1L4AA

X-ray structure of the neuronal complexin/snare complex from the squid loligo pealei
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
b'QPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPTOBREVIN
publication title X-ray structure of a neuronal complexin-SNARE complex from squid.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2002-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l4aA00
1SFCD 1T3JA 2NPSB 4OH8B 3RK2C 2M8RA 3HTKB 3B5NA 1JTHA 1XTGB 3PP5A 1SFCB 5CCGD 3HD7C 2XDJA 3RL0D 2YMYA 5KJ7A 1L4AC 1URQB 3M0DC 1GL2C 3B5NC 2NPSD 5CCGA 1N7SB 3RL0B 5CCHD 2N1TC 2WZ7A 4N78E 3RK2D 1KILD 2NPSA 1URQD 3HD7D 3RK2B 1KILB 4WY4C 1SFCA 2HG5D 1N7SD 1HVVA 1GL2D 3HD7B 2HFED 1URQA 1N7SA 1GL2B 1SFCC 4W80A 2N1TB 5KJ7C 5CCHA 4W7ZA 2PP6A 5CCGC 4WY4D 3RL0C 1KILA 2H8PD 3RK3C 1L4AD 4WY4B 2NPSC 3B5ND 3HD7A 4W7YA 5CCHC 2N1TD 2KOGA 1L4AB 1L4AA 1KILC 3KYQA 3B5NB 1GL2A 5KJ7D 1JTHB 2N1TA 4LGDE 1URQC 3VOPA 1N7SC 3P8CE 3RK3D 3TSIA 1NHLA 4JF7A 4WY4A 3RK3B
chains in the Genus database with same CATH superfamily
4B86A 1SQXD 2J5UA 1OWAA 4PJ0H 1FZCA 2W6JH 1U7MA 3FGAD 2QJKC 4GKGA 3HD7C 1S3JA 2ZXXA 1SS1A 2OQQA 1URQB 1KB9I 2W6AA 1QL2A 1N7SB 1AA0A 3RL0B 2E74B 1Q86Q 1DIPA 2OYIC 2IDBA 4Y99B 2NPSA 1SQQD 3CX5E 3L73D 1BSNA 1MUUA 1X0TA 4I7ZC 1FAVA 4L75A 1L0LK 4Z1MH 4WB4A 2KSEA 1JCCA 1SQVE 3AECC 4JYCA 1J1DB 1MZ9A 2KB7P 2QM8A 4ZMDA 4HH2A 1KILA 1GK4A 2WSFJ 1Z56A 2K9JA 3EWKA 3G3ZA 3H1HE 1W5CE 1LTJC 1M1JB 3G4SP 1T3UA 3G71P 1CW5A 1DX7A 4C46A 2WSCJ 1RE3A 4C7NA 3GF3A 5APTA 3WUVA 1G2CA 1GU4A 3HE4A 2FYUJ 2BCCG 2KZJA 2YKOA 4D6TJ 2Y9YA 2KLVA 3BRVB 1SFCB 2ZT9D 3H32A 1ZRTD 3MTUE 4U3FG 3V5BA 1HWTC 1LT9B 3A5TA 1MV8A 2JJLA 2A45H 1JY3N 3LW5J 4PJ0E 2HPCA 3M9QA 1DD4A 3AE2C 2BCCD 2FFDA 2V4HA 1VL2A 5APUA 2O01J 3L35A 3HD7B 2C0WA 2V7QJ 1KFMA 4H44D 1IFNA 4DCKA 3G9RA 1EZVG 3L71E 4U3FD 1S9KE 5APYA 1NU1J 3GG2A 1IC2A 5KLIB 3UIAA 2IZ0A 4AUWA 1IFMA 2OYIB 3LIDA 4WY4D 1RF0A 4WBAA 2KUBA 1FOSF 2C9NY 2IBZI 1Q90D 5KAIE 4I7ZB 2YKPA 2K3RA 3H1IG 4RO0A 3V4QA 1EZVD 2CPSA 1RE4A 1ZW0A 4IL6H 1NKNA 1IJDB 1FOSE 3P8CE 3RK3D 1NTKK 1E79H 2BEZF 2OYHC 3MZWB 1WRGA 1KQLA 2DW3A 2N9YB 1T8ZA 2YXRB 3ABVC 4AYCA 3CCUP 5DJTB 1KILE 1KYOH 3MUDA 1LTJB 3H1ID 2KSJA 3H1JG 3E7KA 2WSFH 3OA7A 2R3SA 2WSSH 3CC2P 2WT7B 3R2PA 1S1CX 4K35A 1YITP 4IL6X 1QX8A 3VMZA 1DH3A 2WSCH 2QRXA 1S2EA 3JC22 2YNYA 3H1KJ 3N4XA 4GDOA 3AE8C 1BDCA 3H1JD 3Q5SA 1NYHA 2LKMA 1D7MA 4HB1A 3CCEP 3L70E 2ZT9C 3BATA 2NRGA 3CCMP 2KI7B 3RBXA 2LXCB 5CMZA 3L72G 3CC4P 1VQLP 1NTKG 3S9OA 4N3YB 3EQ2A 2N1TA 1NKZB 1RQUA 3BRTB 2V7QH 4C7NB 3TSIA 2W83C 3QWOC 4H44C 1G2CB 1GTWA 1YJNP 3CXHD 1LT1A 3V2RA 5M1BA 3O8ZA 1BGYJ 1KD1Q 3TYYA 3G6EP 1NTZE 3A3YB 3L72D 1J2JB 1OVVA 1NTKD 1UIXA 5APWA 2OARA 4GIFA 1MKMA 1TU3F 2ZYAA 2QM7A 1Q82Q 2OYHB 1EZVI 2KNCB 3NXSA 1R5SA 2Q3IA 2WTYA 3U1AA 2AXTH 4K3AA 3H1LJ 1KYOE 2Q7CA 3WU2H 1FJPA 1GL2D 1GMJA 3C9IA 1URQA 4TLFA 1Y9BA 2PFXA 1N7SA 3VTPC 3CX5D 1R5LA 5C39A 1P84I 1RQVA 3W68A 4U7JA 3CCRP 1BCCE 3LIEA 5CCHA 2Y0EA 3CI9A 2W90A 3H1HG 2GUSA 2YMKA 1GD2E 3TDKA 1LP1B 1NH4A 4GOFA 1YTZI 2Y9ZA 5B66H 2KOGA 2FYUE 1L4AA 2RH0A 3A0BH 2P7JA 5AW4B 1T6AA 2D2CB 3AE6C 3GLMA 2GA1A 4BRYB 1AVYA 2NZ2A 1FU1A 3H1HD 3WUUA 1KMIZ 1U57A 1FDOA 2K1AA 1PFIA 1VQKP 1SP4A 2RN0A 1M1JA 1ZMEC 2AXCA 1JY2N 1K05A 1PGQA 2IPPA 2WWWA 1IK7A 2W6BA 2AEMA 3BCCE 1NU1E 2XKMA 2M5AB 1J1EB 2Y0DA 1PP9J 4L73A 1AQTA 2HODB 5AW7B 2P2UA 2Z5IA 3E1IA 2L5GB 1SFCA 1G1JA 5GTIH 3PTZA 1OVRA 1LT9A 2H43A 1YBKA 5KJ7C 2AXTE 3F89A 4O9BA 3WUTA 1EC5A 2IFNA 5E79H 1N7LA 3WU2E 5AVYB 1S9KD 1YJWP 3A0HH 4ASWA 3HD7A 2M0BA 1PGPA 1SQBK 4OGQC 1GU5A 2CK3H 1LTBC 1HUCA 1L0NE 1QVFO 3E1RA 1OX3A 1E5WA 1PPJE 4BXLA 2IYOA 2R3CA 2OYIA 4EDFA 2RKLA 1SQXJ 3D6YA 1JB0J 3SFEC 2VRSA 3FX0A 1KC8Q 5B66E 2Q5UA 3VP8A 1KB9H 1NTZK 3A0BE 3P8CD 4JPZB 1AFOA 2IX7C 1SQQJ 2W8ZA 3L73J 1QLED 2OYOA 5KKZC 1YI2P 3L74G 1EXIA 1KILD 4KT0J 1VQ9P 1CI6B 2B87B 2QE7H 3VMAA 4WWIA 1JNMA 3CWBE 1LTJA 1RF1C 1GW4A 3VMXA 2WT7A 2AEJA 1GK6A 1M90Q 1FDMA 1A02F 1LTSC 2ZYDA 3L74D 1Q7YQ 1SQBG 2HLOA 2WPVB 3FXEA 3AEBC 1Q2NA 1VF5D 2IZ1A 1L4AB 5TISH 4JYBA 4PV1D 1YQ4C 5CBNA 3B5NB 1FZFA 2FYNC 4LGDE 5KLVE 2B89A 4PD4I 1NTZG 5E79E 3AE7C 5GTHH 1K9MQ 3A0HE 1IFIA 1SQBD 2PAJA 1LTTC 2WQYC 1OXZA 4RKUJ 1ZP0C 4H13D 3RK2C 5K5GB 1M57D 1JMBA 2E76D 1IFJA 3HTKA 2YO3A 4GT1A 3CMAP 4OGQB 2N9BA 1SQPK 1IFDA 1NTZD 2BCCJ 3CC7P 1X8YA 3L75E 1KB9E 3PLNA 4U3FJ 4C7RA 2OTJP 1KQGB 1M8OB 1BCCG 1HVVA 3AE5C 1MFTA 1RY3A 1OIPA 1UIIA 1N73C 1EQ7A 1L0LJ 5DJUB 1HGZA 3V2NA 3O6QB 3ITKA 2OYHA 1YIJP 2KNCA 1KTMA 1KFNA 2QJPC 3T97B 2L91A 5AVVB 4YXWH 1OMIA 3M9BA 2QJKB 3IF4A 1RF1B 1BCCD 1KILC 2P67A 3GF7A 1L0NK 5AVUB 4MN4C 3M0AA 1BE3G 2BEQD 4ZNCA 2OTLP 3BASA 2K88A 1LP1A 3H1IJ 1PP9E 5TISE 1SQPG 1EDIA 4OH8B 3BCCG 1Y47A 3GW6A 3D70A 1QGKB 1HTLC 4OWFA 3HRNA 2KZIA 2POHA 3AEDC 2G3AA 2FYNB 2YMYA 4DJGA 3KZIH 1XTCC 4BRYA 3U1CA 5GTHE 1BE3D 2WZ7A 1VF5C 4PV1C 3V2PA 3H1JJ 2JDIH 3F5HA 3RK2B 1PV3A 1SQPD 4AQRD 1AV1A 2QG4A 3BCCD 2ZFCA 3HUSC 3NTNA 1WT6A 4N6JA 1KV4A 2E75D 4H13C 2FFDC 1LWUC 2M5AA 2E76C 2ITAA 2HODA 1SQXE 1PGJA 5AW6B 3I55P 1VPCA 1L0NG 1NOHA 1PPJG 2R5DA 4W7YA 3MD0A 1FZGA 4L76A 1SQVK 1N73B 5AVSB 1RF0C 2E5TA 2IBZE 1HBWA 3B71A 1L2PA 4TT3H 5KLVK 1SQQE 2QJPB 1VQOP 3L72J 3L73E 3OAKA 2QA4P 1LTIC 1NTKJ 4I6MC 1NTME 2Q6QA 1L0ND 4CPGA 3LW5H 3TGUG 3BVHA 1PPJD 3HTKB 2E42A 1JUNA 3U59A 1X79B 3PP5A 3AEFC 3CCLP 2FBWC 3RL0D 1KZUB 2O01H 1NJIQ 3AEGC 3M0DC 1KORA 3CWBG 5CCHD 1S72P 1RHZB 5CJ4A 3V2QA 4IL6E 3TGUD 3MIWA 4XFJA 4WY4C 1P84H 4WVZA 2LR2A 3KPEA 4NPFX 3VMYA 3RBZA 3CWBD 3D6ZA 5APSA 2P10A 1CI6A 1SQVG 2B87A 2GUVA 5KTBA 4YXDC 1IZNB 3AE3C 4KJMA 3RK3C 5KLVG 1OVUA 3IFMA 1EDJA 2FXOA 3H1HJ 3Q5PA 5CHXA 4H13B 3PJSK 1IFPA 1LWUB 2E76B 3VOPA 2WSEJ 2QJYC 1AVOA 2XNDH 3CL3D 1SQVD 1FS0E 2BCCE 1FZBA 3MGNA 2E75C 4H0LD 1SFCD 5KLVD 4D6TE 3B5NA 1JOCA 2SPZA 3KQGA 1XTGB 5CCGD 3L75G 3Q3DA 4IFMA 3H6PA 1USDA 1X9VA 5KJ7A 4GOEA 5AVWB 1L0LE 2ZT9B 3II6A 4IFFA 2J58A 2WPRA 4DZOA 3CPWO 1YJ9P 4R4MA 2J59M 1WMKA 3HD7D 3SWKA 1EZVE 3GMAA 5KAFH 4XE5B 4NPDA 1G1IA 3L75D 3IAOA 1KB9D 1NAFA 1JO5A 4LC1A 1HJ0A 4H44B 5TJHA 3L71G 1W2EA 3Q2YA 2B9BA 2R44A 5CJ0A 1DEBA 3RL0C 4ASVA 1P84E 3GHGC 3H1IE 3CCVP 1NO4A 4WY4B 3CXHI 4Y99C 5CCHC 2HYNA 2OGUA 5BU8B 3VYIA 3O6QA 2K9YA 3K5BA 3SWFA 3CD6P 1LTGC 1AQ5A 3VN0A 3T97A 1OW6A 1PL5A 2KYVA 3L71D 2JEEA 3CMEP 3N7NA 1NTMK 1GDTA 3RK3B 1RF1A 3B8EB 3H1JE 5H2FH 3H25A 1U7JA 1KQSO 2HR3A 5CBOA 1VQMP 1ZV8A 2XDJA 4HYTB 4HKZH 1GL2C 5APVA 2P1JA 2FYZA 2NPSD 3KXDA 3CX5I 2R32A 4DT0A 1JY2O 2E75B 1VQNP 1ZXGA 2WSEH 3AEAC 2MJZA 3H1KE 2Z5HA 3L74J 3V6IA 2JP3A 1JM0A 2M3BA 4H0LC 1SFCC 4W80A 2WVRA 2ZAEB 2I8DA 3QH9A 3OJAB 3VP9A 5AW8B 4JQ0D 1K04A 3M91A 3PHLA 2A45G 2PP6A 5CCGC 2IBZG 1IO4A 1GZLA 1LT9C 3L72E 1X22A 5KAFE 4XA4A 2PRRA 3L70G 2JWDA 3EFFK 3RGUA 1Q81Q 4PD4H 2OTKE 3HE5B 1KQFB 1EDKA 3L4FA 4EIJA 1NTMG 1SQBJ 1JTHB 1ZR4A 2ZVNB 1T2KD 5AW9B 2W27A 3P32A 4I2LC 5AW5B 2IBZD 5KLIC 5GTIE 3GHGB 1LTAC 5EFWB 2FYUK 1BGYE 1N73A 3L70D 4QMAA 2QEXP 1NTZJ 4RJTA 4ZKUA 5AW2B 5AVQB 1NTMD 2E43A 5AVTB 5KAIH 4N78E 3TNUB 5H2FE 3W67A 1JEKA 2Y0CA 3H1LE 3JSVC 5APXA 3A2AA 1EXJA 3MHVA 5AVRB 5B5EH 2HFED 4EYYQ 1FZCC 4UB6H 1NU1K 1GL2B 1H0TB 1OZHA 1BCCJ 3L37A 1FE6A 2KXPB 3WMM0 1LGHB 3CLQA 2NPSC 1H88A 3M9HA 1FJKA 2D2CD 2XU6A 3IN6A 1KYOD 1FZAA 3AEEC 5KKZB 3D71A 4H0LB 3Q5RA 2FYUG 4UB8H 1OW8A 3S1KA 4D6TG 2A06E 1JY3P 5AVXB 4PD4E 3P8MC 3AE4C 1L0LG 1BE3J 3HUSA 3USSA 2H88C 3IR9A 5APQA 3JCUH 2Q1KA 1FZEA 1LWUA 1VQPP 4LLHA 4YTPC 2FYUD 1SQPJ 4D6TD 2Q3EA 2PGDA 3BCCJ 2FXPA 1CSBA 3PH0A 1RE3C 2O1JA 1NU1G 1T2KC 4JBZA 2ZYGA 1L0LD 2JR8A 3A7OA 2A45I 3P7KA 2FY8A 2KS1B 1SVFA 3FWNA 2IYPA 3EFGA 2XV5A 3SSUA 3I5CA 1QVGO 1H8AA 4IOIH 1NGMB 4YPCA 1NU1D 5B5EE 1JY3O 2FXMA 2N1TD 4UB6E 1W2BO 3M0DA 1FZCB 2RMZA 1P84D 2H7HA 1L0NJ 4OVNF 2ZXEB 2CPBA 1FBMA 1NHLA 1PGOA 3CCSP 2C0XA 4JF7A 4WY4A 1T3JA 1GW3A 2NPSB 3V4WA 4I1LA 2LXBA 1VQ6P 3FXDA 1N8RQ 4UB8E 1YYCA 3KHUA 1QL1A 3L74E 1FDIA 2O01N 3TGUJ 1RE4C 2ZVOB 3FWLA 2O1KA 1KN7A 1KYOI 2R5BA 3H1KG 4A7PA 1PIXA 2D2CC 1ZOYC 1URQD 3JCUE 1KILB 2HG5D 1N7SD 3CWBJ 1HH0A 2E74D 2K9JB 1MFZA 1NVOA 1LNQA 4L74A 3PRJA 1HJBA 3MUDC 1SQBE 4IFDK 1ZN5A 2H89C 2YO2A 1HF9A 1N86A 2P58A 3H1KD 4W7ZA 1S5LH 2M3EA 4GODA 1M7LA 2XZRA 5AVZB 1L4AD 1J1EC 3KZIE 3B5ND 1N2DC 1YQ3C 2O3JA 3HE4B 1A02J 1SQVJ 2QIWA 5KJ7D 2G8YA 1VF5B 2JO1A 5BU5A 2YIUC 1VQ4P 3H32B 1BGYG 4PV1B 5AW3B 2IFMA 5KLVJ 1NAYA 1DD3A 2JWAA 1CZQA 4M3LA 1ZRTE 3CCQP 2C9LY 4OGQD 3HE5A 3HUSB 1S5LX 1VQ5P 2HPCB 1Y8AA 3RL0g 2ZJSE 1ZR2A 1JTHA 2FFDB 3CCJP 3H1LG 2WPQA 1BGYD 3B4SA 3C8VA 2N1TC 1QEXA 3GHGA 4EOTA 2I1JA 3L75J 4U3FE 2AEFA 1LJ2A 2QVAA 3NFQA 4NPEA 2XNXA 4N78D 5L8RJ 1YTZT 3H1LD 3KDPB 3TNUA 2I1KA 1BSHA 3CXHH 2KK7A 1IK9A 1AJYA 2Q9IA 1FC2C 3R4YA 3RK3E 1H89A 4EI2A 1BE3E 3L71J 4BWNA 3AE1C 2JKVA 3KYQA 1K8AQ 1GL2A 2A06G 3TK1A 1H0TA 1JY2P 1URQC 1VQ8P 1S5LE 2K37A 1SQXK 2WITA 2B88A 2YXQB 1N7SC 2GM4A 5AW1B 2E74C 1SQPE 3TF5A 1EDLA 5AW0B 2KLUA 2M8RA 2WMMA 3M06A 3CX5H 1PP9G 1SQQK 2A06D 4PD4D 2YIUB 1L4AC 2FKWB 1M56D 1K73Q 1J1DC 3B5NC 5CCGA 3NMDA 2QSIA 1NWQA 3RK2D 2BASA 1HGVA 4KHXA 1USEA 3L36A 5BVZA 2KIKA 4ZKPA 1PP9D 4RESB 2QJYB 4R4LA 1M1JC 1RH5B 1OW7A 1ZLLA 3SWYA 1JCDA 2KP8A 3OW2O 2N1TB 2YKQA 3I56P 1S4XA 2Z4EA 4Y28J 1R8EA 1M1KQ 3MP7B 2MKVA 2H8PD 1PZQA 3S4RA 3SFDC 2KS1A 2E5YA 1SQXG 1SLQA 4HJGH 1JMMA 1OFCX 3AE9C 3C1LA 2UWJE 3CXHE 1BDDA 4DOJA 3L70J 1DEEG 3Q1MA 2WPSA 1YHQP 3ZDMA 3TGUE 1NTKE 1VDFA 1VQ7P 1NTMJ 1SQQG 3L73G
chains in the Genus database with same CATH topology
1PFIA 3HUSA 4B86A 1SP4A 1OWAA 3HTKB 2E42A 1FZCA 1JUNA 3U59A 1X79B 1M1JA 3IR9A 5APQA 3PP5A 1FZEA 3HD7C 4GKGA 3RL0D 1LWUA 1JY2N 1KZUB 2O01H 1URQB 4LLHA 2IPPA 2W6AA 2WWWA 3M0DC 1QL2A 1N7SB 3RL0B 5CCHD 2W6BA 2XKMA 1J1EB 2OYIC 1CSBA 4Y99B 2NPSA 5CJ4A 1RE3C 2HODB 5AW7B 3V2QA 2O1JA 2P2UA 1T2KC 2Z5IA 3E1IA 2L5GB 3MIWA 4WY4C 3A7OA 1SFCA 1MUUA 2A45I 3P7KA 1G1JA 1SVFA 3KPEA 1FAVA 1L0LK 3EFGA 2XV5A 4WB4A 1LT9A 1JCCA 4JYCA 1J1DB 3I5CA 3VMYA 2H43A 1MZ9A 5KJ7C 5APSA 1CI6A 2KB7P 2QM8A 4O9BA 2GUVA 5KTBA 4HH2A 1KILA 2IFNA 1H8AA 1N7LA 3RK3C 1GK4A 5AVYB 1S9KD 1Z56A 1JY3O 2FXMA 3HD7A 2N1TD 3IFMA 1SQBK 3G3ZA 1GU5A 1LTJC 3M0DA 1FZCB 1LTBC 1M1JB 1HUCA 5CHXA 2H7HA 1E5WA 1T3UA 2ZXEB 1LWUB 2R3CA 2OYIA 3VOPA 1CW5A 2CPBA 1FBMA 1DX7A 4C46A 2VRSA 1NHLA 1RE3A 3CL3D 4C7NA 5APTA 2C0XA 4JF7A 1GU4A 1G2CA 4WY4A 1FZBA 3MGNA 2Q5UA 1SFCD 1T3JA 1GW3A 2NPSB 3HE4A 3V4WA 3VP8A 1NTZK 4I1LA 2YKOA 3B5NA 1JOCA 3P8CD 2KLVA 3BRVB 3KQGA 1XTGB 1SFCB 5CCGD 1AFOA 4IFMA 2IX7C 3H32A 1YYCA 1QL1A 3MTUE 3H6PA 1X9VA 5KJ7A 5AVWB 3V5BA 1HWTC 1LT9B 1RE4C 3II6A 4IFFA 3A5TA 1MV8A 2J58A 2O1KA 2R5BA 2JJLA 2WPRA 2A45H 1JY3N 1KILD 4DZOA 1CI6B 2J59M 2HPCA 3M9QA 1URQD 3HD7D 1KILB 1JNMA 1LTJA 2HG5D 2FFDA 1N7SD 1RF1C 1HH0A 1GW4A 4XE5B 5APUA 3VMXA 3L35A 3HD7B 2C0WA 1G1IA 1MFZA 1KFMA 1IFNA 2WT7A 1NAFA 1S9KE 1HJBA 1GK6A 4IFDK 5APYA 1JO5A 1ZN5A 4LC1A 2YO2A 1FDMA 1A02F 1IC2A 1N86A 3UIAA 4AUWA 1IFMA 1LTSC 1W2EA 4W7ZA 2OYIB 3LIDA 4WY4D 1RF0A 1DEBA 4WBAA 2HLOA 5CJ0A 3RL0C 1M7LA 1FOSF 2C9NY 2XZRA 3GHGC 5AVZB 1L4AD 1J1EC 1NO4A 4WY4B 4Y99C 3B5ND 1N2DC 5CCHC 2HYNA 3HE4B 2YKPA 1L4AB 4JYBA 5BU8B 3VYIA 1A02J 3B5NB 3V4QA 5KJ7D 1FZFA 2CPSA 1RE4A 3SWFA 1LTGC 4LGDE 1AQ5A 1NKNA 5BU5A 1IJDB 3VN0A 1FOSE 3H32B 5AW3B 2IFMA 3T97A 2KYVA 3P8CE 3RK3D 1NTKK 2JEEA 1CZQA 2OYHC 1WRGA 3N7NA 1NTMK 1IFIA 1KQLA 4M3LA 1GDTA 2PAJA 1LTTC 1T8ZA 1OXZA 3RK3B 2C9LY 3HE5A 1RF1A 3B8EB 3HUSB 3RK2C 2HPCB 1IFJA 3HTKA 1ZR2A 1JTHA 2YO3A 4GT1A 4AYCA 3MUDA 1LTJB 2FFDB 2N9BA 1ZV8A 2XDJA 2KSJA 2WSFH 3OA7A 4HYTB 2WPQA 1SQPK 2WT7B 3R2PA 1IFDA 1GL2C 5APVA 2P1JA 2FYZA 2NPSD 2N1TC 2R32A 3GHGA 1X8YA 4EOTA 2I1JA 3VMZA 1DH3A 1JY2O 4C7RA 2WSEH 3NFQA 2WSCH 2MJZA 1HVVA 2Z5HA 2YNYA 1RY3A 2XNXA 4N78D 1N73C 3N4XA 1EQ7A 1YTZT 2LKMA 2M3BA 1HGZA 3V2NA 3KDPB 2OYHA 1SFCC 4W80A 3TNUA 3OJAB 1KFNA 3VP9A 2I1KA 5AW8B 3M91A 2A45G 2PP6A 5CCGC 1IO4A 1GZLA 1IK9A 1LT9C 5AVVB 3BATA 4XA4A 2Q9IA 3M9BA 5CMZA 3HE5B 1RF1B 1H89A 3L4FA 4EIJA 1KILC 3KYQA 2P67A 1GL2A 3TK1A 1JTHB 4N3YB 1L0NK 3EQ2A 5AVUB 2N1TA 1ZR4A 1NKZB 1JY2P 1URQC 3M0AA 1T2KD 5AW9B 1SQXK 2W27A 2WITA 3P32A 3BASA 3BRTB 1N7SC 2GM4A 4C7NB 3TSIA 5AW1B 4I2LC 5AW5B 1G2CB 1GTWA 3GHGB 5AW0B 1LTAC 3V2RA 2FYUK 1N73A 3O8ZA 4OH8B 3TYYA 2M8RA 3M06A 3A3YB 1J2JB 4ZKUA 5AW2B 5APWA 2OARA 1HTLC 3HRNA 1SQQK 2POHA 5AVQB 4GIFA 2YMYA 2E43A 1L4AC 1XTCC 2FKWB 3U1CA 5AVTB 1J1DC 3B5NC 5CCGA 2QM7A 2WZ7A 3NMDA 2OYHB 3NXSA 4N78E 3TNUB 1NWQA 3RK2D 3V2PA 2BASA 1HGVA 2Q3IA 4KHXA 2WTYA 3U1AA 3L36A 3RK2B 5APXA 3A2AA 4AQRD 5BVZA 2Q7CA 2ZFCA 5AVRB 1FJPA 1GL2D 3HUSC 2HFED 3C9IA 1URQA 4ZKPA 4RESB 3NTNA 1WT6A 1FZCC 4N6JA 1M1JC 1N7SA 3VTPC 1NU1K 1GL2B 1ZLLA 3SWYA 1JCDA 2FFDC 2KP8A 1LWUC 2N1TB 2YKQA 3LIEA 5CCHA 2Z4EA 3L37A 3CI9A 2HODA 2GUSA 5AW6B 1GD2E 1VPCA 2H8PD 3WMM0 1NOHA 1LGHB 2R5DA 3CLQA 1NH4A 2NPSC 1H88A 4W7YA 1YTZI 3MD0A 1FZGA 1SLQA 3M9HA 1FJKA 1SQVK 2KOGA 1N73B 5AVSB 1RF0C 1L4AA 1JMMA 2XU6A 2P7JA 1FZAA 1HBWA 5AW4B 5KLVK 4DOJA 2WPSA 3OAKA 1FU1A 1VDFA 1LTIC 4I6MC 1JY3P 5AVXB 3P8MC 3LW5H 3BVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC D;  1T3J A;  2NPS B;  4OH8 B;  3RK2 C;  2M8R A;  3HTK B;  3B5N A;  1JTH A;  1XTG B;  3PP5 A;  1SFC B;  5CCG D;  3HD7 C;  2XDJ A;  3RL0 D;  2YMY A;  5KJ7 A;  1L4A C;  1URQ B;  3M0D C;  1GL2 C;  3B5N C;  2NPS D;  5CCG A;  1N7S B;  3RL0 B;  5CCH D;  2N1T C;  2WZ7 A;  4N78 E;  3RK2 D;  1KIL D;  2NPS A;  1URQ D;  3HD7 D;  3RK2 B;  1KIL B;  4WY4 C;  1SFC A;  2HG5 D;  1N7S D;  1HVV A;  1GL2 D;  3HD7 B;  2HFE D;  1URQ A;  1N7S A;  1GL2 B;  1SFC C;  4W80 A;  2N1T B;  5KJ7 C;  5CCH A;  4W7Z A;  2PP6 A;  5CCG C;  4WY4 D;  3RL0 C;  1KIL A;  2H8P D;  3RK3 C;  1L4A D;  4WY4 B;  2NPS C;  3B5N D;  3HD7 A;  4W7Y A;  5CCH C;  2N1T D;  2KOG A;  1L4A B;  1L4A A;  1KIL C;  3KYQ A;  3B5N B;  1GL2 A;  5KJ7 D;  1JTH B;  2N1T A;  4LGD E;  1URQ C;  3VOP A;  1N7S C;  3P8C E;  3RK3 D;  3TSI A;  1NHL A;  4JF7 A;  4WY4 A;  3RK3 B; 
#chains in the Genus database with same CATH topology
 4B86 A;  1SQX D;  2J5U A;  1OWA A;  4PJ0 H;  1FZC A;  2W6J H;  1U7M A;  3FGA D;  2QJK C;  4GKG A;  3HD7 C;  1S3J A;  2ZXX A;  1SS1 A;  2OQQ A;  1URQ B;  1KB9 I;  2W6A A;  1QL2 A;  1N7S B;  1AA0 A;  3RL0 B;  2E74 B;  1Q86 Q;  1DIP A;  2OYI C;  2IDB A;  4Y99 B;  2NPS A;  1SQQ D;  3CX5 E;  3L73 D;  1BSN A;  1MUU A;  1X0T A;  4I7Z C;  1FAV A;  4L75 A;  1L0L K;  4Z1M H;  4WB4 A;  2KSE A;  1JCC A;  1SQV E;  3AEC C;  4JYC A;  1J1D B;  1MZ9 A;  2KB7 P;  2QM8 A;  4ZMD A;  4HH2 A;  1KIL A;  1GK4 A;  2WSF J;  1Z56 A;  2K9J A;  3EWK A;  3G3Z A;  3H1H E;  1W5C E;  1LTJ C;  1M1J B;  3G4S P;  1T3U A;  3G71 P;  1CW5 A;  1DX7 A;  4C46 A;  2WSC J;  1RE3 A;  4C7N A;  3GF3 A;  5APT A;  3WUV A;  1G2C A;  1GU4 A;  3HE4 A;  2FYU J;  2BCC G;  2KZJ A;  2YKO A;  4D6T J;  2Y9Y A;  2KLV A;  3BRV B;  1SFC B;  2ZT9 D;  3H32 A;  1ZRT D;  3MTU E;  4U3F G;  3V5B A;  1HWT C;  1LT9 B;  3A5T A;  1MV8 A;  2JJL A;  2A45 H;  1JY3 N;  3LW5 J;  4PJ0 E;  2HPC A;  3M9Q A;  1DD4 A;  3AE2 C;  2BCC D;  2FFD A;  2V4H A;  1VL2 A;  5APU A;  2O01 J;  3L35 A;  3HD7 B;  2C0W A;  2V7Q J;  1KFM A;  4H44 D;  1IFN A;  4DCK A;  3G9R A;  1EZV G;  3L71 E;  4U3F D;  1S9K E;  5APY A;  1NU1 J;  3GG2 A;  1IC2 A;  5KLI B;  3UIA A;  2IZ0 A;  4AUW A;  1IFM A;  2OYI B;  3LID A;  4WY4 D;  1RF0 A;  4WBA A;  2KUB A;  1FOS F;  2C9N Y;  2IBZ I;  1Q90 D;  5KAI E;  4I7Z B;  2YKP A;  2K3R A;  3H1I G;  4RO0 A;  3V4Q A;  1EZV D;  2CPS A;  1RE4 A;  1ZW0 A;  4IL6 H;  1NKN A;  1IJD B;  1FOS E;  3P8C E;  3RK3 D;  1NTK K;  1E79 H;  2BEZ F;  2OYH C;  3MZW B;  1WRG A;  1KQL A;  2DW3 A;  2N9Y B;  1T8Z A;  2YXR B;  3ABV C;  4AYC A;  3CCU P;  5DJT B;  1KIL E;  1KYO H;  3MUD A;  1LTJ B;  3H1I D;  2KSJ A;  3H1J G;  3E7K A;  2WSF H;  3OA7 A;  2R3S A;  2WSS H;  3CC2 P;  2WT7 B;  3R2P A;  1S1C X;  4K35 A;  1YIT P;  4IL6 X;  1QX8 A;  3VMZ A;  1DH3 A;  2WSC H;  2QRX A;  1S2E A;  3JC2 2;  2YNY A;  3H1K J;  3N4X A;  4GDO A;  3AE8 C;  1BDC A;  3H1J D;  3Q5S A;  1NYH A;  2LKM A;  1D7M A;  4HB1 A;  3CCE P;  3L70 E;  2ZT9 C;  3BAT A;  2NRG A;  3CCM P;  2KI7 B;  3RBX A;  2LXC B;  5CMZ A;  3L72 G;  3CC4 P;  1VQL P;  1NTK G;  3S9O A;  4N3Y B;  3EQ2 A;  2N1T A;  1NKZ B;  1RQU A;  3BRT B;  2V7Q H;  4C7N B;  3TSI A;  2W83 C;  3QWO C;  4H44 C;  1G2C B;  1GTW A;  1YJN P;  3CXH D;  1LT1 A;  3V2R A;  5M1B A;  3O8Z A;  1BGY J;  1KD1 Q;  3TYY A;  3G6E P;  1NTZ E;  3A3Y B;  3L72 D;  1J2J B;  1OVV A;  1NTK D;  1UIX A;  5APW A;  2OAR A;  4GIF A;  1MKM A;  1TU3 F;  2ZYA A;  2QM7 A;  1Q82 Q;  2OYH B;  1EZV I;  2KNC B;  3NXS A;  1R5S A;  2Q3I A;  2WTY A;  3U1A A;  2AXT H;  4K3A A;  3H1L J;  1KYO E;  2Q7C A;  3WU2 H;  1FJP A;  1GL2 D;  1GMJ A;  3C9I A;  1URQ A;  4TLF A;  1Y9B A;  2PFX A;  1N7S A;  3VTP C;  3CX5 D;  1R5L A;  5C39 A;  1P84 I;  1RQV A;  3W68 A;  4U7J A;  3CCR P;  1BCC E;  3LIE A;  5CCH A;  2Y0E A;  3CI9 A;  2W90 A;  3H1H G;  2GUS A;  2YMK A;  1GD2 E;  3TDK A;  1LP1 B;  1NH4 A;  4GOF A;  1YTZ I;  2Y9Z A;  5B66 H;  2KOG A;  2FYU E;  1L4A A;  2RH0 A;  3A0B H;  2P7J A;  5AW4 B;  1T6A A;  2D2C B;  3AE6 C;  3GLM A;  2GA1 A;  4BRY B;  1AVY A;  2NZ2 A;  1FU1 A;  3H1H D;  3WUU A;  1KMI Z;  1U57 A;  1FDO A;  2K1A A;  1PFI A;  1VQK P;  1SP4 A;  2RN0 A;  1M1J A;  1ZME C;  2AXC A;  1JY2 N;  1K05 A;  1PGQ A;  2IPP A;  2WWW A;  1IK7 A;  2W6B A;  2AEM A;  3BCC E;  1NU1 E;  2XKM A;  2M5A B;  1J1E B;  2Y0D A;  1PP9 J;  4L73 A;  1AQT A;  2HOD B;  5AW7 B;  2P2U A;  2Z5I A;  3E1I A;  2L5G B;  1SFC A;  1G1J A;  5GTI H;  3PTZ A;  1OVR A;  1LT9 A;  2H43 A;  1YBK A;  5KJ7 C;  2AXT E;  3F89 A;  4O9B A;  3WUT A;  1EC5 A;  2IFN A;  5E79 H;  1N7L A;  3WU2 E;  5AVY B;  1S9K D;  1YJW P;  3A0H H;  4ASW A;  3HD7 A;  2M0B A;  1PGP A;  1SQB K;  4OGQ C;  1GU5 A;  2CK3 H;  1LTB C;  1HUC A;  1L0N E;  1QVF O;  3E1R A;  1OX3 A;  1E5W A;  1PPJ E;  4BXL A;  2IYO A;  2R3C A;  2OYI A;  4EDF A;  2RKL A;  1SQX J;  3D6Y A;  1JB0 J;  3SFE C;  2VRS A;  3FX0 A;  1KC8 Q;  5B66 E;  2Q5U A;  3VP8 A;  1KB9 H;  1NTZ K;  3A0B E;  3P8C D;  4JPZ B;  1AFO A;  2IX7 C;  1SQQ J;  2W8Z A;  3L73 J;  1QLE D;  2OYO A;  5KKZ C;  1YI2 P;  3L74 G;  1EXI A;  1KIL D;  4KT0 J;  1VQ9 P;  1CI6 B;  2B87 B;  2QE7 H;  3VMA A;  4WWI A;  1JNM A;  3CWB E;  1LTJ A;  1RF1 C;  1GW4 A;  3VMX A;  2WT7 A;  2AEJ A;  1GK6 A;  1M90 Q;  1FDM A;  1A02 F;  1LTS C;  2ZYD A;  3L74 D;  1Q7Y Q;  1SQB G;  2HLO A;  2WPV B;  3FXE A;  3AEB C;  1Q2N A;  1VF5 D;  2IZ1 A;  1L4A B;  5TIS H;  4JYB A;  4PV1 D;  1YQ4 C;  5CBN A;  3B5N B;  1FZF A;  2FYN C;  4LGD E;  5KLV E;  2B89 A;  4PD4 I;  1NTZ G;  5E79 E;  3AE7 C;  5GTH H;  1K9M Q;  3A0H E;  1IFI A;  1SQB D;  2PAJ A;  1LTT C;  2WQY C;  1OXZ A;  4RKU J;  1ZP0 C;  4H13 D;  3RK2 C;  5K5G B;  1M57 D;  1JMB A;  2E76 D;  1IFJ A;  3HTK A;  2YO3 A;  4GT1 A;  3CMA P;  4OGQ B;  2N9B A;  1SQP K;  1IFD A;  1NTZ D;  2BCC J;  3CC7 P;  1X8Y A;  3L75 E;  1KB9 E;  3PLN A;  4U3F J;  4C7R A;  2OTJ P;  1KQG B;  1M8O B;  1BCC G;  1HVV A;  3AE5 C;  1MFT A;  1RY3 A;  1OIP A;  1UII A;  1N73 C;  1EQ7 A;  1L0L J;  5DJU B;  1HGZ A;  3V2N A;  3O6Q B;  3ITK A;  2OYH A;  1YIJ P;  2KNC A;  1KTM A;  1KFN A;  2QJP C;  3T97 B;  2L91 A;  5AVV B;  4YXW H;  1OMI A;  3M9B A;  2QJK B;  3IF4 A;  1RF1 B;  1BCC D;  1KIL C;  2P67 A;  3GF7 A;  1L0N K;  5AVU B;  4MN4 C;  3M0A A;  1BE3 G;  2BEQ D;  4ZNC A;  2OTL P;  3BAS A;  2K88 A;  1LP1 A;  3H1I J;  1PP9 E;  5TIS E;  1SQP G;  1EDI A;  4OH8 B;  3BCC G;  1Y47 A;  3GW6 A;  3D70 A;  1QGK B;  1HTL C;  4OWF A;  3HRN A;  2KZI A;  2POH A;  3AED C;  2G3A A;  2FYN B;  2YMY A;  4DJG A;  3KZI H;  1XTC C;  4BRY A;  3U1C A;  5GTH E;  1BE3 D;  2WZ7 A;  1VF5 C;  4PV1 C;  3V2P A;  3H1J J;  2JDI H;  3F5H A;  3RK2 B;  1PV3 A;  1SQP D;  4AQR D;  1AV1 A;  2QG4 A;  3BCC D;  2ZFC A;  3HUS C;  3NTN A;  1WT6 A;  4N6J A;  1KV4 A;  2E75 D;  4H13 C;  2FFD C;  1LWU C;  2M5A A;  2E76 C;  2ITA A;  2HOD A;  1SQX E;  1PGJ A;  5AW6 B;  3I55 P;  1VPC A;  1L0N G;  1NOH A;  1PPJ G;  2R5D A;  4W7Y A;  3MD0 A;  1FZG A;  4L76 A;  1SQV K;  1N73 B;  5AVS B;  1RF0 C;  2E5T A;  2IBZ E;  1HBW A;  3B71 A;  1L2P A;  4TT3 H;  5KLV K;  1SQQ E;  2QJP B;  1VQO P;  3L72 J;  3L73 E;  3OAK A;  2QA4 P;  1LTI C;  1NTK J;  4I6M C;  1NTM E;  2Q6Q A;  1L0N D;  4CPG A;  3LW5 H;  3TGU G;  3BVH A;  1PPJ D;  3HTK B;  2E42 A;  1JUN A;  3U59 A;  1X79 B;  3PP5 A;  3AEF C;  3CCL P;  2FBW C;  3RL0 D;  1KZU B;  2O01 H;  1NJI Q;  3AEG C;  3M0D C;  1KOR A;  3CWB G;  5CCH D;  1S72 P;  1RHZ B;  5CJ4 A;  3V2Q A;  4IL6 E;  3TGU D;  3MIW A;  4XFJ A;  4WY4 C;  1P84 H;  4WVZ A;  2LR2 A;  3KPE A;  4NPF X;  3VMY A;  3RBZ A;  3CWB D;  3D6Z A;  5APS A;  2P10 A;  1CI6 A;  1SQV G;  2B87 A;  2GUV A;  5KTB A;  4YXD C;  1IZN B;  3AE3 C;  4KJM A;  3RK3 C;  5KLV G;  1OVU A;  3IFM A;  1EDJ A;  2FXO A;  3H1H J;  3Q5P A;  5CHX A;  4H13 B;  3PJS K;  1IFP A;  1LWU B;  2E76 B;  3VOP A;  2WSE J;  2QJY C;  1AVO A;  2XND H;  3CL3 D;  1SQV D;  1FS0 E;  2BCC E;  1FZB A;  3MGN A;  2E75 C;  4H0L D;  1SFC D;  5KLV D;  4D6T E;  3B5N A;  1JOC A;  2SPZ A;  3KQG A;  1XTG B;  5CCG D;  3L75 G;  3Q3D A;  4IFM A;  3H6P A;  1USD A;  1X9V A;  5KJ7 A;  4GOE A;  5AVW B;  1L0L E;  2ZT9 B;  3II6 A;  4IFF A;  2J58 A;  2WPR A;  4DZO A;  3CPW O;  1YJ9 P;  4R4M A;  2J59 M;  1WMK A;  3HD7 D;  3SWK A;  1EZV E;  3GMA A;  5KAF H;  4XE5 B;  4NPD A;  1G1I A;  3L75 D;  3IAO A;  1KB9 D;  1NAF A;  1JO5 A;  4LC1 A;  1HJ0 A;  4H44 B;  5TJH A;  3L71 G;  1W2E A;  3Q2Y A;  2B9B A;  2R44 A;  5CJ0 A;  1DEB A;  3RL0 C;  4ASV A;  1P84 E;  3GHG C;  3H1I E;  3CCV P;  1NO4 A;  4WY4 B;  3CXH I;  4Y99 C;  5CCH C;  2HYN A;  2OGU A;  5BU8 B;  3VYI A;  3O6Q A;  2K9Y A;  3K5B A;  3SWF A;  3CD6 P;  1LTG C;  1AQ5 A;  3VN0 A;  3T97 A;  1OW6 A;  1PL5 A;  2KYV A;  3L71 D;  2JEE A;  3CME P;  3N7N A;  1NTM K;  1GDT A;  3RK3 B;  1RF1 A;  3B8E B;  3H1J E;  5H2F H;  3H25 A;  1U7J A;  1KQS O;  2HR3 A;  5CBO A;  1VQM P;  1ZV8 A;  2XDJ A;  4HYT B;  4HKZ H;  1GL2 C;  5APV A;  2P1J A;  2FYZ A;  2NPS D;  3KXD A;  3CX5 I;  2R32 A;  4DT0 A;  1JY2 O;  2E75 B;  1VQN P;  1ZXG A;  2WSE H;  3AEA C;  2MJZ A;  3H1K E;  2Z5H A;  3L74 J;  3V6I A;  2JP3 A;  1JM0 A;  2M3B A;  4H0L C;  1SFC C;  4W80 A;  2WVR A;  2ZAE B;  2I8D A;  3QH9 A;  3OJA B;  3VP9 A;  5AW8 B;  4JQ0 D;  1K04 A;  3M91 A;  3PHL A;  2A45 G;  2PP6 A;  5CCG C;  2IBZ G;  1IO4 A;  1GZL A;  1LT9 C;  3L72 E;  1X22 A;  5KAF E;  4XA4 A;  2PRR A;  3L70 G;  2JWD A;  3EFF K;  3RGU A;  1Q81 Q;  4PD4 H;  2OTK E;  3HE5 B;  1KQF B;  1EDK A;  3L4F A;  4EIJ A;  1NTM G;  1SQB J;  1JTH B;  1ZR4 A;  2ZVN B;  1T2K D;  5AW9 B;  2W27 A;  3P32 A;  4I2L C;  5AW5 B;  2IBZ D;  5KLI C;  5GTI E;  3GHG B;  1LTA C;  5EFW B;  2FYU K;  1BGY E;  1N73 A;  3L70 D;  4QMA A;  2QEX P;  1NTZ J;  4RJT A;  4ZKU A;  5AW2 B;  5AVQ B;  1NTM D;  2E43 A;  5AVT B;  5KAI H;  4N78 E;  3TNU B;  5H2F E;  3W67 A;  1JEK A;  2Y0C A;  3H1L E;  3JSV C;  5APX A;  3A2A A;  1EXJ A;  3MHV A;  5AVR B;  5B5E H;  2HFE D;  4EYY Q;  1FZC C;  4UB6 H;  1NU1 K;  1GL2 B;  1H0T B;  1OZH A;  1BCC J;  3L37 A;  1FE6 A;  2KXP B;  3WMM 0;  1LGH B;  3CLQ A;  2NPS C;  1H88 A;  3M9H A;  1FJK A;  2D2C D;  2XU6 A;  3IN6 A;  1KYO D;  1FZA A;  3AEE C;  5KKZ B;  3D71 A;  4H0L B;  3Q5R A;  2FYU G;  4UB8 H;  1OW8 A;  3S1K A;  4D6T G;  2A06 E;  1JY3 P;  5AVX B;  4PD4 E;  3P8M C;  3AE4 C;  1L0L G;  1BE3 J;  3HUS A;  3USS A;  2H88 C;  3IR9 A;  5APQ A;  3JCU H;  2Q1K A;  1FZE A;  1LWU A;  1VQP P;  4LLH A;  4YTP C;  2FYU D;  1SQP J;  4D6T D;  2Q3E A;  2PGD A;  3BCC J;  2FXP A;  1CSB A;  3PH0 A;  1RE3 C;  2O1J A;  1NU1 G;  1T2K C;  4JBZ A;  2ZYG A;  1L0L D;  2JR8 A;  3A7O A;  2A45 I;  3P7K A;  2FY8 A;  2KS1 B;  1SVF A;  3FWN A;  2IYP A;  3EFG A;  2XV5 A;  3SSU A;  3I5C A;  1QVG O;  1H8A A;  4IOI H;  1NGM B;  4YPC A;  1NU1 D;  5B5E E;  1JY3 O;  2FXM A;  2N1T D;  4UB6 E;  1W2B O;  3M0D A;  1FZC B;  2RMZ A;  1P84 D;  2H7H A;  1L0N J;  4OVN F;  2ZXE B;  2CPB A;  1FBM A;  1NHL A;  1PGO A;  3CCS P;  2C0X A;  4JF7 A;  4WY4 A;  1T3J A;  1GW3 A;  2NPS B;  3V4W A;  4I1L A;  2LXB A;  1VQ6 P;  3FXD A;  1N8R Q;  4UB8 E;  1YYC A;  3KHU A;  1QL1 A;  3L74 E;  1FDI A;  2O01 N;  3TGU J;  1RE4 C;  2ZVO B;  3FWL A;  2O1K A;  1KN7 A;  1KYO I;  2R5B A;  3H1K G;  4A7P A;  1PIX A;  2D2C C;  1ZOY C;  1URQ D;  3JCU E;  1KIL B;  2HG5 D;  1N7S D;  3CWB J;  1HH0 A;  2E74 D;  2K9J B;  1MFZ A;  1NVO A;  1LNQ A;  4L74 A;  3PRJ A;  1HJB A;  3MUD C;  1SQB E;  4IFD K;  1ZN5 A;  2H89 C;  2YO2 A;  1HF9 A;  1N86 A;  2P58 A;  3H1K D;  4W7Z A;  1S5L H;  2M3E A;  4GOD A;  1M7L A;  2XZR A;  5AVZ B;  1L4A D;  1J1E C;  3KZI E;  3B5N D;  1N2D C;  1YQ3 C;  2O3J A;  3HE4 B;  1A02 J;  1SQV J;  2QIW A;  5KJ7 D;  2G8Y A;  1VF5 B;  2JO1 A;  5BU5 A;  2YIU C;  1VQ4 P;  3H32 B;  1BGY G;  4PV1 B;  5AW3 B;  2IFM A;  5KLV J;  1NAY A;  1DD3 A;  2JWA A;  1CZQ A;  4M3L A;  1ZRT E;  3CCQ P;  2C9L Y;  4OGQ D;  3HE5 A;  3HUS B;  1S5L X;  1VQ5 P;  2HPC B;  1Y8A A;  3RL0 g;  2ZJS E;  1ZR2 A;  1JTH A;  2FFD B;  3CCJ P;  3H1L G;  2WPQ A;  1BGY D;  3B4S A;  3C8V A;  2N1T C;  1QEX A;  3GHG A;  4EOT A;  2I1J A;  3L75 J;  4U3F E;  2AEF A;  1LJ2 A;  2QVA A;  3NFQ A;  4NPE A;  2XNX A;  4N78 D;  5L8R J;  1YTZ T;  3H1L D;  3KDP B;  3TNU A;  2I1K A;  1BSH A;  3CXH H;  2KK7 A;  1IK9 A;  1AJY A;  2Q9I A;  1FC2 C;  3R4Y A;  3RK3 E;  1H89 A;  4EI2 A;  1BE3 E;  3L71 J;  4BWN A;  3AE1 C;  2JKV A;  3KYQ A;  1K8A Q;  1GL2 A;  2A06 G;  3TK1 A;  1H0T A;  1JY2 P;  1URQ C;  1VQ8 P;  1S5L E;  2K37 A;  1SQX K;  2WIT A;  2B88 A;  2YXQ B;  1N7S C;  2GM4 A;  5AW1 B;  2E74 C;  1SQP E;  3TF5 A;  1EDL A;  5AW0 B;  2KLU A;  2M8R A;  2WMM A;  3M06 A;  3CX5 H;  1PP9 G;  1SQQ K;  2A06 D;  4PD4 D;  2YIU B;  1L4A C;  2FKW B;  1M56 D;  1K73 Q;  1J1D C;  3B5N C;  5CCG A;  3NMD A;  2QSI A;  1NWQ A;  3RK2 D;  2BAS A;  1HGV A;  4KHX A;  1USE A;  3L36 A;  5BVZ A;  2KIK A;  4ZKP A;  1PP9 D;  4RES B;  2QJY B;  4R4L A;  1M1J C;  1RH5 B;  1OW7 A;  1ZLL A;  3SWY A;  1JCD A;  2KP8 A;  3OW2 O;  2N1T B;  2YKQ A;  3I56 P;  1S4X A;  2Z4E A;  4Y28 J;  1R8E A;  1M1K Q;  3MP7 B;  2MKV A;  2H8P D;  1PZQ A;  3S4R A;  3SFD C;  2KS1 A;  2E5Y A;  1SQX G;  1SLQ A;  4HJG H;  1JMM A;  1OFC X;  3AE9 C;  3C1L A;  2UWJ E;  3CXH E;  1BDD A;  4DOJ A;  3L70 J;  1DEE G;  3Q1M A;  2WPS A;  1YHQ P;  3ZDM A;  3TGU E;  1NTK E;  1VDF A;  1VQ7 P;  1NTM J;  1SQQ G;  3L73 G; 
#chains in the Genus database with same CATH homology
 1PFI A;  3HUS A;  4B86 A;  1SP4 A;  1OWA A;  3HTK B;  2E42 A;  1FZC A;  1JUN A;  3U59 A;  1X79 B;  1M1J A;  3IR9 A;  5APQ A;  3PP5 A;  1FZE A;  3HD7 C;  4GKG A;  3RL0 D;  1LWU A;  1JY2 N;  1KZU B;  2O01 H;  1URQ B;  4LLH A;  2IPP A;  2W6A A;  2WWW A;  3M0D C;  1QL2 A;  1N7S B;  3RL0 B;  5CCH D;  2W6B A;  2XKM A;  1J1E B;  2OYI C;  1CSB A;  4Y99 B;  2NPS A;  5CJ4 A;  1RE3 C;  2HOD B;  5AW7 B;  3V2Q A;  2O1J A;  2P2U A;  1T2K C;  2Z5I A;  3E1I A;  2L5G B;  3MIW A;  4WY4 C;  3A7O A;  1SFC A;  1MUU A;  2A45 I;  3P7K A;  1G1J A;  1SVF A;  3KPE A;  1FAV A;  1L0L K;  3EFG A;  2XV5 A;  4WB4 A;  1LT9 A;  1JCC A;  4JYC A;  1J1D B;  3I5C A;  3VMY A;  2H43 A;  1MZ9 A;  5KJ7 C;  5APS A;  1CI6 A;  2KB7 P;  2QM8 A;  4O9B A;  2GUV A;  5KTB A;  4HH2 A;  1KIL A;  2IFN A;  1H8A A;  1N7L A;  3RK3 C;  1GK4 A;  5AVY B;  1S9K D;  1Z56 A;  1JY3 O;  2FXM A;  3HD7 A;  2N1T D;  3IFM A;  1SQB K;  3G3Z A;  1GU5 A;  1LTJ C;  3M0D A;  1FZC B;  1LTB C;  1M1J B;  1HUC A;  5CHX A;  2H7H A;  1E5W A;  1T3U A;  2ZXE B;  1LWU B;  2R3C A;  2OYI A;  3VOP A;  1CW5 A;  2CPB A;  1FBM A;  1DX7 A;  4C46 A;  2VRS A;  1NHL A;  1RE3 A;  3CL3 D;  4C7N A;  5APT A;  2C0X A;  4JF7 A;  1GU4 A;  1G2C A;  4WY4 A;  1FZB A;  3MGN A;  2Q5U A;  1SFC D;  1T3J A;  1GW3 A;  2NPS B;  3HE4 A;  3V4W A;  3VP8 A;  1NTZ K;  4I1L A;  2YKO A;  3B5N A;  1JOC A;  3P8C D;  2KLV A;  3BRV B;  3KQG A;  1XTG B;  1SFC B;  5CCG D;  1AFO A;  4IFM A;  2IX7 C;  3H32 A;  1YYC A;  1QL1 A;  3MTU E;  3H6P A;  1X9V A;  5KJ7 A;  5AVW B;  3V5B A;  1HWT C;  1LT9 B;  1RE4 C;  3II6 A;  4IFF A;  3A5T A;  1MV8 A;  2J58 A;  2O1K A;  2R5B A;  2JJL A;  2WPR A;  2A45 H;  1JY3 N;  1KIL D;  4DZO A;  1CI6 B;  2J59 M;  2HPC A;  3M9Q A;  1URQ D;  3HD7 D;  1KIL B;  1JNM A;  1LTJ A;  2HG5 D;  2FFD A;  1N7S D;  1RF1 C;  1HH0 A;  1GW4 A;  4XE5 B;  5APU A;  3VMX A;  3L35 A;  3HD7 B;  2C0W A;  1G1I A;  1MFZ A;  1KFM A;  1IFN A;  2WT7 A;  1NAF A;  1S9K E;  1HJB A;  1GK6 A;  4IFD K;  5APY A;  1JO5 A;  1ZN5 A;  4LC1 A;  2YO2 A;  1FDM A;  1A02 F;  1IC2 A;  1N86 A;  3UIA A;  4AUW A;  1IFM A;  1LTS C;  1W2E A;  4W7Z A;  2OYI B;  3LID A;  4WY4 D;  1RF0 A;  1DEB A;  4WBA A;  2HLO A;  5CJ0 A;  3RL0 C;  1M7L A;  1FOS F;  2C9N Y;  2XZR A;  3GHG C;  5AVZ B;  1L4A D;  1J1E C;  1NO4 A;  4WY4 B;  4Y99 C;  3B5N D;  1N2D C;  5CCH C;  2HYN A;  3HE4 B;  2YKP A;  1L4A B;  4JYB A;  5BU8 B;  3VYI A;  1A02 J;  3B5N B;  3V4Q A;  5KJ7 D;  1FZF A;  2CPS A;  1RE4 A;  3SWF A;  1LTG C;  4LGD E;  1AQ5 A;  1NKN A;  5BU5 A;  1IJD B;  3VN0 A;  1FOS E;  3H32 B;  5AW3 B;  2IFM A;  3T97 A;  2KYV A;  3P8C E;  3RK3 D;  1NTK K;  2JEE A;  1CZQ A;  2OYH C;  1WRG A;  3N7N A;  1NTM K;  1IFI A;  1KQL A;  4M3L A;  1GDT A;  2PAJ A;  1LTT C;  1T8Z A;  1OXZ A;  3RK3 B;  2C9L Y;  3HE5 A;  1RF1 A;  3B8E B;  3HUS B;  3RK2 C;  2HPC B;  1IFJ A;  3HTK A;  1ZR2 A;  1JTH A;  2YO3 A;  4GT1 A;  4AYC A;  3MUD A;  1LTJ B;  2FFD B;  2N9B A;  1ZV8 A;  2XDJ A;  2KSJ A;  2WSF H;  3OA7 A;  4HYT B;  2WPQ A;  1SQP K;  2WT7 B;  3R2P A;  1IFD A;  1GL2 C;  5APV A;  2P1J A;  2FYZ A;  2NPS D;  2N1T C;  2R32 A;  3GHG A;  1X8Y A;  4EOT A;  2I1J A;  3VMZ A;  1DH3 A;  1JY2 O;  4C7R A;  2WSE H;  3NFQ A;  2WSC H;  2MJZ A;  1HVV A;  2Z5H A;  2YNY A;  1RY3 A;  2XNX A;  4N78 D;  1N73 C;  3N4X A;  1EQ7 A;  1YTZ T;  2LKM A;  2M3B A;  1HGZ A;  3V2N A;  3KDP B;  2OYH A;  1SFC C;  4W80 A;  3TNU A;  3OJA B;  1KFN A;  3VP9 A;  2I1K A;  5AW8 B;  3M91 A;  2A45 G;  2PP6 A;  5CCG C;  1IO4 A;  1GZL A;  1IK9 A;  1LT9 C;  5AVV B;  3BAT A;  4XA4 A;  2Q9I A;  3M9B A;  5CMZ A;  3HE5 B;  1RF1 B;  1H89 A;  3L4F A;  4EIJ A;  1KIL C;  3KYQ A;  2P67 A;  1GL2 A;  3TK1 A;  1JTH B;  4N3Y B;  1L0N K;  3EQ2 A;  5AVU B;  2N1T A;  1ZR4 A;  1NKZ B;  1JY2 P;  1URQ C;  3M0A A;  1T2K D;  5AW9 B;  1SQX K;  2W27 A;  2WIT A;  3P32 A;  3BAS A;  3BRT B;  1N7S C;  2GM4 A;  4C7N B;  3TSI A;  5AW1 B;  4I2L C;  5AW5 B;  1G2C B;  1GTW A;  3GHG B;  5AW0 B;  1LTA C;  3V2R A;  2FYU K;  1N73 A;  3O8Z A;  4OH8 B;  3TYY A;  2M8R A;  3M06 A;  3A3Y B;  1J2J B;  4ZKU A;  5AW2 B;  5APW A;  2OAR A;  1HTL C;  3HRN A;  1SQQ K;  2POH A;  5AVQ B;  4GIF A;  2YMY A;  2E43 A;  1L4A C;  1XTC C;  2FKW B;  3U1C A;  5AVT B;  1J1D C;  3B5N C;  5CCG A;  2QM7 A;  2WZ7 A;  3NMD A;  2OYH B;  3NXS A;  4N78 E;  3TNU B;  1NWQ A;  3RK2 D;  3V2P A;  2BAS A;  1HGV A;  2Q3I A;  4KHX A;  2WTY A;  3U1A A;  3L36 A;  3RK2 B;  5APX A;  3A2A A;  4AQR D;  5BVZ A;  2Q7C A;  2ZFC A;  5AVR B;  1FJP A;  1GL2 D;  3HUS C;  2HFE D;  3C9I A;  1URQ A;  4ZKP A;  4RES B;  3NTN A;  1WT6 A;  1FZC C;  4N6J A;  1M1J C;  1N7S A;  3VTP C;  1NU1 K;  1GL2 B;  1ZLL A;  3SWY A;  1JCD A;  2FFD C;  2KP8 A;  1LWU C;  2N1T B;  2YKQ A;  3LIE A;  5CCH A;  2Z4E A;  3L37 A;  3CI9 A;  2HOD A;  2GUS A;  5AW6 B;  1GD2 E;  1VPC A;  2H8P D;  3WMM 0;  1NOH A;  1LGH B;  2R5D A;  3CLQ A;  1NH4 A;  2NPS C;  1H88 A;  4W7Y A;  1YTZ I;  3MD0 A;  1FZG A;  1SLQ A;  3M9H A;  1FJK A;  1SQV K;  2KOG A;  1N73 B;  5AVS B;  1RF0 C;  1L4A A;  1JMM A;  2XU6 A;  2P7J A;  1FZA A;  1HBW A;  5AW4 B;  5KLV K;  4DOJ A;  2WPS A;  3OAK A;  1FU1 A;  1VDF A;  1LTI C;  4I6M C;  1JY3 P;  5AVX B;  3P8M C;  3LW5 H;  3BVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...