1L4AA

X-ray structure of the neuronal complexin/snare complex from the squid loligo pealei
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
QPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a neuronal complexin-SNARE complex from squid.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SYNAPTOBREVIN
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2002-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l4aA00
3HTKB 2N1TB 4LGDE 1XTGB 3HD7D 3RK2D 5KJ7A 1L4AC 1KILC 3HD7B 5CCGA 3RL0C 1N7SC 1KILB 2N1TA 2M8RA 1URQB 3B5NB 1SFCC 5KJ7D 2HFED 5CCHA 2WZ7A 5CCHD 1URQD 3B5ND 1SFCA 5CCGD 1SFCB 4WY4A 2NPSA 2KOGA 1HVVA 1URQC 3B5NC 1GL2A 3HD7A 1N7SB 1NHLA 3RK3D 1N7SD 3KYQA 3TSIA 2N1TD 5CCGC 1T3JA 3M0DC 1GL2D 4W7ZA 2XDJA 1L4AB 3RK2B 5KJ7C 1L4AA 1L4AD 2N1TC 4WY4B 3RK2C 2NPSB 4OH8B 4N78E 1N7SA 2NPSD 1JTHA 1KILD 1URQA 3B5NA 4W80A 3HD7C 2YMYA 5CCHC 3PP5A 4JF7A 4WY4C 1SFCD 4W7YA 1KILA 1JTHB 3RL0D 2HG5D 2H8PD 3P8CE 3RK3B 3VOPA 1GL2B 3RL0B 1GL2C 3RK3C 2PP6A 2NPSC 4WY4D
chains in the Genus database with same CATH superfamily
3HTKB 2BCCG 2IX7C 1Q2NA 1RH5B 2RKLA 3G9RA 4OVNF 4LGDE 3USSA 1S9KD 2B87A 1K8AQ 2E76D 1BSHA 1J1DC 2IBZI 3V4WA 1SQPG 3JC22 5KAIE 1T2KC 2QIWA 3A0BH 2PAJA 5AW1B 2QJKC 3EQ2A 3OJAB 1GW3A 4DCKA 3L36A 2FYNB 3HE5A 3AE3C 2JP3A 3R2PA 1DD3A 1KILC 1NH4A 2YO2A 1IFDA 2ZT9C 2JR8A 2IYOA 5GTHH 3T97A 1KB9E 3H1LG 4C7RA 1VQ9P 1M1JB 1ZOYC 1N73C 1LT9B 5AW7B 3TNUA 1G1IA 1SQXJ 1X22A 3IF4A 4ZKPA 4Y28J 2OYHA 2KNCB 2K9YA 3CX5H 2E74D 1N73A 3MP7B 3LIDA 1SQPE 1VQMP 3AE8C 2OYIA 4R4LA 2HODA 2N1TA 2Q7CA 4BWNA 2WVRA 1FAVA 2E43A 1NTMK 1URQB 3B5NB 3KZIH 4EDFA 1NTZK 5GTIH 1FDIA 5EFWB 1NWQA 1RF1C 3HTKA 1IC2A 1NTMJ 2K9JB 3AE2C 1KB9H 3CWBD 3IAOA 1NU1K 3NMDA 2K88A 4L76A 1EXIA 1MV8A 5AVTB 3OAKA 2YKOA 3BRVB 1FZAA 1SFCA 5CCGD 3B8EB 2ITAA 1N8RQ 1VDFA 3VMAA 1KFMA 3AEAC 1LTBC 2NPSA 1D7MA 2V4HA 1IK9A 5APQA 3CCMP 2XNXA 5B5EH 1M90Q 1BDDA 1G2CA 2AXTH 1IJDB 1SQXD 5AW3B 1VQ6P 1M1JA 2G3AA 1PP9D 2BEZF 3JSVC 3CCUP 2RN0A 1NTKK 1USDA 5H2FE 1M1JC 1N73B 3M9HA 2K3RA 1K9MQ 3I5CA 3H1ID 3BCCE 3GG2A 2AEJA 1NGMB 4AYCA 3VP9A 4M3LA 2QM7A 1AQTA 2JJLA 4Y99C 3HE4A 3L72G 4K3AA 2WPRA 1KZUB 2W83C 2C0XA 3E1IA 4GIFA 4K35A 3AE1C 2QE7H 1L4AA 3RL0g 5KJ7C 3CCQP 1L0ND 1M57D 2P67A 2P2UA 3H1IJ 3H1IE 1L4AD 2N1TC 5M1BA 3HUSC 4N78D 1BE3G 2OARA 4WY4B 3OA7A 2IPPA 2NPSB 1U7JA 3GLMA 3S9OA 4DZOA 2Y9ZA 1RF1B 3NXSA 1P84E 2O1KA 2XZRA 2P58A 3E1RA 3O6QB 2QVAA 1G2CB 1KYOI 2O3JA 3L73D 1L0NJ 3PH0A 4L74A 4N78E 4XFJA 5AW9B 1OVRA 2KSEA 3V5BA 1JY2P 3K5BA 1MFZA 1PPJE 3H1HE 5KKZB 2QA4P 3WUUA 3CC2P 1CZQA 1W5CE 1H89A 4XE5B 3L74G 3FGAD 3GW6A 1RE3C 4UB6E 3P8CD 1YTZI 1FDMA 1K05A 1VF5B 1OVVA 2FYNC 5CCHC 1K73Q 2FYUE 2WSCJ 3CCVP 1FZCC 2E74B 1DX7A 1NAYA 3Q5SA 3H1HD 2IBZE 2KK7A 3RBXA 3U1CA 1QL2A 1Y47A 2IZ0A 2BCCE 2W6AA 2W6BA 3FX0A 3AEFC 3VMYA 1ZN5A 3FXEA 4C7NB 5BVZA 1SQVG 1GMJA 3EFFK 4U3FG 1PP9G 3D6ZA 4L73A 2RH0A 4PJ0H 2WPQA 1RF1A 2FYUD 4UB6H 2CK3H 1OX3A 2VRSA 2H8PD 2FXPA 1FZEA 1JY2N 2I1KA 3AE4C 1KN7A 1SQQG 2H88C 2OYOA 5TISE 1KORA 5TJHA 3VOPA 1DEEG 4R4MA 2FYZA 1NTMD 2FY8A 3M0DA 4JQ0D 3TYYA 1EDIA 2QSIA 3L75G 2B9BA 4ZMDA 1NTME 2IZ1A 1HGZA 2YKPA 1SQQJ 2D2CB 3AEDC 3RK3C 1NTZJ 1ZRTE 4DJGA 5KAFE 3HRNA 1SQPK 4JBZA 3QWOC 1NU1J 1M1KQ 3N7NA 2Y0DA 3F89A 2FFDB 1Q90D 1SQVJ 1ZRTD 3H1HJ 4BRYA 3SWFA 1L2PA 3WUVA 1FC2C 2GUVA 3HD7D 3RK2D 3VP8A 1BDCA 5KJ7A 4HKZH 1L4AC 3CX5I 2IFNA 2XNDH 4PD4H 5APVA 2L5GB 4D6TJ 4EOTA 1L0NK 1FOSE 3CWBE 5DJTB 1QEXA 3HD7B 1LT9A 1LTSC 2C0WA 3B71A 3CLQA 3KPEA 1JY3N 1VPCA 3BCCD 3L74J 4EYYQ 2OYIC 3L70E 3RL0C 1BGYD 1JY3O 1PIXA 1EZVG 1LT9C 3C9IA 3CX5D 3H1HG 3ABVC 2K37A 3PRJA 4N6JA 2P1JA 3VMZA 2HLOA 3SWKA 1IFPA 2Z4EA 1PP9E 2QJYB 1EZVD 2ZFCA 3L70D 4H44B 4IFMA 2E5TA 2BEQD 2M8RA 3GHGB 4I6MC 3G71P 1DD4A 1SFCC 2JKVA 2Q1KA 2Z5IA 2C9LY 1S5LE 1PV3A 2H89C 5CCHA 1IFJA 4GOEA 4KJMA 3SWYA 2NRGA 2ZVOB 2E42A 2JDIH 1FZBA 3IR9A 2HPCB 2Q3EA 1HJ0A 5AVYB 2HPCA 3Q3DA 4IFDK 3AE7C 2J59M 2KSJA 1X8YA 2ZJSE 4KT0J 5CHXA 3G4SP 2LR2A 1EDLA 1RQUA 1JY3P 1SQBG 4D6TG 3HD7A 1RE4A 3UIAA 3T97B 1N7SB 1HF9A 1GU4A 1JCCA 2JEEA 2I8DA 2LXCB 2AXCA 1VQ8P 2OTLP 1J1EC 1NHLA 1RE4C 2OYIB 1J1EB 4H13B 2PFXA 3AEEC 1RHZB 1YTZT 3P7KA 4PV1B 3R4YA 5AW2B 2H43A 4DOJA 1JY2O 3TSIA 1SQBJ 3L74E 1BE3E 2IBZD 1S2EA 1UIXA 3L71J 3M91A 3M0DC 1Q7YQ 1UIIA 5GTHE 4W7ZA 1KQSO 2QJPB 1M8OB 1P84I 2FYUK 1L4AB 5AW6B 1JMMA 3ZDMA 1NYHA 1EQ7A 2YIUB 4IFFA 1S72P 1YJNP 1Z56A 1KYOD 4GOFA 1AJYA 2Q5UA 3CI9A 4GODA 1X79B 1JM0A 1NO4A 4NPDA 1PL5A 2WSEJ 1NTZD 1SQVE 3A3YB 3RK2C 3RK3E 3CMAP 1VQNP 2CPSA 2WSCH 1A02F 1HBWA 1NTZG 2R32A 2QJYC 3AE9C 2GM4A 1SQPD 1QLED 1RE3A 2A45G 1FDOA 2KZJA 3L71D 2YMKA 1JB0J 4U7JA 1VQKP 3HD7C 3AEGC 1YITP 3WUTA 3L72J 5CMZA 3TNUB 4WVZA 3PP5A 2R5BA 4HYTB 5AVVB 1DEBA 1NTKJ 1SFCD 1ZXGA 4RJTA 1S5LX 4ZKUA 5BU8B 4W7YA 4D6TD 1AA0A 1ZLLA 1L0LK 2A45H 4HB1A 2WMMA 2P10A 3JCUE 1MKMA 3TK1A 1M56D 4QMAA 4TLFA 1NTKG 2O1JA 2KS1A 2AEMA 5AVUB 2KLVA 1VQOP 1JMBA 2WTYA 2KS1B 3D6YA 3CWBG 3KDPB 3RL0D 1IK7A 1VF5C 2KZIA 5KLVK 2IFMA 3RK3B 1Q82Q 3CC7P 1PGQA 2IBZG 1FZGA 2W90A 2XV5A 2O01N 3MUDA 3L75J 4LLHA 1LT1A 2ZT9D 2HR3A 3HE5B 4UB8H 3MTUE 2J5UA 3H1JG 2Y0CA 4EIJA 1HGVA 1KQGB 3MUDC 3JCUH 1NJIQ 1XTCC 3GMAA 1VL2A 1T8ZA 1NKNA 4NPFX 1NU1G 2ZT9B 1LTJA 4ASWA 1P84H 2YXQB 3PTZA 3OW2O 2E76B 4IOIH 5CBOA 1N7LA 1OMIA 1PGPA 2R5DA 1PP9J 1IO4A 1QVFO 1G1JA 4O9BA 2HODB 1BGYE 2DW3A 2N1TB 1SP4A 3AEBC 3MGNA 1SQXE 1S4XA 4UB8E 2V7QH 2FBWC 3H1KD 1XTGB 5AVXB 3RBZA 2R3SA 2RMZA 1EDKA 1H88A 1H8AA 4PD4D 3PJSK 1IFMA 2JO1A 1N2DC 1K04A 1NKZB 2POHA 3Q1MA 3H32B 1JOCA 3L71G 2FKWB 2W8ZA 5AVZB 4TT3H 3A5TA 3I56P 3CL3D 2AEFA 1YIJP 3H1KE 1OWAA 3LW5H 4CPGA 1BE3D 1KQFB 1AV1A 5KKZC 1AVOA 4PJ0E 2A06E 3MIWA 1USEA 2ZXXA 2LXBA 3CXHI 4RKUJ 4I1LA 1EDJA 2HYNA 5AW4B 1QGKB 2R3CA 3S1KA 1EXJA 1JEKA 4I7ZB 4BRYB 1VQLP 1BE3J 3EFGA 3V6IA 4A7PA 5KJ7D 1L0LG 2A45I 4RO0A 2HFED 5KLVE 1RY3A 3H1JE 1X9VA 3H6PA 1YJWP 3M06A 4YXWH 2WZ7A 1LTJC 5CCHD 1YI2P 1T2KD 3KXDA 3H1JD 5KLVJ 4I7ZC 2KOGA 1URQC 2WSFJ 3B5NC 1GL2A 4C7NA 4B86A 1HWTC 4PD4I 2WWWA 4U3FD 1LJ2A 2PGDA 3VYIA 1OW6A 3H1IG 2OYHC 3CD6P 4AQRD 2ZXEB 2BCCJ 3RK3D 2BCCD 3A0HE 3TF5A 4YPCA 3CPWO 1VQ5P 1CW5A 3E7KA 3H1LJ 3KYQA 4U3FE 2N1TD 1DH3A 1FS0E 1AQ5A 1T3JA 3L72E 4H0LC 1BSNA 1S1CX 2QJKB 3Q2YA 3RK2B 3SSUA 2SPZA 1KYOH 2WT7A 2FXMA 3EWKA 1SS1A 1AVYA 3L75D 3L72D 1LTJB 1J1DB 5KAFH 3IN6A 3PHLA 3O8ZA 1Y8AA 3H1LD 5AW0B 4BXLA 1KD1Q 1U7MA 1WMKA 3A0HH 3FWNA 1EC5A 3RGUA 1TU3F 3M9QA 2E74C 5KTBA 1FZCB 2Q3IA 1JUNA 5L8RJ 2E76C 2LKMA 1LGHB 2KYVA 5APWA 3CCEP 1N7SA 1NAFA 1SVFA 4D6TE 4ZNCA 1BCCE 3VMXA 2NPSD 1JTHA 3BCCJ 3F5HA 3GF3A 1J2JB 1KILD 2Q6QA 3L35A 3L73G 4H44D 4HJGH 1KFNA 4PV1C 3P32A 1URQA 3B5NA 4WB4A 4W80A 5KLIB 1EZVI 1AFOA 2KIKA 3WMM0 1ZR2A 3CXHE 2UWJE 3FXDA 1SQQE 2MKVA 3W68A 1BCCD 1GK4A 2IDBA 1OXZA 1KILE 4WY4C 3V2QA 1GU5A 2WSEH 4U3FJ 5E79E 5AVWB 1GTWA 2KLUA 3P8MC 1CI6A 1BCCG 1LWUC 2KXPB 5APYA 4C46A 5BU5A 3H25A 1SQXG 2WITA 2WPSA 3GHGA 3L70G 2QM8A 1EZVE 3C1LA 1LWUA 2WQYC 3C8VA 3CX5E 5APSA 1YYCA 2B87B 1SQQD 3U1AA 1RF0C 3CXHH 2YXRB 1M7LA 3GHGC 1SQBE 4Y99B 3LIEA 2HG5D 4H0LB 1VQPP 1YQ3C 4H13D 1OZHA 1ZR4A 1KC8Q 2FYUG 1T6AA 4JYBA 3VN0A 3KZIE 4GDOA 2QEXP 5GTIE 1T3UA 2IYPA 2ZVNB 2WSFH 4JPZB 1GZLA 2D2CD 5E79H 2V7QJ 2KP8A 1MZ9A 2N9BA 1KMIZ 1GL2C 3RL0B 4GT1A 1HH0A 3II6A 1OW7A 3KHUA 1OW8A 1L0NG 2P7JA 1WRGA 1W2BO 1SQBD 1P84D 3MZWB 2FYUJ 4OGQB 1IFNA 3TGUE 1QVGO 2KI7B 4N3YB 3KQGA 5B5EE 2XU6A 1R5SA 2R44A 2AXTE 2K9JA 2L91A 2OQQA 3L70J 4MN4C 2H7HA 5B66E 1LTAC 3BVHA 5AVSB 2C9NY 1BCCJ 3CC4P 5H2FH 1LP1B 3PLNA 1R8EA 1W2EA 1BGYJ 1VQ7P 1L0NE 2MJZA 2J58A 1ZW0A 4RESB 5AW5B 3TGUJ 3Q5PA 2ZYAA 3AE5C 4ASVA 1PZQA 1R5LA 3L74D 3CCRP 2D2CC 1FBMA 2M5AA 5CCGA 1H0TB 1BGYG 1H0TA 1NOHA 1L0LE 2FXOA 1GDTA 4IL6H 1S3JA 2GA1A 2M0BA 1RF0A 2KB7P 3L73E 3ITKA 5B66H 1S9KE 3BCCG 1NU1E 2CPBA 2KNCA 1N7SC 1HJBA 1A02J 1KILB 4NPEA 1NTZE 1SQVD 1Q81Q 4DT0A 1QX8A 2M3BA 2FFDA 2W6JH 3H1LE 1JO5A 2M3EA 1HUCA 1MUUA 2BASA 1FZFA 5K5GB 1FU1A 1KB9D 1OVUA 2E75B 3IFMA 4JYCA 2E75C 4LC1A 1URQD 3B5ND 3H32A 1NTMG 4IL6E 3W67A 1LP1A 1SLQA 2PRRA 2YIUC 1SFCB 3L75E 4GKGA 4WY4A 3V4QA 4HH2A 4Z1MH 1HVVA 2O01J 1CI6B 2QJPC 3L71E 2E75D 4KHXA 5APXA 5AVQB 5C39A 3I55P 1Q86Q 3AE6C 3TGUG 2WSSH 1SQBK 2M5AB 2Y0EA 4H44C 4PV1D 1RQVA 1YBKA 5AVRB 3CCLP 3L4FA 2OGUA 5CBNA 1CSBA 1YQ4C 3NFQA 3CMEP 2NZ2A 3LW5J 3B4SA 3CCJP 4YTPC 1SQXK 1U57A 1N7SD 3A7OA 5APTA 2JWAA 5CCGC 3N4XA 5APUA 4L75A 1GK6A 1GL2D 1QL1A 1SQQK 3QH9A 2XDJA 3SFDC 2WT7B 1VQ4P 1OFCX 2E5YA 2XKMA 3CXHD 3S4RA 1SQPJ 3TDKA 5TISH 4OGQD 4YXDC 2N9YB 1OIPA 2GUSA 3CCSP 3MHVA 1SQVK 2OTKE 2KUBA 3A2AA 4IL6X 3SFEC 3FWLA 3H1KJ 3U59A 4AUWA 4OH8B 2QG4A 1KQLA 2YO3A 3BATA 3WU2E 3G6EP 3H1KG 3O6QA 1LTGC 1FJPA 1GW4A 2B89A 3V2RA 3M0AA 2YNYA 2OYHB 1PGOA 3V2PA 1PFIA 1E5WA 1X0TA 1ZP0C 3VTPC 1N86A 2Z5HA 1FJKA 1YJ9P 4WWIA 2B88A 1JCDA 2JWDA 4I2LC 3L37A 5CJ4A 2YMYA 3D71A 1ZMEC 4PD4E 2ZAEB 2W27A 1LTIC 4JF7A 3WU2H 2OTJP 1KTMA 3TGUD 2Q9IA 1KILA 1PGJA 1VF5D 2ZYGA 5AW8B 2A06D 1WT6A 1LWUB 2ZYDA 1FZCA 2FFDC 3AECC 1IZNB 1LTTC 2A06G 1KV4A 1L0LD 1JTHB 1NTKD 2K1AA 3P8CE 1E79H 1MFTA 2QRXA 1KB9I 3BRTB 1Y9BA 4OGQC 3Q5RA 1GD2E 1KYOE 5KLVG 1LNQA 3GF7A 1FE6A 1IFIA 2I1JA 3BASA 2O01H 5DJUB 4WBAA 4H13C 4EI2A 2WPVB 5KLIC 1GL2B 5CJ0A 1HTLC 4H0LD 3H1JJ 1PPJG 2YKQA 3HE4B 3L73J 5KLVD 1S5LH 3G3ZA 3V2NA 4OWFA 1NVOA 5KAIH 1JNMA 1L0LJ 3A0BE 1NTKE 3MD0A 1DIPA 1PPJD 3M9BA 2Y9YA 1FOSF 3D70A 3CWBJ 4XA4A 2PP6A 3NTNA 3HUSA 1NU1D 2NPSC 2G8YA 1YHQP 1ZV8A 4WY4D 3HUSB
chains in the Genus database with same CATH topology
3HTKB 2IX7C 1S9KD 4LGDE 1J1DC 3V4WA 1T2KC 2PAJA 5AW1B 3EQ2A 3OJAB 1GW3A 3L36A 3R2PA 3HE5A 5AVZB 1KILC 2YO2A 1NH4A 1IFDA 3T97A 4C7RA 1M1JB 1N73C 1LT9B 5AW7B 3TNUA 1G1IA 4ZKPA 1N73A 3LIDA 2OYIA 2HODA 2N1TA 2Q7CA 2E43A 1FAVA 1NTMK 1URQB 3B5NB 1NWQA 1NTZK 1RF1C 3HTKA 1IC2A 3NMDA 1NU1K 1MV8A 5AVTB 3OAKA 2YKOA 3BRVB 1FZAA 1SFCA 5CCGD 3B8EB 1VDFA 1KFMA 5APQA 1LTBC 2NPSA 1IK9A 2XNXA 1G2CA 1IJDB 5AW3B 1M1JA 1NTKK 1M1JC 1N73B 3M9HA 3I5CA 4AYCA 3VP9A 4M3LA 2QM7A 2JJLA 4Y99C 3HE4A 3SWYA 2WPRA 1KZUB 2C0XA 3E1IA 4GIFA 5KJ7C 1L4AA 2P67A 2P2UA 1L4AD 2N1TC 3HUSC 4N78D 2OARA 4WY4B 3OA7A 2IPPA 2NPSB 1RF1B 4DZOA 3NXSA 2O1KA 2XZRA 1G2CB 4N78E 5AW9B 3V5BA 1JY2P 1MFZA 1CZQA 1H89A 4XE5B 1RE3C 3P8CD 1YTZI 1FDMA 5CCHC 1FZCC 1DX7A 3U1CA 1QL2A 2W6AA 2W6BA 3VMYA 4C7NB 5BVZA 1ZN5A 1RF1A 2WPQA 2VRSA 2H8PD 1FZEA 1JY2N 2I1KA 3VOPA 2FYZA 3M0DA 3TYYA 1HGZA 2YKPA 3RK3C 3HRNA 1SQPK 3N7NA 2FFDB 3SWFA 2GUVA 3HD7D 3VP8A 3RK2D 5KJ7A 1L4AC 2IFNA 5APVA 2L5GB 4EOTA 1L0NK 1FOSE 3HD7B 1LT9A 1LTSC 2C0WA 3CLQA 3KPEA 1JY3N 1VPCA 2OYIC 3RL0C 4DOJA 1JY3O 3C9IA 1LT9C 4N6JA 3VMZA 2P1JA 2HLOA 2Z4EA 2ZFCA 4IFMA 2M8RA 3GHGB 4I6MC 1SFCC 2Z5IA 2C9LY 5CCHA 1IFJA 2E42A 1FZBA 3IR9A 2HPCB 5AVYB 2HPCA 4IFDK 2J59M 2KSJA 1X8YA 5CHXA 1JY3P 3HD7A 1RE4A 3UIAA 1N7SB 1GU4A 1JCCA 2JEEA 1J1EC 1NHLA 1RE4C 2OYIB 1J1EB 2H43A 3P7KA 1YTZT 5AW2B 1JY2O 3TSIA 2OYHA 3M91A 3M0DC 4W7ZA 2FYUK 1L4AB 5AW6B 1JMMA 1EQ7A 4IFFA 1Z56A 2Q5UA 3CI9A 1X79B 1NO4A 3A3YB 3RK2C 2CPSA 2WSCH 1HBWA 2R32A 2GM4A 1RE3A 2A45G 3HD7C 5CMZA 3TNUB 3PP5A 2R5BA 4HYTB 5AVVB 1DEBA 1SFCD 4ZKUA 5BU8B 4W7YA 1ZLLA 2A45H 1L0LK 3TK1A 2O1JA 5AVUB 2KLVA 2WTYA 3KDPB 3RL0D 5KLVK 2IFMA 3RK3B 1FZGA 2XV5A 3MUDA 4LLHA 3HE5B 3MTUE 4EIJA 1HGVA 1XTCC 1T8ZA 1NKNA 1LTJA 1N7LA 2R5DA 1IO4A 1G1JA 4O9BA 2HODB 2N1TB 3MGNA 1SP4A 5AVXB 1XTGB 1H88A 1H8AA 1IFMA 1N2DC 1NKZB 2POHA 3H32B 1JOCA 2FKWB 3A5TA 3CL3D 1OWAA 3LW5H 3MIWA 4I1LA 2HYNA 5AW4B 2R3CA 3EFGA 5KJ7D 2A45I 2HFED 1RY3A 1X9VA 3H6PA 3M06A 2WZ7A 1LTJC 5CCHD 1T2KD 2KOGA 1URQC 3B5NC 1GL2A 4C7NA 4B86A 1HWTC 2WWWA 3VYIA 2OYHC 4AQRD 2ZXEB 3RK3D 1CW5A 3KYQA 1DH3A 2N1TD 1AQ5A 1T3JA 3RK2B 2WT7A 2FXMA 1LTJB 1J1DB 3O8ZA 5AW0B 5KTBA 3M9QA 1FZCB 2Q3IA 1JUNA 2LKMA 1LGHB 2KYVA 5APWA 1N7SA 1NAFA 1SVFA 3VMXA 2NPSD 1JTHA 1J2JB 1KILD 3L35A 1GDTA 1KFNA 3P32A 1URQA 3B5NA 4WB4A 4W80A 1AFOA 3WMM0 1ZR2A 1GK4A 1OXZA 4WY4C 3V2QA 1GU5A 2WSEH 5AVWB 1GTWA 4C46A 3P8MC 1CI6A 1LWUC 5APYA 5BU5A 2WITA 2WPSA 3GHGA 2QM8A 5APSA 1LWUA 3U1AA 1YYCA 1RF0C 3GHGC 1JO5A 1M7LA 4Y99B 3LIEA 2HG5D 1ZR4A 4JYBA 3VN0A 1T3UA 1A02F 2WSFH 1GZLA 2KP8A 1MZ9A 2N9BA 3RL0B 1GL2C 4GT1A 1HH0A 3II6A 2P7JA 1WRGA 1IFNA 4N3YB 3KQGA 2XU6A 2H7HA 1LTAC 3BVHA 5AVSB 2C9NY 1W2EA 2MJZA 4RESB 2J58A 5AW5B 1FBMA 5CCGA 1NOHA 1S9KE 1RF0A 2KB7P 2CPBA 1HJBA 1N7SC 1A02J 1KILB 2FFDA 2M3BA 1HUCA 1MUUA 2BASA 1FZFA 1FU1A 4JYCA 3IFMA 4LC1A 1URQD 3B5ND 3H32A 1SLQA 4GKGA 1SFCB 4WY4A 3V4QA 4HH2A 1HVVA 4KHXA 1CI6B 5APXA 5AVQB 5AVRB 1SQBK 3L4FA 1CSBA 3NFQA 1SQXK 1N7SD 3A7OA 5APTA 5CCGC 3N4XA 5APUA 1GK6A 1GL2D 1QL1A 1SQQK 2XDJA 2WT7B 2XKMA 2GUSA 1SQVK 3A2AA 3U59A 4AUWA 4OH8B 1KQLA 2YO3A 3BATA 1LTGC 1FJPA 1GW4A 3V2RA 3M0AA 2YNYA 2OYHB 3V2PA 1PFIA 1E5WA 3VTPC 1N86A 2Z5HA 1FJKA 1JCDA 5CJ4A 4I2LC 3L37A 2YMYA 2W27A 1LTIC 4JF7A 2Q9IA 1KILA 5AW8B 1FZCA 1WT6A 1LWUB 2FFDC 1LTTC 1JTHB 3P8CE 1GD2E 3BRTB 1IFIA 2I1JA 3BASA 2O01H 4WBAA 1GL2B 5CJ0A 1HTLC 2YKQA 3HE4B 3V2NA 3G3ZA 1JNMA 3MD0A 3M9BA 1FOSF 4XA4A 2PP6A 3NTNA 3HUSA 2NPSC 1ZV8A 4WY4D 3HUSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTK B;  2N1T B;  4LGD E;  1XTG B;  3HD7 D;  3RK2 D;  5KJ7 A;  1L4A C;  1KIL C;  3HD7 B;  5CCG A;  3RL0 C;  1N7S C;  1KIL B;  2N1T A;  2M8R A;  1URQ B;  3B5N B;  1SFC C;  5KJ7 D;  2HFE D;  5CCH A;  2WZ7 A;  5CCH D;  1URQ D;  3B5N D;  1SFC A;  5CCG D;  1SFC B;  4WY4 A;  2NPS A;  2KOG A;  1HVV A;  1URQ C;  3B5N C;  1GL2 A;  3HD7 A;  1N7S B;  1NHL A;  3RK3 D;  1N7S D;  3KYQ A;  3TSI A;  2N1T D;  5CCG C;  1T3J A;  3M0D C;  1GL2 D;  4W7Z A;  2XDJ A;  1L4A B;  3RK2 B;  5KJ7 C;  1L4A A;  1L4A D;  2N1T C;  4WY4 B;  3RK2 C;  2NPS B;  4OH8 B;  4N78 E;  1N7S A;  2NPS D;  1JTH A;  1KIL D;  1URQ A;  3B5N A;  4W80 A;  3HD7 C;  2YMY A;  5CCH C;  3PP5 A;  4JF7 A;  4WY4 C;  1SFC D;  4W7Y A;  1KIL A;  1JTH B;  3RL0 D;  2HG5 D;  2H8P D;  3P8C E;  3RK3 B;  3VOP A;  1GL2 B;  3RL0 B;  1GL2 C;  3RK3 C;  2PP6 A;  2NPS C;  4WY4 D; 
#chains in the Genus database with same CATH topology
 3HTK B;  2BCC G;  2IX7 C;  1Q2N A;  1RH5 B;  2RKL A;  3G9R A;  4OVN F;  4LGD E;  3USS A;  1S9K D;  2B87 A;  1K8A Q;  2E76 D;  1BSH A;  1J1D C;  2IBZ I;  3V4W A;  1SQP G;  3JC2 2;  5KAI E;  1T2K C;  2QIW A;  3A0B H;  2PAJ A;  5AW1 B;  2QJK C;  3EQ2 A;  3OJA B;  1GW3 A;  4DCK A;  3L36 A;  2FYN B;  3HE5 A;  3AE3 C;  2JP3 A;  3R2P A;  1DD3 A;  1KIL C;  1NH4 A;  2YO2 A;  1IFD A;  2ZT9 C;  2JR8 A;  2IYO A;  5GTH H;  3T97 A;  1KB9 E;  3H1L G;  4C7R A;  1VQ9 P;  1M1J B;  1ZOY C;  1N73 C;  1LT9 B;  5AW7 B;  3TNU A;  1G1I A;  1SQX J;  1X22 A;  3IF4 A;  4ZKP A;  4Y28 J;  2OYH A;  2KNC B;  2K9Y A;  3CX5 H;  2E74 D;  1N73 A;  3MP7 B;  3LID A;  1SQP E;  1VQM P;  3AE8 C;  2OYI A;  4R4L A;  2HOD A;  2N1T A;  2Q7C A;  4BWN A;  2WVR A;  1FAV A;  2E43 A;  1NTM K;  1URQ B;  3B5N B;  3KZI H;  4EDF A;  1NTZ K;  5GTI H;  1FDI A;  5EFW B;  1NWQ A;  1RF1 C;  3HTK A;  1IC2 A;  1NTM J;  2K9J B;  3AE2 C;  1KB9 H;  3CWB D;  3IAO A;  1NU1 K;  3NMD A;  2K88 A;  4L76 A;  1EXI A;  1MV8 A;  5AVT B;  3OAK A;  2YKO A;  3BRV B;  1FZA A;  1SFC A;  5CCG D;  3B8E B;  2ITA A;  1N8R Q;  1VDF A;  3VMA A;  1KFM A;  3AEA C;  1LTB C;  2NPS A;  1D7M A;  2V4H A;  1IK9 A;  5APQ A;  3CCM P;  2XNX A;  5B5E H;  1M90 Q;  1BDD A;  1G2C A;  2AXT H;  1IJD B;  1SQX D;  5AW3 B;  1VQ6 P;  1M1J A;  2G3A A;  1PP9 D;  2BEZ F;  3JSV C;  3CCU P;  2RN0 A;  1NTK K;  1USD A;  5H2F E;  1M1J C;  1N73 B;  3M9H A;  2K3R A;  1K9M Q;  3I5C A;  3H1I D;  3BCC E;  3GG2 A;  2AEJ A;  1NGM B;  4AYC A;  3VP9 A;  4M3L A;  2QM7 A;  1AQT A;  2JJL A;  4Y99 C;  3HE4 A;  3L72 G;  4K3A A;  2WPR A;  1KZU B;  2W83 C;  2C0X A;  3E1I A;  4GIF A;  4K35 A;  3AE1 C;  2QE7 H;  1L4A A;  3RL0 g;  5KJ7 C;  3CCQ P;  1L0N D;  1M57 D;  2P67 A;  2P2U A;  3H1I J;  3H1I E;  1L4A D;  2N1T C;  5M1B A;  3HUS C;  4N78 D;  1BE3 G;  2OAR A;  4WY4 B;  3OA7 A;  2IPP A;  2NPS B;  1U7J A;  3GLM A;  3S9O A;  4DZO A;  2Y9Z A;  1RF1 B;  3NXS A;  1P84 E;  2O1K A;  2XZR A;  2P58 A;  3E1R A;  3O6Q B;  2QVA A;  1G2C B;  1KYO I;  2O3J A;  3L73 D;  1L0N J;  3PH0 A;  4L74 A;  4N78 E;  4XFJ A;  5AW9 B;  1OVR A;  2KSE A;  3V5B A;  1JY2 P;  3K5B A;  1MFZ A;  1PPJ E;  3H1H E;  5KKZ B;  2QA4 P;  3WUU A;  3CC2 P;  1CZQ A;  1W5C E;  1H89 A;  4XE5 B;  3L74 G;  3FGA D;  3GW6 A;  1RE3 C;  4UB6 E;  3P8C D;  1YTZ I;  1FDM A;  1K05 A;  1VF5 B;  1OVV A;  2FYN C;  5CCH C;  1K73 Q;  2FYU E;  2WSC J;  3CCV P;  1FZC C;  2E74 B;  1DX7 A;  1NAY A;  3Q5S A;  3H1H D;  2IBZ E;  2KK7 A;  3RBX A;  3U1C A;  1QL2 A;  1Y47 A;  2IZ0 A;  2BCC E;  2W6A A;  2W6B A;  3FX0 A;  3AEF C;  3VMY A;  1ZN5 A;  3FXE A;  4C7N B;  5BVZ A;  1SQV G;  1GMJ A;  3EFF K;  4U3F G;  1PP9 G;  3D6Z A;  4L73 A;  2RH0 A;  4PJ0 H;  2WPQ A;  1RF1 A;  2FYU D;  4UB6 H;  2CK3 H;  1OX3 A;  2VRS A;  2H8P D;  2FXP A;  1FZE A;  1JY2 N;  2I1K A;  3AE4 C;  1KN7 A;  1SQQ G;  2H88 C;  2OYO A;  5TIS E;  1KOR A;  5TJH A;  3VOP A;  1DEE G;  4R4M A;  2FYZ A;  1NTM D;  2FY8 A;  3M0D A;  4JQ0 D;  3TYY A;  1EDI A;  2QSI A;  3L75 G;  2B9B A;  4ZMD A;  1NTM E;  2IZ1 A;  1HGZ A;  2YKP A;  1SQQ J;  2D2C B;  3AED C;  3RK3 C;  1NTZ J;  1ZRT E;  4DJG A;  5KAF E;  3HRN A;  1SQP K;  4JBZ A;  3QWO C;  1NU1 J;  1M1K Q;  3N7N A;  2Y0D A;  3F89 A;  2FFD B;  1Q90 D;  1SQV J;  1ZRT D;  3H1H J;  4BRY A;  3SWF A;  1L2P A;  3WUV A;  1FC2 C;  2GUV A;  3HD7 D;  3RK2 D;  3VP8 A;  1BDC A;  5KJ7 A;  4HKZ H;  1L4A C;  3CX5 I;  2IFN A;  2XND H;  4PD4 H;  5APV A;  2L5G B;  4D6T J;  4EOT A;  1L0N K;  1FOS E;  3CWB E;  5DJT B;  1QEX A;  3HD7 B;  1LT9 A;  1LTS C;  2C0W A;  3B71 A;  3CLQ A;  3KPE A;  1JY3 N;  1VPC A;  3BCC D;  3L74 J;  4EYY Q;  2OYI C;  3L70 E;  3RL0 C;  1BGY D;  1JY3 O;  1PIX A;  1EZV G;  1LT9 C;  3C9I A;  3CX5 D;  3H1H G;  3ABV C;  2K37 A;  3PRJ A;  4N6J A;  2P1J A;  3VMZ A;  2HLO A;  3SWK A;  1IFP A;  2Z4E A;  1PP9 E;  2QJY B;  1EZV D;  2ZFC A;  3L70 D;  4H44 B;  4IFM A;  2E5T A;  2BEQ D;  2M8R A;  3GHG B;  4I6M C;  3G71 P;  1DD4 A;  1SFC C;  2JKV A;  2Q1K A;  2Z5I A;  2C9L Y;  1S5L E;  1PV3 A;  2H89 C;  5CCH A;  1IFJ A;  4GOE A;  4KJM A;  3SWY A;  2NRG A;  2ZVO B;  2E42 A;  2JDI H;  1FZB A;  3IR9 A;  2HPC B;  2Q3E A;  1HJ0 A;  5AVY B;  2HPC A;  3Q3D A;  4IFD K;  3AE7 C;  2J59 M;  2KSJ A;  1X8Y A;  2ZJS E;  4KT0 J;  5CHX A;  3G4S P;  2LR2 A;  1EDL A;  1RQU A;  1JY3 P;  1SQB G;  4D6T G;  3HD7 A;  1RE4 A;  3UIA A;  3T97 B;  1N7S B;  1HF9 A;  1GU4 A;  1JCC A;  2JEE A;  2I8D A;  2LXC B;  2AXC A;  1VQ8 P;  2OTL P;  1J1E C;  1NHL A;  1RE4 C;  2OYI B;  1J1E B;  4H13 B;  2PFX A;  3AEE C;  1RHZ B;  1YTZ T;  3P7K A;  4PV1 B;  3R4Y A;  5AW2 B;  2H43 A;  4DOJ A;  1JY2 O;  3TSI A;  1SQB J;  3L74 E;  1BE3 E;  2IBZ D;  1S2E A;  1UIX A;  3L71 J;  3M91 A;  3M0D C;  1Q7Y Q;  1UII A;  5GTH E;  4W7Z A;  1KQS O;  2QJP B;  1M8O B;  1P84 I;  2FYU K;  1L4A B;  5AW6 B;  1JMM A;  3ZDM A;  1NYH A;  1EQ7 A;  2YIU B;  4IFF A;  1S72 P;  1YJN P;  1Z56 A;  1KYO D;  4GOF A;  1AJY A;  2Q5U A;  3CI9 A;  4GOD A;  1X79 B;  1JM0 A;  1NO4 A;  4NPD A;  1PL5 A;  2WSE J;  1NTZ D;  1SQV E;  3A3Y B;  3RK2 C;  3RK3 E;  3CMA P;  1VQN P;  2CPS A;  2WSC H;  1A02 F;  1HBW A;  1NTZ G;  2R32 A;  2QJY C;  3AE9 C;  2GM4 A;  1SQP D;  1QLE D;  1RE3 A;  2A45 G;  1FDO A;  2KZJ A;  3L71 D;  2YMK A;  1JB0 J;  4U7J A;  1VQK P;  3HD7 C;  3AEG C;  1YIT P;  3WUT A;  3L72 J;  5CMZ A;  3TNU B;  4WVZ A;  3PP5 A;  2R5B A;  4HYT B;  5AVV B;  1DEB A;  1NTK J;  1SFC D;  1ZXG A;  4RJT A;  1S5L X;  4ZKU A;  5BU8 B;  4W7Y A;  4D6T D;  1AA0 A;  1ZLL A;  1L0L K;  2A45 H;  4HB1 A;  2WMM A;  2P10 A;  3JCU E;  1MKM A;  3TK1 A;  1M56 D;  4QMA A;  4TLF A;  1NTK G;  2O1J A;  2KS1 A;  2AEM A;  5AVU B;  2KLV A;  1VQO P;  1JMB A;  2WTY A;  2KS1 B;  3D6Y A;  3CWB G;  3KDP B;  3RL0 D;  1IK7 A;  1VF5 C;  2KZI A;  5KLV K;  2IFM A;  3RK3 B;  1Q82 Q;  3CC7 P;  1PGQ A;  2IBZ G;  1FZG A;  2W90 A;  2XV5 A;  2O01 N;  3MUD A;  3L75 J;  4LLH A;  1LT1 A;  2ZT9 D;  2HR3 A;  3HE5 B;  4UB8 H;  3MTU E;  2J5U A;  3H1J G;  2Y0C A;  4EIJ A;  1HGV A;  1KQG B;  3MUD C;  3JCU H;  1NJI Q;  1XTC C;  3GMA A;  1VL2 A;  1T8Z A;  1NKN A;  4NPF X;  1NU1 G;  2ZT9 B;  1LTJ A;  4ASW A;  1P84 H;  2YXQ B;  3PTZ A;  3OW2 O;  2E76 B;  4IOI H;  5CBO A;  1N7L A;  1OMI A;  1PGP A;  2R5D A;  1PP9 J;  1IO4 A;  1QVF O;  1G1J A;  4O9B A;  2HOD B;  1BGY E;  2DW3 A;  2N1T B;  1SP4 A;  3AEB C;  3MGN A;  1SQX E;  1S4X A;  4UB8 E;  2V7Q H;  2FBW C;  3H1K D;  1XTG B;  5AVX B;  3RBZ A;  2R3S A;  2RMZ A;  1EDK A;  1H88 A;  1H8A A;  4PD4 D;  3PJS K;  1IFM A;  2JO1 A;  1N2D C;  1K04 A;  1NKZ B;  2POH A;  3Q1M A;  3H32 B;  1JOC A;  3L71 G;  2FKW B;  2W8Z A;  5AVZ B;  4TT3 H;  3A5T A;  3I56 P;  3CL3 D;  2AEF A;  1YIJ P;  3H1K E;  1OWA A;  3LW5 H;  4CPG A;  1BE3 D;  1KQF B;  1AV1 A;  5KKZ C;  1AVO A;  4PJ0 E;  2A06 E;  3MIW A;  1USE A;  2ZXX A;  2LXB A;  3CXH I;  4RKU J;  4I1L A;  1EDJ A;  2HYN A;  5AW4 B;  1QGK B;  2R3C A;  3S1K A;  1EXJ A;  1JEK A;  4I7Z B;  4BRY B;  1VQL P;  1BE3 J;  3EFG A;  3V6I A;  4A7P A;  5KJ7 D;  1L0L G;  2A45 I;  4RO0 A;  2HFE D;  5KLV E;  1RY3 A;  3H1J E;  1X9V A;  3H6P A;  1YJW P;  3M06 A;  4YXW H;  2WZ7 A;  1LTJ C;  5CCH D;  1YI2 P;  1T2K D;  3KXD A;  3H1J D;  5KLV J;  4I7Z C;  2KOG A;  1URQ C;  2WSF J;  3B5N C;  1GL2 A;  4C7N A;  4B86 A;  1HWT C;  4PD4 I;  2WWW A;  4U3F D;  1LJ2 A;  2PGD A;  3VYI A;  1OW6 A;  3H1I G;  2OYH C;  3CD6 P;  4AQR D;  2ZXE B;  2BCC J;  3RK3 D;  2BCC D;  3A0H E;  3TF5 A;  4YPC A;  3CPW O;  1VQ5 P;  1CW5 A;  3E7K A;  3H1L J;  3KYQ A;  4U3F E;  2N1T D;  1DH3 A;  1FS0 E;  1AQ5 A;  1T3J A;  3L72 E;  4H0L C;  1BSN A;  1S1C X;  2QJK B;  3Q2Y A;  3RK2 B;  3SSU A;  2SPZ A;  1KYO H;  2WT7 A;  2FXM A;  3EWK A;  1SS1 A;  1AVY A;  3L75 D;  3L72 D;  1LTJ B;  1J1D B;  5KAF H;  3IN6 A;  3PHL A;  3O8Z A;  1Y8A A;  3H1L D;  5AW0 B;  4BXL A;  1KD1 Q;  1U7M A;  1WMK A;  3A0H H;  3FWN A;  1EC5 A;  3RGU A;  1TU3 F;  3M9Q A;  2E74 C;  5KTB A;  1FZC B;  2Q3I A;  1JUN A;  5L8R J;  2E76 C;  2LKM A;  1LGH B;  2KYV A;  5APW A;  3CCE P;  1N7S A;  1NAF A;  1SVF A;  4D6T E;  4ZNC A;  1BCC E;  3VMX A;  2NPS D;  1JTH A;  3BCC J;  3F5H A;  3GF3 A;  1J2J B;  1KIL D;  2Q6Q A;  3L35 A;  3L73 G;  4H44 D;  4HJG H;  1KFN A;  4PV1 C;  3P32 A;  1URQ A;  3B5N A;  4WB4 A;  4W80 A;  5KLI B;  1EZV I;  1AFO A;  2KIK A;  3WMM 0;  1ZR2 A;  3CXH E;  2UWJ E;  3FXD A;  1SQQ E;  2MKV A;  3W68 A;  1BCC D;  1GK4 A;  2IDB A;  1OXZ A;  1KIL E;  4WY4 C;  3V2Q A;  1GU5 A;  2WSE H;  4U3F J;  5E79 E;  5AVW B;  1GTW A;  2KLU A;  3P8M C;  1CI6 A;  1BCC G;  1LWU C;  2KXP B;  5APY A;  4C46 A;  5BU5 A;  3H25 A;  1SQX G;  2WIT A;  2WPS A;  3GHG A;  3L70 G;  2QM8 A;  1EZV E;  3C1L A;  1LWU A;  2WQY C;  3C8V A;  3CX5 E;  5APS A;  1YYC A;  2B87 B;  1SQQ D;  3U1A A;  1RF0 C;  3CXH H;  2YXR B;  1M7L A;  3GHG C;  1SQB E;  4Y99 B;  3LIE A;  2HG5 D;  4H0L B;  1VQP P;  1YQ3 C;  4H13 D;  1OZH A;  1ZR4 A;  1KC8 Q;  2FYU G;  1T6A A;  4JYB A;  3VN0 A;  3KZI E;  4GDO A;  2QEX P;  5GTI E;  1T3U A;  2IYP A;  2ZVN B;  2WSF H;  4JPZ B;  1GZL A;  2D2C D;  5E79 H;  2V7Q J;  2KP8 A;  1MZ9 A;  2N9B A;  1KMI Z;  1GL2 C;  3RL0 B;  4GT1 A;  1HH0 A;  3II6 A;  1OW7 A;  3KHU A;  1OW8 A;  1L0N G;  2P7J A;  1WRG A;  1W2B O;  1SQB D;  1P84 D;  3MZW B;  2FYU J;  4OGQ B;  1IFN A;  3TGU E;  1QVG O;  2KI7 B;  4N3Y B;  3KQG A;  5B5E E;  2XU6 A;  1R5S A;  2R44 A;  2AXT E;  2K9J A;  2L91 A;  2OQQ A;  3L70 J;  4MN4 C;  2H7H A;  5B66 E;  1LTA C;  3BVH A;  5AVS B;  2C9N Y;  1BCC J;  3CC4 P;  5H2F H;  1LP1 B;  3PLN A;  1R8E A;  1W2E A;  1BGY J;  1VQ7 P;  1L0N E;  2MJZ A;  2J58 A;  1ZW0 A;  4RES B;  5AW5 B;  3TGU J;  3Q5P A;  2ZYA A;  3AE5 C;  4ASV A;  1PZQ A;  1R5L A;  3L74 D;  3CCR P;  2D2C C;  1FBM A;  2M5A A;  5CCG A;  1H0T B;  1BGY G;  1H0T A;  1NOH A;  1L0L E;  2FXO A;  1GDT A;  4IL6 H;  1S3J A;  2GA1 A;  2M0B A;  1RF0 A;  2KB7 P;  3L73 E;  3ITK A;  5B66 H;  1S9K E;  3BCC G;  1NU1 E;  2CPB A;  2KNC A;  1N7S C;  1HJB A;  1A02 J;  1KIL B;  4NPE A;  1NTZ E;  1SQV D;  1Q81 Q;  4DT0 A;  1QX8 A;  2M3B A;  2FFD A;  2W6J H;  3H1L E;  1JO5 A;  2M3E A;  1HUC A;  1MUU A;  2BAS A;  1FZF A;  5K5G B;  1FU1 A;  1KB9 D;  1OVU A;  2E75 B;  3IFM A;  4JYC A;  2E75 C;  4LC1 A;  1URQ D;  3B5N D;  3H32 A;  1NTM G;  4IL6 E;  3W67 A;  1LP1 A;  1SLQ A;  2PRR A;  2YIU C;  1SFC B;  3L75 E;  4GKG A;  4WY4 A;  3V4Q A;  4HH2 A;  4Z1M H;  1HVV A;  2O01 J;  1CI6 B;  2QJP C;  3L71 E;  2E75 D;  4KHX A;  5APX A;  5AVQ B;  5C39 A;  3I55 P;  1Q86 Q;  3AE6 C;  3TGU G;  2WSS H;  1SQB K;  2M5A B;  2Y0E A;  4H44 C;  4PV1 D;  1RQV A;  1YBK A;  5AVR B;  3CCL P;  3L4F A;  2OGU A;  5CBN A;  1CSB A;  1YQ4 C;  3NFQ A;  3CME P;  2NZ2 A;  3LW5 J;  3B4S A;  3CCJ P;  4YTP C;  1SQX K;  1U57 A;  1N7S D;  3A7O A;  5APT A;  2JWA A;  5CCG C;  3N4X A;  5APU A;  4L75 A;  1GK6 A;  1GL2 D;  1QL1 A;  1SQQ K;  3QH9 A;  2XDJ A;  3SFD C;  2WT7 B;  1VQ4 P;  1OFC X;  2E5Y A;  2XKM A;  3CXH D;  3S4R A;  1SQP J;  3TDK A;  5TIS H;  4OGQ D;  4YXD C;  2N9Y B;  1OIP A;  2GUS A;  3CCS P;  3MHV A;  1SQV K;  2OTK E;  2KUB A;  3A2A A;  4IL6 X;  3SFE C;  3FWL A;  3H1K J;  3U59 A;  4AUW A;  4OH8 B;  2QG4 A;  1KQL A;  2YO3 A;  3BAT A;  3WU2 E;  3G6E P;  3H1K G;  3O6Q A;  1LTG C;  1FJP A;  1GW4 A;  2B89 A;  3V2R A;  3M0A A;  2YNY A;  2OYH B;  1PGO A;  3V2P A;  1PFI A;  1E5W A;  1X0T A;  1ZP0 C;  3VTP C;  1N86 A;  2Z5H A;  1FJK A;  1YJ9 P;  4WWI A;  2B88 A;  1JCD A;  2JWD A;  4I2L C;  3L37 A;  5CJ4 A;  2YMY A;  3D71 A;  1ZME C;  4PD4 E;  2ZAE B;  2W27 A;  1LTI C;  4JF7 A;  3WU2 H;  2OTJ P;  1KTM A;  3TGU D;  2Q9I A;  1KIL A;  1PGJ A;  1VF5 D;  2ZYG A;  5AW8 B;  2A06 D;  1WT6 A;  1LWU B;  2ZYD A;  1FZC A;  2FFD C;  3AEC C;  1IZN B;  1LTT C;  2A06 G;  1KV4 A;  1L0L D;  1JTH B;  1NTK D;  2K1A A;  3P8C E;  1E79 H;  1MFT A;  2QRX A;  1KB9 I;  3BRT B;  1Y9B A;  4OGQ C;  3Q5R A;  1GD2 E;  1KYO E;  5KLV G;  1LNQ A;  3GF7 A;  1FE6 A;  1IFI A;  2I1J A;  3BAS A;  2O01 H;  5DJU B;  4WBA A;  4H13 C;  4EI2 A;  2WPV B;  5KLI C;  1GL2 B;  5CJ0 A;  1HTL C;  4H0L D;  3H1J J;  1PPJ G;  2YKQ A;  3HE4 B;  3L73 J;  5KLV D;  1S5L H;  3G3Z A;  3V2N A;  4OWF A;  1NVO A;  5KAI H;  1JNM A;  1L0L J;  3A0B E;  1NTK E;  3MD0 A;  1DIP A;  1PPJ D;  3M9B A;  2Y9Y A;  1FOS F;  3D70 A;  3CWB J;  4XA4 A;  2PP6 A;  3NTN A;  3HUS A;  1NU1 D;  2NPS C;  2G8Y A;  1YHQ P;  1ZV8 A;  4WY4 D;  3HUS B; 
#chains in the Genus database with same CATH homology
 3HTK B;  2IX7 C;  1S9K D;  4LGD E;  1J1D C;  3V4W A;  1T2K C;  2PAJ A;  5AW1 B;  3EQ2 A;  3OJA B;  1GW3 A;  3L36 A;  3R2P A;  3HE5 A;  5AVZ B;  1KIL C;  2YO2 A;  1NH4 A;  1IFD A;  3T97 A;  4C7R A;  1M1J B;  1N73 C;  1LT9 B;  5AW7 B;  3TNU A;  1G1I A;  4ZKP A;  1N73 A;  3LID A;  2OYI A;  2HOD A;  2N1T A;  2Q7C A;  2E43 A;  1FAV A;  1NTM K;  1URQ B;  3B5N B;  1NWQ A;  1NTZ K;  1RF1 C;  3HTK A;  1IC2 A;  3NMD A;  1NU1 K;  1MV8 A;  5AVT B;  3OAK A;  2YKO A;  3BRV B;  1FZA A;  1SFC A;  5CCG D;  3B8E B;  1VDF A;  1KFM A;  5APQ A;  1LTB C;  2NPS A;  1IK9 A;  2XNX A;  1G2C A;  1IJD B;  5AW3 B;  1M1J A;  1NTK K;  1M1J C;  1N73 B;  3M9H A;  3I5C A;  4AYC A;  3VP9 A;  4M3L A;  2QM7 A;  2JJL A;  4Y99 C;  3HE4 A;  3SWY A;  2WPR A;  1KZU B;  2C0X A;  3E1I A;  4GIF A;  5KJ7 C;  1L4A A;  2P67 A;  2P2U A;  1L4A D;  2N1T C;  3HUS C;  4N78 D;  2OAR A;  4WY4 B;  3OA7 A;  2IPP A;  2NPS B;  1RF1 B;  4DZO A;  3NXS A;  2O1K A;  2XZR A;  1G2C B;  4N78 E;  5AW9 B;  3V5B A;  1JY2 P;  1MFZ A;  1CZQ A;  1H89 A;  4XE5 B;  1RE3 C;  3P8C D;  1YTZ I;  1FDM A;  5CCH C;  1FZC C;  1DX7 A;  3U1C A;  1QL2 A;  2W6A A;  2W6B A;  3VMY A;  4C7N B;  5BVZ A;  1ZN5 A;  1RF1 A;  2WPQ A;  2VRS A;  2H8P D;  1FZE A;  1JY2 N;  2I1K A;  3VOP A;  2FYZ A;  3M0D A;  3TYY A;  1HGZ A;  2YKP A;  3RK3 C;  3HRN A;  1SQP K;  3N7N A;  2FFD B;  3SWF A;  2GUV A;  3HD7 D;  3VP8 A;  3RK2 D;  5KJ7 A;  1L4A C;  2IFN A;  5APV A;  2L5G B;  4EOT A;  1L0N K;  1FOS E;  3HD7 B;  1LT9 A;  1LTS C;  2C0W A;  3CLQ A;  3KPE A;  1JY3 N;  1VPC A;  2OYI C;  3RL0 C;  4DOJ A;  1JY3 O;  3C9I A;  1LT9 C;  4N6J A;  3VMZ A;  2P1J A;  2HLO A;  2Z4E A;  2ZFC A;  4IFM A;  2M8R A;  3GHG B;  4I6M C;  1SFC C;  2Z5I A;  2C9L Y;  5CCH A;  1IFJ A;  2E42 A;  1FZB A;  3IR9 A;  2HPC B;  5AVY B;  2HPC A;  4IFD K;  2J59 M;  2KSJ A;  1X8Y A;  5CHX A;  1JY3 P;  3HD7 A;  1RE4 A;  3UIA A;  1N7S B;  1GU4 A;  1JCC A;  2JEE A;  1J1E C;  1NHL A;  1RE4 C;  2OYI B;  1J1E B;  2H43 A;  3P7K A;  1YTZ T;  5AW2 B;  1JY2 O;  3TSI A;  2OYH A;  3M91 A;  3M0D C;  4W7Z A;  2FYU K;  1L4A B;  5AW6 B;  1JMM A;  1EQ7 A;  4IFF A;  1Z56 A;  2Q5U A;  3CI9 A;  1X79 B;  1NO4 A;  3A3Y B;  3RK2 C;  2CPS A;  2WSC H;  1HBW A;  2R32 A;  2GM4 A;  1RE3 A;  2A45 G;  3HD7 C;  5CMZ A;  3TNU B;  3PP5 A;  2R5B A;  4HYT B;  5AVV B;  1DEB A;  1SFC D;  4ZKU A;  5BU8 B;  4W7Y A;  1ZLL A;  2A45 H;  1L0L K;  3TK1 A;  2O1J A;  5AVU B;  2KLV A;  2WTY A;  3KDP B;  3RL0 D;  5KLV K;  2IFM A;  3RK3 B;  1FZG A;  2XV5 A;  3MUD A;  4LLH A;  3HE5 B;  3MTU E;  4EIJ A;  1HGV A;  1XTC C;  1T8Z A;  1NKN A;  1LTJ A;  1N7L A;  2R5D A;  1IO4 A;  1G1J A;  4O9B A;  2HOD B;  2N1T B;  3MGN A;  1SP4 A;  5AVX B;  1XTG B;  1H88 A;  1H8A A;  1IFM A;  1N2D C;  1NKZ B;  2POH A;  3H32 B;  1JOC A;  2FKW B;  3A5T A;  3CL3 D;  1OWA A;  3LW5 H;  3MIW A;  4I1L A;  2HYN A;  5AW4 B;  2R3C A;  3EFG A;  5KJ7 D;  2A45 I;  2HFE D;  1RY3 A;  1X9V A;  3H6P A;  3M06 A;  2WZ7 A;  1LTJ C;  5CCH D;  1T2K D;  2KOG A;  1URQ C;  3B5N C;  1GL2 A;  4C7N A;  4B86 A;  1HWT C;  2WWW A;  3VYI A;  2OYH C;  4AQR D;  2ZXE B;  3RK3 D;  1CW5 A;  3KYQ A;  1DH3 A;  2N1T D;  1AQ5 A;  1T3J A;  3RK2 B;  2WT7 A;  2FXM A;  1LTJ B;  1J1D B;  3O8Z A;  5AW0 B;  5KTB A;  3M9Q A;  1FZC B;  2Q3I A;  1JUN A;  2LKM A;  1LGH B;  2KYV A;  5APW A;  1N7S A;  1NAF A;  1SVF A;  3VMX A;  2NPS D;  1JTH A;  1J2J B;  1KIL D;  3L35 A;  1GDT A;  1KFN A;  3P32 A;  1URQ A;  3B5N A;  4WB4 A;  4W80 A;  1AFO A;  3WMM 0;  1ZR2 A;  1GK4 A;  1OXZ A;  4WY4 C;  3V2Q A;  1GU5 A;  2WSE H;  5AVW B;  1GTW A;  4C46 A;  3P8M C;  1CI6 A;  1LWU C;  5APY A;  5BU5 A;  2WIT A;  2WPS A;  3GHG A;  2QM8 A;  5APS A;  1LWU A;  3U1A A;  1YYC A;  1RF0 C;  3GHG C;  1JO5 A;  1M7L A;  4Y99 B;  3LIE A;  2HG5 D;  1ZR4 A;  4JYB A;  3VN0 A;  1T3U A;  1A02 F;  2WSF H;  1GZL A;  2KP8 A;  1MZ9 A;  2N9B A;  3RL0 B;  1GL2 C;  4GT1 A;  1HH0 A;  3II6 A;  2P7J A;  1WRG A;  1IFN A;  4N3Y B;  3KQG A;  2XU6 A;  2H7H A;  1LTA C;  3BVH A;  5AVS B;  2C9N Y;  1W2E A;  2MJZ A;  4RES B;  2J58 A;  5AW5 B;  1FBM A;  5CCG A;  1NOH A;  1S9K E;  1RF0 A;  2KB7 P;  2CPB A;  1HJB A;  1N7S C;  1A02 J;  1KIL B;  2FFD A;  2M3B A;  1HUC A;  1MUU A;  2BAS A;  1FZF A;  1FU1 A;  4JYC A;  3IFM A;  4LC1 A;  1URQ D;  3B5N D;  3H32 A;  1SLQ A;  4GKG A;  1SFC B;  4WY4 A;  3V4Q A;  4HH2 A;  1HVV A;  4KHX A;  1CI6 B;  5APX A;  5AVQ B;  5AVR B;  1SQB K;  3L4F A;  1CSB A;  3NFQ A;  1SQX K;  1N7S D;  3A7O A;  5APT A;  5CCG C;  3N4X A;  5APU A;  1GK6 A;  1GL2 D;  1QL1 A;  1SQQ K;  2XDJ A;  2WT7 B;  2XKM A;  2GUS A;  1SQV K;  3A2A A;  3U59 A;  4AUW A;  4OH8 B;  1KQL A;  2YO3 A;  3BAT A;  1LTG C;  1FJP A;  1GW4 A;  3V2R A;  3M0A A;  2YNY A;  2OYH B;  3V2P A;  1PFI A;  1E5W A;  3VTP C;  1N86 A;  2Z5H A;  1FJK A;  1JCD A;  5CJ4 A;  4I2L C;  3L37 A;  2YMY A;  2W27 A;  1LTI C;  4JF7 A;  2Q9I A;  1KIL A;  5AW8 B;  1FZC A;  1WT6 A;  1LWU B;  2FFD C;  1LTT C;  1JTH B;  3P8C E;  1GD2 E;  3BRT B;  1IFI A;  2I1J A;  3BAS A;  2O01 H;  4WBA A;  1GL2 B;  5CJ0 A;  1HTL C;  2YKQ A;  3HE4 B;  3V2N A;  3G3Z A;  1JNM A;  3MD0 A;  3M9B A;  1FOS F;  4XA4 A;  2PP6 A;  3NTN A;  3HUS A;  2NPS C;  1ZV8 A;  4WY4 D;  3HUS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...