1L3BA

Mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, c2 spacegroup w/ long cell
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
186
structure length
186
Chain Sequence
b'MIPDDEFIKNPSVPGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEALCKIPDIDIAVVGGSGGELQEILRIIKDKLKPGGRIIVTAILLETKFEAMECLRDLGFDVNITELNIARGRALDRGTMMVSRNPVALIYTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6y methyltransferase/putative decarboxylase
publication title The Crystal Structure of Mt0146/CbiT Suggests that the Putative Precorrin-8W Decarboxylase is a Methyltransferase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase, lyase
total genus 49
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.196: Cobalt-precorrin-6B (C(15))-methyltransferase (decarboxylating).
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1l3bA00
3FUXA 5HFJA 3G5TA 3M33A 2OB2A 3MB5A 3UJDA 1ZKDA 3NJRA 4RX1A 3NWBA 3TFWA 2ORED 4MHTA 4AZVA 1XCLA 2OPBA 5ICFA 4E70A 3MHTA 5FCDA 2O05A 3LKZA 3SM3A 5DXJA 1SQGA 2OYRA 5FTWA 5DRYA 2UZ4A 3K0BA 1EIZA 3UZUA 5DT2A 3FYCA 3KQPA 4E2XA 4RTMA 4EVIA 4HH4A 4X60A 3MTEA 3TM5A 2EX4A 4RVDA 3P2KA 2YX1A 3KQVA 4U7TB 3KPYA 5EKUA 1EQAA 3HCAA 4C4AA 2WK1A 3ME5A 3LGAA 3UJAA 3CJRA 3T7SA 4CTKA 4EKGA 1NW8A 3F4KA 3SSOA 3JWGA 3SXJA 2ZBRA 4C08A 3V97A 3UJ9A 3EVDA 4QPPA 5ERGB 2PV0A 3GRVA 3I53A 4RVHA 3EVGA 4RYLA 5E1MA 3UJBA 5KYGA 2B9EA 1N7IA 2IFTA 3FUWA 4LWOA 5DX0A 2IGTA 2YXLA 3FPGA 1Q0SA 2B25A 1KR5A 4CWAA 4DCGA 3MERA 3CGGA 5FWDA 1P1BA 4GC5A 2HR1A 2I62A 3B5IA 3MQ2A 4FZVA 4O29A 1JTEA 1P1CA 2JHCA 1RJGA 3E23A 3ELYA 3SX0A 4GQBA 3HA7A 3DR5A 4PIPA 4R8SA 4DCMA 2YR0A 3A7DA 3X0DA 3DXZA 1RI4A 4HSGA 2ZBQA 5H02A 4YUVA 3EVEA 3TOSA 4FR0A 4PYIA 4PYQA 1G8AA 5FQOA 4P7FA 3UFBA 5BXYA 3ERCA 2A14A 4Y2HA 3ER9A 1M0EA 2VZ9A 2AS0A 1NW7A 1X1AA 3RODA 5ICGA 4CTJA 1X1BA 3DH0A 3O31A 1EJ6A 3GNLA 3GDHA 1L1EA 4V0RA 2IH5A 4RTJA 1XJ5A 3TLJA 4GEKA 1D2CA 4OQDA 2GS9A 3G7UA 3KR0A 4ER0A 3FTEA 1RI5A 2P7IA 3C6MA 2P8JA 4PIMA 3EVZA 3LDUA 4YMHA 2ZTHA 3VC2A 2P3QA 4PYOA 1O9HA 4G56A 2CKDA 3ELDA 3OU2A 4FT2A 5K05A 3KPWA 4HRAA 5HIKA 5DTMA 3CKKA 3K6RA 3E8SA 2QE6A 5CVUA 3NVMB 4OBWA 2ZIFA 4HGYA 8MHTA 1VP9A 4H0NA 5K0NA 3UWPA 3AY0A 5E1BA 3TM4A 5HIMA 3LBYA 5GP1A 3B89A 2FYTA 1I9GA 1SQFA 4QPNA 2I9KA 3R24A 1ZG3A 5EZQA 1YZHA 4GBED 3PT9A 3FUVA 2C7RA 3DULA 5ICEA 2VS1A 1DCTA 3IEIA 1QYRA 1SUIA 3KKZA 5HIIA 3I64A 3GU3A 3SR4A 4BLVA 4EK9A 5EHIA 2YXEA 1L3BA 5K0LA 4KIGA 4X61A 2AOUA 1L3IA 2DULA 4FSXA 1VPTA 4BY9E 5DSXA 2GPYA 3G2MA 2ONZA 3T7TA 5K0JA 4PYKA 5DTQA 5C1IA 2IBTA 3PFHA 3R0QA 5CM2Z 2G71A 1XTPA 4UOEA 3CVOA 2AOUB 5K0GA 4QTTB 4HC4A 1VBFA 5GIPE 3TQSA 5DRTA 5FA8A 2JHAA 2DPMA 1IM8A 2V7EA 3IHTA 5EQJB 1P39A 1UIRA 2VDWA 3E7PA 3G2OA 1XDUA 3NDIA 4LECA 1G8SA 1M6EX 1B42A 2I6GA 4M37A 4QDKA 5E9JA 4GOOD 3GIWA 4POOA 5LQAA 4IV8A 2JH9A 3KR2A 2ZZNA 3SVZA 3FTCA 1PRYA 3HM2A 3A7EA 1BHJA 4BLUA 4GUAA 4OX9Y 4V0QA 5ICCA 3OZSA 3GO4A 2Q41A 2YXDA 3VYWA 4XCXA 4U7PB 1EAMA 3FPJA 3LCVB 4P7KA 3TR6A 2NP7A 2WA2A 3A4TA 4JXJA 3EEYA 4PYMA 5DM0A 4ER6A 4P7GA 1HNNA 1F38A 2PGXA 3GXOA 3G89A 5DPMA 3VSEA 4E30A 3CCFA 5F2NA 3MTIA 1NE2A 1ORHA 2JHPA 4IWNA 2BH2A 4RWZA 3P71T 1EJ0A 4P7JA 1NBIA 2BM9A 1JQEA 3KR9A 4KIFA 4C06A 4EQZA 5K01A 3FRIA 3MGGA 2ERCA 1HMYA 1AF7A 1IXKA 1RI1A 2YQZA 3BGVA 4YUXA 5MHTA 3DXXA 1XXLA 1BC5A 3MCTA 3ID6C 3TPZA 3A26A 3DLIA 4PINA 1PJZA 3JWJA 3OZRA 1WZNA 4CKEA 1AQIA 4KWCA 1KP9A 5CCXA 2UYCA 3KQSA 5DXAA 5EG5A 5K09A 2HNKA 4BLWA 4PCLA 3GRZA 2HV9A 2PXXA 5EGSA 3WSTA 4RTSA 3KU1A 4R6XA 3FUTA 4M36A 1VP3A 2QM3A 3DXYA 1I4WA 3KPJA 3EMDA 2AOXA 3EVFA 5LSAA 1U2ZA 3TMAA 1SUSA 4KW7A 1YFJA 1VE3A 3R9XB 5FADA 4C07A 3AXTA 1RJDA 4QVKA 4PNEA 2Z6UA 3EVCA 1XDSA 3SSMA 1VQ1A 5EZSA 2OB1A 4A6DA 3UA4A 5E9WA 2NXCA 3FRHA 4PONA 1TPYA 4C03A 2YUIA 2EJTA 2NXJA 2P7HA 4DF3A 3G8BA 1KPIA 5EOVA 2ZULA 1NT2A 1KYZA 4YUZA 2WA1A 3UA3A 1Z3CA 1TW2A 3ORHA 4K6MA 2ZIEA 1KYWA 1JTFA 1FP1D 3DOUA 4ISCA 4M38A 5HZMA 4E2WA 1I1NA 5FA5A 3REOA 3PX2A 4MWZA 1VL5A 4C04A 2G70A 2O07A 3T0IA 2ZCJA 5C9ZA 1WG8A 3GJYA 2G8NA 3KPVA 4E2YA 3C3PA 5E1OA 2OXTA 3Q87B 4AUKA 3I5UA 3HCBA 4FSDA 4YV0A 4DA4A 3LX6A 3OFJA 3OU7A 2XVMA 2VP3A 5EEHA 2UYOA 5K0BA 4M7RA 2ZWVA 3B7PA 3LDGA 3JWIA 2ONYA 1P91A 1D2HA 5U4XA 5E9QA 4QDJA 5KS2A 2B2CA 4X41A 2AOVA 4OQEA 2R3SA 3KR1A 1SG9A 5DM4A 3UJCA 1FBNA 2V74B 3DMGA 1KIAA 2PY6A 4HTFA 2IDJA 1RI2A 2KW5A 2JJQA 3AXSA 4FP9A 2C7QA 3EVAA 5EMLA 1ZQ9A 2N47A 2IIPA 3RIEA 3BUSA 3FPHA 1NW5A 2PJDA 3OZTA 4Y30A 2AOTB 4AZTA 4DKJA 2FHPA 2Y1WA 3FPFA 5JR3A 3PLAE 3I58A 4HTFB 3KQTA 4PGHA 4MTLA 2NXEA 2IP2A 3KQOA 3NW9A 4PWYA 5EHGA 3VC1A 4B17A 5GINE 4QVGA 4HGZA 1OR8A 3QV2A 5FHRA 3EGIA 3P8ZA 5LQNA 2O0LA 2FCAA 2Z6QA 3BGDA 3BKWA 5E2AA 1IY9A 2BR5A 3DMFA 3P2EA 4YMGA 5KQRA 2QY6A 5CUQA 5LQRA 4RVGA 3LPMA 5HILA 2BM8A 2NNWB 3GRUA 3LCUA 5CVJA 5FULA 3SGLA 2BR3A 2JG3A 3OFKA 2XYVA 5DSTA 5EMKA 2ZZMA 2H11A 4RTPA 3ELUA 5K0EA 3HVIA 1FP2A 4YV2A 2AVDA 1Y8CA 4KRGA 1X1DA 3EVBA 5DLYA 5DTRA 5EKXA 4XUEA 4MQ4A 5E1DA 3CJTA 3SMQA 5K0FA 3MAGA 4F84A 1R6AA 1KXZA 2AVNA 1QAMA 4PGGA 5EIFA 2ZIGA 2R6ZA 3C3YA 3BWMA 3GWZA 3G8AA 5DX1A 2PXAA 1NV8A 2PX5A 3LHDA 1DUSA 1YF3A 5DM2A 2PSSA 1M6YA 2NYUA 3THSA 5LQUA 5FHQA 3HVJA 5F2KA 10MHA 4AZSA 3V8VA 3M4XA 1TW3A 4E32A 2EFJA 3EGVA 3HA3A 2CMHA 1ZGJA 3AJDA 1QAQA 1RJEA 5DWQA 2XVAA 3IYLW 2AN3A 2ZFUA 3BWBA 1KPHA 1XVAA 3HA5A 4R8RA 4A6EA 3CC8A 2AN4A 2BZGA 3B3FA 5CVVA 2K4MA 9MHTA 1NW3A 2P3OA 4OA8A 2ADMA 3H2BA 4RTKA 4GC9A 1WS6A 3UBTA 4YUWA 2ZW9A 5GWXA 5JUWA 1XDZA 2GLUA 2UYQA 3KQYA 1NV9A 3G2QA 3HNRA 4AZWA 2HMYB 3FTFA 3HVHA 1Q0TA 1ZHFA 3BT7A 4LWPA 4P58A 3IV6A 5KQSA 3TRKA 5LR6A 4RTRA 4KDRA 2CWWA 2FRXA 4ATNA 3C0KA 3P2IA 1F3LA 4X1OA 5K03A 3QOWA 4ER3A 5BW5A 3BGIA 3HEMA 4KDCA 2QYOA 3EEOA 3HCEA 3LBFA 1NW6A 2IBSA 5B1SA 3SSNA 4ZTBA 2P40A 2PX2A 2FPOA 3PB3A 4E33A 2VDUE 2OY0A 7MHTA 4C05A 2PX4A 3OPNA 3R6TA 5D1HA 3G5LA 5EEGA 1SVUA 1O9GA 3JWHA 4QQKA 4R6WA 5BP7A 3M6UA 3MCZA 3B3GA 1YFLA 4Z2YA 2B78A 1R8YA 5GIOE 4NECA 3P9IA 3M70A 4QTUB 4CKBA 4PYJA 3HVKA 2B3TA 2PWPA 2FK8A 1FPQA 2ZSUA 4GOLD 3NMUF 2PBFA 4LG1A 3UJ6A 1NKVA 2LD4A 4DM3A 4RTQA 5HEKA 1VLMA 2ZLBA 4EKIA 4RTLA 2YTZA 5DX8A 5BW4A 3A25A 3NVKI 1D2GA 1RJFA 4WVLA 5EMJA 1MHTA 3QOXA 1BOOA 1X19A 2EG5A 2PLWA 2PX8A 3BXOA 3HTXA 4GF5A 5GM1A 1JG4A 1KPGA 2HWKA 4L7VA 5T6BA 5GOZA 5F2OA 4CKCA 2PVCA 3NDJA 2H00A 4DMGA 4YUYA 4YV1A 2I7CA 2Y1XA 3NWEA 4QQNA 3DP7A 3UJ8A 3PVCA 4FT4A 4RVFA 1FJXA 1R74A 2EJUA 5E8JA 5EC8A 3T7RA 3BWCA 1BKYA 2GA9A 2VDVE 3PX3A 3CBGA 4FS8A 3C6KA 3THRA 2BR4A 3LECA 3HP7A 3ER8A 4FGZA 1AV6A 3O7WA 4WXHA 4AX8A 2OKCA 1X1CA 3LCCA 2XYQA 4E31A 5LQCA 1QZZA 2G1PA 4MIKA 1JG2A 1JQ3A 1WXWA 3LSTA 1T43A 2C7OA 2AOTA 3CJQA 1INLA 3BWYA 2ESRA 3I9FA 2PWYA 4DZRA 5P8WA 1NBHA 5EIWA 3KPUA 4GOMD 3HCFA 1AQJA 4IKPA 3TKAA 4DQ0A 5T67A 4PYNA 1UFKA 4OBXA 4RV9A 1DL5A 1O54A 3P9NA 1VIDA 2XBMA 3DTNA 2ZBPA 2FK7A 2PT9A 5LQJA 1JSZA 1ZGAA 3FPEA 2OBFA 4XUCA 1EG2A 1ORIA 3OE4A 3HCDA 1JSXA 3B3JA 2AZTA 3PTAA 2PKWA 2OZVA 4GOND 4KVZA 4OA5A 2IPXA 3KQQA 2CMGA 5GM2A 1QANA 3OE5A 2F8LA 3M6VA 2GH1A 5DM1A 3AWIA 3M6XA 4R05A 5FUBA 2P41A 3KQMA 2IH4A 1UWVA 5G02A 3OCJA 5CCBA 2E5WA 2CL5A 2QRVA 2HTEA 5FQNA 2XYRA 1YZ3A 3BKXA 3DUWA 4RTNA 1V39A 1G6Q1 1JR4A 4E2ZA 4RSRA 1R18A 3NTVA 5EMMA 1WXXA 3L8DA 5E2BA 1R8XA 3G2PA 2O06A 5T64A 2QRVB 3LL7A 3DLCA 3GRYA 5HIJA 3DMHA 2GB4A 5K8VA 4F86A 1XCJA 2ZWAA 2AOWA 2PXCA 5CVDA 3KQWA 3Q7EA 3EPPA 1JG3A 4HG2A 2ZVJA 1G60A 1JQDA 3ELWA 5CVEA 1KHHA 1RI3A 3RW9A 3OU6A 1N7JA 2H1RA 2PT6A 5IH3A 4PCAA 5EVJA 4BP1A 4CXMA 2IH2A 1QAOA 5FWAA 4F85A 2JH8A 3O4FA 5CIYA 2Z6AA 5LQKA 1G55A 2O57A 5IKMA 2AN5A 5K0CA 3G88A 3P9CA 3FYDA 1SKMA 5EPEA 4BP3A 3GGDA 2P35A 3UJ7A 2NXNA 1L3CA 1YUBA 3S68A 4X63A 1L9KA 4PYLA 5CD1A 3FTDA 3R3HA 5E8RA 1JG1A 3FUUA 3U81A 2ZZKA 2GAFA 3EMBA 1WY7A 3BZBA 3FZGA 5KVAA 2G72A 1YB2A 2IDKA 3PFGA 5C0OE 2OO3A 4EMSA 4XUDA 3A27A 3M6WA 3P9KA 2P1DA 2C7PA 3LDFA 2NP6A 1H1DA 3D2LA 1N2XA 2YVLA 2P3LA 5M5BA 4RTOA 3E05A 4ER7A 2UYHA 3GCZA 5D1NA 1MJFA 2AR0A 3P97A 1R00A 3GRRA 5HOQA 3KHKA 3LKDA 3ANXA 1G38A 3PS9A 4ER5A 3TKYA 3EGEA 4IV0A 3HCCA
chains in the Genus database with same CATH superfamily
1F14A 2Q1YA 2WF6A 5JW6A 2IU6A 1LRJA 4MHTA 1WAMA 1E9CA 1MZVA 1MJGM 2IF0A 3COYA 1L5QA 1PKXA 3DG9A 1SA0A 2DWUA 4UHEA 1TK9A 4UTOA 1OYYA 3A1CA 4GR4A 3GG2A 3PWKA 5EXPA 4LRTB 1C2YA 1L4UA 2PRSA 4XSHA 3WO0A 2OHVA 1RPTA 1UC9A 2CYCA 2AF3C 2XQVA 5B7NA 2ZJ8A 1NY5A 2I2WA 3W5VA 3P0EA 4TMXA 3D02A 3QTLA 5AXBA 4QIHA 4C4AA 3T1YB 4D5EA 1U0JA 2CVQA 2C3PA 2JIBA 1KYTA 2C9YA 2G5TA 1X2EA 3JWGA 4NC9A 5FA6A 3K30A 1ECBA 4G6ZA 3PNQA 2CE7A 1OAKA 1J2YA 1QM5A 2YXBA 3GJSA 1IPFA 3DFFA 4MKFA 2RJ3A 4PX2A 2HJ9A 1ZJ6A 4UNIA 1KK1A 1NIJA 1USVA 3RSZA 1K6EA 1LUAA 1Z39A 2VJNA 6YASA 3MERA 3JWEA 2F8MA 3FSGA 2J09A 2RI6A 3VZPA 3WKBA 1U63A 1GUDA 3PD1A 3B5IA 4BO4A 2XX3A 5CT9A 3ZHBA 1DRKA 3KE8A 3OFSA 3VR2A 3F7NA 3HU2A 1DZ3A 1JGTA 4I81A 3A7DA 5CP8A 4AUKA 3QVSA 4MQBA 3ETJA 3VPCA 1SVNA 2RGBA 2HH9A 4DRZA 1E1NA 5IT5A 4FR0A 4JI4B 1JR3E 5FQOA 2WZDA 2SHKA 4N0EA 4QGFA 3WK6A 1ZK0A 1GYQA 1VLVA 2OMEA 1ZL2A 3P4YA 2WHPB 4LXIA 3O31A 4G5QA 1FZQA 1S8FA 2ES4A 3WADA 9ATCA 1ODKA 4CIDA 5EJ8A 2HIHA 2NT3A 4WOKA 1OWMA 4OJNA 1IVYA 4TTQA 2EW2A 4Q3CA 3R76A 1BFKA 3EG5A 5FPTA 3TKLA 3FR8A 2I6UA 4LIPD 1LDEA 4OATA 4Q1FA 4JT8A 4FFMA 2P8JA 4XD7A 1WXIA 1SXPA 1CY6A 4OLFA 2PD4A 4DJAA 1YS1X 1VOTA 4QUBA 3FY4A 1HX7A 4J0EA 3A06A 3FNQA 3NTXA 1MX1A 4AS2A 3WMRA 3KALA 1GNVA 4BB5A 5AKHA 4ALJA 4BLRA 2PGOA 2SKEA 4L9WA 4M21A 5EP1A 5T3UA 1SXJC 5I7EA 3B5EA 2VFAA 1SFRA 4EEZA 1IN6A 1KK3A 1B8VA 1EE1A 1TUEA 1E9VA 3RVRA 2RGEA 3FMVA 1Z4JA 3HCNA 4YMTA 3CF4A 4D81A 3SLRA 4JLVA 1HC7A 1I01A 2B6NA 2PUVA 4N48A 3PT9A 3I6ZA 5LWHA 4M0UA 2GD6A 1P7PA 1BXRB 1PZNA 2WSSA 5ALZA 4U7DA 1Y89A 1YQDA 5IVKA 3IEIA 2O59A 4QFBA 4KR9A 3ESDA 3ND9A 3UB4A 4AROA 3MXTA 2NTEA 4B4KA 5LYJF 2O8FA 3HJAA 5IAJA 1NC3A 4FEAA 4Z4CA 2XXBA 4N47A 5KINB 5GJVC 1EUCB 1AK9A 3MINA 5ALFA 3I01A 5SYAA 3LY9A 3DO8A 4GNKA 3ZBPA 4MVJP 1EFVA 3W5UA 1DMRA 3K9FC 3VPBA 4J1NA 1L7VC 1XTPA 3H5AA 4XJSA 4UOEA 5CFPA 3CLUD 4OLJA 4JB0A 1Y1PA 2XNJA 3BZUA 3CA8A 3VU0A 5KTKA 3KT0A 1A1SA 4U9IS 4Y1RB 1L7XA 5DRTA 2GAOA 5DYYA 1JR3D 1WLYA 2FPRA 2LV8A 3IHTA 3KRTA 3MS2A 3OCXA 4PZ9A 1YB7A 4TKMA 2VDWA 4JB3A 2Q5OA 4OQQA 5MN6A 4IH1A 4YONB 4DLSA 3O1HB 2W93A 4PFSA 3T54A 4UEQA 3FD8A 4QC2A 2W98A 4L85A 3I05A 4X6YA 3EXFB 4RD2A 5EFZA 3UK2A 3DL4A 3IKMB 4HN2A 4CM3A 4MA4A 1YQWA 5I8WA 2WSYB 4DZTA 3C8ZA 4J7UA 2GTPA 4EW3A 3CEPB 2I7XA 3T5MA 1YJBA 5IWCA 2KYRA 3C6ZA 3TR6A 2C5BA 5BSKA 4JXJA 4JP2A 1KWGA 1KJJA 2J3IA 4ZOAA 1UBNA 2YWCA 3AKYA 1GNRA 3CUEF 4XDGA 3UWSA 3OPYB 2WD7B 3VSEA 4EHLA 3N2GB 3T38A 4H31A 3OOEA 3MTIA 4URWR 4ZK2A 2BH2A 4MW5A 3QU4A 4WZBB 4DR7B 5FBRB 1UJ6A 3GFQA 1LTHR 1SPBS 1HDEA 1QGUA 4MGYR 3HLYA 2ARKA 2CC2A 2GESA 3JAWB 3NHBA 4XA8A 2VRNA 2CZCA 3KJNA 2GN6A 3R6LA 4M0DA 3ZKAA 3NIBA 4ESEA 5KUTA 3K70C 3KKNA 4EFNA 4TVSA 3MJHA 3GQBA 3L7BA 5DI3B 4ZVMA 2NPFA 3KL4A 3PGA1 1P9RA 1UK9A 1VHDA 4R9NA 2HV9A 3AT1A 3NAGA 4ZT6A 5AO9A 2O8CB 3RTEA 2DXIA 1UBGA 3QJ5A 4PAGA 5COAA 2QRHA 2QZSA 4DUYB 2EYUA 5TEWA 3G17A 4G85A 5KNBA 1N9ZA 4LZJA 4R9SA 2NADA 3ND8A 4MH0R 1ND6A 2LKCA 4AW9A 3MG9A 3H6GA 3JQPA 5EKSA 4DIOA 1NF2A 3SSMA 1I2DA 1Z4OA 2YINC 1VQ1A 1L4YA 5E9WA 4PONA 5I8ZA 1PV2A 3DMTC 3KDAA 2JBAA 4X1IA 3E5NA 1FUUA 3K1AB 2R8YA 1ZUD1 4H18A 1GNTA 3HY4A 2QUAA 4IDEA 5EOVA 2OBNA 4JOBA 2ZULA 3CS3A 3MF4A 4WLFA 3T5CA 1I0ZA 2F4NA 3F3MA 3GD5A 5JH7B 1WZEA 4OLBA 4R0NA 3JQFA 2BV3A 3F98A 3RFUA 4AS3A 1O5TA 3L43A 1CUBA 4ZQBA 3AFIA 3AEUA 4UVIA 1N2EA 3OJXA 2GGSA 4ISCA 4OHRA 4E2FA 1T25A 2CZQA 4M87A 4B85A 2C97A 3OM9A 5AM1A 3REOA 3DEIA 3D2AA 3PX2A 4UOQA 5FA5A 4BBZA 1NGSA 3CN9A 4J49A 2Q21A 1FTSA 1W47A 2VF7A 1ID1A 1K6MA 1Z3IX 2DH5A 5THQA 1NTRA 1IXSB 2FW9A 2ZUFA 4D43A 5KKAA 4EZBA 3N0RA 3F5FA 1ZCAA 2VAWA 3AKCA 5LZ7A 2GEDA 2QAIA 2V9CA 4TYWA 1QFXA 3W6OA 3L8ZA 1CF9A 1MJNA 5KS2A 1J0EA 3PQ7A 1NQOA 2C7GA 1ZW6A 3ORRA 3PXEA 2GPSA 4YMWA 2WJWA 1MPXA 3GLTA 3JYHA 5HXAA 1EFRD 4P3NA 5KDLA 2IDJA 4N3BA 5I7AA 2GZMA 2HMUA 3RASA 2QLMA 4EM6A 1RMQA 4ZVOA 2PJDA 3B6ZA 1MC8A 4AK9A 4AZTA 2QP9X 3FPFA 2X8AA 3LK7A 2IEAA 3A04A 1R64A 5KTRA 5C18A 2B8WA 4CV1A 4EGCB 1XEXB 2WDPA 4YAJA 1OR8A 3QELA 4EQ6B 3VU9B 3ISTA 2ODQA 4BNVA 1VHTA 3W1WA 1I3KA 5TIIA 1FEZA 1M6NA 4NK5A 4RVGA 2CLHB 2G25A 3GELA 4FE3A 5FULA 4ARAA 1XOIA 3EXG2 1BXGA 3G2NA 3KHTA 3LVRE 3M3HA 3NIDB 3OFKA 4RH0A 3X43A 5EMKA 2PUAA 4NS4A 4OUDA 5TMBA 2UUBB 5H82A 4L51A 3NGMA 3PXXA 2XBUA 2X8BA 3UANA 4B3GA 3JD4A 1ZDMA 3TDMA 1KXZA 1ZJ5A 1QAMA 2WWTA 3NM6B 3OEHA 2ZJ3A 4Q37A 3N75A 1DKOA 4NMWA 3N2YA 2QL6A 4WI1A 4ZAXA 3Q7SA 2PSSA 1M6YA 3H4VA 3JQ9C 1E1YA 1HOXA 3K2BA 1C9EA 2VQ6A 5B1HA 4Y2SA 1T8WA 1FDVA 2G82A 3AB8A 1PR3A 2YVKA 3M4XA 4PSAA 2EFJA 3RJMA 2HNBA 3SDZA 1QH9A 3W06A 4I5EA 2X22A 5C52B 2WM8A 4UKDA 3NHKA 3T8YA 4MXDA 4A8JC 1U90A 2Y6VA 4JT2A 4R0MA 3F6YA 4XM1A 3OAAA 2WV9A 4V0ME 4ALNA 1U94A 4R9VA 5IXSA 1NW3A 2AYYA 3HE3A 1PDWA 4HH1A 5KNDA 1NI3A 1S2LA 1XNJA 3GMIA 2Q0SA 4IRUB 5JUWA 4F97A 2IBMA 4YHBA 2IW1A 3MOGA 4F4DA 3K2IA 4ND7A 2J9FB 3PI7A 1P4RA 3HVHA 3RC8A 3I1JA 1KI1A 1W2HA 3ONWA 4RGYA 1I6LA 2B99A 5LR6A 3AF0A 4FIZA 4TWAA 4Y2PA 2FRXA 2EFDB 5FF9A 3B1KA 5DN6A 3DDSA 3DBLB 1T91A 3MJVA 3B20A 1JNXX 4JJ4A 5BW5A 1TA0A 2HPHA 2G4LA 2QYOA 2BUAA 2WUEA 3JARA 4IL5A 4BFTA 4TMTA 4F5EA 2IBSA 1B3RA 1DKUA 3IXQA 4L08A 4OMCA 1A72A 3GNSA 4PR0A 1HT0A 1FTNA 3GN1A 4QRHA 1A4UA 4MICA 3A32A 2ZYUX 2EVWX 4DWVA 3R9XA 3AVVA 4MV3A 3DOFA 1EVYA 3IP8A 1YFLA 2QROA 3URKA 1R8YA 1I3CA 3PHIA 4NECA 2ZJ5A 4I8IA 5BYKA 6CHYA 4N39A 4JCCA 4RPCA 5JS8A 3OQVA 2AEMA 3VNQA 1Y4SA 1HZJA 4L0QA 4LG1A 1TX4B 3GFVA 3IRVA 1BZYA 2B1IA 2JIMA 2ZLBA 3QJGA 4DWWA 3GP8A 1NDQA 1OHHA 2G0AA 1OIVA 3L41A 1PVOA 1R2QA 4RESA 2QX9A 2D1RA 1DC4A 2HLNA 3KXKA 4A3SA 2LIVA 1XTIA 1EM6A 1S3GA 2QN2A 1NW9B 4R54A 1XAGA 4BYGA 5MN5A 4UMFA 1R4MB 2XLCA 2BTEA 3D0OA 4X8MA 5KX5F 1VG8A 1WU8A 1MO4A 2ZANA 3EGDB 3QLJA 3K0KA 3QE4A 4DNFA 2JGMA 5A4KA 3VKWA 2QLJA 3W5HA 5A62A 1N3IA 1N57A 3PQDA 5LLSA 2HZBA 2GEUA 3FYSA 5DWVA 1P1IA 5DYIA 3CVXA 2XTMA 1BU5A 1E1CA 1LF0A 3V4SA 1OH6A 2RHDA 3O2SB 3WO1A 4X00A 3IEXA 2BR4A 2NNLD 1M72A 1R10A 3MWEA 4MUYA 2YV5A 5KAPA 1XP5A 2DGDA 1X1CA 4HR7A 2G1PA 4GQAA 1P77A 3JQFC 4R1LA 1Q6YA 6Q21A 4CQMA 2IWHA 3CRQA 2ZDGA 3L01A 3P7MA 3QMPA 5E2IA 3MLBA 5KYYA 2PH3A 2I1LA 1X7YB 4NOMA 3AEYA 5IJXA 1W30A 5SZJA 3KHSA 3RNLA 4BUZA 5HS4A 1GKKA 5JSZB 1NVUQ 2Q5QA 3VR6H 4ODIA 1KIMA 1AZLA 4YAOA 2GD1O 1ABBA 1CR1A 1GJRA 2OEPA 1EHYA 1J0BA 3NIFB 5CGQB 3GH1A 3E2IA 3L07A 4CMEA 3OI7A 2P0AA 1V8OA 3PQEA 2PUGA 2VPQA 1L5WA 1C9MA 4LZLA 1YDMA 2A1UB 1DOAA 1DKMA 4EUHA 5HKKA 5ENZA 3MSXA 1SG6A 3MT9A 4K7JA 4C4YA 3D59A 4KVZA 2VAPA 5U4QA 1OI7A 5I4CA 3BD7A 3S7ZA 3W4JA 3BYZA 3VR5H 2HT6A 5LXTA 4FBGA 5ALKA 4O1IA 3WYEA 3ZI4A 1L5YA 5HPYB 2G28A 1ZVJA 4ENPA 1T8RA 2IH4A 1DEHA 1MJHA 3QMWA 4XOUA 1FRZA 1YE5A 1RBQA 2EFCB 3A1NA 3BKXA 1WSAA 2QN6A 3JQCA 4I6EA 3LPDA 1XVVA 3NTVA 5K8JB 1BD4A 3TVTA 4OX9B 1ZIYA 5DHUA 3IBTA 1GPWB 3OZWA 4NVRA 5CLHA 3C7CB 2N0SA 4XWTA 3DMHA 2WRZA 3ZE1B 1HWYA 4A6PA 5CT6A 5GADl 2OLJA 1PFYA 4P4SA 5JROA 2X2FA 3ZDXB 4ARZA 3AIIA 1BWQA 4N6NA 1RWPA 3BERA 2A0FA 3P20A 2R8EA 3L92A 3Q4GA 2X8LA 4HRXA 3GGCA 4F6RB 5BOVA 2G5PA 2BBSA 2F8SA 3KUDA 3U4HA 4PU0A 3O4FA 3K9BA 5CIYA 2BY4A 2B1QA 3QVJA 5A7FA 2YJTD 1NPTO 2XNHA 3N8GA 5G0UA 3WYGA 2XUFA 1NA5A 3C1UA 1YI8A 3F8SA 4MW0A 3WY9A 2PSFA 2WU8A 2Q2NA 3SEQA 3JQ6A 4PYLA 3U81A 5IG2A 1F8FA 1OY1A 1T3ZA 3SYNA 5FFMA 2QYSA 4CMBA 3CLVA 2XKKA 1QLJA 2G72A 3JVIA 2IDKA 2HJRA 2ZJBA 3DEAA 4IXDA 1L4BA 3C2QA 3R8XA 1Z7BA 3V4LA 1XJ0A 3COVA 3W2TA 2CXOA 1B23P 1G1MA 2YVLA 3TI7A 2ZIUB 5I4IA 5I5GA 1MJFA 1G38A 4TTVA 3THWA 2HSWA 2WVJA 1KJYA 1T2UA 1CVLA 3OQIB 3K0SA 4EUEA 2G83A 1ZKDA 2H8KA 5JV5A 2DTEA 2VTKA 5D00A 3IVRA 5F1PA 4E70A 4B9EA 1J6UA 1FMFA 1SUFA 1F2UA 3H1EA 3LQQA 2O05A 1LBIA 1L5MA 3AY6A 1QH0A 3B7GA 1LW7A 4A1OA 5DXJA 5LA6F 5CXXA 2WYWA 1ZNZA 3I1IA 3K0BA 3ND5A 3EDOA 4OHCA 2FMIA 1Y3BE 1XCGB 2OD2A 3S2SA 5C5CA 3C6XA 4EFDA 4ZOBA 1DKLA 3MELA 2L82A 1X6VA 2EX4A 1LY1A 4YCAA 621PA 1ZHHA 2WE8A 3BXPA 1XUOA 3KPYA 3MWDA 3T06B 1EQAA 2NYRA 4BVKA 4MDEA 1BHQ1 3TDKA 3QVWA 5H9WA 1GLNA 4II2A 4NYMQ 4HO1X 4BNZA 1LPAB 1GSOA 2V7TA 3GAMA 3IESA 3AI1A 4NYMR 5IYZF 1Y8AA 3F4KA 3V32A 2QK4A 5EIAA 1GPKA 2QI9C 1CP2A 1U5BA 1HSZA 1C3LA 2ZBRA 3C5EA 4FMDF 2VDOB 4LYHA 2HXGA 3COSA 2MSCB 3DHVA 4RVHA 4AN4A 4MW4A 4ZTUB 1Y6QA 4MVCA 1S9HA 3PUJA 4KWTA 1J06A 4QO8A 3PPYA 1M2KA 1QWSA 1W88B 4LDPA 4YRDA 4QA9A 2OHFA 1E2MA 1CTQA 2B0CA 3QU9A 5EP3A 1QK5A 4HGPA 1TZCA 1FU7A 4IR7A 2R4QA 3JYQA 3QM1A 1JSRA 4DMRA 3UV7A 1GD1O 4L6CA 1WUYA 1A5AB 5FTJA 1JJAA 2E6KA 2QIPA 3CUUA 2QX7A 2OL4A 1LLUA 3W4KA 4L3WA 2O0HA 1SGWA 4PVCA 3TW8A 4BEBA 4LC1A 3UATA 4KQJA 3DWIA 1DOHA 1Z7EA 4YJFB 3UNXA 1X1AA 5JYBA 4NENB 2C8KA 3B8HA 2Y77A 4DOMA 3RTCA 3V7UA 4G26A 4KXVA 1XJ5A 4M0LA 1CZHA 2OCXA 2X77A 4GEKA 2VWGA 3SZUA 1IQRA 2ORYA 3BGSA 2XGSA 3W34A 1MRZA 2AMJA 2Q9AA 3SQOA 2AX4A 4DVJA 2GPJA 3EVZA 3ROPA 3G9UA 3DCYA 1T29A 4LYEA 2YNMD 1YCGA 2P3QA 2HB6A 1I80A 4Y2QA 4QDTA 5DGTA 4BO3A 4IMJB 4NV0A 2CKDA 4RETA 5DTMA 3CKKA 2XUKA 2FQWA 2Q5EA 1YA4A 2VWPA 3LF2A 4FD2A 3HPRA 5F7OA 5IFLA 4I4TF 4CLOB 8MHTA 4C30A 4Q3EA 1YR8A 3QBJA 2AMYA 3UWPA 4DIUA 1K4YA 5KOIA 1X8XA 1U7ZA 1T4CB 3R0VA 1H4TA 1KEVA 1O4WA 1GAWA 1DBSA 1P1FA 3FB4A 5FNVF 2WFLA 1CVRA 4M53A 2RJNA 2ZE8A 3ELBA 4DWOA 2XZLA 5B7GA 4MVJM 1RQRA 4RK0A 1QGDA 1P0CA 1TYEB 2BEUB 1LK0A 2PJUA 1MO2A 2C3MA 2VL7A 3P0JA 4IGFA 4J6FA 1YS7A 2HLHA 5BPHA 4OQYA 3K6SA 1VKJA 1ZP6A 2GPNA 4U00A 4V0KA 1NN0A 3H5LA 4YJ3F 4KOAA 1EJ2A 2GPYA 4JENA 4NCNA 3ROEA 3TRJA 1LC0A 2QRKA 2CB0A 2YJ4A 4PBTA 5CM2Z 4CFSA 3DXFA 3V4VB 3CVOA 4QTTB 1XQ6A 4KQEA 4X7RA 4TLMB 5GIPE 4L6IA 3GLGB 3ZVMA 1COWA 1TI7A 2RH5A 4BS9A 1SR8A 1DWPA 1QFYA 4YH1A 1GCIA 4LJ6A 1RCUA 4TKUB 1XFAA 3K5WA 3HSSA 3KNZA 3U7RA 1XELA 4P4GA 4EJ0A 3R09A 2H1FA 4N9WA 1NW4A 3RVMA 1M34A 2NUTA 5EHQA 2ZSAA 2ZS9A 2ZUWA 1UDRA 3SX2A 4JD5A 1BMTA 2PGAA 4MA0A 3NC0C 1GL9B 2AG0A 2PYDA 3NBUA 3DQQA 1RAAA 1X1QA 2YN2A 4DXAA 4MARA 1H6AA 1RHQA 2X0RA 3PJFA 5IK2D 2VO1A 4KH1A 3WLJA 1RC0A 5H4GA 2I67A 5K3OA 4H7PA 4EY7A 4ZALA 3FR7A 5AVQA 2AH5A 4D8YA 3EZ9A 2HQBA 3DEHA 4X20B 2GCPA 1RXIA 4C6TA 2XT0A 3UMVA 4P7GA 3L7YA 4FLEA 4UCFA 2AG5A 4KO3S 4GAEA 1UCFA 2H85A 1FFGA 2PZMA 5TT0A 3LD9A 4DFDA 3L1VA 4BDSA 3LUKA 5FR2A 3RAEC 3OPVA 4JYPA 2C84A 2EGGA 2WTEA 4C14A 4GYKA 1WW2A 3BMXA 3F3KA 5AVOA 2VK2A 2X7JA 3HSYA 4KBYA 1A8UA 3I4LA 2R87A 3KZMA 3DDCA 4M1WA 2ZU6A 3W1VA 1SOVA 4YEDA 3W3ZB 1SD5A 1EI9A 1PW5A 3R5SA 1NBEA 3TIIA 2FG6C 4KNVA 4F8YA 2VEDA 3BSYA 5K0TA 4NMMA 2J1LA 3ZG6A 3GHHA 1A7AA 3DJYA 4FC6A 3R5KA 3K9NA 4CODB 4TS4A 4R6XA 2DZDA 4RF4A 5TLSA 3CBQA 1BMFD 2GFQA 3D5TA 4MWCA 3HP1A 3EVFA 4NZNA 1VB3A 2EJCA 4BFWA 1QVWA 1IN5A 1IN7A 2CLFB 1R0WA 3KYDA 3PL1A 4QVKA 3T15A 1ST2A 2XNSA 4H7DA 4S3MA 3SBOA 4F4JA 1QXSA 3EVCA 1OH8A 1NAIA 1NF9A 1ODLA 4NV1A 2NXCA 1I5EA 1ESEA 1G98A 2C98A 3W2FA 2O3TA 2QOEA 4FMBB 3SBXA 3H1AA 4G9GA 2GPBA 3IAXA 4PRYA 2OVBA 3L46A 4C6SA 1KYZA 1K92A 1AGNA 2VI5A 3UA3A 2J5RA 3HUUA 4H7HA 2ACVA 1CVIA 3F9CA 4AQDA 2V7XA 3ZJVA 2F1KA 2HSDA 3GLVA 2Y0BA 4H4CA 1S7CA 4OFWA 3IE2A 3DOUA 4FMCB 4JFAA 1UQUA 2CLEB 5HZMA 1I1NA 1FF9A 1VMDA 4MWZA 3VJKA 2N1MA 1RLMA 1O6CA 2V98A 2EL9A 2Z04A 3A8TA 3JRNA 4ZU1X 3WWEA 2XUDA 2QAGC 3A1VA 3UK0A 4E2YA 1LGYA 1IDN1 4M0CA 4YV0A 3NHWA 2JIOA 3NS7A 3VOAA 3OFJA 1T9DA 3OU7A 1U98A 2VYVD 1NSFA 2A9VA 1PK8A 2ZWVA 4LY6A 3E3OA 4RPLA 2CXHA 2P2CA 2ZSBA 4RNCA 1KI6B 3ZBTA 4B9AA 2R47A 3D6UA 2J5BA 5TEVA 1XPUA 1J8VA 1SKUA 4HTFA 1L6RA 5AVSA 5D87A 2GLXA 3BD9A 1J9ZA 2G4CA 1E6LA 2BGIA 3DM9B 2BISA 2JLXA 4K0KB 3ZQUA 1NLFA 2HA0A 4OHVA 1ZAKA 4GLOA 3PLAE 3OKAA 2QRJA 1WA5A 1CJVC 3TFQA 3DW1X 2PSJA 3K8ZA 2IZOA 5JXGA 1VL6A 4U7JA 1Z8NA 5LJLA 3VR6A 2R8BA 3K1TA 2JJ1A 1KVQA 4B3HA 4ZV7A 2DOKA 3AYZB 3UN1A 4ZU6X 1WPQA 5A71A 1UBFA 1OB2A 1SZDA 1SUPA 1EZ1A 3EQ9A 4UXHA 4GIBA 4XPIA 3E15A 3FJYA 2FGKA 3IIMA 4KJXA 3PEEA 4FYVA 2C2MA 4HOYA 1UFQA 1Y6ZA 2DBYA 5CH5A 1UT6A 3FGOA 4QBGB 2PKEA 2ZE6A 4LDQA 4YP9A 3SMQA 3VR5A 3WR5A 4FJ2A 2MR5A 3CSDA 2P6RA 3FGZA 4N0DA 1TUGA 1XNGA 4EJSB 3JQ8A 2IYFA 3E0QA 4KYUA 4Q7KA 5LMCA 3JD0A 4O4IF 3HZOA 5J2TB 2PX5A 4IYRA 2V54A 1NONA 3GLUA 4B47A 1RAHA 1T2DA 2VCYA 4FVTA 3NZEA 1L2TA 1WXEA 2AJ8A 3IBGA 1UDXA 3LIPA 4K88A 3TS1A 3OOHA 2NV2B 3FNHA 1GTG1 3BRWD 2Z8ZA 4FILA 2Z3WA 1QAQA 4H08A 2OXIA 4AF7A 3Q98A 3RU7A 1UPUA 3EXIB 3V5NA 4C7BA 1FLVA 1OFVA 1K8YB 3WXBA 4EB0A 3I8XA 1A0OA 3U4GA 2P3OA 3ZXYA 3PA6A 5CEJA 3P52A 4M46A 2QLLA 5ENDA 3T6KA 4U6QA 3ZPXA 2G9VA 3WGNA 1ZVKA 3QKRB 3KQYA 4PQYA 1V7QA 3L18A 4D9FA 1US8A 4L8WB 3DOHA 4TUYB 3UMJA 1I0IA 4BE9A 3H1PA 4GWLA 4OAOA 3K09A 2NWQA 1KZ9A 5EZYF 4TYMA 3BHNA 2GM3A 4GI3A 1GQFA 4JN6B 3WLFA 4ETMA 2EKQA 1JLRA 2FI1A 4HGRA 1IZZA 2GCEA 1PT8A 3IUSA 5E6SA 3ESCA 4F3RA 4JDPA 2C2YA 4RF2A 3SFZA 1CR2A 1GM5A 3HA2A 2IGBA 4ZTBA 4B7XA 1SCIA 2QV0A 1BGVA 5HW0A 3RYCA 3AWDA 3BF8A 5A0TA 4QTXA 7MHTA 1FDTA 1W87A 1EZZA 1H5UA 1ZJZA 1T35A 2GKSA 5FB3A 4OJYA 4BNDA 1O9GA 5BP7A 4WH0A 4RL6A 3MCZA 3E84A 3GRKA 1AMNA 4PQRA 5ER6A 3VDMA 4B8WA 4OFBA 5F3WB 3M82A 4CKBA 5JD6A 3L77A 2ZIAA 3PRJA 4AWBA 3EEIA 4TLDA 5CYFA 1RRPA 2VRWA 2PZ8A 1YDGA 1HDIA 4PICA 2FMFA 3U3RA 1WXDA 5F3DA 4RJIA 5TQ0B 3K0HA 3QXGA 4L4SA 4DMMA 2HRRA 2XR1A 3HFRA 3HUFA 1TRKA 4XX0B 3KSBC 1QP4A 5KVCA 4A73A 1C9NA 2GVDC 2WJ3A 4F71A 2AZDA 4GICA 2ZT6A 3EMVA 3RAJA 4JBWA 4G8DA 4YUYA 3ZDAA 4GRDA 2CUNA 3IFSA 2ZPUA 4WERA 2ZT5A 4H17A 2QM0A 4U5QA 4FI3C 4C43A 4KI0A 5JH7A 2HIMA 4ID9A 2C5GA 1DX6A 2GN2A 2VTBB 1TO6A 3ESYA 4AYWA 4BMNA 3DA8A 2IYZA 2O8FB 3BREA 2CVFA 2X6RA 1TYCA 4KODA 3FKSA 3OIUA 2W42A 1YMQA 3V7NA 1EGMB 4M99A 2AHRA 3OLQA 5K6TA 3LP6A 3UMGA 1OAAA 2HPZA 1ZICA 4FLFA 5IABA 1RQXA 1GUYA 4NJMA 1QZZA 5H9VA 3HUEA 1GU7A 3G5AA 3AR5A 1WXWA 4RS3A 4UW9A 3VZDA 1CJCA 1E2DA 4EB6B 3VSDA 4M4SA 3B1JA 1UWLA 3GBVA 5HF6A 3OTQA 3ICEA 5AW5A 1IB0A 3M83A 4MYUA 1WP9A 3HCFA 2BGKA 4IKPA 3W04A 1P2UA 5BN4B 4EEKA 4R2IA 4K81B 1MH1A 2C7VA 3P9NA 1NN5A 1LDGA 2JLCA 3AF4A 4HHEA 4RY2A 1JSZA 1KY4A 4AZ0A 3ESAA 4ZP1A 4PF1A 1EG2A 3AK4A 1P7CA 3FXAA 4K5QA 4DC9A 5JLJA 1GZHB 3AHJA 3PTAA 3II6X 4WFKA 2JJ8A 5LMNB 1P4HA 2H7CA 1F8UA 2O2JA 2CMGA 3DZDA 3N86A 1M1YB 2NU9B 2I22A 1H6BA 4MWTA 3TL3A 3BZWA 1PNQA 1UDWA 2A5LA 2XEXA 5H68A 1EVEA 1WHTB 1VYUA 3SZ3A 3FF1A 2O1WA 3E2PA 2ETVA 2VSFA 2WP0A 1NQWA 4E94A 3BCRA 5JDIA 2QMEA 5JYCA 3NRCA 4PZ0A 3AU8A 3CNQS 1OI2A 1V39A 4E2ZA 3MUNA 3LP5A 4CEHA 5DSZA 3GJXC 3BVPA 4TMYA 4DLBA 4E09A 1DADA 5JIBA 5LP6B 4BJ1A 5T64A 2J3DA 4R0VA 3PYMA 2IW3A 3GRYA 1DINA 2FUG6 3AGPA 4KE9A 4NFYA 2QZJA 5B1DA 5AUOB 4XGRA 4BC1A 3RTDA 5H5JA 4BCBA 2BTOA 2AOWA 2YY7A 4JR0A 4LV8B 5BYBA 4ZKDA 1MB2A 1JEEA 2NVWA 4OMDA 4HEA1 1Z07A 3DV2A 3H99A 4EG3A 3QLUC 5CB8A 1GPUA 1T3TA 1E3DA 3FIUA 2Z5GA 3OKFA 1QPGA 3ENZA 4LY9A 1HMPA 4PGAA 1HQYE 1U2RA 4Y0VA 1ZIOA 3ZW9A 4UVGA 4IIJA 4AM8A 5FWAA 1R0ZA 5JNWA 5KNDD 3QUSA 5JJCA 1EX1A 2DEUA 4OOFA 4B2YA 3VR0A 1RXSA 1V9CA 1ZEJA 1Z6TA 5K4AA 3MMNA 4G5HA 2BPOA 4WQMA 4EHAA 4BOYA 4H1WA 1R6UA 4HAXA 1DTSA 2PUHA 3W6ZA 3U9SA 3EVNA 3WGKA 1L9KA 1VL8A 4G84A 2OXRA 1H1TA 2F6RA 2I34A 1U3FA 4JZYA 5D2CA 3SR0A 4B32A 4FCCA 3DMNA 3FSGD 5IJ0B 3CH5A 2FX2A 3A6GA 2PYIA 3KLBA 3VR2D 2P5SA 3LY7A 4EMBA 3N0WA 3PKJA 1W36D 5KTSA 2IC5A 3PNBA 1EESA 4HGOA 2BIFA 2DKFA 1R66A 2D1TA 1PFVA 3IUYA 4GOKA 1K8ZB 1WCV1 5D51S 3BJZA 3P97A 4N5IX 1DQPA 2HKIA 2JATA 4TL7A 4Z4EA 2WFAA 3CRMA 1GT6A 1VIVA 2IELA 3EF1A 4A2WA 3VU8A 2VP6A 5AK3A 4D6PA 3L0SA 3FUXA 5C3UA 3L79A 1K98A 1FP6A 4RX1A 3TFWA 5CLGA 2QTCA 2A35A 2OKGA 3ZXXA 3EPRA 3CTPA 2QX4A 1UP6A 4XD7D 5H83A 2ORVA 4QLBA 2MSWA 2AC7A 4EBFA 1P4JA 4ME6A 4WOCA 4NYIQ 3WP1B 2C29D 1WE2A 3TZKA 5HR5A 1A5BB 3LBHA 4JR1A 3JSAA 3NEJA 4NYIR 1UMBA 4CT0A 4F3YA 5A4DA 1WBJB 1ONNA 4KR0A 2Z6VA 1FXWA 5H81A 1XP8A 1LX6A 1UBKS 2PKYX 3GMSA 2PT7A 3LGAA 2DLDA 1OLSA 2Q4TA 2QLNA 1HT3A 4Q1DA 2RG1A 5CU7A 3RRYA 1E2GA 2KBEA 2HREA 1W9MA 4IIHA 5K3AA 4M1EA 5ALJA 3ICPA 1NUQA 4MIEA 3RWMB 2IXEA 4LV5B 1R9JA 5B55A 1IOZA 5ALLA 1UOPA 1N7IA 1PNTA 4XGKA 2HEGA 2WSSD 2QBYA 2XWJI 3AVYA 2CLIB 2VP0A 3ZZUA 1HKUA 2E55A 1HNZB 1W0KA 1YIOA 3H9JA 4IUBS 4C4PA 3CSSA 2QL5A 4OXQA 1K1EA 4UTZA 3UJDA 2F59A 2O5VA 3E23A 3JY6A 1H0RA 3HR8A 3W3AH 4N5MA 4DNXA 4PIPA 1A2QA 3PHCA 4WXEA 1E8MA 3P19A 4DCMA 2HYIC 5JECA 3QPCA 4EI9A 6REQB 4XB2A 3A11A 2PGJA 4INJA 3EZ2A 5ES3A 4YQEA 4R2MA 4AWXA 3CIFA 1B7GO 1SC3A 3EQ7A 5A2QA 3LI2A 1V16B 4WKBA 2GXUA 3CT4A 4P7FA 3ERCA 2WWFA 3TLBA 2JNWA 4FZ3A 2VZ9A 8AT1A 1KJ8A 3KJHA 3A6EA 3CLTC 1PR6A 4MGIR 5CTAA 4BP8A 4CI9A 1TT5A 3KJXA 3R8FA 1AIPA 1LLFA 4H3SA 4JC0A 1NKSA 4LJKA 2Y2VA 4RDIA 5ELMA 1Y98A 4K8OA 4BZXA 1X7DA 1I4TD 2BDUA 2H52A 2JI4A 2L2QA 2WMYA 2YV4A 2GD2A 3QV1A 4EO9A 3EPLA 3MT7A 5L4NA 1JLHA 2O2XA 2O2DA 2HYDA 3ZV5A 4NHOA 4I5DA 3IPAA 3WB9A 3VO8A 2FLKA 1ENOA 3TGLA 3CFYA 4R2LA 3BIFA 1KTIA 3C4QA 4GKAA 3TEJA 3U5ZB 2LW7A 2ZUTA 3E8SA 1FFYA 1HE4A 1CZUA 4GM0A 1J42A 2PLFA 2PBZA 2GBLA 4G37A 3TBFA 3ZCVA 1NFRA 2Z5LA 4K3UA 2DPYA 2VATA 1XHEA 4BVEA 3HDJA 2PLNA 3JALA 1JIJA 1Z8FA 4OMFG 4QPNA 1TKBA 5ANRB 4GGMX 1A9YA 5FYDA 4XPZA 2CV0A 1E2BA 1YKGA 4U2FA 4I5IA 9GPBA 1OLOA 2XCRB 1G7CA 1AKTA 4YAWA 3I01M 5A9RA 3ZDBA 5TS3A 1T4MA 3ZWVA 1BCSA 2X4DA 5ALGA 4YS6A 5AVVA 1NULA 4II7A 4N49A 1GPBA 3D43A 3Q8LA 2HT1A 1L3BA 1SHKA 3D1VA 4I5GA 2GYWA 4Q93A 1NLMA 1VJCA 2EOAA 4OAQA 2AW3A 2H5LA 2QUBA 3ZKWA 4C6HA 2H2IA 2Q2WA 5C8YB 2R48A 1HV8A 5EAIA 4HDSA 4FBMA 1RIFA 4HBGA 3CF2A 3LX5A 2G71A 3PD0A 1PUJA 4PZAA 2IHZA 1S3IA 3EIHA 2WOJA 3TQSA 4M49A 4C7OA 1QE0A 1ECJA 3PFNA 2Y0DA 2DWCA 1V5EA 1QRSA 4KR2A 1H8EA 4AJOA 2ZUEA 2X9LA 3FFXA 2OUKA 3BULA 4H4DA 1ESCA 4BGIA 3JPYA 4M9RA 4Z99A 1IY8A 1GPH1 1KZ4A 1F0KA 3DVSX 3M1LA 4IJ5A 1YF3A 4BMYA 5K8CA 5LQAA 4DMHA 2WIBA 3L4BA 4BLUA 5DDIP 3WB0A 3MD9A 1EP9A 2WB2A 2W2PA 4IJKA 2WVGA 3PEUA 3I2KA 4Q00A 1A8HA 3KOOA 4U4AA 1MABA 1TC2A 1QGYA 3FDZB 4FDLA 1SK8A 1P5RA 1ZY2A 2HIGA 2QD5A 1Y3CE 2PM8A 4U7PB 1L4LA 4BFZA 3C3AA 2QG4A 3BMNB 3LFTA 5L7WA 1IXRC 1VPVA 3OLZA 1FFBA 2JFNA 3NJ4A 4KH0A 1AMUA 2QMHA 1DEAA 3EH2A 2YWDA 5DBEX 3MTBA 1BA2A 5DULA 3HYNA 3FGPA 1T26A 2HBYA 3P1JA 3BL6A 3BWXA 3HVUA 3B53X 5BOSB 4GPIB 4IY1A 4IOKA 4BUCA 2FP4A 3MWGA 4AQ7A 2QRMA 2ID9A 1Y3HA 1U0SY 1Y42X 4G2TA 821PA 5HQTA 4LXYA 3IJ5A 4UC0A 1J1ZA 3EXG1 3RB8A 4Y2JA 1XXHA 1UBJS 2GLTA 1UC4B 2D5IA 2JCSA 4UUOA 5REQB 5IWAB 1QYIA 3CCCA 3AHFA 4A0RA 1X8KA 2AN9A 2Q1TA 3HKBA 4I7EA 4M36A 3RK1A 1SHLA 4S04A 4FPXA 1J8FA 3H86A 4RV5A 1CUFA 1SUSA 4Q4JB 5CURA 4LDZA 5JSUA 5JZBA 2F43B 4XIJA 4C07A 1QK3A 1NJFA 3BH6A 4LQLA 2H4ZA 4IUCS 3ANYB 3MW8A 3AETA 1PQ4A 2A9FA 2VPZA 2ZRQA 4XZ3A 1PIWA 2E21A 4AKGA 2H51A 4JGGA 4MMYB 3BSWA 1WXHA 1OBFO 3N2ZB 1D4OA 3QFRA 4X85A 2BKXA 1CWUA 5FTKA 3VTFA 4I0WB 1ZGGA 1B26A 3H9QA 3OQ6A 3D6JA 4J43A 5JRZA 1JWLA 4KYVA 3SNKA 1IC6A 1RPZA 2BGGA 4IWXA 3VVBA 4ZN6A 1CNFA 2A86A 2VOJA 4L0CA 4V39A 3WLEA 4B2PA 4EG1A 1SJ9A 4JY7A 3SJZA 4DSOA 2L69A 1XBTA 4CGZA 4ZGWA 3WNVA 2GPWA 4MGZR 4B6QA 5B3JA 3O8CA 1A3CA 1GILA 3TPFA 3OEHD 1YL7A 3H1FA 4ZXPA 5HSGA 5FBZA 4I9NA 3A3OA 2PK3A 5EY5B 2ZIXA 1L4HA 5G2OA 4DCNA 1GKUB 4M7RA 2WZQA 3A1SA 4YRNA 1GTRA 1W52X 3JWIA 5ALYA 5ALOA 3VZRA 4KR7A 3MVEA 3U6KA 3FHTA 4RGVA 5IDXA 2XUOA 5ALNA 3GT0A 3IALA 3COPA 3TUJC 4TV9B 3ESZA 1F2VA 4RF3A 1EX6A 3GR6A 3EW7A 1SMKA 1D5CA 3OBIA 3CNOA 3NKLA 4FP9A 1MB0A 3OAAD 1O2DA 2C4UA 4XR9A 1EX9A 1N2JA 2KSQA 4NEHB 2B4AA 4WDQA 1H1LA 2PRKA 2VRCA 4DKJA 1DQNA 1G42A 1XTQA 2L19A 2QE7A 3FKJA 4G9EA 3KQTA 5IW8A 1CSEE 5TARA 4A4DA 4EDHA 4HUTA 2UUPA 2UU9B 2JGKA 2QLBA 1BCRA 4GMXA 3B6EA 5K1ZA 3PC2A 4X45A 3UQYS 3R0IA 2QVBA 3I4CA 3WL8A 4YWJA 3P2EA 2XAUA 1C9DB 5DN6D 1T9GS 3U3MA 4U9UA 2BM8A 2AKEA 4XDYA 3S5UA 2GBLC 4LJ8A 3K0FA 1S01A 4LZAA 3TQRA 4YCSA 4LGMA 2VPIA 1HL7A 4ZVRA 4MPRA 1XNRB 1ZZGA 4YV2A 2XYPA 1XL0A 1L7RA 1K7XB 1O97C 1U2TA 1D2MA 1YI0A 3MAGA 1XSEA 3T7DA 4HEHA 4ZZ3A 5KKNB 3GPDG 2A2ZA 1IWOA 3FNFA 3BTSA 3ZNPA 1YJAA 4CM7A 3D3KA 1QCCA 1T5TA 3C3YA 1N8TA 4FNOA 4N3CA 3G8AA 3RYFB 1QIHA 2PXAA 3PYLA 3QWHA 3LHDA 4MVJG 3PC4A 5CDTA 4CEJA 5IVHA 5HFAA 4MX8A 3BGOS 2O2IA 4HDRA 5AUNB 1OBHA 1CUCA 1Q7BA 3HA3A 1X1EA 4BQEA 1EVKA 1EYZA 5BV7A 3QBVA 2D0DA 5KJ6A 4QPJC 1CZOA 2AN3A 3JZFA 1CK4A 3AEKB 4OP3A 1JA0A 4V03A 3UT5B 3HVRA 3T5DA 1C3OA 3WLNA 2NPIA 1YOVA 2K87A 1KQGA 2XB8A 3SHTA 4PE5B 4TRMA 4N54A 5EGNA 4Z3DA 1ZOIA 2NVUB 1KMHA 2FPPA 2RK3A 3IMGA 8ABPA 3BK7A 4FGWA 4H6VA 4G8BA 5ICMA 2UYQA 3SCZA 2O2ZA 4DY4A 3S8EA 1I1HA 4ETNA 1PEYA 3OZ7A 1Y0BA 2PL1A 3RFVA 4AJKA 4DJTA 1JDUA 1RXUA 4NTZA 5KQSA 3U44A 1GDTA 3MYYA 4RTRA 1VB5A 3L6CA 3CR3C 2CWWA 2GMWA 3BAFA 4KDRA 1OX6A 3BJRA 3JSXA 4MLPA 4ZO7A 1W2WB 3OETA 1NOIA 3BGIA 4M9SA 2EW1A 2FPMA 2YW9A 4KDCA 3LBFA 4L0DA 1CV2A 3X2EA 2EIXA 2FUNB 4C2TA 4DMCA 2DLCX 4DV0B 3HFGA 2MSDB 5I01A 2E87A 2FZWA 3SJUA 1VBKA 3C3KA 4N18A 3TNFA 1R0CA 1S1MA 1JAZA 2NO0A 2B83A 3L84A 4MULA 5TMEA 1F60A 2IXBA 4RK4A 3ZY2A 5DB4A 4WADA 4E22A 1IM5A 3Q2OA 1OCEA 2B8JA 2Q9UA 2W8ZA 2ZRHA 2ZGVA 1P7VA 2BFAA 3MD0A 4Z2YA 4O02B 1EFUA 3DDUA 2DKOA 2VT2A 4NARA 3ZIDA 4OM7A 1IJFA 2C2WA 5A5EA 4KQFA 1PJ3A 3H9GA 5FWYA 4AULA 3EGWA 2VPTA 1CS4C 2ZI7A 1NVEA 3OCWA 5AP9A 1F2DA 1J56A 4EFKA 1SVSA 3PNSA 2EZ9A 3QUTA 3AR2A 1C9YA 4G63A 1U8FO 1BOOA 4O2AF 2CXQA 1SVLA 3J7TA 3EH1A 4PNZA 1XFDA 1CQXA 2PLWA 1OX5A 3TQCA 2IUTA 2D6FA 2ZAIA 5KYXB 1JG4A 4RZQA 3AESA 2R1VB 1I5OA 2BBTA 1KS9A 1ORDA 1R0SA 1I7DA 2XTAA 3S1AA 1WHSA 2H00A 4HAIA 1HZZA 3T4XA 1BVUA 1Z83A 1ICIA 2E4AA 4DSZA 4ZHQF 2VUSA 2CJWA 1C8VB 3B48A 3KVOA 4FSHA 5BN5B 3SJ7A 3QJYA 1RRFA 3DFMA 4G5YA 4YGYA 2O14A 3JATA 1L5FA 5DIFA 1R0YA 2QPAA 3IB3A 4RVFA 2JAUA 1UZAA 2YOGA 1JXMA 4DCOA 2QPOA 3T7RA 1LD3A 3ZV7A 3L0ZA 2DMRA 3C6KA 3THRA 4ABYA 3HP7A 3UJ3X 4YJ2F 3WKDA 2M6SA 1Z9BA 2GCOB 4C4SA 4LZWA 1JVNA 1E2KA 2C57A 4H7EA 2F64A 5FL3A 2FG7C 1L5LA 3U56A 1E7SA 3ASUA 3VUEA 1ISJA 2AOTA 3GVCA 1MVLA 1JSCA 2FU5C 2GEBA 2RH8A 2FUCA 2OCGA 3GMDA 3N5CA 1TQDA 3FVRA 3W3AA 2WJVA 1G4AE 3AIMA 3GP3A 3IAHA 1WMFA 1VMIA 1VBNA 4KGDA 4P4LA 2BZ0A 3EIOA 4UUMA 3EC7A 5BN1A 1RM5A 4WNAB 1LJUA 1N5DA 5JYEA 3NHSA 1DL5A 1QGAA 5CFMA 2C5LA 2V59A 1Z5UA 3KKMA 1T8PA 4U2DA 1Q0ZA 2C54A 2FK7A 2YVUA 1L9XA 2ZBPA 3I83A 4KBFA 4PZDA 2WY2D 3VZQA 5LQJA 1P29A 1TVEA 5EMNA 4FK8A 4B7UA 2OFFA 6LDHA 3TLGA 5JD4A 5IS2A 1KI2A 1JDNA 4QELA 1OPRA 4YCCA 5KQPA 3QKUA 3F3YA 1QBGA 3BIJA 1C50A 5ALTA 4WZAE 1YDWA 3QG5A 2C9CA 2RC5A 3O93A 4YHHB 4IMRA 2O5EA 4TXHA 3RC3A 4E1AA 3R4CA 2A78A 2ZYWX 3ZHRA 2E4XA 2CLLB 5JE8A 2ZAGA 2J0UB 1JEDA 4QPCA 1DWUA 3D9QX 2B6HA 5JALA 5KTYA 1USGA 1SC4A 2A3NA 4NCJA 4PPFA 2C4HA 3Q0EA 5PGMA 2FY8A 4CG2A 2JASA 4JVSB 5BMVB 1K66A 1ZWLA 4OI4A 4CEIA 2AB0A 3IAAA 4QECA 5CVDA 3E8XA 3SNHA 4K3VA 4RFSB 1ZS9A 3O1LA 1P1RA 3UT0A 2QT1A 3W4IA 3CPEA 2OLEA 2QN3A 2ZJ4A 1N7JA 2H1RA 4KFSA 2M9MA 5BN3A 1TMYA 4OHXA 4DQLA 2IH2A 1RVV1 2GJ9A 2BGTA 5ENVA 3DDHA 1T0IA 3IUBA 3PQFA 3OZGA 2O1SA 2ZKIA 3NHLA 5A5FA 5AKYA 4KZKA 4WBSA 4TT3D 3AU9A 4OHPA 5BWLA 2JANA 1GTJ1 2PO5A 5CD1A 2H18A 3MJTA 3RT1A 1V8FA 1WMAA 4NKRA 1YO6A 4OHUA 3VYTB 5GV7A 4OB7A 3I9V6 3R5JA 1N5RA 4RD6A 4O3MA 1U4SA 3IOBA 4HLUA 4LN1A 4G3XA 3PQ4A 1PR2A 4XYMA 1XAHA 1DO8A 2P75A 4W8GA 3UCXA 4DC0A 4YTEA 1TEHA 2O1XA 1BNCA 1T4BA 2WMOB 5BV8A 1HDGO 1BH2A 3QYJA 3DCIA 3HJBA 3IOCA 5IAGA 5A1TA 4BVFA 4HXGA 4C2UA 1EVIA 1UBEA 1WKBA 2IE8A 3FSEA 3FZEA 1EFCA 4KXLA 1P5HA 4I55A 1U2QA 4RHYA 3WMGA 3ZNQA 3ZU4A 3EGEA 4J0FA 2QW1A 1U0TA 5AM0A 2CXTA 4AXBA 4BQIA 4PRLA 2C88A 2FZCA 1A71A 3HN7A 5LB4A 2PX3A 4TROA 4C22A 2POCA 3F46A 4JYAB 1XCLA 2ZJ1A 2X5KO 4HNUA 5TE9A 3ENWA 2QLTA 3UQZA 4DLAA 4DABA 1TK2A 5DRYA 2BFBA 4DQVA 2LDBA 2QVXX 3RVSA 3UZUA 4MQUA 4EIWA 1KKLA 4IKEA 5DLQC 2YFHA 4DCUA 3C1TA 2Z30A 4HL6A 4MS1B 1ZWKA 2WABA 3O9VA 3E4DA 2YX1A 3D64A 4H1UA 4UAGA 4DC1A 4P4TA 7GPBA 2A4KA 3OZEA 4OHBA 4XEUA 3F3SA 1PUIA 5GZ1A 4CTKA 2P2NA 3AYXB 1CQJA 5E4TA 4JJGA 4FGKA 2WAAA 1E6KA 1WETA 3RQSA 5AFSA 2H1WA 4NYJR 1A9PA 1RWVA 3TX6A 2Q45A 2JLVA 1CZRA 1MBZA 4ZI7B 1Q0SA 3H4MA 2Y0EA 1Z88A 4YRJA 2P4EA 3AY3A 3L7KA 4ZYYA 2VKTA 2HHAA 1CJMA 1DIOB 4PHHA 3TIFA 2ZWIA 3UAZA 1GN8A 5ILQA 4ZICA 3KBOA 2FE4A 4YV7A 5G1OA 3IA7A 4D46A 2M98A 4M3NA 1DU4A 5IX8A 1E1MA 2ZPAA 1ZMRA 3EXHC 4AN0A 2JRCA 4YQYA 3Q9LA 1Z4PX 2YICA 3PK0A 4FYMA 3EFHA 1V11B 4QNRA 3THYB 3KSDO 4YRMA 1APBA 1COWD 2RGCA 4ZQCB 1D9XA 1NATA 3ABZA 3BMCB 5EXSA 3T41A 2IIBA 2DBQA 1IN1A 1F9EA 1Z2PX 3TIGA 5ESDA 1ZNXA 2H48A 4EB8A 4EGJA 3UJPA 5HYVA 4Q12A 4RKWA 3G7SA 4WZ6A 5JDCC 1KO4A 1M6WA 5JS1A 1C4WA 3O2QB 4LBWA 3W2IA 4IW3B 3OPMA 3UK1A 4JVNA 4XD2A 4S35A 2D1YA 4C4TA 2QRGA 3K6RA 2WKQA 4LVCA 4TZ6A 3U3ZA 4LXTA 2QENA 1UP7A 3M1YA 5T8KC 2HJHA 1DAKA 2VYQA 3DHYA 3N39C 5P21A 5FLYA 3U31A 3AY0A 3VI4B 1OYVA 1VE1A 2PFGA 4C0AC 1E2NA 1RWMA 3AR7A 4GBJA 5B58T 3WVNA 3AUAA 4LPKA 3FUVA 1RRVA 2QP3A 4XYLA 4LJYA 1U1DA 1E4EA 3G49A 5EE0A 2BHRA 3EN0A 4AXXA 1YT5A 2YXEA 3AB7A 4JJ7A 1NP3A 4YRTA 3TDNA 4CL8A 4LGVA 2VJKA 3IAS1 5KHLB 5TRTA 1P6QA 2O2YA 5H4HA 4NNJA 4JIGA 3IVCA 4NCKA 1P1JA 3SDSA 3IIIA 4CTMA 2JI6A 2XZTA 2YV1A 3ZLTA 2A9QA 1O94A 4W9RA 2AXNA 3ZUGA 3HTXA 1KMIY 1B8UA 4QXRA 1N2BA 2X9NA 4F3CA 4HN9A 1CUIA 4FYPA 1AZWA 1LI7A 2QN8A 4K2AA 2XUAA 1NR1A 4LHZA 4YMSA 4XJXA 4K6CA 4RMHA 3A6PC 4YMLA 2IHTA 1Q22A 1C7JA 3A4IA 4RY8A 2O19A 4IDFA 4IINA 1LV7A 1NJ6A 4G67A 4IEIA 5CT8A 1UQTA 3V4FA 2EF0A 1GSIA 3U80A 4FB4A 5CYPA 3SVZA 3JQAA 2C59A 5JHHB 2P4UA 3TNJA 2GK7A 2GJ4A 4QOSA 5JCOC 4G5XA 4K9DA 4M6WB 4QOJA 1IOVA 1EPUA 2VQ3A 4HXEB 1R5NA 4DR6B 2Z2ZA 3A9TA 2IX3A 1G21A 3M49A 1P0MA 4TV8B 1Y3DE 4WW0A 3O84A 1N9GA 4G4GA 1YVDA 5HKLA 3VHXB 1GQRA 1RS0A 3KDPA 3MJRA 3DEKA 3Q12A 4P7JA 5LNK6 2JZNA 3F0TA 4DR4B 1JVSA 2D54A 4BFCA 3KOYA 1KP3A 1MC4A 4YT5A 4DVGA 3D7MA 1CPYA 2XUZA 4YJ2A 2Q1UA 4M9ZA 1P6UA 3E3AA 3FA2A 1W4LA 4RZUA 1I7NA 1EUZA 2GVZC 3OWOA 5GY7A 3R7BA 4DE5A 1XF9A 4ZQEA 4HQ0A 2C9OA 1L7NA 3DLIA 5COQA 3TPZA 1WZNA 2GM5A 3HU5A 3S8MA 3H16A 5HK9A 5K09A 3CV3A 3MK31 2HNKA 2JI9A 2BEVB 3DV0B 2O8BB 4AMGA 1KZYC 3C41J 4CKEB 4S24A 3SZLA 2AN1A 4DS3A 4E5VA 1QTQA 1NZJA 3OWXA 4K87A 2VJMA 1XZEA 5BSEA 4PAWA 4RF5A 1W0JA 1WL8A 2A57A 5DBGA 1X2BA 3DUFA 3DB1A 1G6HA 3ZCPA 4RXUA 1C0EA 1Y1RA 1AQUA 3AERB 3TSAA 4B46A 3GLIA 1ZW1A 3AUTA 1ILWA 1H4SA 5DH9A 5CK4A 4X97A 5JOQA 3LXMA 1PCXA 1N3YA 3TQIA 1M0WA 4TXJA 1KPIA 4NZPA 2H6EA 1QHGA 3VTZA 1J70A 2C2XA 4MW6A 4QFDA 4BO1A 2FW1A 2WYOA 4E5SA 4HY3A 3EZLA 4IJ6A 3DWEX 4LJAA 2VJBA 2WFZA 4IS3A 3I09A 2EBWA 3T3PB 1E69A 3SM9A 1Z2EA 2JGRA 4NF2A 4KB5A 4A8HA 3LWNA 4DGSA 2AI3A 1HYGA 3T9AA 1O95C 3QFHA 5IDVA 2CXXA 2XXAB 3AUYA 3VR5D 2F3SA 2PKCA 1QHHB 1Y6RA 3SF8B 5IM4A 5A4IS 4B6OA 1MG5A 4DTIA 1T9HA 3BL8A 3EXEB 3O4VA 6NULA 1G7TA 1CHDA 1LQUA 4RJ2A 3I5UA 3H7AA 4NZOA 2Y1CA 3H5VA 4IDHA 2ZBDA 1I94B 1P33A 2HF8A 4ZMRA 5F4ZA 3CVWA 5A4FS 3U7QB 3LDGA 2WSLA 1Q3KA 1A4IA 2CHFA 2OOKA 1EP1B 3TTVA 3B1YA 2CNWA 3Q3HA 2FW7A 3ZQKA 1S2DA 2IYUA 1Y4UA 2O9JA 2R86A 2IUUA 1QPZA 3GLHE 4NZZA 5KTNA 1Z7YA 1BDJA 2QQ5A 5IC6A 2E85A 1JFTA 4URVR 4UM9D 1YR6A 3BUSA 3T3IA 5F52A 3IILA 1TM3E 2I66A 1MQAA 1X7HA 3GARA 4HDMB 4DL9A 4DWJA 4M86A 4BE4A 2P0EA 4CGYA 3F8WA 3BICA 2X6TA 1Y5IA 2C5AA 3DE0X 2W58A 3BFVA 4I4IA 3RC9A 2DR3A 4QVGA 2IPAB 4Q7QA 1TJYA 3I3SR 1P9OA 2C03A 4LRQA 2DPHA 3OJ0A 4P92A 3ROFA 1PQWA 1IBCA 3H05A 5D3MA 3FLBA 1VCHA 3LQ4A 4D9EA 1JE1A 1OBVA 2C4WA 4JJFA 4YMGA 2D13A 4LHWA 5CDYA 1I0LA 4UD2A 4JROA 1NFQA 2GCNA 4R5MA 4G0UA 2BR3A 3R7WB 1X74A 5ALQA 1G5HA 4QUHA 5TPZA 4YFVA 1PS9A 1SHUX 3ELUA 3NHJA 4WTOA 2YWHA 3FN4A 1E0AA 2J9GA 1GQQA 1V6SA 3P45A 2BJHA 3FCSB 3PHGA 1C81A 2Q3MA 2WAMA 2C2GA 1KKMA 4PGGA 3D6MA 3EVTA 2Z1MA 3OO1A 5BQOA 3NUQA 4DNPA 2QVYX 1O96B 3TR5A 5LQUA 3IULA 3IIJA 1QWOA 1ZIXA 1S0UA 3LKVA 4ARBA 2HUNA 4ZIRB 3TG2A 4Y2GA 1G8YA 3LK6A 4FQ7A 4QJBA 5TGDA 1TJ3A 3RLIA 2XB4A 1YDFA 4G5SA 1W96A 1FTGA 2G88A 2EBUA 2I8AA 2UVPA 2ZWOA 3BAZA 4ZU3A 3TEMA 3ZGXA 5DWQA 2Y1GA 3HB0A 3Q3EA 3NFYA 4HD8A 4LYAA 3BWBA 4R8RA 5DOVA 1Z6GA 3RVKA 2FDCA 2X86A 2RHTA 1U3DA 1ZXLA 2BZGA 5CVVA 4BQQA 1SULA 2D1SA 3AFOA 3G1WA 4RMGA 4UFOA 1E89A 3BWEA 2O8EB 2KJQA 4UVDA 1I6KA 2BCJQ 1CRPA 3A1TA 3DPIA 3LYHA 3SVLA 3FTQA 4ZVTA 4EENA 1NWCA 1C41A 1FX0B 1PG2A 1W8IA 2FZ5A 1XYVA 2P3SA 4HBZA 2C00A 3H2ZA 1BS1A 3ASZA 3IV6A 4FB5A 4KCGA 1R27A 4M1QA 4RPJA 4Z9FA 3RT9A 3G2JA 1GGHA 2HWUA 3RYHB 3ZVNA 2D0OB 4YAFA 1L5SA 1RP1A 4RVUA 4DIKA 1REQA 2O23A 3BE6A 3HR4A 4Q3BA 1DNPA 2EDCA 4UVHA 4X92A 4Z4GA 1P2VA 1TO1E 1OLUB 3TK1A 4DLTA 4E5NA 1OB5A 3ST7A 4MHOA 3QLTA 2PZAA 3DFKA 4GSYA 2VT3A 3O83A 2FSSA 3L7IA 4LXQA 4M22A 5HF5A 1D2EA 1UMCA 5D6OA 4DDWA 5BT9A 4C05A 4WKGA 2V97A 1N0VC 1TVKB 4KXFB 1UKAA 2IV3A 3V2UA 3WGLA 4QQKA 4E14A 2ADFA 3L4SO 4EF5A 1TLFA 4ND2A 3VYUB 2R66A 1B00A 2V7PA 2QL9A 3QEBZ 3MT8A 4L22A 1XTVA 4QUKA 1NHWA 3P9IA 3PUZA 4X8OA 3W5AA 1PDOA 3VDQA 5EHXA 2ZSUA 3A9CA 3DEFA 2QRZA 2NU8A 1J5XA 4DM3A 1BWRA 1A4XA 1PGNA 1AUOA 1C0LA 1VLMA 3QQPA 4CL0A 1L5GB 1SK9A 1FU4A 4JVOA 5AXCA 4DJ5X 2BFFB 1C7FA 2PWZA 3OY2A 2IA5A 5TB5A 3TOZA 3THXA 1HDCA 1HFKA 1KI8A 2QS9A 3F4LA 4W5HA 2JFPA 2PX8A 1V35A 3IUJA 1FMLA 4GF5A 2PGIA 3V2GA 4KE7A 5GOZA 1Z5OA 2PGLA 1BX0A 1GZUA 1NJ5A 2OG1A 1GR1A 1ULBA 1XJCA 1JAHA 4ZK6A 1GL7A 4FJ0A 3F78A 4LDRA 1PK9A 1R0BA 1SKQA 3R2JA 4BXOB 3D6TB 2HSGA 1ECPA 1HDOA 1KF0A 4EI2A 4EFLA 2W48A 2VPPA 4W5WA 3GY0A 2BGLA 2VDVE 3EY4A 3GFRA 3NAQA 1H8HA 1JTVA 1VYTA 3FCAA 3PRKE 4F6LA 2A0XA 4JP1A 3R0ZA 5JY6A 3AJEA 1NXSA 2OKCA 1ZU4A 2ZK7A 2G1AA 3A6HA 4TWJA 3V6LA 1DTWA 4EG8A 2JIPA 4ZD6A 1DIRA 1IPEA 3FNEA 2ZE7A 3C5HA 3IR7A 4XX1A 5KQMA 2H8GA 2BONA 4L76A 4R2HA 2JS7A 3GRFA 4OB8A 1KMNA 3PKZA 3CUYA 2AFIE 1H0KA 1DQRA 3K0AB 3FNBA 4EYSA 5DJ5A 1L5VA 3RVPA 2D4HA 2OO7A 3RAPR 3MRTA 3AI7A 4RKYA 2M1XA 1XA3A 3CE6A 4LK2A 3L7DA 2ZPTX 1N92A 3NJ8A 4URFA 4D8VA 4WDRA 1DJPA 3A36A 7REQB 4B3RB 2C0CA 3ISJA 2H7XA 4WCFB 2RGWA 4JODA 1ULHA 2DG2A 4TTPA 3D8SA 4N12A 3UXHA 4BVAA 1LS6A 2PKWA 2XUJA 3KQQA 2WJHA 2G5CA 3ILVA 2EWWA 1QANA 2QTGA 3BXXA 3AWIA 5ALDA 2ZI5A 4B6FA 4V1CI 2W8BB 1HT2E 1IHPA 2P9ZA 3G7NA 1AO0A 2E37A 2Y8EA 4HX5A 4QUEA 4RY9A 4LKOA 3J7AC 2CNDA 4PLCA 1GYPA 1OYOA 2JGDB 4HLNA 2RARA 4CUJA 3ZWXA 1DAIA 2ZYIA 2TMGA 2ZUUA 3L8DA 3MPUA 4J4HA 4ON9A 4UE2A 4CKWB 1N2CA 1Q95A 1R15A 4DR5B 2A5JA 1IOWA 3PV0A 1WPXA 3FPLA 3VO9A 1JKMA 5J4HA 1JZTA 3A4YA 5HIJA 5A6SB 1OIXA 4YWHA 2MSNA 5YASA 4YQFA 1QF6A 3M8KA 3SLGA 1PT6A 2H9IA 2MYTA 3BXGA 1VJGA 1XROA 3EPPA 1Y81A 5JAQA 2P9QA 5K3EA 3RW9A 1AZSC 1RZUA 5AW7A 5AVUA 1AXRA 3RI3A 3D2BA 2R1UA 3PKIA 1E7MA 1KI7A 2TSYB 4X93A 4ICIA 2MHCA 3VC7A 5KNCA 3K9CA 2PJRA 1KDTA 3X44A 2QXYA 3QBTA 5DTEA 3KFVA 1ZM3A 4L8GA 1L4FA 3CNLA 4IDOA 5G0TA 3ZJ5A 4EG6A 5K0CA 1PT7A 1N6NA 2O2EA 4BDTA 1JVBA 1NMYA 4NAHA 3TCNA 3GGDA 1BGXT 2D1FA 3JQ7A 4KSCA 3UHOA 4YX9A 4X63A 3RABA 1FVFA 3EOZA 3OURA 3P32A 1JG1A 5C1DA 4LTMA 4DR3B 4L5JA 4RLHA 3FZGA 2BI4A 3EMBA 5K0JA 4EUFA 1N78A 1T6ZA 3BMQA 1NRIA 2PAAA 3CX8A 3L6BA 3I04M 3KYJB 2C7PA 3AGQA 3O8NA 1PFUA 4PYRA 4NBNA 4YPOA 3U3XA 5ADHA 1ZOSA 2IP4A 5LZ4A 1SURA 4MA5A 4TYQA 5KEIA 3CLRC 5LP6F 5IT4A 3NXSA 3E9RA 1MA0A 4DNOA 4PSUA 2L17A 4CQNA 4F8JA 1X15A 3DYVA 2I87A 1UEIA 4TMZA 1AVTA 3H0CA 5HFJA 3WRXC 2EARA 3NJRA 2PRYA 2W90A 2GARA 1SCBA 5ICFA 4W8OA 2V9ZA 4U6NA 3RRFA 1O6FA 4B71A 1CB0A 5I5EA 4ZCMA 1CIVA 1P72A 1LW6E 1N7GA 2YH2A 5DU2A 4IXMA 3NU1A 4PAMA 1HL3A 4E2XA 4IJMA 4LVNA 2P4HX 4ZOEA 3MTEA 2Z3VA 2PIDA 1ZMTA 1SA0B 1D9ZA 4RVDA 4U7TB 5FUWA 1H9AA 3N8DA 1OYWA 1RNLA 2A1TS 2YV3A 4KACA 4EGAA 2CMDA 3ZJUA 3JYPA 4S1VA 3RWOA 4IHJF 1H2HA 1VHJA 3PWZA 4JK3A 3IB6A 2E4WA 2HA3A 2J4DA 2OD9A 3F49S 3MTAA 4LCJA 3V97A 4M76B 4WBNA 4DJDC 5IPFA 1EFDN 2GERA 4ERXA 1P61B 4BTEA 4PZYA 3ZD9A 2I91A 4FFOA 3G85A 4OK3A 5K6AC 4K9RA 4II3A 5CB6A 5F64A 2R96A 3FUWA 1TDJA 4QULA 4OAPA 3QY0A 5BNTA 4R2XA 2FN3A 3RRNA 3H9CA 5F7JA 1G16A 1ZYUA 3MQ2A 2JBHA 3JXEA 3SYTA 4HQRA 3OG9A 1TRHA 1Y1SA 4HGQA 3ZZ1A 1Z0FA 4GHWA 5EPUA 3SMVA 2EG9A 4HSGA 2I1WA 3MBOA 4LNUA 4PS1A 2FJUA 5CA0F 5L7YA 2OZEA 3MEQA 5ITZA 5AM4A 3GPLA 4EX7A 3CRVA 4GYYA 4KN6A 3ZUPA 2CJYA 1SBNE 4WN9B 3HEAA 3K9WA 6ABPA 3H75A 4WESB 1FQJA 3WWCA 5M04A 1DS6A 3BE4A 1H8ED 4PGMA 4C01A 3A3PA 4ER0A 2M6RA 1RI5A 2OFOA 5ULLA 1X13A 3DT6A 3ED5A 2BMDA 4JT9A 1VL1A 2XE4A 2ZTHA 3VC2A 3LFUA 4ROSA 5JRDS 1W85A 3KEQA 2IP1A 2QTVB 1UXKA 2R60A 4V0OA 3R6WA 16PKA 5H3LA 2GCIA 5HQ3A 1ZSNA 1AE1A 5A4AA 3ZQJA 1RKQA 5JWHA 3AO0B 4ZAVA 4GPTA 1XDGA 5BO5A 2JCGA 3LZCA 2C5HA 2B2NA 5B37A 4OBWA 4CMCA 4DG8A 1TCBA 4EAQA 4OXXA 4ARCA 5K0NA 5CG2A 3BQMB 1GL6A 3WWOA 1NJGA 2QUJA 4R1TA 4R9RA 4J0QA 1F6DA 1VFPA 1I9GA 2ODTX 2HHJA 3KOWA 5GP1A 1JQBA 5ILGA 5G0SA 3CTMA 4PG4A 3E48A 2AV6A 3DOJA 3D1LA 4K9QA 4UTXA 5CDFA 4DKXA 3EZFA 3OEEA 5ICEA 4O4HA 3QVOA 1AKYA 1QCYA 1E2FA 2GUGA 4BLVA 4EK9A 3PUHA 3RS9A 3S5JA 3AEXA 4JP5A 3WICA 4JP8A 2ODNA 4RDXA 2XV1A 3BXHA 1K6JA 3AHCA 4MLZA 1VKNA 1AQYA 2R00A 5BVGA 4PPGA 1TAHA 1LI5A 2HLDD 2Q2QA 3G2MA 1D3AA 3QNMA 5A9SB 7MDHA 2IBTA 1CJUC 4X3PA 4U39A 1KOFA 1E3JA 2REQA 5K0GA 5J5AA 1EFVB 1UL1X 5BQPA 2WWGA 3HYSA 1ZH0A 1NJ8A 3DC2A 4RMIA 4S0ZA 1FDUA 1ZA1A 1ZM4A 3BK1A 1GG8A 2DPMA 1IM8A 5KYWA 1SQ6A 1P39A 3CWCA 3K7EA 4LOHA 3OD5A 1NQUA 4K6OA 1EUDB 4BFVA 1YR2A 3EMKA 1YS6A 4MUGA 2EZ4A 1G8SA 3EE6A 2XKAA 4LECA 4LRWA 4P5PA 3V4PB 3UG6A 3QOFA 1V71A 5IBRA 1CUZA 1JAXA 1Q2UA 2VDWB 4GH5A 4L2IA 4MWBA 1BGWA 3MXOA 2RHHA 2Y27A 2R1TB 3IVAA 4NY1A 4V0QA 1M1XB 2FEOA 3A1DA 3CZRA 3DAGA 4LE2A 2AWOA 4D79A 1CJKC 3W5JA 1NP7A 3H5OA 2FHSA 1NBME 1XD9A 3EEYA 1YNOA 5TY0A 1ECGA 2VF5X 5JJBA 3B85A 2GXSA 3IT0A 3GZTB 4AMZA 1WZUA 5F2NA 4V0LA 1MT0A 1EFKA 3O03A 4KGXA 1B6SA 1Z34A 4YMVA 4AURA 3T4UA 1ITZA 5C8YF 2J45A 4KEAA 3MRVA 4XOIA 3R1IA 1Z0JA 3L6EA 3GBPA 5DCUA 4PNPA 2Z08A 2QT0A 1R0XA 1E2IA 1IAVA 1QBKC 3VYVA 3RSGA 3K32A 4O4LF 3ID6C 4DXDA 5C7YA 2VBIA 1PJZA 3JWJA 3FTNA 1CG6A 1KEUA 1OA1A 1P81A 1SUBA 5F1YA 4ZOQI