1L3BA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, c2 spacegroup w/ long cell
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3bA00
1DL5A 2ZVJA 5GM2A 5C0OE 3DLIA 3HP7A 1X1CA 1WXXA 5FTWA 5FCDA 1ZKDA 3UJ9A 4DF3A 2FK7A 2O0LA 4BY9E 3GJYA 5P8WA 2ZIFA 4E32A 3EMDA 3NTVA 4E70A 2AVDA 4M38A 3BZBA 1SQGA 2WK1A 1O54A 4PONA 4QVGA 5FA8A 3SGLA 2BR4A 2G8NA 5KQRA 2IBSA 1XTPA 2IGTA 3HVIA 3OU7A 1BC5A 5FA5A 3OE4A 4Y2HA 3KPYA 2AOWA 4RYLA 3KR1A 2B2CA 5F2KA 3WSTA 4GC9A 4H0NA 3VYWA 3EVDA 5DRYA 2YR0A 4PYIA 4Y30A 1QZZA 1G55A 3G2MA 4QPNA 3FPEA 5G02A 1O9HA 4A6DA 2R6ZA 3G5LA 5EMMA 8MHTA 3DXZA 4F86A 2Q41A 3AXSA 3IYLW 1R00A 3GGDA 4DCMA 1RJDA 4YUVA 2ZFUA 5HIMA 3FUVA 3HNRA 3CJQA 2PT6A 1N2XA 1B42A 2ZIEA 3PX3A 4R6XA 5H02A 3PS9A 1YZHA 1TPYA 1YUBA 2AN3A 4OA5A 3EVCA 4P7FA 3ELDA 1XDUA 4E31A 2ERCA 3UA3A 2XBMA 1O9GA 2B25A 3BKXA 1SKMA 1RJFA 3DP7A 4KDCA 5DM4A 5DSTA 2AOXA 5HIKA 5E9QA 4YUXA 3P8ZA 1XVAA 1TW2A 3GRVA 2VP3A 3BWBA 4FP9A 5FULA 1L3BA 5HIJA 4PCAA 3BGDA 3EVBA 4EKGA 3R9XB 3KR2A 10MHA 2GH1A 4X41A 1UFKA 2IDKA 1UWVA 3PX2A 4RX1A 5E1MA 1Q0TA 5M5BA 5EMJA 3FYDA 1FJXA 2O05A 3B3GA 5EG5A 5JR3A 3LDFA 2PSSA 2ZSUA 3CC8A 4U7TB 1N7JA 5HZMA 2AOTB 3DTNA 3HCEA 5K01A 3UJ7A 2PT9A 2GS9A 2UZ4A 4E2XA 4X60A 5DRTA 3FUXA 3SXJA 2QE6A 5KQSA 2ZIGA 5HFJA 1AQJA 5FHRA 4MIKA 4LECA 4PIMA 1WS6A 3P9CA 1OR8A 1JSXA 1R8YA 1NW6A 3KQVA 4GOND 2G71A 5FUBA 5C9ZA 5GIOE 2PWYA 3E8SA 5EKUA 2QY6A 1JG1A 4LWPA 2YXEA 1YFLA 2VDUE 3BWYA 2PV0A 3JWIA 3OCJA 3B89A 1L1EA 2PXAA 3P2EA 1H1DA 2QRVB 2HV9A 2IPXA 3JWHA 3LSTA 2GPYA 3LCUA 3MAGA 3TR6A 4GOMD 4G56A 3LHDA 3VSEA 5K0GA 4MWZA 3I64A 3BWMA 2AOUA 3GRYA 2FK8A 1Z3CA 5K0CA 1KPGA 5EMLA 1XCJA 2BZGA 3DXYA 5ICGA 4X1OA 1KYZA 2ZBPA 2Z6AA 4PGGA 4RTLA 1NV9A 2ZBRA 4AZWA 4ER0A 3CJTA 3KKZA 2NP7A 3HA7A 3LKDA 1ZG3A 4P7JA 2P3OA 1VQ1A 2XYRA 3ELYA 4C03A 4OX9Y 5E8RA 2ZWAA 4C06A 3A25A 2DULA 3UBTA 2UYHA 2HR1A 2NYUA 4L7VA 2AZTA 3LKZA 5EHIA 3FTCA 3UFBA 1KR5A 3E05A 5HEKA 3U81A 2HNKA 4OQDA 3UJAA 9MHTA 4FR0A 4V0RA 3HCBA 2IIPA 2UYQA 5LQAA 3DMGA 5E8JA 5E1OA 4CKBA 3MQ2A 3QV2A 4P7KA 4OBXA 1EAMA 5BP7A 3HCFA 5E1BA 4WVLA 5DXJA 3A4TA 1RI1A 2P40A 2CKDA 5D1HA 1X1BA 3CCFA 3HCDA 2NXEA 3BGIA 4V0QA 2YUIA 2EJUA 4HC4A 4X63A 1I9GA 2P7HA 3AJDA 1WY7A 3A7DA 5U4XA 2OZVA 2G1PA 5CIYA 4AX8A 1IXKA 2PX4A 3DLCA 3I53A 1NW5A 3FYCA 3G8BA 4R6WA 3TKAA 3KHKA 3MTIA 3ER9A 5T64A 1WZNA 2JHCA 3M6VA 1MJFA 5HOQA 3NVMB 3SSNA 1M6YA 4POOA 3KQQA 3FPJA 4C08A 1L3CA 4RVFA 1QANA 4RV9A 4E2WA 3LECA 3NMUF 5FADA 5E2AA 4XCXA 3A26A 3Q87B 5LSAA 5GP1A 3UZUA 3RIEA 5DT2A 4RTOA 1R8XA 1U2ZA 2ORED 5FQOA 5GIPE 2LD4A 3HCCA 3FPHA 1DUSA 2PX5A 3EGVA 4ZTBA 4CKCA 1R6AA 1P39A 1V39A 2Y1XA 3LDUA 3OU6A 3ID6C 5BW4A 2QM3A 3TRKA 3BT7A 2GA9A 5GM1A 3NDJA 3A27A 3GO4A 5DTRA 5FWAA 2PX8A 4YV1A 1JQDA 2PWPA 2UYOA 1KPHA 1SUIA 2NNWB 5ICEA 4RTMA 2B3TA 3LL7A 2OYRA 1G38A 2IFTA 4EK9A 5KS2A 4PYJA 1YZ3A 2WA2A 4DZRA 5IKMA 4MTLA 4HH4A 4BLUA 2DPMA 4HTFA 1R18A 2AVNA 2Y1WA 3GRUA 3PB3A 2YXLA 5CVUA 1KPIA 2VZ9A 4X61A 4QQNA 2OB1A 3GIWA 2Z6UA 3PFHA 4KDRA 3C6KA 4EQZA 4RTNA 3DR5A 1KP9A 5E9WA 4EKIA 4RTKA 3THSA 2E5WA 3FRHA 3DULA 1QAMA 2AOTA 3G88A 4PYNA 5KVAA 3HA3A 5E1DA 3SX0A 4QTUB 1NKVA 1NW8A 2I62A 2OBFA 4PCLA 5EEGA 1D2CA 3KR9A 1VPTA 1NW7A 1JSZA 3SSOA 3ANXA 3DUWA 4R05A 2G70A 2HWKA 3MGGA 3LBYA 4HGZA 2ZZKA 3V8VA 3MERA 3R3HA 3HVHA 3UJ6A 4RVDA 4FS8A 3P97A 4RWZA 1RJGA 4U7PB 2AN5A 5CVJA 1P91A 2PLWA 3X0DA 3GDHA 5EC8A 2IH4A 4Z2YA 4FT2A 2OXTA 2AOVA 1XJ5A 1VP9A 4RTPA 4BLVA 4ER5A 5BW5A 1XCLA 4PYLA 3E23A 1SVUA 3FTEA 2A14A 2PX2A 2VS1A 2NP6A 3G8AA 5HIIA 2QRVA 2JHPA 3NDIA 1MHTA 2YX1A 3HVJA 5EPEA 5T67A 1D2HA 4K6MA 2NXJA 3D2LA 1NBIA 2I9KA 1N7IA 1JQEA 4M7RA 4OQEA 5GOZA 1NBHA 5K03A 2JG3A 1ORIA 1EQAA 1F3LA 2YXDA 3PTAA 7MHTA 1HMYA 3FZGA 2IDJA 3L8DA 3M6XA 2P1DA 3R24A 2WA1A 3CGGA 3KPJA 3HM2A 1BOOA 2H11A 3CJRA 4R8SA 3K0BA 4GF5A 5FWDA 4BLWA 5CCBA 4CWAA 3OFKA 4M37A 4OBWA 4PYOA 2JJQA 5CUQA 5ERGB 3TPZA 3ERCA 3GU3A 1L9KA 3F4KA 3LBFA 3SMQA 2AR0A 3TLJA 3DMFA 2YTZA 3QOWA 1ZHFA 3P9IA 3OFJA 2BM9A 1EJ0A 1WG8A 2JH8A 4LWOA 3GXOA 1FP2A 1IY9A 4R8RA 4DMGA 2AN4A 1IM8A 4GOLD 4LG1A 3G5TA 4E33A 5DLYA 2B9EA 5DWQA 2GAFA 2EFJA 4E2ZA 4PYKA 4YUYA 3FUWA 3SR4A 4DQ0A 1ORHA 2O07A 3NW9A 5EMKA 5DSXA 3LCCA 1QAOA 1YB2A 3M6WA 2C7OA 2OY0A 3QOXA 2NXNA 3JWJA 4XUDA 4AZTA 4B17A 5DX8A 4E30A 5LQUA 2C7QA 4F84A 3GRZA 5DM0A 1Y8CA 3OPNA 4NECA 2PBFA 1FPQA 1L3IA 2FPOA 2OB2A 4M36A 3MTEA 2H00A 3SM3A 2BR5A 2N47A 3EVEA 2IH2A 1BKYA 4CXMA 1KHHA 3KPVA 3OZTA 4A6EA 4ER6A 2P35A 5T6BA 5DX1A 3KQSA 2HTEA 2FHPA 4KIFA 1RI4A 3NVKI 2XYQA 4QDKA 3KQMA 1ZGAA 1ZQ9A 3M6UA 4KRGA 1RI5A 3SSMA 3UWPA 3IHTA 1AF7A 1KYWA 1VP3A 4KVZA 2FCAA 2VDWA 2P7IA 3AWIA 2AOUB 2XYVA 3BUSA 3C0KA 3O31A 3FUUA 3KQWA 3TM4A 3OZSA 3V97A 4YV2A 4RTJA 1JG2A 5LR6A 2KW5A 5EIWA 2B78A 4P58A 5JUWA 1EIZA 1G6Q1 3B7PA 3M4XA 4FSXA 5K0NA 1R74A 4CTJA 3DMHA 4IWNA 4FGZA 3GWZA 1JTFA 4EMSA 5BXYA 2PGXA 1YF3A 4MHTA 3KQOA 2O57A 3EPPA 4AZVA 3HEMA 2CWWA 3S68A 3ER8A 1NE2A 2PJDA 3EEOA 4PYMA 5GINE 2PVCA 2ONZA 5DTMA 4IV0A 3FRIA 4HRAA 4CTKA 4YV0A 5EIFA 5C1IA 4RTRA 1AQIA 2V74B 2GB4A 4QQKA 4C05A 5K8VA 5EOVA 2K4MA 5K05A 5EZQA 3CKKA 3P71T 3LPMA 4FSDA 3KQPA 3G2QA 5DX0A 2P41A 3GNLA 4JXJA 4RSRA 5K0FA 2P8JA 4HG2A 3RODA 3FTDA 1F38A 3A7EA 3FUTA 4PGHA 5EVJA 1YFJA 5K0LA 4ER3A 5F2NA 4RTSA 2ZZNA 1JG4A 4QTTB 5DM2A 1G60A 1JTEA 1XDSA 2BR3A 3PLAE 1TW3A 3IEIA 3E7PA 4F85A 3UJ8A 5LQRA 2ZTHA 4IKPA 1PRYA 2VDVE 5CVVA 1SQFA 5CVEA 2H1RA 3TM5A 2EG5A 2JH9A 1FP1D 3P9NA 3EGEA 4MQ4A 3KR0A 1EG2A 5D1NA 1NW3A 3OE5A 3LGAA 3ME5A 4PINA 4EVIA 1X1AA 1AV6A 3JWGA 4PNEA 1Q0SA 3NWEA 5K0BA 2IBTA 4GQBA 3TKYA 3UJCA 5MHTA 3PVCA 3BGVA 1KXZA 2CL5A 4YUZA 3HTXA 2BM8A 3BXOA 4ATNA 2V7EA 1VBFA 2F8LA 3ORHA 3DOUA 4C07A 3TMAA 1QYRA 1INLA 4GEKA 3DH0A 1JG3A 3HVKA 4KIGA 5EKXA 3VC2A 3EGIA 5KYGA 3NJRA 3OU2A 4GBED 4XUCA 1EJ6A 4RVHA 1I4WA 3EEYA 3HCAA 3O4FA 4GC5A 3P2IA 2EX4A 3P2KA 2OKCA 4IV8A 3REOA 2ZULA 3PT9A 4DM3A 4QPPA 2G72A 5E2BA 4BP3A 3EMBA 4FT4A 2PXXA 2NXCA 5FQNA 1FBNA 2O06A 2OO3A 2XVMA 2C7RA 3R6TA 1G8AA 5E9JA 3UA4A 5CD1A 3DXXA 3KQYA 1P1BA 1KIAA 3LDGA 4KW7A 1SUSA 4HTFB 3MCTA 4DCGA 3T7RA 4O29A 5EHGA 1WXWA 2ADMA 4PWYA 4PYQA 3UJDA 4KWCA 3B3FA 1VIDA 2P3LA 2PXCA 3IV6A 3FTFA 4GOOD 1HNNA 1UIRA 3R0QA 2YQZA 3H2BA 4QDJA 2Z6QA 1RI3A 5EQJB 5DXAA 3G2OA 2ZLBA 2PY6A 1X1DA 1ZGJA 4FZVA 2OPBA 4QVKA 3AY0A 2ZW9A 4XUEA 3P9KA 3MHTA 3C3YA 5EEHA 3KU1A 5F2OA 3I58A 5DTQA 3TOSA 3VC1A 3O7WA 2ONYA 5CVDA 2JHAA 1VL5A 5IH3A 3AXTA 3TQSA 4C4AA 2UYCA 5LQNA 1JQ3A 4AZSA 5CM2Z 1VLMA 3I9FA 3UJBA 4ER7A 1RJEA 1VE3A 5LQKA 1BHJA 2CMGA 3EVFA 3KQTA 2I6GA 1JR4A 4CKEA 2ZWVA 3B5IA 4YUWA 1M0EA 5DPMA 1NT2A 1P1CA 1DCTA 1SG9A 5DM1A 2ZZMA 4P7GA 3CVOA 2I7CA 3CBGA 2BH2A 4RVGA 4HSGA 1QAQA 4HGYA 3FPGA 3BKWA 4E2YA 4DKJA 4RTQA 3M70A 5K09A 1RI2A 3Q7EA 3RW9A 1T43A 3B3JA 3ELUA 3GRRA 3T0IA 1X19A 3MB5A 5LQJA 2IP2A 3KPWA 4WXHA 3PFGA 4C04A 3I5UA 1XXLA 3C3PA 5EZSA 2CMHA 4YMGA 5K0EA 5B1SA 2FYTA 3T7TA 3TFWA 2ESRA 3SVZA 5EGSA 5ICFA 2GLUA 5K0JA 1G8SA 1PJZA 2HMYB 4GUAA 3KPUA 1XDZA 3EVAA 1D2GA 2YVLA 3C6MA 3ELWA 2QYOA 2ZBQA 2XVAA 1NV8A 5FHQA 3T7SA 1I1NA 3MCZA 4ISCA 4AUKA 2PKWA 4UOEA 3K6RA 3BWCA 5LQCA 2EJTA 4BP1A 3OZRA 3NWBA 3LCVB 2FRXA 3LX6A 4PIPA 2R3SA 5ICCA 2IH5A 2C7PA 2ZCJA 5GWXA 3G89A 3GCZA 3HA5A 4OA8A 4YMHA 3FPFA 3G2PA 1M6EX 3G7UA 5CCXA 3EVGA 2P3QA 5HILA 4DA4A 3M33A 2AS0A 3THRA 3EVZA
chains in the Genus database with same CATH superfamily
3FNGA 4UAUA 4UHKA 4ACBA 3I30X 4G5GA 5G0WA 2QYHA 4A82A 3THWB 1FTGA 3A04A 3KJGA 4BY9E 3C45A 1BA3A 4XJXA 3VR4A 3EMDA 4JL8A 1NQAO 2VHEA 3DVLA 1EHYA 1U28C 2VYQA 4RCZA 4FOOA 3ZDAA 1QX3A 1Z0UA 2VJQA 4IPTA 2CDNA 3N7UA 4A8PA 5ALLA 1PR0A 1CNEA 4ZK6A 4NHEA 3DKIA 3OZGA 4HRVA 5JW6A 3QFFA 5ITVA 3OQNA 1XTUA 2BGIA 1CRZA 5T8KC 4JLKA 3UUFA 4C01A 5IYZB 1FLAA 1RYDA 2JFQA 2JJ8A 2WJIA 2A5LA 2JJ1D 2XSZA 2QUAA 3H5RA 3PGJA 5TC4A 5J2TB 2Q9CA 1U90A 2L82A 1OXXK 1WD7A 5TPZD 5LU9A 2CV0A 4A6DA 4CEIB 4UBMA 3TNFA 2IEBA 4NEHB 3FNQA 1NUHA 2V7WA 4KLRA 4YO7A 5IAKA 2IF2A 4L5CA 1Y48E 2VAMA 4L7QA 1W87A 4B6PA 3GJZA 2VJBA 4BRSA 4E4TA 5IRCD 1NVAA 3LWZA 1TRHA 1PF7E 2H0QA 1K66A 1E6WA 2YVUA 3BHNA 4X1KB 3PX3A 3KTFA 2J9RA 3B7WA 3CURA 1LK0A 1CUGA 2DF8A 2E4ZA 3EVCA 3VQTA 3ZUGA 1Q11A 3KEFA 4RJKA 3BKXA 4EKEA 2BY4A 1LEHA 2VN8A 1EXMA 2QE7D 1DG3A 4Q39A 1M1UA 4D99A 1BGVA 2UUOA 4YJKA 5KNBD 2HA5A 3OF3A 2Z8ZA 3MZ0A 4MR8A 1MT3A 10MHA 1TIPA 4MJXA 5JFOA 1OB2A 3KSRA 1ODFA 1OCEA 4MYUA 4RPLA 4DANA 5F7ZA 4ETMA 4RY2A 2CK3A 4MQLA 1N6RA 5I9IA 2ZWMA 1E2QA 4U7GA 5CITA 5JNSA 4US0R 2G67A 5JR3A 1RHKA 1BVYF 1TJNA 3FM9A 1Z3IX 3FROA 3R20A 1J90A 1FNMA 1PKEA 1G6OA 2PT9A 2E1PA 3NHZA 3IQHX 4JENA 1A27A 1DAEA 2O7SA 4RFLA 3IP9A 1UADA 1IEWA 5FHRA 4WXRA 4F4CA 4KE6A 4IVPA 2W8BB 4RORA 2Q3MA 3IEKA 4AJNA 2VJKA 4EEZA 5DGHA 4B1FA 4PRLA 1C1YA 3WC4A 5I8ZA 4CQLA 2B30A 3ICCA 1R6UA 2I34A 1KAHA 4JVMA 3O38A 4LYGA 5JYBA 1Q0HA 3FVQA 1OT3A 4ZAYA 5J47A 3PVSA 3ND9A 4GX5A 5AI4A 1DXQA 1XZKA 3JWIA 2OM2A 3OCJA 3PFCA 2CLEB 2IYLD 3B89A 4I36A 2DLDA 2PXAA 3AEZA 3B9BA 4ZVKA 2ZYGA 3CNBA 4A2PA 2PEYA 4UNSA 1CF2O 4RPCA 3W8RA 5AW8A 2VHTA 3M3DA 3S2UA 3VSEA 5K0GA 1OBFO 1MC4A 1ZM4A 5C1OA 4D3XA 2EQAA 1WUJS 4INJA 2JCVA 5KSWB 3CEJA 1D4OA 4GP9A 3OOJA 4E08A 3BH0A 4RK7A 2GVDC 4ZAGA 1O95C 1TZCA 1KYTA 1NV9A 2G36A 2A1UA 2BFFA 2YVQA 4ZV4A 1UKAA 4V1CA 4MPTA 5CDHA 4P83A 3EK2A 1ISRA 1NAHA 4IH4A 1VQ1A 3DUFA 2Z09A 4LYHA 5JC1A 2BFBB 4OX9Y 3U6KA 5J23A 5FJIA 1JJVA 2GM4A 1IB6A 2DULA 3Q1KA 2A33A 3CF4G 1RHQA 3DZHA 3OPVA 2AZTA 3OTWA 4IO1A 4L7VA 4M1YA 5EP2A 3OJEA 5ER9A 9GPBA 2C9BA 5FF9A 4RLSA 1YRAA 3PDHA 2PE5A 2Y6UA 5BR8B 4DCPA 3DMGA 2O3UA 2FOLA 5E1OA 5IBRA 2Z9CA 4OBXA 3VDXA 1T5TA 1QHHA 3LM8A 2NU6A 4Y98A 3FBWA 1AKVA 3CW8X 2X3FA 4FCCA 4A7PA 3L1IA 3LC0A 3JCZA 4HNVA 3B1VA 3ETCA 4AMBA 4F38A 4NBNA 521PA 1VFPA 1UCFA 1WY7A 3UV3A 2FFJA 1H8HD 3HYRA 1PVOA 5AQEA 3W2TA 3HBNA 4R0MA 2QU7A 3AUXA 3DBHA 1GSHA 1T4GA 4NE7A 2N1BA 1FXWA 5JCJD 2IZOA 4X66B 1UZUA 4R41A 2TYSB 3HPRA 3FHCB 1KS9A 2QZJA 1JF8A 3LLCA 4FHFA 4H3HB 4HN4B 1PTJA 4S2UA 4Q1BA 2H8GA 3UMJA 1EGHA 4E2WA 3VX4A 3ZCXA 4EA9A 2BF7A 3BB3A 3LYHA 2YUTA 5FFFA 3EH1A 3Q87B 4DIBA 2Q2WA 1SD5A 2NXWA 3IOBA 4HH1A 4FKZA 1U2ZA 4TYWA 1II8B 1T3GA 3QNWA 1G4HA 4GYJA 1MB0A 2I9PA 5AXDA 4EG3A 4DV1B 3U17A 2QM3A 3V7NA 1PVDA 1G7CA 3BT7A 4PHHA 2XQIA 5DTRA 1CKEA 3UHFA 4ESHA 1FQKA 1NXPA 1TUEA 5AI6A 5T4HA 2YW9A 2Z43A 4MVXA 3RSSA 5A5GA 4KIUA 3M3PA 4KXLA 3H5LA 3KAJA 3EVNA 1GZHB 3S1AB 3IDQA 4LHSA 1YZ3A 2WA2A 1GFSA 5LP6C 5KS2A 4EITA 4YXWD 4DR7B 4KJXA 4RW0A 2QTNA 3GRUA 4KITB 3VH1A 4GZ6A 1ZUNB 4UMVA 4DDWA 1DKRA 2OB1A 3IAS6 4Q1VA 2FQ1A 5IJXA 4KE9A 3CR3C 4YP6A 3ETGA 2FW6A 3ROZA 3SHOA 5DM70 2GZSA 2G1JA 2QIOA 3BE6A 4PCUA 3T3OA 3SX0A 5JJKA 1TA0A 3AVXA 1HYQA 1XLVA 2E18A 2RIPA 4X8LA 3UTDA 3CH4B 4RHXA 2DY1A 1JSZA 2XIQA 3BJZA 4LV8B 4N5LA 1I32A 4IHAA 4A36A 1HC7A 3WLPA 2ZZKA 1UBHS 4EJSC 4H4CA 4RVDA 2G1PA 4RWZA 1RJGA 1DEHA 1UBCA 4NMWA 3ZKWB 2FN9A 1UT5A 3JAWA 4XCVA 1G41A 1BH6A 5IZ4A 3X3HA 3URMA 3QMMA 1XJ5A 3L8GA 1PJRA 2A67A 1XAHA 2QLJA 5A7HA 4MQBA 1SRQA 4W5OA 3WYDA 1YACA 1R8JA 4QBKA 5IVHA 4XIGS 2A14A 5FOVA 3OSZA 4HWOA 1JKIA 2IZZA 2QRVA 3NDIA 4NY1A 2QLMA 3HACA 3L43A 3UIEA 1U7UA 2HXSA 4FPXA 5BSKA 2OORC 4DARA 2C5EA 5THQA 2GAIA 3VNUA 4OATA 2B4YA 3FWPA 3UO8B 5D3MB 4CTNA 5JIBA 4RDHA 4B74A 2G09A 1YFKA 4JLMA 4A27A 3UGKA 3V55A 4K5QA 1OPRA 4KXYA 5IMSA 2MSDB 4GMFA 4ZAVA 1K9SA 2W2LD 2WU3A 1QDEA 3W4IA 5CCBA 3DOIA 1LTQA 4LEIA 3JZAA 2JJQA 4HLNA 4OD0A 5DASA 5E3JA 4M83A 1F60A 4AECA 1L9XA 4JC0A 3RUIA 1NQTA 1ZYUA 4LUCA 3DE6X 5IXJA 5KDDA 4FZ3A 1IUKA 1KGDA 3KLBA 1QXSA 3RM3A 2BFEA 2F62A 1KP3A 3DL7A 1ONOA 1XD9A 2QD1A 3H7IA 3HGQA 4GM0A 5A3SA 4EL5A 5KWEA 3T9EA 1PWZA 2O07A 3NW9A 3T1TA 3QI7A 4TKUA 1KZHA 1VKHA 1Y5LA 3U1VA 1HE2A 2VBIA 4BX2A 2NXNA 3JWJA 5FA6A 4C0BA 5HK9A 5L53A 1CUEA 3T52A 1X3LA 3L7MA 2OEPA 1ACMA 1BZYA 2Q6IA 3OPNA 4MP3A 4TMXA 5JH7B 4CMBA 5JXJA 1YQGA 3MHPA 4FKBA 2QN7A 5IKXA 3K31A 4W5QA 4LDAA 2CHGA 2ZSKA 4BO6A 2YBEA 1KL7A 3KQSA 3I4LA 3AK4A 4WUVA 4NJEB 1GL7A 3TJRA 3TLMA 2DRIA 1Z6TA 2ZT8A 3THWA 2IPOA 3B36A 4KRGA 1RI5A 4XQ9A 2OXFA 3AV0B 4Q05A 1QU3A 2X40A 5AHKA 1CW2B 2XA9A 3LCMA 1KY3A 3BUSA 4LC0A 4JAVC 4DDKA 1NNUA 3OZSA 3TTXA 1O9BA 1PK7A 1SULA 3QQ5A 1JG2A 5BSWA 2A9JA 5H3HA 1N2OA 4K9KA 4NJMB 3KWLA 3TMYA 2OLEA 4ZT7A 4K6CA 5F73A 1Z4MA 4U7HA 3JPYA 2IYWA 3COZA 3EW7A 2HIHA 1EBFA 1PYOA 3E3MA 1CETA 5EVCA 1BE1A 1WWKA 5IYZA 2V6MA 4NONA 5GINE 5LQMA 1PQYA 2QTTA 4EELA 5I4BA 1SXQA 1Z2DA 1MA3A 4GM4A 3GHYA 4CEIA 1Q1ZA 4PGAA 2W6PA 2VK4A 3FDXA 1SOAA 4JUFA 3CYFA 5G1PA 1QKJA 4JD5A 5IARA 4W9NA 2Y0CA 4V2UA 2OG1A 3SX2A 1HRDA 5D01A 4HQ6A 4Z86A 2FPGA 4BWYA 3OOHA 2J4FA 4MW4A 3TOXA 3LE8A 2Y66A 2M9MA 1RQPA 1EE2A 2BDUA 4EPYA 1H69A 1JTEA 1VL8A 3VV3A 2CT8A 3T6KA 1HFWA 2JIPA 4P3KA 4UTOA 2FPPA 3I0MA 1G7TA 2SKDA 5F4BA 1GDHA 1TCBA 1Q7GA 5CVVA 1T9GS 3D8TA 4TLLB 4ZV7A 2PTHA 4UJ5A 2HMVA 3MCAA 5EJGA 3G3EA 4IGFA 4ODIA 3AI2A 2XQKA 1QOQB 4R3NA 3WADA 1H05A 4QVIA 4BU1A 3MFYA 4X84A 5H9VA 2KSQA 4U7DA 1J0BA 3BSYA 4NZOA 3SZLA 1Q21A 1ESNA 3E58A 3U26A 2DB3A 3PZBA 3T54A 2PGAA 3D8HA 2H92A 4D9EA 3TMAA 3LLSA 3UAZA 1O8BA 2W8BA 2GFHA 3NJRA 2WHYA 3OU2A 2A94A 3DTTA 1XF9A 1U04A 4YAEA 3RO7A 4PS0A 1OU0A 3I72A 5CFNA 3ONEA 3IKTA 3SFTA 4AVYA 4RMIA 4LY3A 2ODNA 4AF6A 2CVZA 2F1RA 4H60A 1PUJA 2EF1A 4QLAA 4HNSA 1DELA 1VRVA 2IQIA 1HY3A 3A9RA 3SQWA 3O1JC 3U3JA 1PW7A 4M8IA 2O8EB 1O97D 2XVMA 4LSWA 3UJPA 5CD1A 3TW6A 3LDGA 1KI1A 2GQ0A 2O2YA 3MJSA 3QKRB 2AXEA 1N32B 1GQYA 1Q1QA 2GYVA 3AB7A 1K8RA 3SHVA 5CK4A 2FSVA 2AQKA 2ZJYA 3AJEA 3D31A 3KUKA 4FFDA 4O29A 1SB8A 3RTBA 5KVVA 1U8CB 1MC8A 1XKLA 1XQYA 3GUZA 1XB2A 4N54A 3ADBA 5AK4A 3IL2A 3PEVA 4M9QA 4QUJA 1AKEA 2K7FA 2FSHA 3QPDA 4C3ZA 1UQRA 4BQRA 2GCNA 2O2SA 4MGZR 5DNAA 5K9ZA 4DHEA 2IVZA 4QVKA 5J4LA 2WTUA 2PRSA 1TMGE 2DJIA 3WK5A 1VE5A 1G3UA 3ZI7A 1J5EB 1P2VA 1NYLA 2OFOA 3D7MA 1GARA 3IP1A 1OTYA 4ND8B 3VC1A 2X9LA 4YGYA 2ETXA 1I6KA 1PJTA 2HO4A 5EP3A 4HL6A 3L4SO 1PEYA 4JI7B 1F7VA 2YY6A 5IVIA 2GN6A 3HZZA 3FAZA 3IDOA 2WF6A 3MUEA 2AJLI 3G0DA 3RQSA 5JMWA 1BYIA 4DDHA 3NBKA 4YP9A 3RUEA 1XP5A 3PKZA 4ICIA 2XADA 4KL8S 4XJVA 3SP1A 4BX0A 2JCBA 2CJWB 1IZZA 4ZDIA 4DUGA 1VDZA 2HJVA 4RVGA 5AJYA 1QAQA 1WU7A 4H3VA 3QKWA 4RTQA 3TE6A 3F7OA 4JA2A 4ARSA 1PLLA 1I2ZA 4HX2A 4ZCLA 5CB4B 3V8QA 3M9LA 3M4YA 4PC3A 3GRRA 2D62A 3ESDA 4MO2A 4MYDA 1OILA 4DPLA 4LVUA 4MQEA 1TDJA 2CMHA 2BGTA 4FQ5A 4ROSA 2CXHA 4MVYA 2ESRA 3EWAA 5JMOA 4UMDA 5EGSA 4CQMD 3C74A 2C4MA 3A3YA 5K0JA 2DETA 1A0OA 4LZNA 5B36A 2WM8A 4D41A 3PUIA 5ARBA 3VNRA 1KI6A 3QI2A 1J8QA 1Z34A 1BJTA 3QBJA 4ZC1A 4EFDA 5IJ9A 2XT9A 3RI3A 2BJVA 4A2QA 4RY9A 5FBRB 2X7HA 2VUIB 3HV0A 4EGAA 1UZNA 3TDKA 1KERA 1II8A 4UEQA 2FRXA 3OUZA 3RLIA 1A50B 1AK9A 3ZCUA 2FPXA 1CUFA 1Z5NA 1U2PA 3GR6A 1I7PA 3MT9A 2QM8A 2PGJA 4KPYA 4G0YA 4X3OA 4JLWA 4WFKA 5H3CA 5A2QA 4GPZA 1TLLA 4U5XA 4NAHA 1TM4E 2EBHX 1HE3A 3A32A 4EM6A 4DA4A 1GCAA 1MDFA 1WVMA 1WW3A 1LF5A 2XOKD 1DL5A 1L7PA 3S1AA 1OYWA 3OQ6A 2X41A 3FVTA 4AN1A 3FCYA 2JJYA 1A98A 1LU9A 1WXXA 3F5DA 1NLFA 2JRLA 4UTXA 4BVEA 3COWA 1BN7A 1GUBA 3EXG2 4D6YA 1L4HA 3PGA1 1M5TA 2IUTA 5K8CA 4WE3A 3E8MA 1SVKA 4BNXA 1FMJA 1GGEA 2VDWB 4CKWB 1SZJG 3LPDA 4O4IF 1ULUA 4JX8A 1GG2A 2C9ZA 3H5AA 3HB1A 5EL0A 1WCIA 1QG2A 2IGTA 4CM4B 5AVJA 4Q9LA 5C7YA 5C8XA 2PMKA 1F6BA 1XRSB 2ZPTX 4JU8A 1QO7A 3O2SB 3PDIB 4U9HS 5AW9A 1VYHA 4WJZA 1EQUA 2OHJA 2QM7A 2VNSA 1DOAA 1VE9A 1ADJA 3OLVA 3KR1A 4G0NA 4G5YA 3KBOA 3TQOA 2B36A 1SHTX 2MMCA 3RVRA 1GAWA 1ZWLA 5A9RA 1L1FA 1J56A 2JIQA 3BFJA 1OBOA 2YR0A 5EQDA 3ZKWA 5AVWA 1TKAA 2YIMA 4ND6A 4DXAA 5G02A 5K6AA 3PQ7A 1EFAA 4MVJE 5B6JA 2DQSA 3LGXA 2Q6TA 2OYSA 3LHKA 4F5ZA 3ZU5A 4D57A 1UM9A 3LX5A 2MTBA 1O2DA 5HTOA 1B8NA 1RJDA 3DJYA 4YAGA 2OESA 4YMSA 3IFSA 3CUTA 4LRUA 3AR6A 1QHIA 3CJQA 4I4LA 3ABSB 1L5HA 3PJFA 2O52A 3NAZA 2WYUA 2X6QA 5AT1A 3NGLA 3E27A 4KQMA 1S8FA 5D3MA 5J2UB 2A7QA 2C3YA 2PYZA 2EFEB 2RMKA 2B25A 4L6CA 4B8ZA 3ACDA 1KKMA 3H4TA 2MU1A 3GZTB 4DC1A 4WLUA 3OX3A 4YMLA 4GRDA 2C83A 3EMVA 4HBGA 1QMGA 2FFHA 3R9XB 4UXJA 3D6VA 4NCHA 2WTNA 3VM6A 4F1KA 5IBCA 4WDRA 2IDKA 2LR0A 1N0VC 3TTSA 4CUZA 1TVKB 1NC3A 1VI5A 2PO5A 3QYFA 3UH1A 1ISGA 2SKCA 2WTXA 3CEAA 2WFZA 4TZ0A 2DY0A 1UMKA 5KQGA 5CAEB 4H16A 1EUCB 2GS9A 1RPZA 1UODA 2AYXA 2OILA 3CCBA 2XGSA 4MCAA 1EH5A 3B5EA 1RCFA 3KYJB 5DNEA 1U4OA 4RADA 3BOSA 3VYVA 2O54A 2FZCA 3GCXA 3N53A 1MORA 5FBLB 1MH9A 1S1MA 5AM1A 3S8MA 2AD5A 2QN2A 4D42A 3MGBA 1SGWA 2QL6A 3AP3A 4AJEA 4F1JA 4P3YA 1SUFA 2PVPA 3Q8KA 1EFRD 1UH5A 2P4UA 3NTRA 5HF9A 4AKGA 1W9MA 2Q5CA 2BKVA 3IKJA 1U6JA 3M1AA 4H7HA 5EKUA 2JCYA 2O19A 4LYAA 2YXEA 1SCUB 5JDCC 4NJEA 1E9VA 1ZJ6A 2HA7A 3QXHA 4BFLA 3KUCA 1BIFA 2PTGA 2QLLA 4H4EA 2V54A 4G56A 2IY9A 2IXAA 3DA8A 2VO1A 1IZYA 1KAQA 3LUCA 1JZTA 2ZRBA 4L4SA 3T7JA 4PXSA 4ES6A 5C7OO 5GTDA 4F6CA 3JZDA 1VLQA 4LYFA 1H2ZA 1KPGA 2PX0A 4JMLA 1NRIA 4IMPA 4MTCA 4PXYA 4Q34A 4Q9NA 4IMIB 3LUAA 1I51A 4NJMA 4CIDA 2AYZA 2ZJ2A 4TM7A 1CF9A 1TZ2A 5LMNB 2PKCA 2FFAA 2Q5IA 2YIVX 3FNIA 3TL2A 4OGWA 5ALEA 3PA8A 2ZBRA 4E1BA 3SZMA 2EW2A 3ZIAA 3MYYA 3VTAA 1WHSA 3QBVA 3V8EA 3ZGXA 1XZLA 1QFMA 2RHGB 3L6UA 3MWLA 1KJ9A 2YN0A 3H97A 1Z56C 3N5CA 3H8WA 1HDCA 2C8KA 2HU7A 3UFBA 1JIQA 2R66A 4XASA 5CURA 1ZJWA 2VUUA 4MVJM 3TSOA 3N2GA 1OT5A 2SCUB 4H2DA 3VKVA 4QGSA 3H75A 1M6VA 2NPFA 3IAS1 2WZDA 4ENQA 2ASVA 3D8RA 4LFBB 2ZRDA 4KGDA 3L49A 2CKMA 4WVLA 2YRXA 2CKDA 3K1YA 1AKQA 4ARZA 4DDMA 5KVSA 3O8OB 5DN6D 2PVSA 3N07A 3HDVA 1XZAA 3BBPA 1Z12A 1A3CA 5FLYA 5FH9A 3L4BA 1FJGB 2P7HA 2W43A 3R5XA 3HJUA 1ZD9A 4BNNA 1I8TA 4YJ2A 2XGMA 5I7WA 3KEGA 4N0EA 1NG1A 3A4LA 3Q9SA 2FJUA 3PUWA 5CHYA 4YONB 2JZNA 1FP4A 4ITVA 4R9RA 3GLFB 5PNTA 5KNDD 2FA9A 3RC7A 4ZVOA 3EZ9A 1NXXA 5AKLA 2CDBA 3KEOA 4O1MA 4CKCB 2ZIXB 2F55A 1DJOA 3IEMA 1ZA2A 2EZ9A 1ZUWA 4EGSA 1QANA 2E21A 3VOSA 4N41A 2JH3A 4GWKA 3W06A 1E0DA 2CYCA 4D80A 2R7MA 3CLUC 1XZJA 4XCXA 4EYGA 4NZNA 1Y4AE 1XKTA 3A6GA 3RIEA 1HK7A 3VTKA 3JZMA 3WYCA 3JYNA 5IM4A 2I2CA 3Q9UA 4CLRB 1EGVB 1N2HA 4WD3A 5JRZA 2G5TA 3FPHA 2GZ2A 3QYPA 4LXXA 4QOSA 1P39A 2K2QB 1N3IA 3HR7A 2I7XA 4HGQA 5TS3A 3ELBA 4HEHA 5C8DA 4D0GA 4YUAA 2B6NA 1UQTA 2AG6A 4GX2A 1QO9A 1Y6FA 2J3JA 4WBXC 2R1ZA 3C3DA 1C2YA 2N42A 4IJ5A 4EBBA 5HVNA 4BKUA 1G38A 2I3BA 2VUHB 3BMOB 3ONNA 3NXKA 4RVOA 4X1IA 2VT2A 4RVUA 1UXIA 4JQCA 1M83A 1ISJA 1E2HA 4WAUA 3PNPA 4TWIA 4P7BA 2VJYA 2W42A 3PFHA 1WE2A 4B43A 2IGBA 2FWAA 3ZVKA 4DMRA 1KMQA 2QPOA 3KWJA 2FFBA 3W5SA 4RTKA 1UOPA 3DMTC 5I5EA 4CMJA 2XH8A 3LOQA 3AHDA 2NTVA 4K6FA 2A6PA 4RM3A 3SBDA 3JU3A 3O4GA 5EEGA 3PSAA 1FUKA 3FBTA 5J3JA 2I4RA 5KX5F 1NGSA 3W5HA 3FVWA 3HDYA 5DNYB 4EFMA 1CUBA 2W37A 1DO8A 3E84A 2E48A 4YFVA 2G88A 3VPBA 3K35A 1QR6A 1WX1A 2ZAGA 3I9JA 4TMYA 3AEYA 5K8IA 5DTJA 3ZWQA 9LDTA 3HXMA 1W76A 1UPUA 4DMCA 8GPBA 1DX4A 1JIJA 1QO0D 2J32A 2W48A 5D6NA 4F45A 5JVDF 3MEQA 2QT0A 4HMQA 4RTPA 1PR5A 1VLZA 4FGLA 4HRXA 3E23A 2C3PA 2VS1A 3NT5A 4YXFA 4MRMB 3AUAA 5SYAA 2CJWA 2JHPA 3HJBA 3IPXA 5ALNA 4EABA 1VLJA 4R05A 2AA3A 4QQRA 1MIOA 3T1VA 1RMYA 3LTNC 5CB4A 3T15A 4EG6A 5CB8A 2IODA 3PC6A 3RABA 5I9LA 3NHFA 1KRWA 1WVGA 4P2BA 2V58A 1SCBA 2GD0A 3HH8A 4BGDA 3KLOA 2IDJA 4MW7A 5DP2A 5EMHA 1KE1A 4G0WA 3ZJ4A 4P54A 3GP8A 2YWGA 4RFSA 3AIIA 4GF5A 4LZPA 5FWDA 2IYVA 2G7ZA 3J81A 5KSOA 2XYGA 1UEJA 5J1SB 1EE1A 1FU4A 1L7VC 4BO2A 5C53B 4KQKA 3IUNA 4ZCRA 3H5WA 3K9GA 2NYRA 3SZGA 1GVNB 3JPWA 5HGXA 1JFTA 3QOWA 4EG8A 1L5FA 3K70B 1SAYA 4J90A 2C5GA 1G20B 1V8PA 1CQPA 2V7GA 4YP7A 3WQQA 4FFWA 3IP3A 4R2MA 4F1WA 5THKA 3D0RA 4JITA 3QVWA 4CM6A 2RHRA 4JP1A 4N8EA 4N5MA 2CFRA 4MVJF 5TLSA 4G84A 1IXRC 1DKNA 1GP2A 2E4UA 3JQ9C 4L08A 4PN3A 1C0IA 2EERA 2PD6A 3RD5A 4JT8A 3SE7A 4B17A 5DULA 2PD4A 3AL2A 3DAFA 1D0SA 2XLCA 4LFCB 5BNTA 1YQTA 1LSSA 3BFPA 2H00A 3A6KA 1RRFA 1OFTA 3AWDA 2FZVA 2H52A 3CF2A 4TTQA 4ZU3A 3L8FA 4M87A 2Q2OA 3D6HA 2EDCA 2JBWA 4YROA 2P90A 3H9UA 5L4NA 2FZGA 1XSEA 2CFSA 3W04A 1K98A 1V4NA 4TSRA 1ZMBA 1QLHA 4JJKA 4PTLA 5HS6A 2VDWA 2JBAA 2VTDA 3H1FA 4KO8A 1K1EA 1XXHE 1P5HA 4LRYA 3VDMA 1U8YA 1TD1A 5DGXA 3ET4A 4CM4A 2B78A 1E8MA 4FSXA 4CTJA 5K0BA 3GROA 2VKQA 1C3VA 2EP7A 1ZRNA 3PDIA 5E4FA 4RKWA 3BH6A 4J91A 4MVCA 5CPBA 2YZMA 2YWDA 1BDMA 1N6LA 2A9QA 4N03A 4L22A 3DJFA 3C5VA 5D3ZA 1VOTA 4EGJA 1U9IA 2Q5OA 4MQ5A 2V7PA 1YL5A 2GN9A 3P71T 3PUVA 3RWOA 2WHRA 5LPNA 3KOMA 5ALPA 3AVOA 1FQOA 2EWMA 3CNOA 2I4OA 3RC1A 3CLHA 1LSJA 5DOVA 4BFUA 4B3JA 5JPDA 4C2TA 4QUAA 5EVJA 1GPDG 1MRSA 2GBPA 4BTVA 4BVKA 5JAHA 1LBTA 3DZFA 5CLGA 5COAA 3ZV6A 3OZDA 2C97A 1I0LA 2R8XA 4G1FA 4QOJA 1GG5A 1E63A 1ORWA 2ZJOA 3C6QA 4ZOLF 5ECGC 4NWIA 3PLAE 4KLCA 4WN9B 3A1WA 3SDBA 3IUSA 3MNFA 4R83A 3RSHA 3BGWA 5BN5A 3HXTA 2IDMA 1JXOA 1Z5WA 2BBTA 2VWQA 3SNHA 4BVAA 3R9XA 2NOAA 1SEPA 2J6BA 2V3VA 4EHKA 4NCAA 3JQGB 5HXAA 3AH8A 2ZRHA 1BWPA 1V1JA 5TQVA 2DVMA 4D0RA 1CNMA 4PLZA 1LKZA 3V4SA 1TVKA 1X1AA 2QN3A 4TV8F 1YB6A 1TEHA 2DH5A 2D2XA 2Z3ZA 2VTBA 1ES9A 2WUEA 3C7AA 2AW5A 2R68A 3BTUA 5CAEA 3ZN2A 5GOTA 3RGWS 1Y89A 1Z83A 3OZIA 3UK6A 4A6PA 3IC5A 4WWHA 1BEEA 4IQFA 1T5SA 5CIQA 2CV1A 1QYRA 5JS7A 4AS3A 2ZROA 3JQ8B 2QB5A 1E89A 4QTYA 3AM5A 2OLJA 1OXTA 1K7YA 2GK6A 1X86B 3B7GA 3T99A 2BD0A 2JFGA 2QSYA 3BCUA 3P2IA 3RQIA 1CQWA 3ADCA 4NPHA 1TVCA 4IIGA 1JAXA 1R15A 1TYDE 2I8AA 1EAYA 2FEAA 3EXEB 3HFRA 3LFUA 3EISA 1USVA 1SCUA 4MWGA 4Q9AA 5K2MA 5A3VA 4BO1A 1RXUA 2I4IA 3E22B 2ATCA 1NJFA 4OSPA 4JI6B 3WY9A 4L5BA 2PGDA 2RH8A 2GPBA 3DBVO 5I7RA 1MMFB 1VIDA 2CFOA 3FTFA 3QVMA 1EP3B 1ZP6A 1L6RA 2Q1WA 3KHTA 4MI1A 1IWBB 4O2RA 1G1MA 1P61B 2BTQB 3EQ7A 4U5QA 4ZCQA 2JGJA 2X0DA 5ADHA 1AC5A 3KFXA 2ZSAA 1PEAA 1FXUA 1DBRA 2G5PA 1O94A 3L07A 1URPA 3N3BC 1TA4A 5HCIA 2IE8A 4G4SP 3IUQA 3G0IA 4QARA 4N0MA 1GN8A 3N58A 1W48A 3C3YA 3BTSA 1SM4A 4HDQB 2PUHA 3E9YA 5DTQA 1NBEA 3T7AA 3KAQA 1XKQA 3FMFA 2DHDA 2DFPA 5CM2Z 1JPVA 1ZW6A 2CB9A 1TGYA 2QJWA 5AKEA 4DHWA 1AKRA 1BHJA 1L7BA 2GBCA 3PUHA 3W5DA 3L1VA 1RE1A 3L7JA 1M0EA 1DRVA 1E60A 1Q0RA 5JECA 2I7CA 1J21A 3Q4GA 3LS2A 5HRUA 2VLIA 1EFLA 3EB9A 2WP8J 3G9ZA 4R69A 3I3OA 4NBSA 3BJIC 2P2DA 3O8OA 1JDBC 3PNQA 1Y6RA 4PZCA 1SIBE 4J0CA 4I5DA 3KTDA 2FMKA 4QODA 3FJ1A 4R9VA 3W2FA 3CE6A 4AMUA 1JQ5A 1YJAA 3NTLA 5IWAB 2ZUBA 5EQTA 3T3HA 1C1DA 2QJTA 1VFNA 2M1ZA 2DERA 2WM9B 3LA8A 3H16A 1GTL1 2FYTA 3AZPA 4ND3A 5FNZA 2H7XA 1DIOB 2WWIA 1BJRE 3GJSA 2NU7B 2ZIXA 3DBRA 3UK2A 4OUDB 2RI6A 2XRYA 1X3SA 1NV8A 2I2FA 2XGGA 4LE0A 4IHKA 4M1OA 3CU5A 4A0HA 3VR6A 4EHJA 4K9SA 2P2CA 3AX6A 4R9UC 3SG0A 2VIIA 4P4NA 1C9YA 5LYJB 4NZPA 1ZMXA 4YRGA 3GJ6A 3LCVB 2GYUA 2RK6A 5ALYA 5TEVA 3F98A 2GNOA 2CDCA 4DNPA 1A2KC 3CN9A 1VHWA 4B5KA 2Q1UA 2QGZA 4WKBA 2C8JA 2J31A 3ACBA 1TI7A 4L4RA 4Y0AA 2O2DA 4U9UA 4YBZA 2GARA 2PHZA 5JS8A 3CPJB 1YS6A 2ZVJA 5JI3E 4ZHQB 2WJ3A 1ODCA 3ROEA 1B00A 1VI2A 1LW7A 4Q9HA 6ADHA 1U5BB 1NW9B 3UJ9A 4QGFA 1FVFA 3VR3D 3B1WA 4BN0A 2ZS9A 1Z47A 2C2XA 2HJSA 4IF6A 4IS3A 4XPIA 1JXQA 4B2IA 4H7DA 7REQB 4TKVB 4D81A 5EGNA 2ZRCA 2J6HA 4C0QC 2D4HA 4PONA 3LP8A 4RMNA 4D46A 1PBTA 3D3JA 4G85A 4CIXA 1OLUB 4DREA 3N70A 3QVLA 3FSGA 3CSUA 5DEIA 2XEXA 3OE4A 3CRVA 2YV4A 2F9FA 3IQGX 3I9OA 1ZC4A 4GS5A 2R2GA 3RYHA 2JB9A 4PICA 2XW6A 4OYRA 4TM8A 5KJEA 1RZ3A 2NTJA 2AE1A 2JFHA 2P4SA 1SC9A 3VAAA 3PDUA 2VAVA 3EFHA 1G55A 2JLCA 3UG6A 1EDEA 1XYVA 3QWBA 5LLDA 2R84A 3QVKA 4K3VA 4LV5B 5J2UA 8MHTA 1M1YE 2Q41A 2V7QD 1T13A 3AXSA 4DPKA 3U5ZB 2WJAA 4LZJA 5AK6A 4QDTA 5E3HA 2X9GA 1K0FA 1UBGA 1XU9A 2GZ3A 4PSCA 5FTLA 5IH7A 2ZGVA 4C14A 3PFWO 5BQ3A 1Z0KA 1K5GA 1H2YA 4TL8A 5F52A 1NQWA 4PX5A 3KBBA 4JLPA 3PDJA 3QU5A 4GAEA 3VDRA 5JISA 3ELDA 1QQBA 3R3VA 2WE8A 1ZQ1A 3IP8A 2XUPA 4RACA 3ZWNA 4XWKA 2XBMA 8AT1A 5L4LA 2YQ4A 5DM4A 3H05A 3BX1A 3CRMA 4PSUA 1G9SA 4J1QA 4J0KA 2W4MA 1X7XB 3OZCA 1A77A 4PCAA 4ZZIA 1CULC 2RONA 2GAJA 1Z5GA 3NNDA 1CJSA 3RVJA 2HAEA 4EKNB 1UWVA 2ZRMA 4F3YA 3VVMA 4B4WA 3WMFA 1QU2A 4B6JA 4CMGA 1SCQA 3DZGA 4O4IB 2IU4A 3AF2A 4Q7LA 4OGKA 2AOTB 1U0TA 5K01A 1JHZA 4UZSA 3ZGOA 1W36C 2JF0A 2UZ4A 1KMIY 3PR2B 3RVKA 3PL5A 1TLTA 1JE1A 5JAOA 5BV1A 4PANA 3EWIA 1FFEA 3G0BA 5FWXB 4WK2B 1AN9A 1Y7HA 1TIBA 2ZT5A 2CBZA 3N39C 4IIJF 1HDOA 3FYUC 4GBGA 1NW6A 4M53A 4WKGA 5CFLA 1SQ5A 5AM2A 4RHYA 1XZPA 2CJXA 4KQCA 5FUBA 5C9ZA 1TIKA 4XVQA 2O8FA 1RLMA 4I3GA 2X0EA 4HEA1 3E8SA 1GG8A 5DP1A 3C97A 1E5DA 3HN6A 3RASA 4CUKA 5K0SA 4HLUC 3VU9B 4CF7A 2PV0A 4DR3B 3WIDA 3AJ9A 3AHEA 1VBMA 1OIXA 2J4CA 2V3WA 2VSXA 3JWHA 3SU8A 4XB2A 1AO0A 3LHDA 1V43A 3RSCA 4JFRA 1PN3A 1TUBB 3D7LA 4MWZA 4UCXA 5B1YA 1IBSA 5K0CA 2Q62A 3CB2A 1WPQA 1V4BA 3BPSA 2OUIA 4O0MA 4B87A 3DXYA 3AEKB 2NSYA 1B3RA 2GERA 3DS8A 4KR3A 1H2AS 1QUFA 1J22A 1I6LA 3EIXA 5EZ6B 5KYUB 3AW8A 5MN5A 3R7LA 4UNNA 1JLLA 4JWKA 1TKCA 1ST3A 1SUWA 4X95A 3K1JA 3T5BA 4US1R 3V7UA 3ELYA 1SB9A 2ZXEA 3CVYA 5CJPA 2HR1A 4NHOA 1EDDA 3CWCA 2QIPA 4MDFA 2A3NA 3OICA 5CP8A 4R81A 2GF2A 3I9V6 1OA1A 1XTZA 1NDQA 1KH3A 4PG5A 1XRPA 1DPGA 4TQ9A 1D9ZA 1JG6A 1P80A 3BJRA 4P7KA 2DQYA 5GONF 1MB9A 1WZ2A 4R1UA 5EHXA 3DT9A 2XECA 1KJJA 3MRVA 4Q1AA 5JFTA 2EJUA 4B3HA 1AX9A 1MG5A 2R6FA 5J5CA 5JG7A 3EN0A 1E6UA 3KOZA 2C42A 1QH0A 2WSLA 3QH4A 1TD9A 2OZVA 4JJGA 3ENZA 1NIJA 2R44A 2OGZA 1ONPA 1Z4LA 2YXPX 3JQGA 4R1QA 4IJ6A 1SEVA 1U0RA 3J7AC 1W88B 3B53X 4PX2A 2P9QA 3VR4D 4TZKA 5CDSA 3SR3A 1M2FA 2KHZA 3V1YA 1GUZA 3K4QA 4Z4QA 4H6WA 4IS2A 5E2IA 1ECBA 3T5MA 4J29A 2H06A 3PXBA 4JBGA 1JDVA 2ODWA 4PEVA 1D07A 4O4HA 1OREA 4LJ8A 3DLPX 1PR6A 3WTCA 4C3VA 4C4XA 1K6MA 2II6A 2JGLA 4C21A 1Q77A 1LC3A 2WG0A 3QX3A 1EBUA 3JQ8A 3IV7A 4LQLA 1K7XB 2RGYA 4Z8YA 5F5XA 4M1TA 3FZNA 3WJ7A 4CM8B 5G1OA 3F90A 4C0LA 4OXKA 2WVAA 1ETHA 1O6GA 2R48A 2XSZD 2Y1OA 3NOQA 3W3AA 2OV4A 4DMUB 4URVR 4EUEA 2NQ2C 2NPIA 2XB4A 1YCFA 3LV8A 4ABYA 3CIFA 3G5MA 1KPHA 1OVMA 2YFQA 1FUYB 2XDWA 3EXEA 3IHLA 5ALXA 2IFTA 4I46A 5BO5A 2IYTA 4YRIA 1JWLA 4IRMA 4Q4HB 3HI6A 2X7JA 3E22A 4M8KA 4L51A 4M1QA 5HJ7A 1BX0A 1U0OC 1YJCA 3Q7RA 2E7ZA 3TPFA 2CLDX 2DLNA 3JQ6A 4J0IA 1SXJA 2JRCA 3GBVA 2YASA 5DLQC 4UZEA 3GFGA 5EHZA 4KXVA 2RGBA 3H8VA 3ZPXA 1LPAB 1XVIA 3ZW7A 4FDTA 1DJNA 4JP5A 4E3WA 1XNGA 3RTCA 3QKIA 3QY9A 2FP4B 2NZJA 3M1LA 3BGSA 3RRXA 2QMOA 4XLZA 3K72B 5AP9A 4NNPA 4C4RA 3OFNA 3KE8A 2CK3D 1TC2A 3AIMA 3CLSC 4K9PA 4E22A 3OX2A 3QSGA 1P91A 2GM9A 5CIWA 1E1QA 3B60A 1A1SA 4B71A 2NO7A 4NX2A 1PDVA 4JOSA 1YDWA 3HZHA 2E85A 4EMUA 1VP9A 4TKMA 2WKRA 1ACLA 4R0VA 4AFNA 1PNRA 1UFVA 2I22A 1ZN8A 2Y77A 4LBZA 5D84A 5JQWA 3ETHA 5TF0A 1LX7A 3UWDA 4BNDB 1E2MA 3G8AA 1FFCA 4LGCA 4FD2A 5TJ9A 5L9AA 1W0KA 1W85B 5B7GA 4WLOA 1I36A 2QW1A 3D2LA 2PCLA 4DR5B 1KI9A 4M7RA 1DEXA 2JIZD 3NIFB 4TVOA 1VYTA 4UBJA 3WRYA 1EI9A 2XE4A 4P4TA 1YOBA 4B09A 2VZ0A 1HMYA 2NV6A 5T4BA 3RIHA 1WBJB 1FRNA 4F4UA 1MW9X 1QWSA 5LQDA 5B2EA 5CH3A 3CGGA 1FRFS 3PD7A 5EI5A 1KI7A 3BHJA 1KARA 3DPUA 4LXTA 3F9RA 1EU1A 4UOQA 4CTOA 4HWSA 3O3CA 1Z2OX 5CUQA 1L5NA 4ECEA 1NT4A 4XGRA 5JAZA 3GU3A 2QTWB 4G1UC 4OJNA 2O14A 3RS2A 4LI3X 3KQHA 3ERCA 4OUDA 2RHCA 2WZCA 2HY7A 5JO0A 2JK0A 1EJ0A 2H3EA 3HADA 1S2IA 1SBZA 1S8NA 2B4RO 1JXAA 2GASA 1CD5A 4TWAA 4Z7OB 1AMUA 2VBFA 5JWOA 5ALDA 1NSYA 4E33A 1FDTA 4FE7A 4LWQA 4PPQA 2NUAB 4PYKA 4E2ZA 4YUYA 4H1VA 5FUQA 1YBVA 3WAJA 4JJAA 4MGEA 1QQ6A 4PPGA 4RH1A 5KX5B 3E1KA 1EZ4A 4JT4A 2Y1LA 1VE6A 1U8AA 2CUZA 4I1OA 5LQUA 2GNAA 2MSWA 1J7JA 2Z83A 1VL1A 3ZTTA 3TRJA 1RQ7A 3C6XA 5KOYA 2IKQA 2OB2A 4QECA 1QRUA 1KZ4A 2P1ZA 2Q50A 4UHHA 5JVDB 2IH2A 2JLWA 2HRQA 3DHNA 3NHWA 1E94E 3OZTA 4QJIA 2Q28A 5KJCA 3CE9A 1F2VA 1GPMA 5J43A 4YRZA 2JGFA 1N78A 1DX9A 1Q2UA 1V9CA 3O9ZA 4ZXFA 4XYLA 1U5BA 2Q0HA 4F4FA 1YZFA 1LUAA 2P9TA 3EYWA 3ISVA 1JI0A 1KYWA 4URXR 3EIEA 3TLCA 3QEOA 3EEIA 7REQA 3TRFA 4TKVA 1ZJ4A 2MIIA 3A9WA 3ISJA 3TIIA 5KU7A 5MF6A 3HJGA 5CT6A 4P98A 2LBPA 5KTMA 4BASA 1JQBA 2Q9AA 1AGYA 2ZCUA 4Y6LA 3DMHA 4RVNA 1PHRA 5AJTA 1KO8A 1BRTA 3HXLA 5A2GA 4BO9A 3SZ3A 3W6PA 5ALQA 4Z4EA 1N6OA 2PVCA 3PPXA 3SJUA 1V9SA 2CDAA 2OZLB 4HRAA 4AM8A 1ISIA 1I2BA 2FSIA 4B3XA 3MIZA 4HHEA 4YRCA 4RZQA 3ZY3A 3CRW1 4EFLA 1SOUA 2DUJA 2QZ9A 3A1DA 4ZGBA 3BGOS 4PIVA 5CD9A 3LPMA 4J49A 4OEHA 3G2QA 4BOYA 2VDJA 2P41A 3GNLA 3OEEA 4JXJA 1A69A 2QUBA 3FMIA 4L5AA 1IZ8A 3VX3A 5HDBB 5A0FA 1AIPA 4DA8A 3NZEA 2OG2A 4AKTA 4BB5A 5JBQA 1AMNA 3PNBA 3OI7A 1JG4A 3HCNA 1IM2A 4N6GA 2OL4A 3DT6A 2QLTA 3K8OE 4M1WA 4YRRA 1AHHA 3EPJA 3VYTB 3WGMA 1PD0A 3EX7C 2DUUA 4BX8A 1AE1A 1SR8A 2RK3A 1U5AA 4CR8A 5LUAA 1X7XA 2AMJA 1P45A 4JQZA 4MI6A 2V8OA 2EG5A 3PIDA 4Y2VA 2BZ0A 4ND1A 5DGDA 2X5NA 1E1LA 1HDEA 1IM5A 1Z82A 3AFGA 2PZEA 1FSZA 4X44A 5KYVA 1Q6ZA 2NU8B 3SAJA 3D2CA 4LKOA 2DLCX 4K88A 1NMEA 1OAKA 2BMVA 2ZI3A 4O4IA 1JSLA 1WNFA 4YWJA 1JHMA 1ND6A 5EIBC 2IXBA 2RCNA 3DEIA 4NH4A 3K0EA 1CFZA 4HUJA 1IHDA 1R6BX 3O4HA 2OHIA 3CNQS 2ZQZA 3DOUA 4GOJA 4GZLA 4INPA 5FJJA 5BQOA 1T15A 1NZDA 4C5BA 1VKNA 1NF8A 1Q15A 1EXWA 4DR2B 5CT8A 1N2ZA 1SUBA 2HADA 1EJ6A 2I2BA 2YS6A 2P27A 4XYEA 2IE0A 3SJZA 1W1WA 3C4QA 1CT9A 3WKBA 2IHTA 4MR7A 3S2ZA 1B1AA 1SVLA 2V7TA 8ATCA 1P5FA 4BQNA 2BZSA 1UBUS 1OKKA 1K92A 3E9RA 4HAIA 3L7LA 3ON5A 1R66A 5DBIA 4G3XA 3RRFA 2NQTA 1FMTA 1ULAA 5JBIA 2ZPAA 1G59A 2BVNA 3EY4A 1T36A 1H9AA 1FQJA 3KQYA 1P1BA 3PTLA 3R5TA 1M5UA 3TVTA 3OY7A 5K7SA 1DAHA 5TPWB 1Z5UA 1WHTA 2B8EA 3L82B 5FWYB 5ALFA 1T6NA 3BRWA 4L73A 3C70A 4I55F 3AR9A 4F5DA 1XA4A 4PPYA 4ESVA 1WXWA 4YQZA 2PUFA 3TLGB 1NQOA 4ZOLB 1FJHA 2RH9B 1QQ7A 2AGVA 2PXCA 3LY7A 3QE9Y 1FDUA 3FVVA 4YMIA 3O74A 4HJRA 1O6CA 5AI9A 3R0QA 5C5EA 3D6AA 4D02A 5D87A 1RI3A 3VV2A 1A5SB 3CH5A 2QN8A 3P0RA 3RBAA 4EY4A 2VDPB 3KB1A 5KYUA 3MOGA 3RAFC 4CODB 5FUWA 3RHZA 4FGJA 1PP4A 3ST7A 4TMWA 5GJVC 1FFXB 3HWX1 3QA3E 4UVGA 5JWRA 3B3AA 4TV8B 2BMJA 1SKYE 3F96A 1R16A 3D5EA 4P4LA 3SEFA 1VLMA 1U9JA 3A9SA 4GXQA 3FFWA 2C4NA 4IJUA 1PD1A 2CMGA 3KQTA 5B57C 2YHAA 2ZWVA 3B5IA 2FF7A 5JHGB 4GU5A 1K5HA 4B76A 1FRQA 4CEJB 1I3LA 1MUUA 2NVWA 1C30A 3PRKE 5DI3B 5F3RA 4UARA 1AXRA 1GDDA 3FWHA 1XTJA 3JZIA 3KTAA 1A9YA 4DKJA 2B34A 1Y3BE 4JOQA 1MBZA 2PBLA 1VJ0A 2ZRFA 4P6VF 4BQQA 2ENWA 1CY7A 1BAPA 2Y6VA 1ZO8A 1N2CE 3AUSA 4WLNA 2LVBA 4MKGA 4WBSA 4B75A 1THTA 1EXDA 3WFIA 2XTZA 1Q7CA 1AZTA 3EDRA 3A3OA 3NFRA 1U8ZA 5A4JA 1BQEA 1J25A 2Z98A 4CTMA 1LB1B 1NDUA 1FSGA 1TAGA 1Z5PA 2VYFA 3D7SA 2X5XA 1PJZA 2I1QA 2ZJFA 4FNGA 2RBEA 4RSHA 5BQ5A 5KNCD 1SBIA 2VSQA 4K8RB 5KJ6A 2VQEB 2OHHA 5ECDA 3NDBB 4Q03A 4ZVVA 1EJBA 3HCWA 3PJDA 3MS7A 2V4MA 4G81A 4GHWA 3CRQA 3FKSD 1PK8A 3GFSA 4LHEA 4KXUA 3LLMA 3PKJA 1D8TA 1X1EA 2XCQA 4KQ2A 4WEOA 4ZVSA 4XD2A 4ZZ0A 2W9XA 1OTHA 5DFAA 1RRKA 2YJ4A 4O5OA 1UFQA 2RGAA 3D4PA 4YVFA 4BBPA 3VZQA 1ZC3A 1L5OA 3L3BA 4TGLA 4CM8A 4LYEA 1W8IA 1G17A 1Y8AA 4KEAA 3GV0A 5L6MB 3GFTA 4TXMA 4CL0A 1BCRB 4RFVA 2HSEA 1PEKE 1MZVA 2CLFB 2PJUA 2IEYA 3QLUA 4XFJA 3MJ4A 5JAPA 2Q3FA 4YI5A 2WZQA 1J2UA 2ZJ6A 4HDMB 4RZXA 4Q4HA 1C3OB 4H1WA 3GGGA 2OUKA 2VAWA 2A7XA 4YRKA 4UCQA 5CA0F 4RPHA 3EODA 4BMPB 1X1SA 2L0XA 2RAVA 3PBKA 2OGSA 3OEHA 4ZEWA 4EDFA 1MP0A 3PNYA 1B23P 1G2OA 3ZQUA 4E6EA 2CL0X 1NR7A 4AJLA 1NA5A 1CERA 3PI6A 3PQ2A 3QU7A 3ZNNA 4XSHA 3OU7A 3CLSD 3RFFA 1IBMB 2FP4A 5C3MA 2MSLA 5JOQA 5JZ9A 3U3ZA 3QVTA 3IDAA 1U94A 3PITA 2QG9A 2HK7A 4GMHA 2C4UA 3VR5H 4XWTA 5TEWA 4KI0A 2FV8A 1E2FA 1RYMA 4H0NA 4KO3S 3D02A 1T8PA 1XX6A 5L3SB 1RHMA 2CXOA 1WETA 2DEUA 3SZRA 1A5TA 1QRDA 2RIRA 4MUBA 5HUJA 2FZ4A 1O87A 2KB0A 4IDQA 5ADUS 2I6FA 1ISPA 3F9IA 4KSBA 4XVRA 2YHUA 3MJRA 3UUWA 1GNTA 1CS0A 1O6ZA 3F1LA 1QFZA 1AUXA 5FLEX 2VXOA 3D54D 2FW7A 4R1NA 5D8DA 5IW8A 3X44A 1W85A 1ODKA 3QPWA 4X1YB 3W6NA 1YZHA 1YUBA 2QVGA 3W9UA 1CJMA 3E9EA 1HEYA 4ZYWA 4KYVA 4JL5A 3AVYA 1CR2A 1OLXB 5AHOA 5T5QA 3BJEA 1KSFX 5G1NA 1NN0A 4MYTA 4EI7A 4Y9DA 4ND4A 2WINI 3TZBA 5HQ3B 1ZR4A 1JDNA 2YVKA 3IP7A 3EVBA 3LC2O 3CLTD 3PHBE 3ULKA 2IEDA 4RDCA 4RX1A 4KBFA 1YE3A 3I2YX 4RU1A 2F00A 3G6KA 1EDZA 3FYDA 1IZ9A 2DWCA 1YD7A 2YWBA 2ZI7A 4U0JA 1WY5A 2L69A 1QCZA 3JV7A 3Q0TA 4GXNA 1TCAA 4BMYA 2BGNA 3NC1C 1KWKA 3HCEA 4CN9A 4Z7JA 3GZ4A 1SJ9A 1CS4C 1YNSA 3SXJA 1ZXLA 2NUAA 4XGKA 3ZU6A 1K2VN 2HDHA 4J2OA 3TQFA 1AQJA 3F6SA 1OASA 1JPNA 4Y18A 1MU0A 4MS1A 5EA2A 3RUHA 3K1TA 4B8YA 3D6JA 1O3YA 4ZK2A 1OR8A 2BSAA 3CEMA 1JE0A 1LDBA 1SXHA 3ZS8A 1AH2A 5DW3A 3N74A 3LX8A 5G4LA 1I33A 1JNXX 3H0EA 1Z7EA 1FDSA 4ZVMA 4MJLA 4X85A 4DB4A 3ZBQA 2IPAB 3LXMA 3V1NA 1EB8A 3AF3A 1NONA 4KX3A 2XCIA 2W2PA 2DBRA 3RAJA 4I0WB 2IIVA 1U2TA 4JUDX 5HM8A 1MENA 4Y1RB 1TU3A 2QLNA 1PR1A 4B85A 4OYLA 2WKWA 2CNOA 2XUIA 4FMBB 3BWMA 1MXHA 1TKBA 3ITNA 5DOZA 1Z16A 3N76A 5EXSA 1KFCB 2E6UX 3MWKA 5C5CA 1XZDA 1VMDA 4AWXA 3ZOZA 1Z63A 2EFHB 2RG7A 3TYXA 4BAUA 5I45A 1XXHB 1PV4A 2WABA 1R9MA 2FHSA 1I5EA 5AJXA 1Z7GA 1GRQA 3CJTA 4H3SA 5TRTA 1M72A 4M0PA 4FFOA 2XYRA 3W77A 5E8RA 1D1PA 1K9VF 4HWGA 3GT4A 2HF7A 4NYJR 4BYGA 4EG1A 4HDOB 1FC0A 3D8UA 1KQ3A 3WZLA 4PZAA 4HOYA 3G68A 5ERYA 5AXAA 2JVIA 5I3ZA 5JANA 4ZT3A 1XPUA 1HG0A 1QV9A 3WDLA 1A9SA 2W2TA 4MVJA 5EJ5A 5F1YA 3FDFA 3H9GA 4L3VA 1V8DA 4IIJB 4J0JA 5D1HA 2VJLA 1ONNA 3CCFA 3IIMA 4LX0A 3U0VA 4II3A 3QF7A 3HLTA 4Y1GA 1Z0AA 1Q1AA 3UUGA 3DFFA 3GLGE 3HWSA 1THMA 2I3GA 2HA3A 3I23A 2XT0A 2DSNA 1ZBQA 2ZETA 5AUOB 2O8CB 1L8AA 1J99A 1QOPB 2JFZA 1YHZA 3IELA 4PHCA 2OVBA 3U4HA 2MOKA 2XODA 5EIBD 3WRWA 4CCAA 5ADVA 5IHPA 5K0ZA 4DQVA 1YU9A 2HF2A 4RVFA 4RO0A 1U2GA 3K7EA 1W96A 4ZTZB 1CQIA 3W7BA 2YWRA 4D3SA 3QV1A 1YQWA 2GZHA 4OL0A 5DMXA 5HKAA 4KAJA 4B7CA 1MVLA 5DT2A 3P9SA 3OZEA 3CUEF 1IL0A 1AK1A 3IJEB 4M1ZA 4QASA 1D03A 1WB6A 3WL6A 3PCRB 1IMJA 5DNCA 3TJMA 5AD1A 4ZTBA 3OU6A 4XW2A 4HXGA 1GPWB 2WT4A 4P22A 2QN9A 5BW4A 5C8VA 3E9QA 2CXQA 1PFUA 4WXEA 3FF1A 5F3DA 4ZYYA 4D56A 1AZSC 1GLGA 4N65A 3WTBA 1B6TA 4JNKA 1W5SA 4AMYA 3A6DA 3KVOA 2B3TA 2OYRA 3KKOA 2W6CX 3KK0A 3MLAA 4D7AA 4RXTA 2CLOB 3AVVA 5E95A 1J9GA 1NZJA 1T3TA 2EVWX 3IT3A 1WUHS 1GZ3A 5CTAA 5GONB 5FWYA 1U0GA 3G7SA 4RE5A 1KMNA 1NSTA 4EPWA 2QP4A 4HKTA 2ZANA 1XTBA 4ZOLA 2XTJA 1FU8A 2YWHA 4U4AA 1XVTA 1K3FA 5P21A 2AI3A 1YO6A 1JIXA 2GAOA 2EYQA 2IY7A 3EA5A 3GNTA 2QNBA 1Y8RB 1MT0A 2E5WA 2FR0A 3CF0A 2BMWA 4RMJA 3THSA 1RR6A 2POCA 3I1JA 5DWVA 1PR3A 3H3FA 2D1SA 3PTAA 1ZVQA 3ASVA 5SY4A 4I50B 1AB5A 1BTOA 1M8GA 4LOIA 1FFXA 2LWIA 3QFRA 5DHUA 4I81A 3CVJA 3P97A 4U9IS 3THOA 2YZNA 2QGNA 2YKGA 3OX4A 4I1YA 1BGXT 4FX2A 2IH4A 3ZLBA 2XZLA 2XJ4A 4QAJA 1JEYA 1IHYA 1CV2A 3Q3IA 4L72A 1AB6A 2HKIA 1KAMA 4OQFA 4OHKA 1XAGA 1U81A 1A4XA 4IUCS 1Y82A 2PZAA 3HZOA 5IC5A 1Y3CE 5JJ5A 4KFTA 5FKJA 4CEJA 4ZEVA 4XWWA 5DI3A 2FEPA 4OXNA 1KORA 3V8RA 5I7HA 4I66A 5D86A 3EGDB 4K6MA 4PX3A 4W1SA 3S5UA 8ADHA 1OVGA 1DUIA 2X7XA 2J3HA 4WLEA 1QHYA 1GZ5A 3KKMA 2FOIA 3MRSA 1VG1A 3ZKAA 5K03A 4CEHB 4BNGA 4KTTE 3ROTA 1LLQA 1E20A 5CU7A 3I6IA 2D1FA 1LBQA 2H5EA 4F7DA 2YICA 1TGVA 4AJJA 1LLFA 2ZT7A 2X1MA 2UVQA 4F72A 3F6EX 4M37A 5JWHA 3PEEA 1WLYA 2H08A 1QHGA 3G13A 3KLPX 2F43B 4O25A 3DMFA 1ESCA 3WMWA 3GBPA 5KOHA 2OP0A 5D7BA 3P9IA 2E5LB 1ZR2A 1GGJA 1QQ5A 3BIFA 5JJBA 4LWOA 3GXOA 3DVAA 1ECLA 5JYDA 1AHPA 4EP1A 1P81A 4L5JA 4KHZA 1CQZA 3LZDA 1CZLA 4GLBA 4MW5A 4C7KA 5AUQA 5AM3A 2EEPA 3AO0B 3R74A 1OQAA 3W5BA 3UQYS 4HDKB 2JGKA 2DG2A 4JDPA 4XUDA 3NVDA 5AI8A 3GEDA 5DX8A 4F84A 1MX5A 1WMFA 4W1RA 3KALA 4JWTA 4YRLA 2D4AA 1II9A 3AF6A 1C9KA 1OBCA 3QNUA 1PX2A 5HQTA 4BAGA 1YR3A 3R3XA 5HRCA 4Q3CA 4AG3A 5B3KA 2CF5A 4I4CA 5KMGB 1KNQA 2Z5FA 2IC5A 1YDGA 3INTA 2IKSA 2BGGA 1GAJA 1GAEO 2DU8A 3SF8B 3M6UA 3V48A 5F7OA 2D5AA 5E38A 3KL4A 3HK2A 2DCUA 3DBLA 3HGTA 4TMVA 3V97A 4AURA 3JR7A 2WJWA 3AEUB 4REMA 1H2EA 3M4XA 3BA6A 3VZRA 1B93A 3AHJA 3RUAA 4FFSA 9LDBA 4IWNA 1JP7A 2HBRA 2VF2A 3GT0A 4HLCA 4IVNA 4RNDB 3VYRB 3WGOA 4DLRA 2KPOA 1VYUA 3H9JA 1MZPA 2CWWA 4MWOA 4N12A 1EPUA 1BVHA 1AXEA 1L5RA 5EIHA 2WIKA 3R23A 3ZWCA 5EIFA 2YY7A 1XMQB 1SZDA 3ZD6A 2V74B 1DAGA 2HDNB 3JALB 4M0CA 4BVJA 1CUZA 2KI5A 3BS4A 3GVPA 4LYDA 4M2LA 4P4SA 4OFXA 1HYEA 3GLVA 2BEKA 4PHTA 4RIGA 5GGYA 3LY9A 1W2WB 5BN1A 1TK9A 2ZBDA 5DBFA 1E9RA 2A5JA 2GX6A 4BU0A 5I7OA 1M1YB 4D4HA 4G86A 2CMKA 1TAHA 4DLZA 1N5LA 4C0XA 4AMZA 4PHGA 1QIEA 4KYIB 3C3KA 4ZALA 1RXCA 4HDSB 1TW3A 2P9JA 3A05A 4QHYA 2P9EA 4YJ3A 2QMZA 2ZJAA 3JQAB 2OGWA 4LDRA 3V32A 3GNQA 4B5LA 5C5DA 5HQ3A 3PQ3A 1ACJA 1QS0A 5LL6P 2QQGA 3TM5A 5AM4A 1BVRA 2YC4C 1Z6QA 1QVZA 1RAGA 3ITDA 4UHBA 2D5BA 1V9LA 4I1SA 3CINA 4G5HA 3LGAA 5D1NA 3ZU4A 3FSJX 4RSGA 3CF6R 4U00A 2C9DA 2FMUA 2GOYA 3H1GA 1OU4A 2NU9B 2X0NA 5AVYA 1O58A 2AQIA 2RHJA 3FSRA 3G6WA 3N6RA 4GQBA 3STUA 5MHTA 1XPJA 1KXZA 2C77A 4Q24A 3A4MA 5FV7A 2RI0A 1T5OA 4KN6A 1UPFA 1RZUA 2BUAA 3QIAA 4UUOA 3WL8A 1CJUC 5KWJA 1Z74A 3ZTWA 4RZSA 4WGGA 4ZYXA 2BEWB 1MOPA 3IJPA 1GPJA 4IVQA 4MMYB 1YMVA 1DPFA 1U3TA 4UVIA 2DP4E 4YCLA 3EEYA 5F78A 2WM3A 5DGTA 1YMUA 1K4YA 1FB5A 2BMAA 4KMOA 5IJAA 4DFDA 4TWZA 6Q21A 2XQFA 1W46A 4DM3A 1YSCA 3M5WA 4QLOA 4BP3A 5IK2A 3E9ZA 4XGQA 3ZYZA 4WL0A 2G5CA 3MJEA 3QUTA 2OCGA 3LVBA 3P96A 5JMPA 3SQDA 5IKEA 5LMUB 2WD8A 4DTIA 4E2FA 2OQIA 2PU5A 3TIGA 1CC1S 4E15A 1ZH6A 5JZMA 5KNLA 4RBNA 5TT1A 7GPBA 1Y4DE 4G0UA 2OOKA 3CX4A 1IZ7A 4DZTA 2X1HA 1DTWA 1HPLA 1M0TA 2AI2A 2P3LA 3X1ZA 5ITZB 3NBAA 3U44B 2NV2B 5KDOA 9ABPA 4P5EA 4MWDA 4HT3B 2Z6QA 2BFDB 1G8PA 3UB3A 1XXHA 3A2LA 5B4TA 4DY6A 4Y2QA 4Q4JB 4B6FA 3GLSA 4OAOA 3HB7A 4UAJA 2PWAA 3OD5A 1T2NA 2ZWIA 3A70A 4BO7A 4ZJZA 5FTJA 4AMGA 3WIUA 2JCGA 2Q5FA 4Q12A 3DAHA 5BXQC 3KL2A 5C8YF 1PK9A 2I8CA 4RLQA 4XIIA 3WJAA 4NYIR 1IH8A 4PS1A 4BNZA 4AJPA 4AZSA 4LXHA 3CVWA 4RH0A 2A84A 3O8RA 3OOYA 2HO5A 4OLHA 4TMKA 3FR8A 3T5CA 5EXEA 2I6GA 3NTQA 3K70C 3DT8A 4YUWA 1TYEB 1HA3A 1TCVA 4C0SA 3ICQB 2IX9A 1SIUA 1VHLA 2EX0A 3CO0S 2HSWA 3F6RA 3PCTA 4NICA 4OO3A 4AYXA 4AZ0A 4I4TF 2OCXA 4FZJA 1Z6PA 3BK7A 4JJIA 5ALWA 1CCWA 2XUGA 2X22A 1LDYA 4E2YA 2D8MA 1D4FA 4MVWA 1WPXA 2C57A 1DHRA 4QPCA 4C0JA 3KSDO 1QKKA 1N77A 1PSDA 1MCZA 4LSZA 4F6RB 1PFVA 3DV0B 2EKDA 3KSUA 3I5UA 1TQ6A 2PUWA 4U2KA 2YWFA 4JLSA 5CK5A 3Q8XB 2MR6A 1QKIA 2M98A 3O0TA 5DLEA 1C0LA 1EK5A 2QDXA 5B3JC 1K7FB 5BPHA 1E98A 4RYDA 3PDWA 3LDHA 4PNHA 1X7YB 4BJ5A 2WT8A 1CUJA 3NAMA 3TI9A 3UKOA 4I55B 4U2DA 1VPDA 5ADWA 3WLJA 5IS2A 2OBMA 5FYDA 1JHQA 3VI4B 3B20A 4P81A 4HYQA 1KYIA 1CP2A 2NZ8A 3JVIA 3T4UA 1UDXA 4FYKA 3WL3A 1OFHA 4RPKA 3WGKA 5C8ZA 4PC2A 3H5TA 3LX6A 4PIPA 4XM0A 3FB1A 2C7PA 1VIAA 1E0SA 2FUCA 2HEIA 2I6UA 4OV6B 2XA2A 3NX4A 3AP2A 3C3AA 1M6EX 4FHZA 1DFIA 3R77A 4BP9A 3I9MA 4TZTA 5M04A 1Z25A 2ONKA 3R9IA 3HXOA 3EJ6A 3GFQA 2AZMA 4UZFA 4BE7B 3O83A 4O59O 1KDRA 1XEXA 1KI2A 4QLBA 2HSGA 3EUAA 5EHNA 2A5GA 2WNHA 3WLNA 1CY4A 4AG6A 3QVOA 1GQQA 1GPKA 1ZH8A 3JTMA 5I7UA 1JEDA 3DLIA 3W5VA 3BE5A 4DWOA 4ZPXA 3RHSA 1Y7LA 3NC0C 3ZJ5A 4DT1B 5ICSA 4NMLA 4QRHA 1P74A 2J0QA 3WLHA 4PY2A 1GZVA 2WLSA 5TF4A 4N8SA 3R8FA 3BZBA 2QD4A 1O54A 1TPZA 1Y8RA 4QVGA 2DKNA 4RANA 1XHFA 2DX7A 2H7YA 2L42A 4N4AA 4TTTS 4YAFA 4XVCA 5AI0A 3TG8A 3RJTA 2FR8A 1BO6A 3KPYA 2XMPA 3HP4A 3EEQA 1SELA 1UK7A 2O6LA 4R7TA 1J07A 4LJSA 4UEWA 1DO0A 1AKYA 2G3YA 3R7WB 3VTZA 2GUWA 4FKMA 3FPEA 4QIHA 4QOHA 1FUUA 2XX3A 3ZDRA 3WIEA 3VPXA 2W70A 1Z08A 4X9XA 1YT5A 3GVXA 2EQBA 2IEAA 3F4BA 4QJ3A 1BHQ1 5A62A 3E9MA 1GFWA 1N7GA 2FSPA 4TYQA 3FIJA 4YQYA 2GILA 1QIIA 1YR8A 3STYA 3R4CA 3LUGA 3VHQA 2LNDA 3BCSA 2OGTA 2COKA 5JNVA 1XDDA 2D7JA 3EGDA 2ZVDA 3D8BA 4WN3A 4LY0A 1ZL0A 4I7EA 4OXIA 4QNRA 5BSHA 1T8TA 1CB0A 1Z6YA 5EWLB 3CR8A 4J0HA 4YDRA 3OA2A 5B1IA 1MJ5A 1XJ0A 3DPSA 3NHPA 1SKMA 1QZXA 5DSTA 5ED0A 5B1HA 3TTUA 1NVVQ 3QKUA 1PYGA 3WNVA 1T9GR 1RYHA 2XTAA 5DNWA 3IOEA 1E58A 3AM1A 2H0AA 1NXQA 5FUXA 2EC5A 1KK3A 3TPCA 3TXYA 4D0NA 5C32A 3BB1A 2EGHA 3MJFA 4BJ6A 5EJ7A 3WGIA 4LOJA 2AE2A 2ZIAA 2JFPA 3LD9A 2F43A 4NNJA 5L51A 4EYKA 1JI3A 2DR2A 3AB8A 4N0DA 4X6LA 2RB4A 4YAUA 3U9TA 5JNTA 4LYJA 1GSOA 2F1JA 1O94D 1R3DA 3D0QA 1JDSA 1QC5A 3NV7A 3IERA 3DP9A 4RABA 5KQSA 4LJRA 4MRVA 1S96A 1M74A 2XUHA 1X6VA 4HDKA 4IEFB 4Q47A 3RWBA 1P0FA 1WS6A 3BMNA 1SHKA 2F17A 3K8QA 3PNVA 5F12A 5YASA 3IBFA 1KEWA 4TUYF 1E9BA 2ECKA 5ICMA 2UUAB 1B16A 1NG9A 5JCOA 3IH5A 3EA4A 1QVWA 3L0YA 1JXMA 4B0OA 1APBA 3E7WA 1YK0A 1RMQA 1JG1A 3C15C 4ETNA 5KMGA 3SYTA 2AEEA 3DNPA 1H1DA 1UZLA 3OCVA 4Q9IA 4AT1A 3DE7X 4EGQA 3CWQA 1M6WA 3E81A 3MMPA 2B69A 1WSBA 2NO1A 3DDZX 1AKNA 3FJYA 3SF8A 2XRFA 4TLBA 1YCDA 2JZOA 3EIWA 4UU1A 4KFSA 3R7NA 3OZVA 3PC3A 2GEJA 2AMFA 2J09A 1KOFA 1KNXA 1Y9JA 3E3NA 3V7YA 5IASA 1G19A 2QSUA 3AEUA 4M1KA 4ANFA 1I01A 1MTOA 1Z39A 3A9UA 4NXMB 1YVEI 3HUUA 3K20A 2BZGA 4X8HA 3TGLA 4X45A 1IDN1 4PGGA 4UATA 4XJSA 1YBAA 1JFSA 1R9GA 5FR2A 3CX6A 2ODEA 3K92A 3I2GA 1MG0A 3TQTA 1MKYA 3FW1A 3PFIA 3PGVA 1OJ7A 1K88A 1HFEL 1XF1A 3EMKA 5HKOA 3MW8A 2OV8A 3RC2A 3JALA 4EJ2A 2QRKA 3VR6D 2QV7A 3FTCA 5A4FS 2C82A 3B1XA 1RQ2A 1JNYA 1DQZA 3FE2A 3UAXA 2MDTA 4QJ5A 5LQAA 4E03A 3KKQA 1H2HA 3M5DA 4LC9A 2HIMA 4QG7A 2ZSHA 4NE2A 5IEBA 1HLPA 2IV2X 1R0YA 1JSCA 1WKVA 1F8UA 5EUCA 4V0QA 1LDEA 2QX7A 1QH8B 4GBJA 1XQ1A 4HDSA 2XKKA 3OBBA 2XWBF 1HFKA 1Y4UA 2GPWA 5TQJA 1N4AA 3U4MA 1M2HA 3E03A 1C7IA 3JVEA 3L05A 3MK31 2J3LA 3LVRE 3MINB 4F4DA 2VDRB 2FEKA 2OO7A 4TXJA 4BKQA 2ZUDA 3ZV3A 3QYJA 2HWYA 2PQMA 4HADA 1WZNA 2R5NA 5FBZA 1B14A 3KJXA 4E0BA 1HBJA 3GOHA 3SMVA 3TQHA 3U3OA 3EXHA 1LPBB 4POOA 5K8LA 3KQQA 4LGMA 2NU9A 3W9SA 4BMVA 3VPDA 1NBOA 3ZVNA 1JAIA 1Y3IA 2OA0A 3F7TA 4OM8A 4BEBA 2CNKA 1PDWA 1NULA 4GKJB