXD A;  3L13 A;  3V60 A;  3SU8 X;  3ZRC A;  1WF9 A;  2NVU I;  3V6E B;  3H7S A;  3MHS D;  2LGX A;  4GIV A;  2NS5 A;  2HD5 B;  1R4M I;  2Z59 B;  2KWV B;  3HHM A;  4WAA A;  1V86 A;  1WR6 E;  4BOZ B;  4ASW C;  4DHJ B;  3PGE A;  2V3S A;  5AZH A;  4MJS B;  5TR5 A;  3VFK A;  2N9X A;  2Y5B B;  2FUH B;  2Z0D B;  2LUE A;  2LVP A;  4NNJ B;  4XZ4 A;  2KJH B;  4XC2 A;  4E3C A;  1V49 A;  5CHV C;  3QWZ B;  2CHX A;  2C7H A;  2L3Z A;  2LXC A;  3L17 A;  4WJO A;  4ZRI A;  2M0X A;  2R2O A;  3ZLZ A;  4BKG A;  1P9D U;  1P98 A;  2KK8 A;  1Q5W B;  3PZD A;  3MJW A;  4WWP A;  1IP9 A;  2ZNV B;  2LRW A;  1XT9 B;  3IHP C;  3DBH I;  1OTR B;  3AU4 A;  1WZ0 A;  1CMX B;  1F9J A;  3KH0 A;  3ZNI D;  1ISN A;  2IO3 B;  2N9E B;  2JPH A;  2YLM A;  1WIA A;  2IO1 B;  2PPH A;  4FHK A;  3UF8 A;  5JZE B;  3PV1 A;  2C7N B;  2LGD A;  2DZM A;  3AUL A;  3HIZ A;  4JQW C;  5IAA C;  4FA6 A;  4PS7 A;  4AJW A;  3W1S C;  1WX8 A;  2FID A;  1SGH A;  4G50 A;  4KSK C;  4X57 B;  4EKU A;  3W1S A;  4HDQ A;  3KYC D;  5J18 A;  2ZPY A;  3PRZ A;  2JUO A;  2JZZ A;  1MG8 A;  1WM2 A;  1V5O A;  2KHW B;  2NBW B;  2RSU A;  3IBE A;  1WRD B;  4G11 A;  2QHO A;  4TQ0 A;  2K8H A;  2JF5 A;  2MLB A;  4MSQ B;  3HK0 A;  1NDD A;  3R66 C;  2JXX A;  4GN1 A;  1E8W A;  3UQA A;  1E7V A;  1WXS A;  2BPS A;  4CYE A;  3M62 B;  4NPN A;  4KDL B;  4WJQ A;  3RUI B;  2FCQ A;  2MSE D;  2J0K A;  2IY1 B;  3EEC A;  2N7E A;  1WYW B;  1P0R A;  3PTF C;  3PS6 A;  5DPR A;  1E90 A;  2JT4 B;  3DVG X;  3V61 A;  3CSF A;  4OVV A;  2MA9 B;  3UIP B;  3TIX A;  3RYT A;  1WE6 A;  2KOX A;  4EUT A;  2KTR A;  2DHZ A;  4A3O A;  2KZR A;  3PSE B;  4ZRK A;  3ZUN A;  1EUV B;  3B0A A;  4K7U A;  4MGZ E;  4NQL B;  4TQ1 A;  4FBJ B;  5DPW A;  1GJZ A;  2AEH A;  2J0M A;  2J7Q B;  2G3Q B;  4BFR A;  1E8Y A;  2AWT A;  2N7D A;  2K25 A;  4AP4 C;  2KD0 A;  4M8N A;  3QCA A;  1WZ3 A;  1EF1 A;  2N1V A;  2KJR A;  4FJY A;  3RT3 B;  2KX3 A;  2ZCC A;  4LJO B;  2D11 A;  2IZV B;  3ENE A;  4DXA B;  4ZDV A;  3QJZ A;  2D07 B;  3TL5 A;  4MEM A;  2M8S A;  2WDT B;  3U30 A;  4IC7 B;  4HLE A;  1J0G A;  1WJU A;  2KDF B;  5D7G A;  3SDL C;  4AJY B;  3QHT A;  4W9E A;  2MBH A;  5G55 A;  1I35 A;  4WQO B;  1LM8 B;  2IYD B;  3UIO B;  3VUX A;  2GMI C;  3B08 A;  1TZ1 A;  5D2M B;  2MCN B;  4I6L B;  1WMH B;  2FNJ B;  3H9D A;  4BKT A;  4DK5 A;  2C5L C;  4BKS D;  2B3A A;  2EMT A;  2MBB B;  3V6C B;  5D6J B;  2DYM A;  1WGY A;  2L7R A;  1FXT B;  2ASQ A;  3BY4 B;  3DCG A;  4FLH A;  2KLG A;  2L8J A;  1HE8 A;  4WWO A;  1E8Z A;  2DEN B;  3VUY A;  4G0N B;  2KFK B;  4PS3 A;  4K81 A;  2KO3 A;  1EF5 A;  1Z2M A;  1WGR A;  3KUD B;  4W9L A;  3KUZ A;  3DPD A;  5IA7 A;  2W9N A;  2KDE B;  3VTU A;  4B6W A;  3DVG Y;  2M1M A;  4NJ7 A;  1WGD A;  3GZN I;  4ANX A;  5L83 A;  4NAW A;  5J2R A;  4IM2 A;  3NZU A;  4A20 A;  2JRH A;  2UYZ B;  2KQS A;  2JY6 A;  2GBK A;  2XK5 B;  3NOB A;  5AZF A;  2I1J A;  2VRR B;  3K9P B;  3N32 A;  4ZYN A;  3KUC B;  2DZJ A;  3AI5 A;  2K8C A;  3D32 A;  3ZRF A;  4IWP A;  1WFY A;  2OJR A;  3VUW A;  3TMP B;  3ZNZ B;  1RRB A;  3NS8 A;  3HM3 A;  5GMV A;  3GOE A;  4FN2 A;  4II2 B;  2BKF A;  2EMS A;  3AXC A;  4W9G A;  1OQY A;  3PHW B;  1E7U A;  2BKR B;  3ZNH B;  3PPA A;  4E71 A;  4HDO A;  3ML8 A;  3A9J B;  1WXV A;  2K39 A;  3U7D A;  4GDK A;  2MQJ A;  3WAM A;  1UBI A;  2O2V A;  1YD8 U;  4NY0 A;  4LDT D;  4ANV A;  2JZ3 B;  1V80 A;  2MBE A;  3ZTC A;  3R3M A;  5LLI A;  2O6V B;  4KZC A;  3ZO5 B;  4PYZ A;  3H7P A;  4M8M A;  3PRE A;  3QIJ A;  2LVQ A;  3ZNG C;  2KAN A;  1AAR A;  2LXA A;  5E6N A;  2UWQ A;  2BGF A;  3M95 A;  2HE7 A;  2KN5 A;  3I3T B;  3VH4 B;  2L0F A;  1LQB A;  1YIW A;  2FCN A;  3X23 A;  4MGK E;  4B9K A;  2I1K A;  2IBI B;  3A9K A;  2G45 B;  3RCZ A;  5JH5 C;  4TUU A;  2K6Q A;  2NPT B;  3DBL I;  5LXI B;  3WIM A;  1E8X A;  2KFJ A;  1TTN A;  4IWQ A;  2KMA A;  4ANU A;  3PLU A;  2OOB B;  2ZPN A;  2KVR A;  4K7W A;  5L95 C;  4FJV B;  2KX0 A;  3ONS A;  3KYD D;  4MGI E;  4HPM B;  2JVC A;  3ZKJ C;  1C3T A;  2Z0E B;  1KM7 A;  3JW0 X;  3RUL A;  2DX5 B;  2CU1 A;  5CHF A;  4MEL A;  4E74 A;  2J0J A;  2RGF A;  3QAQ A;  4W9I A;  5DPT A;  3QX1 A;  1RAX A;  2AYO B;  3IG3 A;  4DDI D;  4FAD A;  4EZL A;  2C9W B;  2V1Y A;  3UGB B;  1KJT A;  3WAO A;  2KXJ A;  1EO6 A;  1YJ1 A;  2D10 A;  3K9O B;  5D94 A;  2MBO A;  3DOW A;  3VH3 B;  1IYF A;  1ZGU B;  2MP2 A;  1QZE A;  2C7M B;  2HJ8 A;  2IO2 B;  4HJK A;  2L05 A;  4KIK A;  3TJP A;  4ANW A;  4KVG B;  3V62 A;  2RD0 A;  5DPS A;  3ML9 A;  4DWF A;  4GXB A;  3S2A A;  5LXH A;  4DDG D;  3H1U A;  2D3G A;  2FIF A;  1GNU A;  2NBV B;  2KWC A;  5CX3 A;  3PHX B;  3PLV A;  4IW0 A;  3W1Y A;  4BKS A;  3ZDT A;  4GDL A;  4MJS A;  2JWZ A;  3DDC B;  2RR9 A;  3H7P B;  4GMV A;  4TKN A;  3VVW B;  4BBN F;  2DZK A;  3ALB A;  2WX1 A;  3VAW A;  1WX9 A;  3QC8 B;  2ZNV C;  2WYQ A;  1YX6 B;  1T0Y A;  1GC6 A;  1V9J A;  2BF8 B;  2MX2 A;  5FR6 A;  3TCA A;  2LZ6 A;  1E5W A;  1M94 A;  1S1Q B;  3A9K B;  3PVL A;  2BYV E;  4CO7 A;  1XQQ A;  5E6O A;  2CHZ A;  4EOY A;  2PE6 B;  2RPQ A;  4DHJ D;  4AUQ C;  3LDZ E;  1GG3 A;  3N30 A;  4HCN B;  4BBN C;  2XEW A;  1A5R A;  1TBE A;  1L2N A;  4I6P A;  2LRU A;  4F1S A;  2PEA A;  2LWP A;  3N3K B;  3PT2 B;  3VHT C;  4BVU C;  4P7I A;  4DBG A;  3UIN B;  2MRP A;  1WM3 A;  2HTH A;  1UD7 A;  4HK2 A;  3APC A;  3BIN A;  1VD2 A;  2DZI A;  1KLV A;  4FJZ A;  1SE9 A;  3KW5 B;  4W9H A;  2MWS B;  1C1Y B;  3L10 B;  3IVF A;  4A3P A;  2N1W A;  2EKE C;  4AOF A;  2KTR B;  1ZKH A;  2L0T A;  2R2Q A;  3WAP A;  1Y8R C;  3O65 B;  3ZW3 A;  2PJH A;  4RM9 A;  1V2Y A;  2K1F A;  3WA0 A;  1LFD A;  2MP2 B;  1GC7 A;  2KKC A;  4W9C A;  4WJP A;  2FCS A;  4M0W B;  2XBB C;  3P2B A;  1K8R B;  2BYE A;  4W9D A;  4EEW A;  4I6N B;  5AEK B;  1P3Q U;  1R4N I;  1V6E A;  4IWO A;  3A4R A;  3OLM D;  3ZIM A;  4CHK A;  1GUA B;  4ICU A;  3VXW A;  1BT0 A;  2LGY A;  3VQI A;  3APD A;  3JSV A;  2LAS A;  2KDI A;  4GDL B;  4JLC A;  2CKH B;  1WH3 A;  2DYO A;  4MGY E;  5CHW A;  1WY8 A;  5DCN A;  5BO4 B;  4KZ0 A;  2KWU B;  2BYF A;  1WE7 A;  2REX A;  3U8Z A;  2L00 B;  4HPL B;  2GBJ A;  4GGQ A;  2AL3 A;  4II3 B;  2DYB A;  3WAL A;  1S3S G;  1TGZ B;  1VCB A;  2KLC A;  3DVN U;  1WX7 A;  4ICV A;  4IM3 A;  4JGH B;  4WJN A;  1PQS A;  2FCM A;  4GU2 A;  2JRI B;  4BOS C;  3WAN A;  2KQ7 A;  5AZG A;  4DHZ B;  4OVU A;  3L16 A;  2A5U A;  3Q3F A;  3RZW C;  2G4D B;  3ZTD A;  4TV3 A;  2GBR A;  4F7Z A;  1WGG A;  4LJP B;  3DBS A;  3EFU A;  1OEY J;  4XX5 A;  4IG7 B;  2YVC A;  3HM6 X;  4K1R B;  4EZJ A;  4F8C B;  3B1L X;  5EDS A;  1UH6 A;  4MDK E;  2K6D B;  2DAJ A;  3QA8 A;  4N9F 4;  1J8C A;  2K8B A;  3KVF B;  3L54 A;  4GOC A;  3A1Q A;  2NBU A;  1U4A A;  4G3X B;  4IUM B;  3LJ3 A;  2GBN A;  3APF A;  3SD5 A;  3VTW A;  1RLF A;  1J19 A;  1UEL A;  2C60 A;  2IY0 B;  1KOT A;  2ZVN A;  3RZF A;  1UBQ A;  2KMC A;  4RM8 A;  3QQ8 B;  3OJ4 B;  3TBL D;  3VDZ A;  2CR5 A;  1NBF C;  1LXD A;  4KSL C;  3ZVV A;  4NJ6 A;  5KHO A;  1WJN A;  1Q1O A;  1XD3 B;  3JVZ X;  3ECI A;  1WMH A;  4PS8 A;  4NAW B;  2LD9 A;  3EHV A;  2CHW A;  1WJ6 A;  3M3J A;  4LDT B;  4EFO A;  4J6I A;  3A33 B;  1UZX B;  2AL6 A;  2KTF A;  2NR2 A;  4K7S A;  4PYU A;  3RD2 A;  2DAF A;  2FAZ A;  2M17 A;  4KV2 A;  1P1A A;  2KJ6 A;  4KDI C;  4IM0 A;  5JHA A;  1I42 A;  2ZEQ A;  3NHE B;  2D2Q A;  1L7Y A;  2KNB A;  3OJ3 A;  3UQB A;  4JL9 A;  2N9P C;  2WX0 A;  2KFK A;  5C23 A;  1UGM A;  2NCN A;  4EZK A;  4HCP B;  4YL8 A;  3MTN B;  4JIO U;  1H8C A;  3NZS A;  2BWE S;  2LVO A;  2PE9 A;  3CST A;  4GDK B;  4LCD E;  5G2N A;  5KHQ A;  4B95 A;  3JSV B;  2O2V B;  3IFW B;  3L08 A;  4NQK E;  3ZDM C;  3R7Q A;  4WWN A;  4GB9 A;  3L0W B;  2XK5 A;  1Z5S B;  1OGW A;  4W9J A;  3EC8 A;  4GSW A;  2G4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...