1L3BA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, c2 spacegroup w/ long cell
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3bA00
3KQMA 2YQZA 2ZBPA 2ONYA 3KPVA 4RV9A 9MHTA 3TOSA 1P91A 2XVAA 3UJ6A 2ZBRA 3D2LA 3K6RA 2IH4A 2H11A 3L8DA 3LL7A 4E2WA 1AV6A 1JQEA 2VDWA 2H00A 3GRUA 3ORHA 3DXZA 4IV8A 2YXDA 4GOLD 1RJGA 5C9ZA 2PT9A 5K05A 2DULA 2QE6A 3HVJA 4LG1A 3OZRA 2A14A 3TLJA 5CVDA 5FWDA 3SGLA 3HA5A 3HTXA 2NP6A 3GRYA 4C07A 5HIMA 3EVEA 5DRYA 3UJ8A 5DM1A 4P58A 4DMGA 3DMHA 4PNEA 1HMYA 1QYRA 3EMDA 1SQFA 3BGIA 1NE2A 3EPPA 5E9JA 3OZTA 3LHDA 1G38A 3P9CA 3CJRA 3OFJA 5EKUA 3RODA 3HNRA 2VP3A 3PX3A 2G8NA 5DX0A 1JQDA 5K09A 2YX1A 3BXOA 5CUQA 3B3FA 4ER0A 4C04A 3LDGA 2AVNA 3TKAA 1OR8A 2ZLBA 3UJBA 5U4XA 4ER5A 4GUAA 1ZGJA 4CWAA 3M70A 3KU1A 1NKVA 5HOQA 3G7UA 3KR0A 3T7RA 1NW7A 3JWJA 2G1PA 5E8JA 5CCBA 5E1BA 1RI1A 5DSXA 1XTPA 4GOOD 2P7IA 3JWHA 2QY6A 2ZWAA 5K0EA 2P3QA 3VYWA 3ER8A 3B89A 3CC8A 1QANA 2O06A 3LGAA 3G8AA 5DTMA 3SSNA 4BLWA 1MHTA 2V74B 3ELDA 3LCVB 2PWYA 3EGIA 4G56A 2UYHA 1B42A 1UWVA 4YV1A 2IIPA 3EEOA 1N7JA 3B7PA 2ZW9A 2NXJA 3GIWA 2BH2A 1PJZA 3DXYA 1N7IA 4X63A 3HCEA 4GC9A 1X19A 3MTEA 2CL5A 5EVJA 2AN3A 2FPOA 5B1SA 1NW8A 2FRXA 1R6AA 2O05A 4DF3A 3EMBA 1MJFA 3O4FA 2IFTA 5K8VA 4KVZA 3B3GA 5T6BA 3CBGA 1EQAA 3P97A 5E9WA 3SSOA 2IH5A 3KPYA 8MHTA 4KWCA 4IKPA 3G2QA 1L1EA 1KXZA 2GLUA 3HP7A 5CVVA 4CKCA 5T64A 2PT6A 2AOUA 2AVDA 1VP3A 5FQOA 4POOA 1RI3A 1FP2A 1JQ3A 3FPEA 4PINA 5E1DA 2I62A 2PGXA 3E05A 3O7WA 1ZKDA 3FTFA 3FRHA 5DSTA 3G88A 1F38A 2CMHA 4RYLA 4C4AA 3NVKI 5EG5A 4PYMA 3C6KA 4XUCA 4V0RA 1NW3A 4OBXA 4CTKA 2NYUA 1QAMA 2Z6QA 2Y1WA 2IBSA 3FUVA 5DLYA 4GBED 5F2NA 2FCAA 4AZSA 5DRTA 1VE3A 3FTDA 4UOEA 5E1OA 3P9KA 3MAGA 4AZVA 4OX9Y 3PLAE 2GH1A 4QDJA 2K4MA 3LCUA 2JJQA 2P1DA 3E23A 3IV6A 2JH8A 2QRVA 2OBFA 3PFGA 2OYRA 1PRYA 4F86A 3ER9A 4FGZA 4C03A 3DMGA 4R8RA 1R74A 2IPXA 5CVEA 3CJQA 1VQ1A 2PX8A 5FQNA 1TW2A 3T0IA 3VSEA 2HMYB 3H2BA 5T67A 2BM8A 3TPZA 2ZTHA 4HTFB 3PVCA 4A6EA 4MTLA 4FSXA 4LECA 3UJ7A 1DCTA 5EHGA 5CVJA 2HNKA 3BWBA 3KQWA 3LSTA 2ESRA 3R24A 2PXXA 1U2ZA 4P7KA 5EIFA 2VS1A 5FA5A 1M0EA 2PKWA 5FWAA 4Z2YA 4CXMA 5EOVA 3HVIA 4HC4A 3RIEA 2AOTA 2R6ZA 5GIOE 2ADMA 3R6TA 5LQAA 2QYOA 5E2AA 2WA2A 4YMHA 5CCXA 2ZFUA 2XYVA 3LCCA 4NECA 5FADA 1JR4A 3DLCA 1WG8A 1JG3A 3FUTA 3BZBA 4PONA 3TFWA 5GM2A 3UA4A 4DCMA 3G5LA 3JWGA 4YUYA 5EIWA 2P7HA 2UYOA 4BP3A 4CTJA 4FR0A 4GEKA 1I4WA 2P35A 1ORHA 2PBFA 4PCAA 5GWXA 3UBTA 3A25A 3C3YA 5GINE 4RVGA 4OBWA 1O54A 1AQIA 3I5UA 3BKXA 4HRAA 1AQJA 2NP7A 4R8SA 4P7GA 5ERGB 3LDUA 3EVGA 3KKZA 3NVMB 5DM2A 5GIPE 4F85A 5DXJA 2P8JA 2IGTA 3FPGA 5K0BA 10MHA 2OB2A 5P8WA 4HGZA 4YV0A 3SM3A 4PCLA 3EVCA 4PYOA 3P9NA 5ICFA 4RTQA 4KRGA 3SVZA 5ICGA 5LSAA 5DWQA 1JTFA 1RJDA 3TKYA 3MCZA 3PX2A 3FUXA 4EKGA 3BUSA 2BZGA 3T7SA 2JG3A 2ERCA 5EEHA 5EQJB 2AR0A 3F4KA 4QVKA 3ELWA 3HVKA 1SUSA 3A26A 4ER6A 1DUSA 4RTSA 3MERA 4ISCA 3FRIA 3LKDA 3SR4A 1XCLA 2YVLA 4FSDA 3B5IA 3UJ9A 1X1CA 1YFJA 4QPNA 2G71A 3U81A 1D2CA 3FPFA 3G5TA 3K0BA 5BP7A 2OZVA 4FT2A 1ORIA 3AJDA 3LKZA 3V8VA 1R18A 2AS0A 2CMGA 2CWWA 5LQRA 3ME5A 3G89A 1R00A 2P41A 3I9FA 3DTNA 3GO4A 5K03A 3KR1A 3FZGA 1X1AA 3EVBA 3DP7A 1X1DA 4PYLA 4DKJA 4E70A 4RX1A 1AF7A 1SQGA 3GCZA 1D2HA 1QAOA 5GP1A 2AN4A 2AZTA 3TM5A 3VC2A 4H0NA 4Y2HA 1YZHA 1JG1A 4R05A 5HILA 5EZQA 5EPEA 2B3TA 2G70A 3NTVA 3P2KA 1X1BA 5F2OA 1BHJA 2PXAA 4X41A 2B25A 1G55A 2QM3A 2BR5A 4E2YA 5K0FA 1IM8A 3OE4A 1NV9A 1Q0SA 2QRVB 4HGYA 1TPYA 3TRKA 3DOUA 2EJUA 3PS9A 2NXEA 2PVCA 1RI4A 2CKDA 3BWMA 7MHTA 5CVUA 4RTPA 5ICEA 2R3SA 1EJ0A 1WS6A 2P3OA 1H1DA 4OA8A 1RI5A 5FUBA 5FULA 3GDHA 4L7VA 5LQJA 3C0KA 3IHTA 3TMAA 4ATNA 2F8LA 2KW5A 3EVFA 3KHKA 2B2CA 2Z6UA 3NWBA 3Q87B 1EJ6A 2G72A 4FS8A 3T7TA 1YF3A 3LECA 1IXKA 1YZ3A 3QOWA 5EC8A 3A4TA 1NBHA 5E8RA 4U7TB 3A7DA 5EKXA 1O9HA 4FT4A 2VZ9A 4B17A 5EGSA 5BXYA 3HCAA 2XBMA 2XVMA 3VC1A 4RTLA 4RVFA 2AOXA 3BWYA 1VBFA 4DCGA 5CM2Z 2P40A 3LDFA 1IY9A 4GOMD 4E2XA 4X60A 1RJEA 2VDUE 5G02A 3KPWA 5LQCA 3G2MA 5HZMA 2YR0A 1G6Q1 5GOZA 3NJRA 5GM1A 3IYLW 3P9IA 3PB3A 1NW5A 3EEYA 4PYKA 1I9GA 3UJCA 5DT2A 4CKBA 4YUZA 4M36A 4MHTA 3AY0A 3AWIA 3TM4A 1YUBA 3G2PA 1Y8CA 5LQNA 1EIZA 2B9EA 5JR3A 3GU3A 5KS2A 1FJXA 5HEKA 1R8XA 3I64A 2YXLA 1KYZA 3EVZA 4RTKA 2Z6AA 2O07A 2PX4A 2FK8A 3FUUA 3LPMA 3NMUF 3R0QA 3P2EA 3GXOA 4XUDA 4QTTB 4EKIA 3BT7A 4PYIA 4GC5A 4RTMA 3KPUA 3KQVA 4PGHA 3KQOA 4YMGA 4C08A 2HWKA 4IV0A 3DLIA 1BC5A 4RVHA 2JHAA 3C3PA 1ZGAA 3KQPA 3HM2A 2FYTA 4QDKA 2ZIFA 2UZ4A 2I7CA 2UYQA 3THSA 2PSSA 3GWZA 4E31A 4BLVA 3IEIA 4DZRA 4YUWA 4V0QA 3KQYA 2UYCA 4M7RA 5LR6A 1WZNA 4KIFA 3M4XA 3GRVA 3CKKA 4M38A 5M5BA 2XYQA 5E1MA 4EK9A 4XCXA 1NBIA 3DMFA 5FCDA 4ER3A 3OZSA 3TR6A 2C7RA 3A7EA 2E5WA 3REOA 5FHRA 3RW9A 4IWNA 3I53A 5EEGA 4K6MA 4AZTA 3EVAA 1Q0TA 3M6WA 4E2ZA 3ANXA 3OFKA 5KYGA 2WA1A 4M37A 3JWIA 2O57A 3CJTA 4EQZA 3AXSA 3ELYA 3M6VA 1YB2A 2PY6A 2OPBA 3MTIA 1VIDA 2Y1XA 2EJTA 4C06A 5CIYA 2C7OA 4BY9E 4KDRA 5DM0A 4ER7A 5HIKA 5K0JA 4RSRA 1BKYA 1XCJA 1ZQ9A 2GPYA 4RWZA 5D1HA 1WXXA 4U7PB 3OU7A 1JTEA 3R3HA 4F84A 1XJ5A 1EAMA 1JSXA 1XVAA 4HSGA 4P7JA 3THRA 3P2IA 4EVIA 5EMKA 1KP9A 5K0GA 4GQBA 3KR9A 1BOOA 1KIAA 4PYNA 3C6MA 4PIPA 3SMQA 1VPTA 3OU2A 4XUEA 1EG2A 3Q7EA 2H1RA 1KR5A 4PYQA 2PXCA 3UJAA 1KPIA 3ELUA 3HCFA 5K0LA 4CKEA 5EMLA 4X1OA 1JSZA 1UIRA 4QPPA 4DA4A 2YTZA 4AZWA 3HCBA 1SUIA 5KVAA 2ZZNA 1KHHA 2NXNA 2WK1A 1RI2A 3A27A 3DULA 3EGEA 5IH3A 2HTEA 5LQKA 2XYRA 5FA8A 4E30A 3MCTA 1FP1D 4QTUB 2OXTA 2PWPA 3DR5A 3HA7A 5EMJA 2PLWA 2AN5A 4MQ4A 1KPHA 3HA3A 2P3LA 3MB5A 1XXLA 5K01A 3OE5A 4GOND 4LWPA 3GGDA 1NW6A 4BP1A 3X0DA 5DM4A 5IKMA 2PV0A 5DX1A 5LQUA 2C7QA 2ZVJA 2FK7A 2I6GA 2V7EA 3NWEA 1SKMA 5C1IA 3R9XB 4DM3A 4X61A 4AX8A 1YFLA 2IP2A 2IDJA 3V97A 2AOVA 3TQSA 5MHTA 3G8BA 1RJFA 3KQQA 2O0LA 2GS9A 2IH2A 2LD4A 4YUXA 4O29A 3CVOA 1FPQA 2JHCA 2ZBQA 4Y30A 1KYWA 1P39A 1DL5A 1VP9A 5DXAA 3QV2A 5HIIA 2OY0A 5E2BA 3B3JA 4YUVA 4WVLA 5DTQA 3E7PA 5DX8A 3FTEA 5CD1A 3DXXA 4BLUA 1N2XA 3UJDA 4FP9A 1NT2A 3WSTA 2ZZKA 4OA5A 3KQSA 2YXEA 3GJYA 3ID6C 3EGVA 1UFKA 2HV9A 2JHPA 3BKWA 4ZTBA 1I1NA 1L3CA 1T43A 4MWZA 2ZWVA 2EFJA 4KDCA 4E33A 2PJDA 3FTCA 2ORED 3HVHA 2ZCJA 4HH4A 1L3IA 1ZHFA 3E8SA 4PGGA 3I58A 4KW7A 2OO3A 2GA9A 1WY7A 2OKCA 1JG2A 2ZULA 2ZIEA 3KPJA 3LBFA 5K0NA 3UFBA 5HFJA 5K0CA 2N47A 3MGGA 3FPHA 2ZSUA 5HIJA 2ZZMA 2B78A 3CCFA 1SVUA 1F3LA 4PWYA 5F2KA 5DPMA 3BGVA 3DH0A 4RVDA 3QOXA 3OPNA 1XDSA 2C7PA 2PX5A 5DTRA 2NNWB 3UA3A 3ERCA 3BWCA 1TW3A 2Q41A 3FPJA 3LBYA 3SXJA 4JXJA 4E32A 3OU6A 4QQNA 2BR3A 4R6WA 2AOUB 5JUWA 1P1CA 1VL5A 2FHPA 2IDKA 3FYDA 4MIKA 4FZVA 5EMMA 3MHTA 1INLA 5FTWA 4AUKA 3FYCA 2AOTB 3SSMA 1XDZA 3NDJA 5E9QA 1L9KA 4KIGA 1ZG3A 2GAFA 1XDUA 2JH9A 1FBNA 3P71T 1R8YA 1G8SA 1L3BA 1D2GA 4RTNA 3OCJA 3PT9A 4WXHA 5EHIA 1NV8A 2AOWA 2ZIGA 1QZZA 3G2OA 5D1NA 4YV2A 3M33A 5BW5A 3O31A 4HTFA 4A6DA 5ICCA 3M6XA 4RTOA 1Z3CA 3PFHA 4R6XA 3SX0A 2I9KA 5H02A 1QAQA 1O9GA 2VDVE 3S68A 2PX2A 3MQ2A 4P7FA 5KQSA 5FHQA 4DQ0A 2IBTA 3BGDA 4QQKA 1G8AA 3LX6A 3HEMA 2BR4A 2GB4A 3KR2A 1HNNA 1VLMA 3GRZA 1WXWA 1M6EX 1SG9A 2NXCA 2YUIA 4OQDA 2DPMA 5C0OE 1M6YA 2BM9A 3UWPA 3P8ZA 3PTAA 4HG2A 4PIMA 3CGGA 3M6UA 4RTRA 4GF5A 4LWOA 1V39A 5EZSA 3EVDA 3UZUA 2EG5A 1KPGA 4RTJA 4QVGA 3HCDA 3NW9A 1JG4A 3GRRA 3FUWA 3NDIA 4C05A 3HCCA 1G60A 2OB1A 3AXTA 2HR1A 4PYJA 5KQRA 3GNLA 2EX4A 1P1BA 3DUWA 3KQTA 5BW4A 4EMSA 2ONZA 4OQEA
chains in the Genus database with same CATH superfamily
4ZAWA 4ZHQA 3ZJVA 1BH6A 3QRWA 4ZQGA 4FOOA 4OUDB 2IH4A 2ZROA 3WYEA 3WGZA 3F73A 4LJRA 2X13A 3B6JA 3RRJA 2HIHA 1Y48E 4Z86A 3EZ9A 1UBOS 3D6TB 1DAHA 4HD8A 3QWHA 5EYPB 2FPPB 3MJDA 2DULA 4L95C 5K2OA 3UQYS 3AOEA 2V6IA 3HJBA 4D6YA 4RDIA 2UU9B 1RRGA 3ENQA 1L7XA 1DJQA 3QNWA 3TK1A 4P58A 4TQGA 4NIMA 3FA2A 4NYIQ 1M34A 2WE7A 3FR8A 4KTTE 1LRLA 4EF6A 3P9CA 1M1NA 4KN5A 5CT5A 5EUCA 2ZS9A 1YE8A 1CUCA 1VBMA 4E7PA 1JQDA 2IV2X 1R37A 2PZGA 1N2IA 3FCUB 4ER0A 1YB6A 2C96A 1L7DA 1ENZA 3B20A 4PNPA 4D9NA 3VSAA 5KTNA 4EZIA 4CWAA 4I1RA 3ZWMA 4PS1A 4JKIA 4HNTA 4TSFD 1NKVA 1UXIA 2VQ3A 2Y1LA 5DHRA 2W2XA 4YWJA 4JI6B 4YT4A 4GUDA 1CJCA 3RKUA 4MS4A 3E7FA 4XKJA 3OHPA 5TMDA 1RCUA 3H0KA 2C7VA 1JQAA 3HXPA 4GOOD 4KVAA 1MW9X 5LBUA 3TQIA 5JATA 2P7IA 2R11A 4KE6A 5K0EA 4XVRA 2YWHA 1CP3A 3QEMA 3WQBA 1G0NA 2GARA 2GMWA 4W7SA 3TD2A 3VO2A 1ZJ6A 3LIPA 1KQOA 4IJVA 4PFQA 2BSQA 4YRBA 1IONA 1YZLA 1ZD3A 5B1DA 4DEVA 3DXYA 5FR2A 3JQGB 1U2EA 3HCEA 4FWBA 2BM1A 4EGCB 3ZEIA 1SOAA 1UJ6A 5TQ0B 4D25A 4L85A 1MA3A 2QPAA 3FVRA 4BDTA 4CEIA 4HUJA 2DTDA 2LW7A 3C4JA 4P9NA 5CX4A 4GMDA 4R1NA 4OHOA 1ZQ1A 3IOMA 3VAZA 5CDSA 3G3EA 1WVMA 1NVBA 1RXSA 2LUOA 4J0GA 4TTQA 3NWPA 3ZBPA 4XVUA 5AHRA 4POOA 1RQGA 2EEPA 1BDMA 1FP2A 3EQ7A 3J81A 2Q1WA 3KWLA 3O7WA 1O95D 3E2PA 2W6JA 3H9CA 1EE1A 4BWFB 1JHXA 4KR3A 5C2JB 4IINA 5TPZD 1J5PA 4D5EA 1H66A 1UDCA 3QU7A 4AJJA 1FJGB 3VNBA 1QK3A 3JRWA 3EXIA 1TF5A 4JELA 4AM8A 3U1BA 2DCMA 4HB0A 1ZL2A 1N6RA 4HPWA 2WJ4A 1P2TA 1T8TA 4LGYA 1QPBA 5B55A 5CU7A 2IP4A 1Z2AA 3K16A 4OH1A 2GH1A 1G5QA 2Q5OA 2K4MA 1QIKA 3CH4B 2O2IA 2QRVA 2OBFA 3TTYA 4CIXA 3P0HA 4E5YA 3VC3A 4F9FA 1U4OA 3WHKA 5T67A 4H7FA 1ZAYA 3G9TA 1YVDA 3SEQA 4HSEA 4N49A 4LPSA 4UUBA 2PZLA 4BAGA 2E48A 4JK3A 5J2UB 1JQLB 2YZNA 4IYRA 3DNMA 5TGDA 4P0QB 2JF0A 3I76A 1JVSA 3WK7A 3FNGA 1KVUA 3DZIA 1N2SA 4PE5B 5DM60 5J2TA 5FA5A 2R4QA 4CCSA 3JRNA 4CTOA 4KWEA 4Y2GA 1EUCA 4L0QA 1G5FA 4RHXA 4BGEA 1EHCA 1BX3A 5LQAA 3A4IA 4LVOA 1MB2A 1H23A 3BH6A 3KOZA 4QOHA 3VR5D 4FXPA 3W5UA 4YRCA 3L4KA 1A8IA 3I5AA 4MNTA 2VHXA 3AV0B 2PDAA 2CV2A 1UJBA 1D8AA 2UUAB 3G5LA 4DV2B 4X65B 1NX6A 3HM9A 1I6LA 5DYGA 1JDZA 4PCAA 3U3XA 4DVJA 1Z63A 1WA5A 3NHAA 4IIYA 1MB9A 3I9OA 4OBWA 2Q5QA 3QEOA 1WUIS 3RYFA 4JT9A 1RCFA 2AL7A 3MTJA 1DPGA 2XA9A 3DFFA 1M2EA 4M2LA 2XB6A 3PEUA 2G1AA 2XE4A 5KYWA 3SF0A 4BTEA 2IGTA 4L0DA 2GHIA 4NZZA 3VSDA 3SJZA 5P8WA 4RMGA 3E03A 5SY4A 5CVTA 3AW9A 3HP1A 3V80A 4DYDA 4A10A 3RYIB 1JEYA 4LC9A 1G5PA 4CIAA 2WKWA 5TF0A 2ZRCA 4Y2QA 1BU8A 3QBDA 3DSRA 1ODJA 1B6GA 3R09A 4QNNA 4B3HA 1FDWA 4IDPA 2AR0A 5EQJB 4F7DA 3S8YA 4GOJA 1D6MA 5GVRA 2HWUA 2PFGA 2H7YA 5E0KB 3F3MA 3UT5B 2ODEA 5ESDA 2GEDA 3CF0A 1OAAA 4UZEA 5HZHA 4U2GA 3A4NA 3KTAA 1HA3A 3DPUA 4L50A 1F4VA 2G71A 5CNMA 3SHQA 4DUPA 1PJRA 4YJHA 1QCCA 4P4LA 2BYTA 4YT2A 2OZVA 3DPSA 1JYEA 3WQHA 3OZDA 3GLGB 4FYYA 1K8YB 4K6HA 3SQNA 1DEOA 2C3YA 1FA9A 1TVEA 4MZDA 1BX0A 3N07A 3KR1A 2E21A 5AFSA 1SUFA 3HR4A 3EVBA 4GVXA 3HKCB 4M1YA 4JLNA 2POCA 1JQKA 4AW9A 1ESNA 2K7FA 4RLHA 2WF8A 2A9OA 2AZTA 1OWMA 2CUTA 4NENA 3OJLA 3A05A 3JTMA 4Y2HA 5F2EA 4AF8A 4CCWA 3EXG2 2VTKA 3SE0A 3VPGA 4I0WB 2X7JA 1YA8A 2WT8A 2JCGA 2X6QA 3L02A 3P0IA 2FXIA 1O96A 4HDSB 5K0FA 4UMVA 1PJAA 3OPMA 1A8QA 2Y1GA 3F67A 1L4MA 4PRLA 4XOUA 5DHSA 1ODKA 1HLPA 2OCBA 1IN6A 4I9UA 2AJTA 2VYND 4D8VA 1PR6A 5JRZA 3VO9A 1EJ0A 4YJGB 2VJLA 5JJCA 1KZ1A 1EFPA 1PW5A 1XWWA 4F1KA 4GG1A 5FV7A 4N0QA 2K2QB 2IY7A 5E6UA 3GDHA 1NYQA 5AKEA 3IHTA 4J1TC 2GPAA 5DLDA 1PS0A 2FEXA 5ALHA 4Q01A 2PLFA 3QYPA 1QX4A 2CVFA 2PUHA 5CLJA 1PUJA 1JP7A 3FOZA 2FZGA 4B31A 3ZW7A 4Q6BA 3S2SA 4MDEA 5A05A 2A7QA 1DWPA 2C0PA 3DBLA 4G1UC 2XGGA 3E9MA 3AJ9A 3T7EA 3GMTA 2VF4X 4C3ZA 4Y2SA 1XPJA 3LDFA 4X7BA 3QKTA 4NBSA 4Q03A 2FP4A 3WADA 1EBBA 1UC5B 3IL2A 1I2AA 4MRRA 1P1JA 4X7RA 1VRCA 1RLOA 3PB3A 3O9MA 1Z6QA 3W5VA 3B6ZA 2FP4B 1TEXA 3I39X 2G0TA 2ZAOA 5FWYA 1EEXB 1YTUA 2X4IA 2HDWA 2J32A 4C89A 4QPDA 2JIZD 1J2TA 2FZLA 1ZP6A 2UAGA 1UBCA 5D3KA 1CY4A 3IPCA 4JJAA 4RTKA 1X1QA 3EXFA 1ZUHA 1M7GA 2EGHA 2ZSFA 5I9SA 4EFNA 3BK2A 1U4SA 3TVYA 2RHBA 5F3RA 4YMGA 4ZC8A 5A9TA 3VNAA 3HV0A 3NIDB 4QO7A 1RHMA 1KZ4A 1SIBE 2YJ5A 4MAAA 1DX6A 3P9RA 4MVJI 1JBQA 3FPCA 3NRCA 2B1IA 1Q1NA 3C3AA 4DZTA 3VR3D 3RVNA 2GJSA 4M7RA 1NM5C 4KYIB 3SIXA 4ANFA 2RHJA 3DEIA 3IESA 1QE0A 1YOBA 4U02A 4YLGA 4XWTA 1ABBA 4XW2A 2HNAA 2ZJFA 2E5WA 1KAGA 4H27A 2H92A 3KEQA 3VU8A 1OXBB 4C3UA 3MJFA 1J07A 1VPEA 2VZ0A 2HHAA 1Q15A 4JUBA 5B1EA 2ZJZA 4EQ6A 1N32B 2QV7A 2AFVA 1ZM4A 1GGFA 3M6VA 2D0DA 3FKSD 3ROMA 3FLMA 3AU8A 5KINB 3AOGA 2BFDA 2QQGA 3KT0A 3MUNA 5AHOA 3N5CA 1RFGE 1MQ8B 1T5OA 1E1QA 1QH8B 2IXDA 5CTAA 5ICSA 1JLKA 3DE0X 2QR5A 1HQYE 4E51A 2H08A 1SU4A 5EHNA 1P6UA 2V98A 3ESBA 2XT0A 4ZVNA 3BHJA 1M8FA 3TG8A 3JS5A 4UXHA 4L9AA 2JFOA 4GMKA 3NC0C 4LJLA 4BO0A 3VC7A 1PEDA 3NHBA 3HCFA 1WCIB 3CLTC 3DG9A 3PPIA 4BN4A 4EA8A 4MP3A 5E0OA 5HF6A 3UQZA 1ML4A 4B5KA 4FN4A 4M76B 2Q0SA 3OWHA 4BQNA 1I7PA 1SG6A 2NXNA 1C1XB 3FOCA 1U6KA 3I2KA 3RRYA 1DAEA 3UH0A 5AESA 4OGLA 5FA8A 1P81A 4HGQA 1NTRA 3MS4A 1W4AA 1TYDE 2HRQA 5EP1A 4E13A 4GZ6A 4ROSA 2DT8A 3GUZA 1DIHA 1DRVA 2R6AA 2G6BA 2X0NA 3HFRA 2PUEA 3K2EA 2DKFA 2EVWX 3IEMA 2PFKA 1QQ6A 3H0CA 1I6MA 3IKLA 4HMPA 1XEWX 2WILA 3UMFA 3ZUPA 2RAUA 2B7BA 3N9IA 3RU2A 2LPMA 4BMCA 5BQ3A 2OFPA 4BMVA 5L40A 1YZNA 4X61A 2IP2A 2IDJA 3U3JA 3HB1A 3NTOA 4MPJA 4Q15A 2XLBA 2J5QA 4KXXA 1I80A 2OXFA 2NSYA 4WJKB 2E37A 3KV3O 5JFOA 4UE3S 1KQ3A 4TVOA 4MUGA 1Q11A 5DXAA 3WNQA 1DL5A 4G9GA 4HRYA 2I4RA 4UULA 4EUHA 2IHKA 4OGKA 1F1JA 1YONA 1Z2EA 3FDIA 5TRTA 1L5HA 1E6LA 4O8CA 4INOA 1FNBA 1W76A 4LC1A 4YAKA 3LQ4A 6REQA 2G9ZA 3I9V1 2ACVA 1WPRA 4GX2A 5I51A 3P5BA 1CJSA 1V8DA 3UWDA 4F4CA 1XHFA 3HUDA 3RT9A 5C1OA 4HB4A 3WSTA 3FWPA 4LYYA 1ZM9A 3DW1X 3KQSA 1PSDA 1RWWA 3KWFA 1AK2A 1WUJS 1UEXC 1XZCA 3T3DA 3D8SA 3TQCA 5BUZA 4IDBA 1XF1A 2HV9A 1FQKA 5DVZA 1L3CA 3ADDA 3I6BA 1E77A 2RHMA 2ZWVA 2P4QA 3FVWA 4HY3A 4MWZA 1W73A 4Q4AA 1RZ3A 2J0EA 3A28A 3O3MB 3WFIA 1NY5A 5F1YA 4DNQA 5KMGA 4DLYA 2IS1A 4H3SA 4QT0A 5IFKA 2NU6B 2ZI6A 1JIXA 2BW0A 1NSYA 2P5SA 2XODA 3T0GA 1WY7A 4BOYA 2AC4A 1QIMA 4AG3A 5CB4A 4W1RA 2N47A 3D4BA 3ZXIA 4ESOA 1W2HA 3L6DA 1SRRA 4RHEA 3CG0A 3QTBA 5FI3A 2ZZMA 3R0JA 4TTTS 5F78A 1H2ZA 3DH0A 5LYJF 4KGVA 4YA6A 3ICEA 3NV9A 3ODPA 2O8CB 4MHSA 3MBKA 5CT6A 5L3SB 5TJ9A 2FPGA 3AUKA 1SPBS 4DHEA 4LHEA 3C14C 1RBZA 1S7CA 1B3BA 4FEYA 4JP2A 1HFKA 4LTNA 3KZMA 2HDOA 2ZRMA 4QQNA 1L5SA 1PK7A 3QVXA 2FHPA 2VDWB 4HEHA 2I7VA 2QJTA 3M4JA 1PK9A 1Y1TA 4N3AA 4IHJF 3RVSA 4FINA 4UEOA 1JKJA 2Y4OA 5HKAA 1OBHA 5A1TA 2X3FA 1QGDA 2LP4Y 2Y05A 2H29A 2V7WA 2B21A 3ZUGA 5KPDA 4DR3B 1QHSA 3TSAA 2WINI 4PU0A 1R8YA 2W2MA 4QAQA 2N1MA 2WM2A 3OPYI 4RPLA 3OCJA 1Q19A 2YVQA 1QZZA 2A0XA 4A16A 3MLEA 4J9UE 4ZYYA 4G65A 1N5KA 2KHZA 5IJ9B 3H9GA 2G7MC 1WZIA 2J3MA 1ORWA 3CX7A 3EWIA 4HH0A 4IVNA 5EZ5A 4AJPA 5B2EA 4EGQA 3ZQJA 2ZSDA 4DLVA 3ZLJA 2WTXA 3SS9X 4U39A 1FRNA 4QU9A 3TLGB 4E94A 1KYVA 1DRKA 4N5HX 3W2GA 3EBOA 4J3NA 4ZMBA 2JARA 3EGXA 1NQTA 2CYBA 3TKLA 3GNSA 1P2VA 2H1IA 1D9ZA 3GHHA 4ND8B 2ZR0A 5DGXA 5EWJB 2FPMA 3A9WA 3Q9SA 2ZIVB 5K51A 3SYTA 4XX0A 3KOOA 5EFZA 4LKRA 5EGNA 2JLBA 2R47A 1NIPA 2MINA 2HMAA 3ZCXA 1WM1A 2G17A 1Q0UA 1CJTC 2QN3A 3PI7A 4G97A 1T3GA 1KC1A 1USIA 4W8OA 5DM70 4D46A 1EFDN 2H1CA 4L3WA 3A32A 4BNFA 4B43A 4PYJA 4JL6A 3TJZA 3DUWA 4D9GA 4HNVA 2XW6A 3KQTA 4RZQA 4TMVA 3EASA 4HN4B 4YK7A 4EM6A 1EXVA 4I5EA 2IKSA 4ENTA 1AX9A 1RSZA 1IM2A 2J6CA 3BEOA 4DAOA 1AV6A 1D2NA 1OGJA 2VJKA 2EXXA 1MOZA 3K5PA 4P98A 4OU4A 2CL6X 1XYYA 2RD2A 3GUHA 3PRYA 4Q12A 1YQEA 4HFRA 1AN9A 1TC1A 4Z4HA 3PGMA 1EA7A 4BQRA 3B52X 3MBIA 1DCMA 3O8BA 1Y8RB 3U26A 1FPMA 3VZSA 5HIMA 4U6QA 1PCXA 1VGRA 2ILVA 4G0WA 4KRYA 5THKA 3RAFC 3EMDA 2C2XA 4RA6B 3SBDA 3OZTA 5BUCA 4HGPA 1EDZA 4PTZA 1TQ8A 1MRZA 1DAIA 2VPPA 4TWJA 3VISA 2PMFA 1UC9A 3BERA 2R60A 4EB6B 2O3RA 3F8WA 4WBNF 1BQ3A 2ODWA 1FFYA 4BZQA 4ER5A 4MLCA 2WUEA 2ZOSA 1PQWA 3K8QA 1RAFA 3WMRA 1N3IA 2Z8ZA 3FSJX 2EU8A 3EH2A 1SHTX 5G3YA 4YPVA 2B34A 3OWOA 5EZYA 3KKLA 1C81A 4UMEA 2LTAA 2NAFA 1XTPA 3ZWVA 4EA6A 1QRUA 4ZIRB 5IW8A 2SKEA 2BFBB 4KO4S 1E2NA 1P1KA 1ZD1A 3MAJA 2IL1A 4MGKR 3SN6A 1JPVA 2R2GA 2DBVO 1L4HA 1YR6A 4IR7A 4FFRA 5BN4B 3RV3A 1O57A 1B42A 1W0JA 4UQPA 2D7DA 3UC9A 1SU6A 3AB3A 3TINA 1UOOA 2OVBA 2AX3A 3IDAA 1M0TA 3JD3A 4HJXA 1RLJA 1Y9DA 1F3OA 1KOJA 3T41A 1XXHE 4A8TA 2SNIE 4S04A 2ZM5A 4BNGA 1XAJA 3MMXA 1H22A 2POQX 5K3SA 4FEAA 1ZNQO 1AV7A 4KVZA 2PA3A 4NJEA 1P1FA 5EYPA 1Z08A 3ROXA 5AVUA 2BF4A 5FWXA 5JD4A 1UPBA 3CRNA 3E3AA 4DL9A 3LPAA 2OLEA 4IJUA 4CCAA 3X1DA 2XD4A 2XZDA 5IASA 1F6DA 3ONNA 4I4NA 4B80A 2PT6A 3HBJA 5FKJA 5FQOA 2D4HA 2UYYA 4DCUA 3S1AA 4ESHA 3TAHA 4F3RA 3VDQA 2C20A 5AM1A 4CM6A 5THXA 2QLFA 4JQZA 4MP8A 4P80A 2DR2A 5HJ2A 4BNMA 3W77A 1Y5LA 2QZ9A 4JBYA 3U7JA 2I5PO 3WOVA 1NW3A 1XRMA 5FBRB 4CTKA 4HVLA 1QAMA 3L7BA 4NLLA 4BUJA 3LKVA 1A5SB 3TIVA 1KYQA 3NDPA 2R751 3VI4B 3OY7A 3KEOA 2OHJA 3DLHA 3Q0EA 1GL6A 4AB1A 4RJ2A 4ZCQA 5E1OA 5JISA 1ENPA 4RHTA 3HLTA 1BXRB 4RCZA 3GLGE 3QSYA 2DLCX 3T3OA 3UCEA 2DPLA 1II0A 1MH9A 5KNCA 4II3A 1CQIB 2JH8A 1T9ZA 2C4UA 1SVSA 4D9FA 3PICA 4MV1A 1A5AB 4O4IA 1H05A 4M49A 1JQJC 2QG4A 3K4QA 3LT4A 3RSCA 5JAUA 1UBSB 5JAZA 3I28A 1JU4A 1ZK0A 3KYDB 4BP9A 3W7AA 2UVQA 2BHSA 2GJAA 3QIVA 2XGMA 1QG2A 2PX0A 2IX9A 2LKCA 3WYFA 4JR0A 2NWQA 4ZV7A 3T34A 5I7HA 2NU8A 4C21A 3CLSD 3HRIA 5EJ6A 1DJPA 1ICEA 2PRIA 4LX8A 4N5NA 4DLNA 3M0EA 4QBTA 1E1KA 4ZMSA 3S4YA 4RNDB 3FFXA 1V25A 3E7XA 4GGMX 1CULC 2Q6VA 1SBQA 3SJCA 3FNHA 1XU9A 1XE3A 3PXXA 3SVTA 2QTGA 4HDKB 3PCRB 3LCCA 5BQXA 1KI1A 2H2IA 2CMFA 3N7AA 3OOSA 5TLSA 4OSEA 3E5NA 3I0MA 4DCMA 4YI3A 1FFDA 4C6SA 1YV9A 4CTJA 5AM0A 3O1HB 4GICA 4DDVA 4HWKA 5KSOA 2YL2A 4JLWA 5GZ6A 1NMQA 4XUGB 3SLKA 2ZTVA 1E96A 4EGFA 3A9RA 3FHJA 2JFHA 3OQNA 5BV2P 1XZQA 4MVJP 4P7GA 1L7NA 2QUBA 4KI7A 5GTDA 4IIEA 4Q3BA 3A0UA 3JQ7B 1Q0LA 5K0ZA 1NJSA 1HTBA 3O4VA 3ANLA 4GFDA 1RYZA 2WM9B 5JNRA 3T7DA 3UW3A 5KIAA 4UXJA 4O2AB 3E0XA 2YYYA 4EB0A 2VR1A 4PQEA 4PXYA 2OCGA 4FTWA 1JB1A 3F49S 2IZ0A 3T52A 5EL0A 4MV8A 1X77A 5EEHA 3SEZA 4QVKA 2FKNA 3N2ZB 1YASA 3PTZA 3MTDA 3HDGA 3OECA 1DUSA 1HH4A 2G76A 3DO6A 1BE0A 3MERA 3PVZA 4H4DA 4JJEA 2WTBA 3PFCA 4MV5A 4RE5A 2QWXA 3BIOA 3SR4A 3WHLA 5JI2E 1CEYA 3UJ9A 5J5CA 1YFJA 1J49A 1HE2A 1ZH0A 2C57A 4ZVMA 5EUMA 1IXZA 3UV6A 1KYTA 1ORIA 3IQZA 5SYNA 2O23A 1JDUA 1DQZA 1OLSB 5AICA 4RMJA 5KWVA 3X44A 1E6WA 1R66A 5KU7A 1O0CA 3WLLA 1AKWA 2O5RA 3NEPX 3EOAI 1MU0A 4RD4A 1I32A 4BLTA 1Q0PA 3FMVA 3O38A 4CF4A 4LF4B 4CFZA 4MULA 1F20A 2H0AA 4H6VA 2W6ZA 4TN1A 2V1UA 1CHDA 4YRNA 2Z0MA 3LYAA 1R64A 1LFAA 1Y5MA 3NM4A 2C54A 1VC2A 4YJ3B 2J59A 4RJTA 1CUUA 2QZ4A 3OQVA 4XDYA 1Y4AE 3GJ4A 3W5DA 3F9IA 1YIOA 2OQRA 3FYUC 1ZNYA 4G01B 4OQPA 4EPVA 5CA0A 3WDSA 2QJOA 3AO0B 3K2IA 3NCTA 2PL1A 4IILA 4UQLA 5JROA 1W36C 3H2SA 2BGIA 3K1TA 3L82B 4NBUA 1W0CA 3UF0A 5BN3A 2PVCA 4BO4A 3DMYA 5I7VA 1RXIA 2CFTA 2A9VA 1ZVKA 4BAZA 3C3JA 4N82A 2IYEA 4IVQA 1LI4A 4ARZA 2ZUCA 1AUXA 3QITA 5KHAA 1QHEA 3U56A 2Z6UA 3MWEA 1XTUA 2BLNA 4CV1A 1XCMA 3Q2IA 1LF5A 1N6PA 1JNXX 3D7KA 5DBEX 2A1UB 4P93A 3U61B 3WGLA 1KFKB 1TK3A 2XMDA 5INTA 1RP1A 1YZ3A 4FMCF 4MQUA 1J1UA 1SGWA 2EX0A 5EPOA 2AFHB 3K31A 2J41A 1O7JA 3AF5A 5HF9A 5KOJA 5IYZA 1T35A 1CDEA 1KDPA 3ASUA 4XCVA 5IMSA 4WBXC 2BV3A 2IWHA 1LZKA 1VL8A 1UP7A 3CVUA 5JJKA 4PRYA 2IEYA 2XH8A 3EQZA 4JBLA 3VR1A 5LQCA 1RJEA 4CI0B 1I2DA 2E85A 3JQEA 4E07A 3C45A 5HZMA 1WQ1R 3NT2A 5GM1A 4YIHA 2Y0PA 1K86A 1VM6A 2ATVA 1T34A 2EHDA 1MIOA 1CR1A 2PKEA 3LXRA 4M36A 5CPBA 3ZIUA 4MW4A 2A35A 5F5LA 5JNVA 3CUUA 4URYR 4O33A 2FUG6 1PBTA 3H19A 3MWEB 4RKEA 1OBVA 4R71A 1WB5A 3DC2A 3ADBA 3ZGZA 1I36A 2FQYA 1QE3A 3N7TA 5LUBA 2OCYC 1JKXA 3WGTA 3I62A 5AI6A 1KQFA 3AL0C 1IUKA 4HATA 3KPUA 1NHGA 2EWVA 3GJ8A 2GAOA 4AKGA 3ETCA 1N25A 1HX7A 3HKDA 3OD5A 3OOHA 5CA1F 4L4ZA 4QDKA 3UAVA 3GWZA 1A4RA 3WICA 1IOLA 3ETHA 4D02A 3UPTA 2G4VA 3G0OA 1P6QA 4HNUA 2AV6A 4B73A 1JFLA 3MINB 1M54A 1N2CB 3W8DA 2YCBA 1CUFA 4ARBA 1ZJ4A 1ZK4A 3OZSA 2W6MA 2NVUA 2FWAA 2OCXA 5B3JA 3REOA 4AG5A 1I3LA 1CUWA 2G9RA 3JTEA 2ZKLA 5ALEA 4CODB 1TCBA 1B74A 3GPIA 3OICA 3QWAA 5JV5A 2VQFB 1R0ZA 4YRPA 2WA1A 2XRFA 2VYQA 4CW7A 1H5UA 2E4UA 2P5TB 3FNFA 2OPBA 3F6SA 3MTIA 3TZEA 1F51E 2WTAA 4W82A 4INJA 3SBEA 3CE6A 3TL3A 1RC1A 2YKGA 1H1TA 2O8EB 5DBGA 4NBKA 3PNQA 2O1WA 1SIUA 1X14A 2RHCA 2QSUA 1TRHA 2YNMA 3Q11A 5TGZA 4KNYA 2O3JA 1P4AA 3QE0A 4NU8X 2O7VA 1SRQA 4OREX 1UANA 1C3EA 3M49A 2GF9A 3QM1A 4JZYA 4WX2B 1YRLA 4YO8A 4AWAA 4E88A 1LBHA 1MVLA 3AVXA 3TZLA 1I5RA 1ZI6A 3E81A 4MAMA 4MPPA 3WNZA 1TIKA 3GEPA 1E3JA 3LTEA 2VJYA 3EPJA 3WKDA 4BFUA 2ZJ4A 4R0MA 4ZARA 1YQXA 4AZWA 4DJEC 2C9MA 3L18A 5KVAA 3F6BX 3IUBA 3TNDA 2W6IA 1JI0A 4LFAB 5DBHX 4RK1A 1IZ9A 1ZUNB 4FC6A 4XWOA 1E6MA 1SXJD 2OCLA 3EWSA 5E4TA 1R10A 3PJGA 4GSYA 4KWIA 3GQVA 4CKYA 1OLUA 3NPMA 2R8PA 4CEJB 2EGGA 1AA9A 4NULA 2J0UB 4CE6A 2XKKA 5A4AA 3W5BA 3VR5A 3DHVA 5IKMA 3M5PA 3V7FA 1ESMA 1YZGA 1MD9A 1GOTA 1M9NA 4C4YA 2Q6OA 2G77B 4IIBA 5AVWA 1RPTA 1E6EA 2BC9A 3I2HA 5FNZA 2IHYA 1COWD 4EYQA 4UBMA 1XVVA 2HREA 2O0LA 1OXXK 4HQFA 4O29A 1IQRA 4ZVQA 4G5XA 3BJMA 1SVOA 1L4NA 2N75A 3I04A 3V4VB 3E70C 4BUZA 1KYWA 2VYVA 1XQVA 2IK8A 3WGVA 2YOFA 1QFMA 3BL8A 4R51A 1O4WA 2C4MA 2JZOA 2H9YA 3AUAA 2F9FA 3COVA 3LWZA 1UDWA 3C4QA 4NBNA 5F4ZA 1HDZA 2Q1XA 3ZGVA 2WKQA 5FYDA 1GYPA 3I37X 5TXGA 1HE1C 5IF9A 4W9MC 3HR7A 4CHGA 4P4SA 1GDTA 4EJSB 2VDJA 1E9FA 2XGJA 2ZU0C 2W98A 5KTMA 1U04A 3V6MA 3WY9A 2F1JA 3FFBA 1GQRA 2GSDA 3ID6C 1CSEE 5BQPA 5DYWA 3HSSA 2MSDB 1J8VA 1DDGA 3PSAA 4BIMA 4DJJA 2EFJA 2XNDD 2XD9A 3KXKA 1HFWA 1HORA 3PA6A 2PJZA 4AMYA 2IP1A 2HRBA 3ABOB 4EB3A 1MNAA 4G2NA 3LBFA 5G40A 3UFBA 1P2GA 3BYZA 5HFJA 4B7CA 2PR7A 3UMRA 2VWPA 1WDKA 1GNQA 4NAHA 3UMMA 2O7QA 3EPLA 2CE2X 3RB8A 1U8TA 1Z6TA 3QOXA 2UXBB 5EMNA 2PX5A 2JLXA 3EPHA 4E6EA 2FB9A 1OVMA 1AVTA 3M9LA 2IITA 4HWGA 1D8TA 1PR9A 4BVLA 1Y6QA 1CJUC 1IG3A 2F3RA 3C4VA 3B6MA 1JDTA 4ZVKA 1WHSA 2AQIA 3C3MA 3I8OA 1UKBA 4F6RA 5JUWA 4YAOA 2GR9A 1IHPA 4XA8A 3CEPB 2O7NA 1B8PA 4P3YA 2DB3A 4M6WA 4ZHSA 2Y1CA 2IU6A 1RPAA 2NVWA 1MDBA 3IELA 1O6FA 4WXEA 1H93A 4HDNB 1GN8A 5CHEA 4BMXA 3U6BA 4BV2A 4YJ2A 3QVWA 4Q1FA 3U48A 5ER9A 3MD0A 4TYQA 1ZZEA 3CQ9A 4JB8A 3HH8A 3VH3A 1NXPA 1A8HA 2CB9A 2G88A 1P7ZA 2ZIGA 5EKSA 2FQQA 1YJQA 3PGVA 3QEBZ 5G3ZA 2Z08A 3PLRA 2BTOA 2Z4TA 3EBPA 4NFSA 4KQ6A 2IHZA 2Q3FA 4MGHA 4JHLA 3K70B 4EW2A 3S68A 2FPRA 2PUJA 2MSKA 3MQ2A 1JR3A 1L4KA 1SN7A 2JW5A 2Q50A 4KSYA 1ZMOA 1AHPA 2JCYA 4E5PA 2VDQB 1MC1A 4URXR 1KE2A 1ACLA 1MJGA 3DAYA 4U5QA 4D4LA 1Q1EA 3CLRC 1I3OA 3U4IA 4BO1A 1J2UA 4O3MA 1HE5A 4OQDA 4URZR 4Z7NB 1M6YA 3P8ZA 1H8HD 3OQBA 4Q24A 2UZ1A 3V8EA 2PSFA 4WQMA 5CT8A 1X8XA 4BE4A 1KY4A 3UT0A 3R8FA 4LIPD 4ETNA 1PJCA 1SCIA 2X1HA 1QV7A 4J76A 4LYGA 2VA8A 3QEJA 4FFOA 3RYFB 5CEFA 4AKHA 4HUQA 4XD2A 4Q82A 4C7KA 1ZEMA 5B7GA 1O6CA 2EKDA 1Q1AA 1JPJA 4M0EA 1LVHA 1NRXA 3FCXA 3U1VA 4PLTA 1CEEA 1FXWF 1WUHS 1WW2A 2GD1O 2VG8A 4ID9A 5DLEA 1J5XA 1UBKS 2JAPA 3CUWA 3SDBA 3U9TA 3URKA 5IAAA 3TFOA 3VA7A 2JGDB 3OJEA 4YS6A 1E3EA 1DO8A 2R8BA 1YFZA 1J0BA 3RK4A 1RJGA 3MIZA 1N2BA 2JZCA 4F5WA 1YBVA 3EN0A 4LYEA 4L9RA 4TZ6A 1QHHB 2A14A 3B82A 4M9CA 3LUGA 1U7ZA 2I03A 1VBKA 3LQFA 1W85A 4I66A 4UHBA 1VPDA 3SGLA 4GLFA 3V8MA 2QAGA 4BNUA 1QTIA 1C30B 4HAIA 3BIFA 4JJGA 3AIOA 3D9QX 4P84A 5JEDA 5F9HA 1JIUA 4L4YA 4MYUA 1FUUA 1WVIA 1QYRA 3DW3X 4TMWA 5AT1A 4H17A 2DBRA 1MFPA 3LHDA 4UCFA 3CPSA 3EZGA 1I2BA 4EH1A 3DEFA 3OFJA 4H18A 2G4CA 4G0PA 4EG6A 3M4ZA 4NC9A 3GRAA 3Q6IA 4X24A 4UQOA 2F67A 3OOWA 5CUQA 5EY5B 5FLYA 2G80A 3AP2A 5MN5A 2JLUA 3ZVNA 4Q7JB 3QBTA 1N7GA 5ALJA 3TOCA 2GASA 2XA2A 2J3KA 1V0JA 3NOQA 1U0OC 3TMYA 1GSIA 1OWOA 2LGJA 4L8GA 2GUGA 1A9SA 1RPZA 5E1BA 1X1SA 2CK3A 3NJ8A 3TG2A 2AJDA 3H86A 1LS6A 2FZKA 3TQHA 5IKXA 1QANA 3U4DA 2WAOA 2V74B 3MC1A 2RH5A 4YRJA 2VP4A 1YK1A 1M8JA 3CPHA 4G56A 2P9QA 1KL7A 4DMLA 3OESA 5JSKA 2AMJA 4JBNA 1JECA 4RHUA 1OVGA 2FTKE 5EE5B 3SAJA 4CQLB 2PZ8A 1TEZA 4EEKA 4B0OA 1L9XA 5E7IA 2BGTA 4I55B 4A1FA 3RU7A 2HPZA 3WRVA 4KAFA 4OMUA 4I6EA 4RKRA 4WZBA 3ZI4A 2YYAA 5IK2A 1MJFA 2W8BB 1E2QA 1C5KA 4EKNB 5K8TA 4C20A 3R3JA 3OZIA 5LDHA 1Y9EA 1T4DA 2WOJA 5BUSA 5K3OA 4MWGA 4HEA1 1UBJS 5KTKA 2J08A 4LMPA 4GI5A 3BRWD 5FFFA 1DZ3A 4WPGA 3BVPA 1S3GA 2LCIA 2I8AA 1NF2A 2WBLC 1NSFA 2A67A 2HAEA 4JODA 3L84A 4DPLA 1TT5B 4LHWA 3U13A 4PYMA 4V1CB 3T9EA 3MJVA 3F8TA 1DIAA 2ARKA 2GEVA 2VF5X 3HU5A 3EBLA 3I30X 3PSHA 4FYMA 4O5AA 5E6SB 3VU9A 4ARVA 5HW0A 3V8PA 5L7TA 2ZUFA 4DGSA 5BR8B 1NUQA 5DRTA 4WFKA 3QYFA 3PWKA 1DQNA 4RXMA 1VG0B 5BURA 1ISJA 4JS0A 1FJ2A 4MRPA 2WJGA 4KSBA 3TLMA 3DV9A 4G2TA 2QN1A 1JI3A 3LPCA 2GXQA 3E3NA 1IQ0A 4IHAA 4P0TA 3E9RA 2AG0A 4M1ZA 3QXXA 3RVLA 3ZY5A 1G8HA 1HOTA 3R9WA 1N5OX 5IFLA 1P1IA 4I8IA 2DBQA 3LZDA 2QRKA 1IBSA 2XTNA 4Y2RA 4AF7A 3I6MA 3UOAB 4J6EA 2WVHA 3WQQA 3GELA 1AQUA 3A1DA 3ZWYA 4IIJA 4ETIA 4MTLA 1N2HA 3TI7A 4FSXA 3RVMA 1J8YF 3LC7O 4R1PA 4DUGD 4PO9A 1QB8A 3DKVA 3V4FA 2XMPA 3T1HB 3KKEA 3BXGA 3MQ4A 1D7AA 4Q9LA 2XMZA 4K26A 2BH9A 2QTHA 5JH7B 2OBNA 3ZWAA 1UBTS 1W5AA 1W5EA 2EV9A 3QELB 4TXJA 2GX6A 1KI7A 3NT5A 4MVXA 2QAJA 3CLHA 1UWKA 3DUFB 3ZJ4A 1XHLA 3HRHA 3M5DA 4XQGA 3BXXA 4BDSA 5JANA 3LG2A 4NXMB 4JOSA 3OX3A 1KS9A 1TUGA 3AZQA 1UFQA 2QD3A 3PNVA 4ZAFA 5JAQA 3UBTA 2EZ4A 3GH3A 5AK3A 4HLNA 1HEUA 4HNSA 4PZCA 3WWOA 5C46F 4N8SA 1IWBB 3G6WA 3BKXA 3VAYA 4BO6A 5KOHB 3Q8MA 2NZVG 4QELA 4JEMA 3I2JA 3FTNA 3IIKA 1OA1A 3BJIC 2A8YA 3LDUA 1C2YA 4ZJYA 1EFVB 2W6PA 2ZSBA 3C8HA 3JYPA 3GLFE 1JIVA 2VHTA 1F2UB 4OM8A 1QIFA 4M1OA 4BVFA 2O6LA 4XFJA 4BNJA 1MXHA 4TYNA 4RA9A 1SZPA 3NXSA 3M3DA 1Z83A 4RU1A 1XZFA 2ZS8A 2NZ2A 2HEIA 2IT1A 3KFLA 3R20A 2PTHA 4IUCS 4M0UA 3TNLA 5ICGA 4IZIA 1FNNA 2OENG 4L2IB 1UKVY 1WCIA 3V1YA 1Q0QA 2QLMA 4U7WA 2DR0A 3BUSA 2QGNA 3L0ZA 1RVV1 5KQMA 4FMCB 4AROA 1EAYA 1WEHA 4UNPA 1Z06A 3W90A 2QGZA 3KXDA 3RAGA 4ALJA 4C1NA 3E8MA 5B7QA 4JLKA 4TLAA 1CYDA 3WK6A 1PWHA 6Q21A 2NO7A 4CFYA 1ZD9A 1NVDA 4K6GA 1AXRA 4L74A 3U7RA 2BFMA 3C7TA 1H2WA 2BGNA 3ML1A 4MPRA 3R6LA 4R68A 1W59A 3OMWA 1II8A 3D0OA 2O5EA 3H2KA 4LAFA 3AVVA 1RKXA 1EUCB 2CWWA 1H3EA 3L7CA 1I10A 3N6XA 4G5YA 3AJRA 4YGXB 1RQNA 2EARA 1U0LA 4K9QA 4YXWD 1QVZA 2I4MA 5FI5A 3WL7A 4R98A 3WWDA 2F3SA 2W2KA 3OC6A 4REQB 1T2DA 3WE7A 3QOYA 4OXYA 4CJXA 4TRRA 5J5VA 1SKBA 2HA0A 2QOEA 3MMNA 5ULLA 4UNRA 1DKOA 4LFBB 5JNTA 3NXKA 1CZKA 2OEPA 4UBLA 4WKGA 2X9NA 3JZAA 5LFAA 1V37A 2GGSA 2GNPA 3E3MA 2J6HA 1V5FA 5CLLA 2QRVB 1E2UA 1OFUX 4QJ3A 2AUMA 1ODCA 1KOGA 1Q7GA 3DMRA 2FPSA 4FGUA 5CMLA 2YMLA 4TTVA 5SY6A 3LWNA 3MGBA 1VA4A 3BORA 1OBCA 4ZGBA 2J6BA 2CZQA 3AEUA 1E4OA 2WPDA 4UASA 1G8GA 3F6RA 2CHVA 1ECCA 3PXEA 2F8LA 2KW5A 2PEZA 3EVFA 4L8LA 4WK6A 3ZU4A 4BAUA 4BU0A 4ZT7A 1LDGA 1VCIA 2PUVA 3ESQA 4HDAA 1VYTA 2G72A 2IYQA 2I78A 1JZSA 2LCFA 5HUJA 5KQPA 4MW6A 1E2JA 3D8NA 1NBHA 2IPAB 2QD4A 1GV0A 4MEBA 1M76A 1PV2A 1TPZA 3B1ZA 4S1WA 3VC1A 4KGDA 1VPWA 4RVFA 2VDKB 2C77A 2JKYA 1TAGA 1W4CA 1ZWKA 2JFFA 3C15C 1P9OA 3N8DA 2ZYVX 4BTLA 4BZPA 1FBTA 4B3FX 4Q05A 3ZHBA 5HQ3A 5E95A 1XD8A 2JGDA 2XE7A 1Y4UA 3OIFA 3PPWA 4EY7A 3W1EA 1H4QA 2ZI7A 3RU3A 5EXEA 1TUBA 1ZUWA 3RSHA 2VYNA 3ELBA 1LPNA 2DTXA 1DG9A 3H97A 1CLEA 4V2UA 4WXPA 1XZJA 3O8QB 1Z33A 5FBKA 3GLRA 2OBBA 1Q16A 3R7FA 3RIXA 1JFFB 2FK8A 4QECA 2HW8A 3R0QA 3TX6A 1ONBA 4WUVA 1N9GA 3GJXC 2X76A 3WYDA 2JFZA 4IV0A 4QBHA 5AXCA 5B7NA 1EWVA 1OYVA 4N3GA 4R01A 2WU1A 3SC6A 4TKVA 3HJRA 2GBFA 5ESRA 2ZIFA 4LTMA 1I9CA 1TZ2A 1KRHA 4BVGA 4B3MB 5A0TA 2Q1SA 2Z2IA 1GIAA 3ZTYA 1MG0A 1AN0A 2JFYA 1DOZA 3HCPA 3PRJA 4G0UA 2AEEA 4KIFA 3P4UA 1JJBA 1XAGA 3K73O 4H1UA 4C4RA 3RTGA 5ISMA 5CDGA 2VTDA 4BCCA 4OHMA 4V1CA 2Z57A 2V8OA 3GT0A 4XIIA 1B4DA 3H8JA 3SFVA 4QKQA 3UO8B 2CLIB 3P0JA 1KAQA 3KDPA 4RHYA 4UTRA 4CMIA 1XP8A 3WMFA 3I5XA 3ELYA 3EGCA 4RFSA 2BKEA 4H2DA 2R62A 1H0KA 2OO7A 2RC6A 3IC5A 4J07A 1FTSA 1OFHA 3D3JA 4ND3A 4PLGA 2HYDA 2XKBA 4RWZA 3BBLA 3NNDA 4B6QA 4KXLA 3G5UA 4JLJA 2ETVA 2R44A 4EABA 2HA3A 3UAOA 4L5JA 1EM6A 4RQBA 2JBAB 3G9XA 5JY6A 3RJ9A 1BGWA 2ZRIA 4D26A 4RUKA 5G0TA 3WI7A 4FMPA 1B73A 3OZXA 1PHRA 1EG2A 3P0RA 4R8LA 2V97A 2OA0A 4GX5A 4MUMA 2HJWA 4F97A 2G9VA 1VRVA 4MA0A 1WUYA 1ZICA 2D54A 2YHAA 1VFPA 2VPWA 1DAKA 3BL5A 3V7YA 2H7CA 3A1UA 2XCUA 4EKEA 3W9YA 7GPBA 1E66A 4C7JA 1WBBA 3K15A 2ZRPA 4EMBA 3OD1A 5DULA 1GEEA 5LA6F 2V5AA 3OM9A 4KR0A 2H0RA 2H2DA 4B09A 2XCLA 1SWVA 4WNAB 2GZMA 3H9UA 3VDXA 2SBTA 1IN4A 3B2QA 3JXEA 4HXFB 4ICIA 2DHDA 5AVOA 2BGMA 1C0LA 4GPZA 3H3JA 5GY7A 2GBIA 1DJLA 4XEHA 3NYRA 2Q1YA 1QH1A 3PUIA 3L93A 2P0EA 2L69A 4NCJA 2VJDA 3ZHXA 4EY5A 3ECSA 1LDBA 2BMAA 4PFJA 1U0BB 3I9NA 1TAUA 3U4AA 1SVNA 4M9ZA 2JH3A 2QX9A 4ITVA 4QE3A 2HB6A 2O52A 3IVGA 2O5VA 5GOTA 4GR4A 3R7WB 4C2TA 1LBQA 1NL3A 1LBTA 3E8XA 2PZBA 2V7GA 4BC1A 4MW7A 2LD4A 5L6LB 1KY2A 3QKRB 3K09C 4I5FA 3WLSA 3QK7A 3MCVA 1QR2A 4G9EA 1P39A 3N0WA 4DC9A 2JKVA 4MKFA 5DNUA 4HWOA 3CSSA 3MJ4A 1KEWA 3U4QB 3G68A 2FGJA 2UVPB 2WJZB 3B7GA 3AM1A 3BF8A 1T8RA 1OYYA 2WJWA 2ZR8A 2DVMA 2RH4A 3JU3A 2P1RA 3E7PA 1JBKA 2DPYA 4BLUA 2ECKA 4QARA 3R7LA 4CL8A 3DKIA 3C8DA 1G41A 1VXOA 3DEYX 1Q57A 3ZE6A 1E2EA 3HXOA 1L8LA 5JMWA 4DV6B 2ZSHA 1U8FO 4AI6A 1BNCA 1RE0A 4RZ3A 2C2YA 3M89A 4KDCA 4A3SA 5JZVA 2VXOA 3R9XB 2F9LA 1CS4C 3EAQA 3N2KA 7AT1A 1NJGA 1Z5GA 3HKEA 1GGKA 3GW8A 1K2VN 1LFDB 3RHZA 3AUSA 4AKSA 4CNQA 1V48A 1XVTA 1R0RE 2I2FA 3GVCA 4YB8A 4NMWA 4P5PA 3DKPA 3HGMA 1RP7A 3N8KA 3GGOA 3U3MA 4K88A 2IODA 4URHA 2JIPA 5AVVA 2MYPA 3TZQA 3VFDA 2O3UA 4BV3A 1S8OA 1DBIA 5DW0A 3AFMA 4AXXA 1Q7TA 1QGOA 2AEJA 2SECE 4KE9A 1JA0A 5FLKA 4L5BA 2F3QA 1VJTA 3C98A 5F35A 1ZZGA 4TTIA 3WIEA 4LF6B 4JB3A 3QLVC 4DV7B 1J0AA 2EW1A 3O94A 3MJTA 5TDHA 1AK9A 1W46A 3DV0B 3Q40A 4NL4H 3OO1A 2OFWA 3IA2A 3ZHOA 4MCAA 5E6RB 3KKNA 3E15A 1HOXA 4J49A 1HZJA 4OIFA 3EQ6A 3IEPA 3FYCA 1A69A 4R2IA 1CRQA 5ALZA 1CE8B 5NULA 4A2PA 1L9KA 1HNZB 3K05A 1IOZA 1XB2A 2QJFA 2QM7A 2VO1A 2A1IA 2IOFK 1GZHB 1YS6A 2YV1A 3AF4A 3MOIA 3P71T 2PGNA 4OJKA 4BZZA 1U1CA 3A9TA 1SXQA 4M1KA 3JASB 2RBGA 2JATA 1U02A 2ZCVA 2A78A 4DLTA 2V6GA 1DB3A 1YACA 2CMDA 2XUPA 4UHCA 3QE9Y 4GWKA 1EBUA 1PYDA 1XZEA 4HTFA 4XYBA 4MYHA 4RTOA 2NVUB 1JN0A 2JK1A 2XY4A 1X42A 2VDVE 3HSKA 4KMSA 3EZYA 3S2IA 3OPVA 4O4JA 3R5SA 1TYBE 3ZD9A 2A92A 3AWDA 4WSOA 5MFZA 2BOVA 3VX4A 3IKTA 3RVKA 3MJCA 4LZPA 4B76A 2XR1A 2Y9MB 2PL9A 2GM9A 2NXCA 3LO8A 1CUBA 2XADA 2NO0A 1ULAA 3WNCA 1VLLA 1ZSNA 2OV4A 4CU5A 4RMHA 4O4LF 4QTXA 2JFVA 4Q7QA 3MEQA 4CRWB 4F4UA 2ECFA 3WAKA 4WMLA 1VJRA 1UXGA 2JHGA 3IKMB 4BNYA 4NV1A 4ZTUB 1P80A 3QJYA 5A5FA 1QCYA 2FOIA 1R8QA 3NW9A 5C5EA 5A6VA 5I7UA 3FUWA 4IIXA 4Y0AA 3DB1A 3FMFA 1QKKA 2C1XA 3OMLA 1QOQB 1D4OA 4YAIA 5JMOA 2R4UA 1ZMTA 5KQRA 4JXKA 1P1BA 1R5OA 3G1TA 4ZDJA 3KWMA 4EGJA 1FRVA 2ONKA 5B3JC 2EKPA 1FTYA 3Q5EA 4Z4EA 5AKIA 4E2WA 4NAVA 4PNZA 3HJAA 3PEWA 4J1TA 5DYYA 5JDIA 5DU2A 4GKAA 1A7AA 4KNWA 5C5DA 2PRYA 1Z12A 3C1AA 2HL6A 3CT4A 4JDUA 2HT1A 2VP6A 4Q4CA 5L3VA 3B70A 4RV5A 4DQDA 5IP5A 5KJCA 4F45A 4MQEA 5CITA 1Y5IA 2X2FA 2JDIA 2ERYA 2R1TA 1P4GA 3N2GA 5K3FA 4KPFC 1REQA 3V1KA 3FF1A 3RADC 3KT8A 1ODFA 3LJKA 5L4SA 2GDJA 3GH1A 2JLCA 3CWQA 4UFOA 3U5TA 3IDFA 5EKUA 4L08A 3AHIA 1A96A 3IIJA 1TLTA 2W37A 3UW1A 3OSUA 1J22A 1TMOA 3MELA 4LOLA 5AVTA 4B4DA 5TT0A 1CDOA 2BKUA 2WUDA 1E5DA 2XXBA 4ZFNA 5LP6B 3LCRA 2TRSB 3IT0A 3OFND 4Y1RB 4EUNA 1RXVA 3H5OA 5A9SB 5IZCC 2X9VA 3RE1A 3H8WA 2V54A 2V6JA 3PR2B 4QQFA 5B4UA 3QPVA 3AJAA 1SOMA 3SNKA 3JAWA 4LJKA 1PGPA 2QY6A 3DBVO 4WGGA 1QTQA 3D0QA 4Z9BA 2QK4A 1EPUA 4G8DA 1P8AA 2YJ4A 4Q4HA 3KKPA 2B20A 4M0LA 4N03A 4X54A 3V00A 3VMFA 3EF1A 1BE6A 2UYHA 4BGUA 2DETA 2ZSAA 3TW8A 3ZWQA 5AXAA 3I32A 4WLEA 4B6JA 1UBUS 4ZGGA 1SKUA 4NV3A 1VJCA 3NKLA 3TF5A 4RZUA 5IC4A 1PJ3A 2FRXA 4MRMA 2FOLA 2CLCX 3DOIA 4EA9A 4AKTA 3T5DA 1X7ZB 3F5QA 3CBGA 2WC1A 8MHTA 2EZ8A 3KPYA 4RABA 4WL0A 4H7DA 1AK1A 3INRA 2P75A 4EX7A 4OQYA 4BZXA 4DE5A 3IVXA 3F97A 2GCGA 1EQUA 2ORYA 3IV9A 3KOMA 3GPBA 4PINA 2DF8A 4Z9FA 3O2SB 5E1DA 4O1HA 3RFFA 2C4KA 4F4DA 1ZKDA 2IPNA 5E38A 1GSAA 4YJDA 3WJ1A 3L0DA 3KB1A 1BEEA 4MB0A 1LI5A 4GKJB 4IUBS 2ZJ3A 5I9MA 2PGIA 4US2R 3B53X 2IIBA 1M6VB 4YX9A 1ISIA 1LY1A 4E15A 3WMEA 1RM0A 2HA6A 2OGWA 3OH8A 4K1LA 4R2MA 4WZBE 1IOWA 1HL7A 2OZKA 2ZT7A 3GBSA 3R8XA 3SC2A 4QEDA 1MHPA 3A4VA 2JANA 4QDJA 3TWOA 3CTMA 1PR4A 3IP1A 3QWIA 3QUBA 4LYJA 4LHVA 3TLGA 1F8XA 1U2RA 1YHZA 3ZIDA 2YY6A 1QP0A 1V8ZA 1WD7A 2Q3HA 1B41A 2IPXA 3PJFA 1Y6ZA 4TKUB 4RGBA 5ICMA 2BM8A 4FGJA 5TY0A 3TPZA 1XJ0A 3F47A 2BPOA 2RAVA 3A1TA 1I7NA 1NI3A 1XIVA 5CYPA 3SX4A 2F64A 2QMYA 4O59O 5JQGA 1GNLA 4UTPA 4FE3A 1W1IA 1MT3A 4EPTA 2CXOA 1GN9A 1PW7A 1PG5A 1XP5A 2NSHA 1P0PA 2PL5A 1GUDA 2NIPA 2W2LA 1M0EA 5EOVA 1X39A 1RR6A 4UD6A 1Q21A 4G0QA 4PC3A 1P7WA 2RB5A 3CY6A 3WIUA 2CV1A 2H59A 1S1CA 3A3NA 2J87A 3IAEA 1NR5A 1NU6A 5FADA 1KJNA 1APBA 2HY7A 1QNLA 2ZAMA 3EC1A 3OI7A 2QRLA 3D6NB 4ITUA 2Q9UA 3MWGA 4PONA 5AKYA 5IKOA 3EODA 4GM4A 3NC1C 1F5SA 1PZHA 3FMOB 1PI3A 3K96A 4KFSA 4MWTA 1AQIA 2GPNA 3GLKA 4B47A 1GTZA 4RVUA 4OBBA 2P79A 2CLSA 3L79A 1IBMB 2ENWA 2X1MA 2A9FA 4P0PB 1SKYB 5KSYA 3UK1A 1ICIA 1RYHA 2ZQZA 4DWJA 2YIMA 2ZVQX 1U5BA 2YMPA 3D1JA 4JEHA 3FPGA 3ON5A 4TV8A 1Z4JA 2O1XA 5I9BA 2PSHA 2GZSA 4ARUA 2P6RA 3DTYA 4G26A 1QWSA 4W5HA 5KB3A 3SM3A 4EAQA 1JA1A 1QP4A 4IHJB 3QPWA 5KTSA 3UC5A 4BE7B 2QAGB 1MUUA 1AE1A 3TCXB 2JLYA 2AE2A 5BR1A 4L7QA 3DBRB 4D42A 4RGQA 4QVIA 1DAPA 5AW7A 5JY1A 1RS0A 3HVKA 4TWZA 1SUSA 1X7GA 1KO5A 3LUKA 4GZLA 4WADA 4ZAVA 2VC2B 3ZVRA 3L06A 1JLLA 3IJRA 4Z7QB 1G3RA 3SCZA 3C6QA 3L0CA 3LRTA 3O92A 4UUQA 4QHTA 1JR3D 2XXJA 4M3NA 2OILA 4ZV4A 2OHIA 3D5QA 3DZGA 2HIAA 4Y2PA 1C8VB 2VPQA 4JMLA 2X40A 1NRWA 1R18A 2IYYA 2HHHB 1E0DA 5LQRA 1DAMA 3G89A 4GX0A 2RG1A 2PNJA 3RK0A 2H85A 3G5AA 2DFVA 4OQ4A 3EWAA 1WQ3A 3K72B 1Q14A 3OZEA 5ECDA 1WDMA 3WC4A 1W25A 4NFHA 3FCAA 3U39A 4RX1A 1AF7A 1SQGA 1Z16A 3KXLA 5J3JA 1Y81A 4L27A 1LC0A 5HF8A 2COUA 1RM4A 3AF0A 1OV4A 1JG7A 2QUIA 1XNRB 6LDHA 5KSWB 4A5OA 1H2XA 4AMBA 3BD9A 1VB5A 2XDWA 3KKOA 5REQB 1G55A 1LPSA 1T9HA 2J67A 5TVGA 4DR6B 1SC9A 3JATB 3GFRA 1Q0SA 1Z39A 2I4NA 1U80A 1BKDR 2R00A 3CUYA 2WHEA 3F96A 4NJMA 3BDIA 2M9MA 1DKPA 1SXJE 5LOVB 3O4GA 2DY1A 1IY0A 1M7HA 1GSHA 2O8NA 3FGPA 2P3OA 2J0VA 3JYNA 1ZUNA 4UU7A 1OAOC 5LQJA 1GAXA 4LJYA 4JYZA 2QBYA 1M2VB 2NTJA 1N6KA 2AK2A 3DT8A 3FB1A 4OHCA 5FFNA 1QHIA 4YJ2B 1JDJA 1DBQA 2N9UA 1YOVB 1TJ5A 4FMDF 1SURA 1FMTA 3ND7A 4HAOA 4PCUA 1U7WA 1ECFA 4FYHA 1ZH2A 1GL3A 3NTRA 1OOEA 3BCUA 1IPFA 4JIMA 4KYTA 4UNSA 1L5NA 1TQHA 2QQEA 4HZUA 4FMDB 4OQZA 1B8VA 2VT2A 1I6KA 4DC1A 3L3BA 2OV6A 3KYBA 3WLRA 2UUOA 1Z6XA 4DB2A 1JPUA 3SF8B 1C3LA 1PZEA 1U31A 4GGPA 4GOMD 3H2JA 2RDMA 1CK4A 1VJ5A 3VZPA 4BBAA 5U9CA 3WMXA 2O0JA 5TARA 4AS1A 4MGZR 5H7XA 2VKQA 5KYNA 3ZZ1A 4TZKA 1E94E 2GPSA 4WRRA 4E3ZA 2OLJA 4Y6PA 2Q9AA 3L1VA 2H57A 4PLWA 4YUZA 5L4LA 4ZD6A 2E18A 2VHCA 4J0DA 1M2NA 2CLEB 3K70D 4ALKA 1SKQA 4BEJA 2JGIA 3KYDA 2B9EA 3KTAB 3LX8A 3ZHYA 3FWZA 4WK4B 1P9NA 1F9EA 3UT6A 4DRXB 4D79A 1XA4A 4TXLA 3SHOA 2Y8EA 4KSCA 1TTPB 1YKSA 3GXOA 4FDLA 1F0NA 4Q3KA 2RSLA 4FWTA 2MIIA 1SHUX 4PGHA 2KWIA 3KQOA 3OCXA 5I8WA 3LA8A 1BG6A 3FHLA 4K9LA 4RZIA 1CQJB 1E64A 3BAZA 3GB9A 3QE4A 4EYKA 4YHBA 2FYTA 1IN7A 3FYHA 2NNLD 2FDCA 5LP6A 4Z0TA 3HGQA 3EXFB 5H80A 2ZJ5A 3WIBA 4Z1MD 2JAUA 2H52A 2X6RA 3ICWA 4LGMA 1Z4KA 3OPYA 4ZXFA 4JI3B 3WDLA 3CKKA 3QJ5A 4QDTA 3PGKA 3MWYW 4ZYUA 2FMIA 1I0LA 4OMFG 4KWHA 2CDBA 1QC5A 3RW9A 1CVLA 3PFFA 3PQ5A 4ZO9A 2FEAA 2RGBA 3KS9A 5EEGA 5BSGA 2CVZA 3OFKA 5GAJA 5ADWA 3DXFA 2G5CA 5EJIA 1MW8X 4YT8A 3FUCA 1VIDA 4C06A 1KO8A 1ZIXA 3D8BA 2GPYA 1E3WA 1KAHA 1UJNA 5CNKA 4J3FA 1Z8NA 1JAYA 2V0CA 4EY3A 4F84A 2QV0A 3W6UA 1OTYA 1ZRHA 1V8OA 4GPEA 1NZJA 4NQRA 5H9VA 3UENA 1QG0A 1XX6A 1ADGA 3RHTA 5CBPA 2MYTA 4XLLA 4C0JA 1TXGA 3BE6A 2CNKA 1LTHR 4DWVA 4GDMA 4I81A 3NVDA 2LR0A 1YVUA 3D6VA 3GOQA 2Q49A 4PTLA 1X7YB 5AW9A 1E7MA 1BX1A 1PR2A 1T0JB 3NETA 4N0PA 3RRMA 3CH5A 2QTLA 4P08A 6AT1A 2RGAA 4OQNA 2GDZA 4INPA 1F48A 4I4TA 4IIUA 4QBGB 4X0EA 2JIMA 1WZEA 4BMZA 2A0UA 3H1BA 4F3NA 3N0TA 5KOYA 1YQGA 3ZJUA 4DSNA 2EFHB 3MCTA 3V55A 4XGIA 1A97A 3CEHA 4KN8A 3BIXA 1OX5A 2CFRA 1B0PA 5JT1A 1P4HA 2QR2A 2ZI5A 3LUFA 4D1YA 1I7SB 2ID4A 1V26A 4O2AA 3TGPA 1KJZA 4FFBA 5I4KA 4ZOLB 4BNHA 1XRRA 3N1UA 4RPIA 3FYTA 4NNPA 1KI3A 1ZN2A 4LZAA 3HJNA 1DOAA 1U0EA 4M7OA 2P2GA 5DT9A 3VAAA 2VBGA 2OP0A 3ABQB 1E1YA 3SI7A 1ZOPA 1ADJA 1VFNA 4YUXA 2O2YA 4OQQA 1BD4A 2ZREA 4M8LA 4TQ9A 1VIYA 4HAUA 4U5XA 1NLYA 3QV2A 3CKLA 3A6KA 4KHZA 1YR2A 3GEMA 3KVRA 3RRXA 3GR6A 1T8UA 1W0KA 2BE7A 4CQMD 5IABA 1TO2E 5FPKA 1JWLA 3R7SA 2X0KA 4LWQA 3U4QA 5LOVF 3U7GA 4AY5A 2PS3A 5AP9A 3KZNA 2QJWA 2Z98A 2W2VA 4QBKA 2X1LA 4FQ7A 1SVKA 4RJLA 1OROA 2HHJA 2XUAA 2WVGA 1H2AS 2ZJBA 3BB4A 2W11A 2V7XA 4UU0A 3RUAA 3S3TA 2BGUA 1VYUA 2B69A 3FFAA 4X62B 4DTIA 2QLLA 3IA7A 4ZTBA 3IURA 4G5RA 1UIMA 4QEZA 4OL9A 4S35A 3T54A 2PJDA 5COAA 3GGGA 4OLFA 3IAM1 5KNCD 1Y4ZA 2PUCA 3ZS9A 1LV8A 3C1UA 2CZGA 1RWXA 4MH0R 2FU5C 1WMSA 1DRJA 3W3AH 1BIFA 3I73A 2JIOA 2DUUA 2GYYA 1TRKA 4IO1A 2R25B 4N65A 2D7CA 4OSPA 3OIYA 3WHIA 3F1LA 4QUKA 3QTTA 1E79A 1SEPA 1Z6PA 3BGVA 4LHZA 4CL2A 1F4LA 2XTAA 2Q7DA 1QYWA 4OHZA 3IP3A 4F5YA 4Q93A 4LZJA 5TPZA 1AQ6A 2C2BA 4ALNA 2DWCA 1O4VA 1JFSA 4YMLA 2OCKA 1ZJZA 4J6FA 3RTAA 4DDUA 2Y2VA 3NDBB 1EFHA 3PZRA 2H9IA 2ZVPX 5A4KA 2YWEA 4M8NE 3N3AC 3BJRA 5SYMA 4BB5A 3A37A 1VG1A 3OIVA 1S4MA 1BAPA 2VSOA 2Q8NA 4UDYX 2C5FA 2IZ5A 4S1NA 2QN2A 3RVJA 4LHYA 1HSZA 2I2AA 3ZV6A 4JJKA 2XQGA 2WUWE 3U7IA 2BBWA 3B3AA 1Y3DE 2XUIA 3SSMA 3DKRA 1P33A 2E4ZA 2IF0A 2E4AA 2O7RA 4YAWA 1L4GA 2V3VA 1NBOA 5JD6A 3VM6A 1A95A 4PSVA 1J0DA 3ZCPA 1Y0BA 1XK6A 1T8YA 3MS2A 2HX1A 1HRKA 3DEAA 4ZYXA 1RLIA 2VP0A 3RSLA 2GPJA 1ZI9A 3STXA 1QIEA 2NADA 3M6XA 2WWXA 1Y98A 3PFHA 4GWLA 4ZA2A 5A5EA 3CONA 1CVRA 3L9XA 5KQSA 1TB4A 3NP9A 4OXXA 1HT3A 1T6ZA 2FSVC 3DTVA 3LX6A 4F3TA 2NLOA 1K9SA 3HYTA 3TLXA 1GRRA 1AMUA 2BM9A 4GVPA 1NWHA 1SCUB 4ZI5A 1KI6A 5AVXA 2F8SA 2B4TO 4E4TA 2CNNA 2HWYA 4GF5A 4LXIA 1KDOA 3BG5A 5IUKC 1GEGA 2H63A 5LVAA 4H7HA 5BV0A 4C3OB 2AQHA 2C78A 1X0XA 4QVGA 5J40A 3NALA 4WJLA 4FLMA 3IOEA 3IE2A 3K6JA 4BRSA 1LK7A 1Y3BE 1KI6B 1YQTA 2WU0A 5ESXA 3AXTA 4AP9A 2OGZA 1OLSA 2PMBA 4E1AA 1AUQA 1DT5A 3ABRB 1A82A 4PHCA 4B8ZA 4H35A 1VE7A 1K9VF 1O3YA 4I7EA 1RHJA 1WB6A 4BVKA 2YQZA 4RV9A 3RSQA 3H8SA 2JGNA 3VH2A 2VCHA 3ZD8A 1LPMA 1A4UA 2ONJA 1KK2A 1Z9BA 1QK5A 1YZQA 4LSMA 4WT7A 5K4AA 5BWOA 1BE8A 1UCFA 1PEYA 2YXDA 1Y80A 1TKCA 1WB4A 2C0QA 4PHHA 3WQRA 4B7XA 1YQQA 3HVJA 3STYA 3WLEA 2XTZA 4QGSA 4D0SA 1MG5A 4UPVA 4B3TB 4P54A 3FIUA 1XN1A 2CWDA 2FW9A 2VHVA 3IODA 2MSLA 1O9BA 3NANA 3PJDA 1W1UA 3KXIA 2GCEA 1YGPA 1EZZA 2IEDA 1FNDA 2BRUC 2IHBA 2KX7A 2XAAA 3DMHA 4GRIA 1Y1KE 2YYSA 4UNQA 4NQZA 4K1XA 2GN4A 4G4JA 4TV9A 1PFUA 2LWIA 3NCHA 4MUBA 3VPSA 3M4YA 3X2FA 5ES4B 5JH7F 5THQA 4HAZA 4K0RA 2FSIA 1MF7A 4DMMA 3OKAA 4UHEA 3DF7A 3UANA 2AJ8A 2YJGA 4QUDA 4WBSA 1A9YA 5CM9C 2AVNA 2EEZA 2M1ZA 2ZP1A 1LX7A 5FBVB 4LX0A 2HD4A 4C5BA 4Q5IA 4EAAA 3G7UA 1GRNA 4ZK2A 4CMAA 1R6BX 4BMSA 2RK3A 4IG9A 3HZRA 3E3OA 5AYVA 3N6VA 4BNDB 2VQEB 5B57C 1IFXA 2ZBVA 4AECA 3AUFA 5FUWA 3MWDA 1L1FA 1MAVA 4KHPB 3BTUA 3IILA 2P9GA 5JSHA 1ZS9A 3B89A 3LGAA 4HVCA 3P32A 1WXQA 1Z0DA 2RIRA 4EARA 5BOSB 4W5QA 4KO1S 3FSEA 4M7PA 4J7AA 1Z2NX 4P4NA 1L8OA 2PT7A 2VDPB 4V03A 3RVRA 1ZM3A 5C32A 3KQUA 1PWYE 3BFKA 3ZX4A 1WPXA 1N7JA 2XWPA 3MWJA 4PQFA 4Y0NA 3WP1B 4B3CA 3GZNA 2AXQA 4KU4A 4K8RB 2ZB4A 5GMOA 4MJ3A 2E0IA 2I1LA 4Q6WA 2AN3A 1B15A 4MEAA 4Y9TA 2BN4A 1H65A 4UTZA 4GIBA 4BLSA 5AW8A 3H5IA 3HBNA 1JE1A 1JXOA 2WF7A 1EQAA 1CG6A 1P5FA 1PJTA 4MRSA 2VSNA 3K9LA 4M22A 2Y1KA 2VPIA 4HWTA 1ELOA 2B94A 2Z3VA 3GF4A 3QLVA 3R3YA 3LQRA 2I2DA 5F12A 1IUNA 4AURA 1G5HA 3QF7A 1SBTA 4JQOA 2AOUA 4D6XA 1IMOA 2RAFA 4OXRA 4CGZA 2I62A 2QSZA 2YNMD 3MCAA 3DFIA 1ZA1A 3M81A 4V3CA 4WKBA 1BXRA 3TL2A 4DJ5X 5JC8A 5I5EA 3KZOA 3IKVA 2Z1NA 2D2VA 3QOFA 2D6FA 4OK3A 1CU1A 3C39A 2CLMB 2SCUA 1WIWA 2IBSA 2FEOA 2D13A 1A50B 1TVCA 3W1WA 2EP8A 3WNVA 1T3SA 3Q7SA 5HM8A 3QU2A 1FX0B 3TDNA 4PX9A 4V1CI 5M04A 1W4ZA 2Z58A 3BTOA 4OI0A 1OAKA 2XKAA 5IM5A 4KTVE 2C9OA 4OX9Y 1AC5A 1OY1A 2HJSA 1IL0A 1F8UA 1GU0A 1XCPA 3PDIA 4P4TA 4X64B 4PCVA 2PVSA 3T38A 2GZ2A 1P0IA 1N0HA 3BC1A 4C0WA 1I2MA 3UMBA 2BFWA 5CVEA 5FTNA 4O4HA 1VJ0A 2DPGA 2NV6A 3H2BA 4UMFA 3ZE2B 3VHLB 1OGIA 4A6EA 4R2XA 4IQ4A 4R1UA 3UGQA 1YDEA 3W6OA 1RKVA 1ACMA 5EHGA 1BH2A 3OCUA 4A36A 4HMOA 2C29D 4L4RA 3LSTA 5I45A 2W8ZA 2WFAA 5CURA 4LCBA 5EQFA 3IQDB 3WXMA 3K94A 3RYHA 2PKWA 1XZNA 1KZHA 1Q2UA 4XPZA 3IR6A 3U4GA 1CPYA 3WHPA 4GEGA 2LRHA 1QV6A 2IOFA 2PUTA 3M82A 2WWWA 5AVSA 3HVRA 1SHLA 1C9EA 1DXOA 4R81A 4OM7A 2FUEA 1BW9B 1HK7A 2ZJ8A 3H84A 4PPYA 4BNLA 4BQSA 1E3LA 5KVVA 4KPYA 4GDFA 1LJ8A 3ETEA 3HY4A 3ETLA 4J9VA 4EHJA 5IANA 1KGDA 2F3UA 1JPNA 1ZOOA 5GWXA 1QORA 3NWJA 3E7DA 3VU0A 1CQJA 3TLEA 4FNOA 5HA5A 5FNVF 1H0HA 1NE7A 4LXGA 5J5AA 3RSZA 2J9GA 3UGTA 4F56A 2F1RA 2AFRA 3CIOA 5FOQA 2ZAIA 3K9WA 3OJOA 2JFGA 1XQYA 3MMZA 2H3EA 4JSTA 4U2FA 4LXQA 4F4IA 4Z3OA 1OH6A 3CLUD 4JFRA 3JZFA 5EERA 5GGYA 2BBOA 1P0FA 2EYUA 2Y2UA 4RFLA 2O3QA 4PCLA 1DXQA 2HA7A 2QG6A 3EPRA 1KSGA 1CDDA 3ZX5A 5LSAA 1TGYA 1ZH6A 1X1RA 4O2BA 4EA7A 3OQMA 2QZJA 3HXMA 3UOGA 3VQTA 3LPLA 5KOHA 5EP2A 1JEAA 2GZAA 4FKMA 5EP4A 3T7SA 1HURA 1NI4A 1H3NA 3F4KA 1PR0A 3ELWA 1JEQB 3FOWA 3WFZA 3UCFA 1M0WA 4TZTA 2P30A 2E2WA 1Y42X 2ACWA 2NACA 1NNEA 4QYSA 3LKDA 5DT2A 4FSDA 4D4GA 1IIRA 3PDHA 4KPUA 1B8NA 1T2CA 5IAKA 1D3AA 4A8JA 4MA5A 3O26A 4ZXPA 3I8XA 2TECE 2XZLA 3UMGA 4TVKA 4O5OA 3LX4A 4S1VA 1NF8A 4BKRA 3IIMA 3OX4A 5KC8A 1EGQA 5MDHA 3PITA 1IZ8A 3UMVA 2XVZA 1YUNA 1OF1A 1OILA 3H13A 1EWYA 2HRCA