1L4AA

X-ray structure of the neuronal complexin/snare complex from the squid loligo pealei
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
QPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPTOBREVIN
publication title X-ray structure of a neuronal complexin-SNARE complex from squid.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2002-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l4aA00
1URQC 1N7SB 1T3JA 3P8CE 3B5NB 5CCHD 5CCGA 3RK2B 2N1TB 3KYQA 3M0DC 2M8RA 4W7ZA 5CCGD 1GL2B 5KJ7C 1N7SA 1L4AC 2H8PD 3HD7C 1KILC 3RL0D 2NPSC 1N7SD 4WY4C 1URQB 5CCHA 4W80A 3RK3C 2N1TD 2PP6A 1SFCA 5CCGC 1SFCD 1JTHA 2HFED 1L4AB 3HD7B 1KILB 3HTKB 2XDJA 2NPSB 3B5NA 4JF7A 4WY4B 4OH8B 1NHLA 1XTGB 2N1TA 3B5ND 4N78E 3RK3B 3RK2D 1GL2A 5CCHC 1L4AA 1GL2D 1L4AD 4WY4A 1SFCC 1URQA 4WY4D 3RL0C 1URQD 1N7SC 2HG5D 3PP5A 3RK3D 3B5NC 3TSIA 4LGDE 3RK2C 2N1TC 5KJ7A 3HD7A 2YMYA 1KILA 1GL2C 2NPSA 3VOPA 5KJ7D 1HVVA 2WZ7A 2KOGA 3HD7D 1KILD 1SFCB 2NPSD 4W7YA 3RL0B 1JTHB
chains in the Genus database with same CATH superfamily
3VMXA 1T3JA 2B87A 3B8EB 4D6TD 1LTJA 1VF5C 4H13B 1JNMA 2D2CC 1YQ3C 4H44D 4TLFA 4B86A 1N2DC 2KI7B 1Q90D 1NTMJ 4PV1B 2FXPA 3VMAA 1M1JB 1FC2C 5KLVJ 1FBMA 3L70J 5AVVB 2IBZI 1CW5A 2Q9IA 2E76D 5AW8B 1FDIA 1ZW0A 3H1JE 1NVOA 1SQQE 2QJPB 5AW0B 1X8YA 1YYCA 1SQXK 5KLIC 1NTMD 3LIEA 3RK3B 1GL2A 1NU1G 1R8EA 3WUUA 1HJBA 5KLVD 5H2FE 4XA4A 2P58A 3L72G 3L70D 3KQGA 4WY4A 4ASVA 3K5BA 1JMBA 3M91A 1FDOA 1ZR4A 1NTZG 3C9IA 1SQBG 1N7SC 2FYUE 2QJKB 2Y0CA 3TGUE 3B5NC 2V7QH 2B87B 2BCCJ 3WU2H 4NPEA 2R5BA 2J58A 4OVNF 2JR8A 1VQ7P 4PJ0H 2E75B 2YIUB 3CX5I 4K3AA 1ZR2A 1S9KD 1AJYA 3CXHH 3L71G 2BCCD 1MZ9A 5KJ7C 4YPCA 5BU8B 3BRVB 3AE9C 3SSUA 1WRGA 2K9YA 2I1KA 4PD4E 1G1JA 2IFNA 2Y9YA 1N73A 1KB9H 3VTPC 1PPJE 1OVVA 1SFCD 1JTHA 1LTBC 4IFFA 2AXCA 3H1HE 1RE4C 1BCCE 1L0NJ 4WY4B 2QJYC 2W27A 3H1KG 3EFGA 2Y0DA 1EZVI 3Q5SA 4UB6E 5AVYB 2Z5HA 3OJAB 1A02F 3VMZA 2O01J 2OYHA 1SS1A 3PLNA 3CCMP 1CI6A 5CHXA 1Z56A 1VQ5P 4I7ZC 1KB9I 3GF7A 3CCJP 3UIAA 3ITKA 1QX8A 1FE6A 1GTWA 3A0HH 2A45G 2NPSD 2W90A 2J59M 1S5LE 1T2KC 3HE4B 1M90Q 3GLMA 4C7NB 2N1TB 3KYQA 2K9JA 2ZVOB 1LWUC 2JO1A 1VL2A 2ZJSE 2H8PD 4RO0A 2Q1KA 3L35A 2WMMA 3P7KA 2ZYGA 1W2BO 1AVYA 5APTA 1RF1C 4WB4A 1IFMA 2XU6A 3H1LG 1H0TB 2IYPA 2YMKA 1BSHA 3CCLP 3HRNA 2P67A 1SQXG 4ZKPA 2OGUA 2WSCH 2WT7A 1JMMA 3BCCE 3B5NA 3EQ2A 3V2NA 4WBAA 3D71A 1EDLA 1ZV8A 1RQUA 5B5EE 1G2CB 5B66H 4WVZA 3JCUH 3TK1A 2QM8A 2E43A 3S4RA 1IC2A 3PHLA 3AEBC 3D70A 1GZLA 5AVRB 2UWJE 3G4SP 1Q86Q 4H13C 5KJ7A 1S9KE 3CC7P 3CCQP 1E5WA 3L36A 1PL5A 1P84D 4JQ0D 3SFDC 2C0WA 3V2PA 3CCSP 3HD7D 4KJMA 2YO2A 1HBWA 1FZCA 3CI9A 2K9JB 3MTUE 1U7MA 1MKMA 4OGQD 4PV1C 1M1JC 2E74B 2OYOA 1LT9B 2FXOA 3VYIA 1U7JA 1RE4A 2IFMA 5AW6B 3GHGB 2IDBA 5E79H 2CK3H 3FXDA 3AE5C 2W6JH 2LXCB 1FZEA 2QJPC 2GM4A 2WSFH 2JP3A 3RK3C 4L73A 1NO4A 1SQPD 2AEMA 4U3FG 3CL3D 1KILE 2WVRA 4WWIA 1SQVE 3HUSA 3TNUB 2QJKC 2HYNA 3M0DA 2W8ZA 4M3LA 1L0NE 1LJ2A 3L74E 3AEAC 1OWAA 1FZFA 3TYYA 2FYZA 2IBZE 2NRGA 1ZP0C 2M5AB 2E75C 1URQD 5APXA 2YIUC 3ABVC 3PP5A 3RGUA 1EZVG 2JEEA 1FZCB 3CMEP 3BRTB 2ZT9D 1KYOI 3HTKA 2A06D 3H32A 2FYUJ 3H1JD 1PP9G 5C39A 2E76B 1GMJA 1RF1A 1Y47A 3RL0B 1SQQD 1JY2O 3OW2O 2E5TA 3F89A 3H1IE 4JYCA 2JKVA 4TT3H 5APUA 3QWOC 2FBWC 3V5BA 5AVTB 3CC2P 1LTAC 5AVWB 1OXZA 3B4SA 2FYUD 4WY4C 3MIWA 1BGYG 5AW1B 1NTKE 1DD4A 1MUUA 3HUSB 1JCDA 3CX5E 2KS1A 3V2RA 1PIXA 1VQ4P 3WMM0 1FU1A 1KQSO 5CCGC 4R4LA 1JY2N 1VDFA 2Q7CA 1SLQA 1XTGB 3FWLA 2H43A 1RE3C 3V6IA 1X22A 1HGZA 3KZIE 3L75G 1L4AA 3ZDMA 2Q6QA 5EFWB 1FDMA 1LNQA 2G8YA 3H32B 3L73E 4PD4D 2LKMA 4HYTB 1OFCX 1NTMK 1X0TA 2O01N 2WQYC 2N1TC 1PPJD 5KLVK 4DZOA 3VOPA 3H1HD 2WZ7A 5KAFH 1SFCB 4DT0A 1L0LE 2P7JA 3W68A 2BASA 1G1IA 3MP7B 3OAKA 1LTIC 5APSA 2ZFCA 2A45I 3A0BE 4NPDA 1Y8AA 1M56D 1YTZI 3AECC 2XV5A 2O1JA 2KS1B 1JUNA 1N7SD 3GF3A 3T97A 2R44A 1RY3A 1U57A 3LW5J 1EDIA 2NZ2A 3E1IA 5KAIH 2OYIC 1L4AB 3L71J 1JY2P 3LIDA 3VMYA 2NPSB 2CPSA 1BDCA 2WSEJ 2N9YB 3AE4C 2XNDH 4AQRD 1JB0J 1BE3G 2WSSH 2IZ0A 3IAOA 1VQOP 2KZIA 2B89A 3V4QA 3BCCJ 1KQFB 1J2JB 2A06E 3V4WA 1QEXA 3GG2A 5AVQB 1SP4A 2E74C 2W83C 1LT9C 5M1BA 2E5YA 1KC8Q 1RQVA 2L91A 3G6EP 1KQLA 1MV8A 3GHGC 4IFDK 3BCCD 3HE5A 1IJDB 4LLHA 3D6YA 5KKZB 4L75A 2KK7A 3AEFC 2YXRB 5CCGA 3T97B 2M8RA 1YIJP 2MJZA 4D6TG 1PFIA 1RE3A 5GTHH 2VRSA 3P8CD 2KP8A 4IFMA 1GW4A 2KLVA 2GUVA 1JEKA 1MFZA 1GD2E 2KB7P 2Y9ZA 3CCRP 4H44C 1GDTA 3HD7B 3MZWB 1E79H 1GW3A 3HE4A 1YI2P 1P84H 1T2KD 4C7NA 1NKNA 1FZCC 2N1TA 5APQA 2AXTH 5GTIH 3H25A 5CCHC 1ZXGA 1SQVJ 1BDDA 4N6JA 2QG4A 2IPPA 2E76C 3KDPB 1ZMEC 3R2PA 1NTMG 1SQXJ 3RL0C 2AEFA 3M9BA 1J1EB 5KLVG 3CXHI 1PGJA 1H0TA 3L74J 3L70G 1ZRTE 3HE5B 2W6AA 1RH5B 4A7PA 5AW7B 4O9BA 1KILD 3MUDC 1SQVD 1NU1E 1ZLLA 1FZBA 2V4HA 1DX7A 1SQXD 3L72E 1L0ND 2KXPB 1G2CA 3L74D 3HUSC 2R3CA 2OYIA 4RJTA 2KNCA 1NTZE 4RKUJ 3M0DC 1SQBE 4DOJA 2IBZD 2Z5IA 2O3JA 1KYOE 2OQQA 4L76A 3H1IJ 1NAYA 3A5TA 2MKVA 4CPGA 1URQB 1JY3O 4EOTA 3Q3DA 1LT1A 4XE5B 2BCCG 3CWBG 2K3RA 3P32A 2JDIH 3AE6C 1K05A 5AVZB 2C9NY 3Q2YA 1PGQA 1YHQP 1NTKJ 1M1KQ 4PV1D 3H1ID 4H0LD 1LT9A 2Y0EA 3EWKA 3L71E 4ASWA 2YO3A 3RK2D 5BVZA 3G71P 3GHGA 1IK7A 3AE1C 1SQPK 2W6BA 1GK4A 2V7QJ 1SFCC 4U3FJ 2JWAA 3RBXA 4L74A 1QL2A 1Y9BA 3TF5A 2LR2A 4XFJA 1NTKD 3F5HA 1OW7A 3RK3D 1RHZB 2OARA 1DIPA 3CX5D 2FY8A 3IFMA 2K1AA 1JCCA 2KSEA 2OYIB 3H1KE 3SWFA 3W67A 2KNCB 3L73J 4RESB 3TNUA 1NYHA 3C8VA 4U3FD 3MD0A 1HWTC 1FZAA 2KIKA 3P8CE 2M0BA 2M5AA 1L0LJ 3E7KA 5CJ0A 1L4AC 1LP1B 1EXJA 4KHXA 2NPSC 1NGMB 3L73D 1SQQK 3CD6P 2POHA 2Z4EA 1VQ6P 5CCHA 3H6PA 2DW3A 3CCUP 4UB8E 4PD4H 1EZVD 3M9QA 3G9RA 3A2AA 1L0LD 3JC22 2B9BA 2OTJP 1Q81Q 2PFXA 2XDJA 3GMAA 2FYUK 1OZHA 3M0AA 1KB9D 3NMDA 2P10A 5AVXB 4C7RA 5KAFE 5CBOA 3MUDA 1CZQA 1GL2D 5L8RJ 3WUVA 4WY4D 3H1LE 4DCKA 1JY3P 1S3JA 3AE3C 5KKZC 1SQXE 3FXEA 5TISE 1LTSC 3KHUA 2YMYA 1KQGB 4U7JA 4H44B 1HVVA 1DEEG 1VQ9P 2WTYA 3S9OA 1S5LH 4GKGA 1VQNP 1USDA 3CCEP 3KXDA 4IL6X 2K37A 2JJLA 2QE7H 1EDKA 1IFDA 3AEGC 5CBNA 3HD7C 4KT0J 3U59A 1KFMA 2ZYDA 2WPQA 2HODA 3N7NA 1NAFA 4EI2A 2WSCJ 2N1TD 2FFDB 1SFCA 3AE7C 1K73Q 3BVHA 2HFED 1QVFO 1S72P 1FAVA 3M9HA 3JSVC 1J1EC 5AW4B 3EFFK 1SQPG 1S2EA 4N78E 3RK3E 2BEQD 2J5UA 3P8MC 2HR3A 5B5EH 2ZYAA 3L37A 1TU3F 3Q5PA 4U3FE 3V2QA 3WU2E 1VF5D 4AYCA 1BE3J 2D2CD 3A7OA 1HUCA 2NPSA 4PJ0E 3CPWO 1YJ9P 3CMAP 1URQC 4Y99B 3CXHE 3H1JG 3SWYA 4GODA 1NJIQ 2HODB 4W7ZA 1NU1J 1SQQG 1MFTA 1KD1Q 2WSFJ 1EZVE 1PGOA 4I1LA 1VQLP 3L72J 1FJKA 1K04A 2R5DA 3MHVA 2E74D 1ZRTD 1NTZJ 1K8AQ 1SQBJ 5AW9B 1PP9E 3O6QA 1KB9E 2PP6A 2FYUG 1H8AA 1L2PA 3IN6A 3TGUG 1NU1D 1T6AA 1KILB 3L72D 1S4XA 3VP9A 3B5ND 1HGVA 3FWNA 1NTZD 4NPFX 1SQBD 1LTGC 4EDFA 3SWKA 1UIXA 1PZQA 1KYOD 3N4XA 1BGYE 3II6A 2ITAA 4IL6H 2K88A 2IZ1A 1KMIZ 2O01H 3TSIA 3I5CA 3HD7A 3KPEA 5KJ7D 3A0HE 2HPCA 1QLED 1X79B 3L75E 2RKLA 2XNXA 3L71D 1PPJG 1FOSE 4H0LB 1YQ4C 1J1DB 3H1HG 5CCHD 3PRJA 3H1KJ 3RK2B 5AW5B 1BCCG 1NH4A 3CC4P 1A02J 4JYBA 1NOHA 3O6QB 4AUWA 3RL0D 2R32A 1SQVK 2P2UA 2JWDA 3FX0A 2QM7A 2PGDA 2I1JA 1L0NK 3H1KD 3CX5H 4MN4C 4IOIH 2FYNB 4BRYB 4ZKUA 3C1LA 3KZIH 3CWBJ 5B66E 1HH0A 3JCUE 1EQ7A 1LTJB 3B71A 1Q2NA 1OW6A 1URQA 2Q3IA 2HPCB 1KV4A 3U1AA 2HG5D 1OW8A 4OGQB 3PTZA 1AFOA 2B88A 2IX7C 5AVUB 1K9MQ 2C9LY 2FXMA 3H1LJ 3CWBD 2Q3EA 2KOGA 1BE3E 1GK6A 5TJHA 2O1KA 4W7YA 2RN0A 1JOCA 3S1KA 2YNYA 1AQ5A 1OVRA 1NTKK 4BXLA 2FFDC 3A0BH 3BCCG 3CLQA 1R5SA 4K35A 1P84I 3AEDC 1GL2B 5E79E 3H1LD 3IR9A 3BASA 3FGAD 1IFJA 4ZMDA 2WPSA 4Z1MH 2FKWB 1H89A 1GU5A 1X9VA 1QGKB 3OA7A 1HJ0A 1M7LA 4GOEA 1EDJA 1VQPP 1HF9A 1YITP 4I2LC 2WPVB 2QEXP 4H13D 4D6TE 1Q7YQ 4I6MC 4JBZA 2ZT9B 1LP1A 3GW6A 4YTPC 3Q1MA 1L4AD 2YXQB 5APYA 2L5GB 1S5LX 1L0LK 3O8ZA 1N7LA 1IZNB 4Y99C 3G3ZA 1KTMA 2XZRA 5K5GB 2KSJA 1DEBA 3U1CA 1N73B 5H2FH 1NKZB 2KLUA 5CJ4A 1JY3N 1JTHB 2YKOA 4N78D 1M57D 2SPZA 1ZN5A 1N86A 1NTME 1SQVG 2YKQA 2BEZF 3RBZA 5KLVE 3L70E 1N7SA 4LC1A 1D7MA 1KILC 1IO4A 1L0NG 1PV3A 3L74G 2OYHB 2ZXEB 1RF0C 3BATA 1CI6B 3AEEC 2IBZG 1OVUA 5APVA 3NFQA 1VF5B 4EIJA 2D2CB 2ZXXA 1OMIA 2H88C 2XKMA 4OWFA 1EXIA 3PH0A 1QVGO 2E75D 1PP9J 4JF7A 4OH8B 2E42A 3CXHD 1DD3A 5DJTB 3SFEC 4HB1A 3TDKA 3H1IG 1WMKA 2PAJA 2BCCE 3CWBE 4R4MA 2QA4P 2CPBA 2I8DA 2FFDA 4H0LC 1PP9D 1J1DC 5KLIB 1USEA 1SQPJ 1BGYJ 3IF4A 4LGDE 3RK2C 1M8OB 3I55P 4YXDC 1AVOA 4C46A 1NTKG 4UB6H 1EC5A 4BWNA 2WPRA 1UIIA 5BU5A 4PD4I 1N7SB 1IK9A 2WT7B 2C0XA 2QRXA 3B5NB 1AV1A 4Y28J 1OX3A 1WT6A 2G3AA 2KUBA 1BSNA 1SVFA 1BGYD 1ZOYC 2QIWA 3L75J 1T8ZA 5CCGD 1VQKP 2KZJA 2AEJA 4GT1A 1KYOH 1W5CE 4GOFA 3L4FA 3NXSA 2LXBA 1AQTA 2FYNC 3NTNA 2GUSA 4HKZH 3USSA 5KAIE 3H1JJ 4DJGA 3L73G 1LTJC 3VP8A 4IL6E 1SQQJ 3L75D 2ZAEB 3LW5H 2N9BA 1KORA 1YTZT 4OGQC 2OTKE 3QH9A 1LWUA 4ZNCA 4N3YB 1L0LG 2WSEH 2WWWA 3D6ZA 1FZGA 1PGPA 1IFIA 1NU1K 3TGUJ 3I56P 4HH2A 2R3SA 1YJWP 1VQMP 2ZVNB 1IFNA 2QJYB 1S1CX 3RL0g 3Q5RA 2H7HA 1QL1A 3MGNA 2M3EA 5CMZA 1NTZK 4JPZB 1H88A 1SQBK 1NWQA 2M3BA 1KILA 1GL2C 1JM0A 2HLOA 2RH0A 3VN0A 2GA1A 1RF0A 1W2EA 3TGUD 3R4YA 3A3YB 1YBKA 4I7ZB 5AW3B 4YXWH 3AE8C 1OIPA 2WITA 1GU4A 1T3UA 2IYOA 1AA0A 1R5LA 1VQ8P 5GTHE 3WUTA 1YJNP 1CSBA 2RMZA 1KFNA 1DH3A 5APWA 4QMAA 5KTBA 1KN7A 2H89C 4W80A 1FJPA 2A06G 3E1RA 2QVAA 4GDOA 3H1HJ 2ZT9C 2A45H 4UB8H 1LWUB 1BCCJ 1BE3D 5AW2B 4EYYQ 1FOSF 1P84E 1M1JA 1LTTC 3HTKB 3AE2C 2Q5UA 1NHLA 2AXTE 1RF1B 5GTIE 2OTLP 2P1JA 1Q82Q 2PRRA 1VPCA 1N73C 1BCCD 1IFPA 1KZUB 4GIFA 2QSIA 2KYVA 4HJGH 4D6TJ 1LGHB 5DJUB 1XTCC 5AVSB 1HTLC 3CCVP 1JO5A 2YKPA 5TISH 1N8RQ 1FS0E 3M06A 1SQPE 4BRYA 2OYHC 3PJSK
chains in the Genus database with same CATH topology
1FZAA 3VMXA 1T3JA 1AQ5A 1NTKK 4JYCA 3B8EB 3P8CE 5APUA 2FFDC 1LTJA 3CLQA 1JNMA 3V5BA 5AVTB 1GL2B 1LTAC 5CJ0A 4B86A 1L4AC 1N2DC 5AVWB 3IR9A 3BASA 1OXZA 1IFJA 4KHXA 2NPSC 4WY4C 2WPSA 1SQQK 2POHA 2Z4EA 3MIWA 3H6PA 1M1JB 5CCHA 5AW1B 2FKWB 1H89A 1MUUA 3HUSB 1GU5A 1JCDA 1FBMA 1X9VA 5AVVB 3M9QA 3V2RA 3WMM0 1CW5A 1FU1A 2Q9IA 5CCGC 3A2AA 3OA7A 5AW8B 1M7LA 1JY2N 1VDFA 2XDJA 2FYUK 2Q7CA 1SLQA 5AW0B 1XTGB 1X8YA 1YYCA 1RE3C 3M0AA 1SQXK 2H43A 3NMDA 4I2LC 1HGZA 3LIEA 3RK3B 1GL2A 5AVXB 4I6MC 4C7RA 1HJBA 1L4AA 4XA4A 3MUDA 1CZQA 1GL2D 1L4AD 3KQGA 5APYA 4WY4A 2L5GB 1L0LK 3M91A 4WY4D 3O8ZA 1ZR4A 1JY3P 1FDMA 1N7LA 3C9IA 1N7SC 3H32B 2LKMA 4Y99C 3G3ZA 3B5NC 2XZRA 4HYTB 1NTMK 1LTSC 2N1TC 5KLVK 2YMYA 2KSJA 4DZOA 2R5BA 1DEBA 3VOPA 3U1CA 2J58A 1HVVA 2WZ7A 1N73B 1SFCB 1NKZB 5CJ4A 2P7JA 2BASA 1G1IA 3OAKA 1JY3N 1JTHB 2WTYA 1LTIC 5APSA 2ZFCA 2A45I 2YKOA 4N78D 1ZR2A 1S9KD 4GKGA 1ZN5A 1N86A 1YTZI 2JJLA 1IFDA 2YKQA 1MZ9A 2XV5A 5KJ7C 1N7SA 2O1JA 4LC1A 5BU8B 3BRVB 3HD7C 1KILC 1IO4A 3U59A 1JUNA 1WRGA 1N7SD 2OYHB 2ZXEB 1KFMA 1RF0C 2WPQA 3BATA 1CI6B 3T97A 2HODA 2I1KA 3N7NA 1G1JA 1NAFA 1RY3A 2N1TD 2FFDB 2IFNA 5APVA 3NFQA 1N73A 4EIJA 1SFCA 3VTPC 3E1IA 2OYIC 3BVHA 1SFCD 2XKMA 1JTHA 1LTBC 4IFFA 2HFED 1L4AB 1JY2P 3LIDA 1RE4C 3VMYA 2NPSB 1FAVA 2CPSA 3M9HA 4JF7A 4WY4B 4OH8B 2E42A 1J1EC 5AW4B 4AQRD 2W27A 3EFGA 4N78E 5AVYB 2Z5HA 3OJAB 1A02F 3P8MC 3V4QA 3VMZA 2OYHA 1J2JB 2PAJA 3L37A 3V4WA 1CI6A 5CHXA 2CPBA 1Z56A 2FFDA 5AVQB 1SP4A 3V2QA 1J1DC 1LT9C 4AYCA 4LGDE 3RK2C 3UIAA 3A7OA 1HUCA 2NPSA 4C46A 1KQLA 1GTWA 1MV8A 2WPRA 3GHGC 4IFDK 2A45G 2NPSD 3HE5A 1IJDB 2J59M 5BU5A 1URQC 4LLHA 1N7SB 1IK9A 1T2KC 2WT7B 2C0XA 3HE4B 4Y99B 3B5NB 4C7NB 3SWYA 5CCGA 1WT6A 2N1TB 3KYQA 1SVFA 2HODB 2M8RA 4W7ZA 1LWUC 1T8ZA 5CCGD 4I1LA 2H8PD 2MJZA 1FJKA 4GT1A 1PFIA 1RE3A 2R5DA 3L35A 3P7KA 3L4FA 2VRSA 3NXSA 3P8CD 5APTA 2KP8A 4IFMA 3NTNA 1RF1C 1GW4A 2GUSA 1IFMA 2KLVA 4WB4A 5AW9B 2GUVA 2XU6A 1MFZA 1GD2E 2PP6A 2KB7P 1H8AA 1LTJC 3HRNA 3VP8A 1GDTA 2P67A 4ZKPA 3HD7B 1KILB 2WSCH 2WT7A 1JMMA 1GW3A 3HE4A 3LW5H 3B5NA 1T2KD 3EQ2A 2N9BA 4C7NA 3VP9A 1NKNA 3V2NA 4WBAA 1FZCC 1YTZT 2N1TA 3B5ND 1HGVA 5APQA 1LWUA 4N3YB 1ZV8A 5CCHC 1LTGC 2WSEH 2WWWA 1G2CB 3N4XA 3II6A 1FZGA 4N6JA 3TK1A 2QM8A 1IFIA 1NU1K 2E43A 2IPPA 3KDPB 4HH2A 3R2PA 3RL0C 1IC2A 3M9BA 1IFNA 1J1EB 1GZLA 5AVRB 2O01H 3HE5B 2H7HA 1QL1A 3TSIA 3MGNA 2W6AA 5CMZA 1NTZK 1S9KE 5KJ7A 3I5CA 1H88A 1SQBK 1NWQA 2M3BA 3HD7A 1KILA 1GL2C 1E5WA 3KPEA 3L36A 5KJ7D 2HLOA 5AW7B 2HPCA 1X79B 2C0WA 3V2PA 4O9BA 3VN0A 3HD7D 1KILD 2YO2A 1HBWA 1FZCA 1RF0A 3CI9A 1ZLLA 3MTUE 1W2EA 2XNXA 1FZBA 1DX7A 3A3YB 1FOSE 1M1JC 5AW3B 1G2CA 1J1DB 5CCHD 3HUSC 2R3CA 2OYIA 2WITA 1LT9B 3RK2B 1GU4A 5AW5B 1T3UA 1NH4A 3M0DC 3VYIA 4DOJA 1A02J 1RE4A 4JYBA 1NOHA 2Z5IA 2IFMA 5AW6B 4AUWA 3GHGB 3RL0D 2R32A 1CSBA 1SQVK 1KFNA 2P2UA 3A5TA 1FZEA 1URQB 1DH3A 5APWA 1JY3O 4EOTA 5KTBA 2QM7A 2GM4A 2WSFH 2I1JA 4W80A 1FJPA 4XE5B 3RK3C 1L0NK 3P32A 2A45H 5AVZB 1NO4A 1LWUB 3CL3D 5AW2B 2C9NY 1FOSF 1M1JA 1LTTC 3HTKB 3HUSA 2Q5UA 1LT9A 3TNUB 1NHLA 2HYNA 1RF1B 3M0DA 4ZKUA 2YO3A 4M3LA 3RK2D 2P1JA 5BVZA 1OWAA 3GHGA 1HH0A 1FZFA 1EQ7A 1SQPK 2W6BA 1LTJB 3TYYA 1VPCA 1N73C 1GK4A 1SFCC 2FYZA 1KZUB 1URQA 4GIFA 2Q3IA 1QL2A 2HPCB 1URQD 5APXA 2KYVA 3U1AA 2HG5D 1LGHB 3PP5A 1FZCB 1XTCC 2JEEA 5AVSB 3RK3D 1HTLC 3BRTB 2OARA 1AFOA 1JO5A 2IX7C 2YKPA 3IFMA 5AVUB 2C9LY 2FXMA 3HTKA 1JCCA 2OYIB 3M06A 2KOGA 3SWFA 3H32A 1GK6A 4RESB 2O1KA 4W7YA 3TNUA 1RF1A 1JOCA 3MD0A 3RL0B 2OYHC 2YNYA 1JY2O 1HWTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URQ C;  1N7S B;  1T3J A;  3P8C E;  3B5N B;  5CCH D;  5CCG A;  3RK2 B;  2N1T B;  3KYQ A;  3M0D C;  2M8R A;  4W7Z A;  5CCG D;  1GL2 B;  5KJ7 C;  1N7S A;  1L4A C;  2H8P D;  3HD7 C;  1KIL C;  3RL0 D;  2NPS C;  1N7S D;  4WY4 C;  1URQ B;  5CCH A;  4W80 A;  3RK3 C;  2N1T D;  2PP6 A;  1SFC A;  5CCG C;  1SFC D;  1JTH A;  2HFE D;  1L4A B;  3HD7 B;  1KIL B;  3HTK B;  2XDJ A;  2NPS B;  3B5N A;  4JF7 A;  4WY4 B;  4OH8 B;  1NHL A;  1XTG B;  2N1T A;  3B5N D;  4N78 E;  3RK3 B;  3RK2 D;  1GL2 A;  5CCH C;  1L4A A;  1GL2 D;  1L4A D;  4WY4 A;  1SFC C;  1URQ A;  4WY4 D;  3RL0 C;  1URQ D;  1N7S C;  2HG5 D;  3PP5 A;  3RK3 D;  3B5N C;  3TSI A;  4LGD E;  3RK2 C;  2N1T C;  5KJ7 A;  3HD7 A;  2YMY A;  1KIL A;  1GL2 C;  2NPS A;  3VOP A;  5KJ7 D;  1HVV A;  2WZ7 A;  2KOG A;  3HD7 D;  1KIL D;  1SFC B;  2NPS D;  4W7Y A;  3RL0 B;  1JTH B; 
#chains in the Genus database with same CATH topology
 3VMX A;  1T3J A;  2B87 A;  3B8E B;  4D6T D;  1LTJ A;  1VF5 C;  4H13 B;  1JNM A;  2D2C C;  1YQ3 C;  4H44 D;  4TLF A;  4B86 A;  1N2D C;  2KI7 B;  1Q90 D;  1NTM J;  4PV1 B;  2FXP A;  3VMA A;  1M1J B;  1FC2 C;  5KLV J;  1FBM A;  3L70 J;  5AVV B;  2IBZ I;  1CW5 A;  2Q9I A;  2E76 D;  5AW8 B;  1FDI A;  1ZW0 A;  3H1J E;  1NVO A;  1SQQ E;  2QJP B;  5AW0 B;  1X8Y A;  1YYC A;  1SQX K;  5KLI C;  1NTM D;  3LIE A;  3RK3 B;  1GL2 A;  1NU1 G;  1R8E A;  3WUU A;  1HJB A;  5KLV D;  5H2F E;  4XA4 A;  2P58 A;  3L72 G;  3L70 D;  3KQG A;  4WY4 A;  4ASV A;  3K5B A;  1JMB A;  3M91 A;  1FDO A;  1ZR4 A;  1NTZ G;  3C9I A;  1SQB G;  1N7S C;  2FYU E;  2QJK B;  2Y0C A;  3TGU E;  3B5N C;  2V7Q H;  2B87 B;  2BCC J;  3WU2 H;  4NPE A;  2R5B A;  2J58 A;  4OVN F;  2JR8 A;  1VQ7 P;  4PJ0 H;  2E75 B;  2YIU B;  3CX5 I;  4K3A A;  1ZR2 A;  1S9K D;  1AJY A;  3CXH H;  3L71 G;  2BCC D;  1MZ9 A;  5KJ7 C;  4YPC A;  5BU8 B;  3BRV B;  3AE9 C;  3SSU A;  1WRG A;  2K9Y A;  2I1K A;  4PD4 E;  1G1J A;  2IFN A;  2Y9Y A;  1N73 A;  1KB9 H;  3VTP C;  1PPJ E;  1OVV A;  1SFC D;  1JTH A;  1LTB C;  4IFF A;  2AXC A;  3H1H E;  1RE4 C;  1BCC E;  1L0N J;  4WY4 B;  2QJY C;  2W27 A;  3H1K G;  3EFG A;  2Y0D A;  1EZV I;  3Q5S A;  4UB6 E;  5AVY B;  2Z5H A;  3OJA B;  1A02 F;  3VMZ A;  2O01 J;  2OYH A;  1SS1 A;  3PLN A;  3CCM P;  1CI6 A;  5CHX A;  1Z56 A;  1VQ5 P;  4I7Z C;  1KB9 I;  3GF7 A;  3CCJ P;  3UIA A;  3ITK A;  1QX8 A;  1FE6 A;  1GTW A;  3A0H H;  2A45 G;  2NPS D;  2W90 A;  2J59 M;  1S5L E;  1T2K C;  3HE4 B;  1M90 Q;  3GLM A;  4C7N B;  2N1T B;  3KYQ A;  2K9J A;  2ZVO B;  1LWU C;  2JO1 A;  1VL2 A;  2ZJS E;  2H8P D;  4RO0 A;  2Q1K A;  3L35 A;  2WMM A;  3P7K A;  2ZYG A;  1W2B O;  1AVY A;  5APT A;  1RF1 C;  4WB4 A;  1IFM A;  2XU6 A;  3H1L G;  1H0T B;  2IYP A;  2YMK A;  1BSH A;  3CCL P;  3HRN A;  2P67 A;  1SQX G;  4ZKP A;  2OGU A;  2WSC H;  2WT7 A;  1JMM A;  3BCC E;  3B5N A;  3EQ2 A;  3V2N A;  4WBA A;  3D71 A;  1EDL A;  1ZV8 A;  1RQU A;  5B5E E;  1G2C B;  5B66 H;  4WVZ A;  3JCU H;  3TK1 A;  2QM8 A;  2E43 A;  3S4R A;  1IC2 A;  3PHL A;  3AEB C;  3D70 A;  1GZL A;  5AVR B;  2UWJ E;  3G4S P;  1Q86 Q;  4H13 C;  5KJ7 A;  1S9K E;  3CC7 P;  3CCQ P;  1E5W A;  3L36 A;  1PL5 A;  1P84 D;  4JQ0 D;  3SFD C;  2C0W A;  3V2P A;  3CCS P;  3HD7 D;  4KJM A;  2YO2 A;  1HBW A;  1FZC A;  3CI9 A;  2K9J B;  3MTU E;  1U7M A;  1MKM A;  4OGQ D;  4PV1 C;  1M1J C;  2E74 B;  2OYO A;  1LT9 B;  2FXO A;  3VYI A;  1U7J A;  1RE4 A;  2IFM A;  5AW6 B;  3GHG B;  2IDB A;  5E79 H;  2CK3 H;  3FXD A;  3AE5 C;  2W6J H;  2LXC B;  1FZE A;  2QJP C;  2GM4 A;  2WSF H;  2JP3 A;  3RK3 C;  4L73 A;  1NO4 A;  1SQP D;  2AEM A;  4U3F G;  3CL3 D;  1KIL E;  2WVR A;  4WWI A;  1SQV E;  3HUS A;  3TNU B;  2QJK C;  2HYN A;  3M0D A;  2W8Z A;  4M3L A;  1L0N E;  1LJ2 A;  3L74 E;  3AEA C;  1OWA A;  1FZF A;  3TYY A;  2FYZ A;  2IBZ E;  2NRG A;  1ZP0 C;  2M5A B;  2E75 C;  1URQ D;  5APX A;  2YIU C;  3ABV C;  3PP5 A;  3RGU A;  1EZV G;  2JEE A;  1FZC B;  3CME P;  3BRT B;  2ZT9 D;  1KYO I;  3HTK A;  2A06 D;  3H32 A;  2FYU J;  3H1J D;  1PP9 G;  5C39 A;  2E76 B;  1GMJ A;  1RF1 A;  1Y47 A;  3RL0 B;  1SQQ D;  1JY2 O;  3OW2 O;  2E5T A;  3F89 A;  3H1I E;  4JYC A;  2JKV A;  4TT3 H;  5APU A;  3QWO C;  2FBW C;  3V5B A;  5AVT B;  3CC2 P;  1LTA C;  5AVW B;  1OXZ A;  3B4S A;  2FYU D;  4WY4 C;  3MIW A;  1BGY G;  5AW1 B;  1NTK E;  1DD4 A;  1MUU A;  3HUS B;  1JCD A;  3CX5 E;  2KS1 A;  3V2R A;  1PIX A;  1VQ4 P;  3WMM 0;  1FU1 A;  1KQS O;  5CCG C;  4R4L A;  1JY2 N;  1VDF A;  2Q7C A;  1SLQ A;  1XTG B;  3FWL A;  2H43 A;  1RE3 C;  3V6I A;  1X22 A;  1HGZ A;  3KZI E;  3L75 G;  1L4A A;  3ZDM A;  2Q6Q A;  5EFW B;  1FDM A;  1LNQ A;  2G8Y A;  3H32 B;  3L73 E;  4PD4 D;  2LKM A;  4HYT B;  1OFC X;  1NTM K;  1X0T A;  2O01 N;  2WQY C;  2N1T C;  1PPJ D;  5KLV K;  4DZO A;  3VOP A;  3H1H D;  2WZ7 A;  5KAF H;  1SFC B;  4DT0 A;  1L0L E;  2P7J A;  3W68 A;  2BAS A;  1G1I A;  3MP7 B;  3OAK A;  1LTI C;  5APS A;  2ZFC A;  2A45 I;  3A0B E;  4NPD A;  1Y8A A;  1M56 D;  1YTZ I;  3AEC C;  2XV5 A;  2O1J A;  2KS1 B;  1JUN A;  1N7S D;  3GF3 A;  3T97 A;  2R44 A;  1RY3 A;  1U57 A;  3LW5 J;  1EDI A;  2NZ2 A;  3E1I A;  5KAI H;  2OYI C;  1L4A B;  3L71 J;  1JY2 P;  3LID A;  3VMY A;  2NPS B;  2CPS A;  1BDC A;  2WSE J;  2N9Y B;  3AE4 C;  2XND H;  4AQR D;  1JB0 J;  1BE3 G;  2WSS H;  2IZ0 A;  3IAO A;  1VQO P;  2KZI A;  2B89 A;  3V4Q A;  3BCC J;  1KQF B;  1J2J B;  2A06 E;  3V4W A;  1QEX A;  3GG2 A;  5AVQ B;  1SP4 A;  2E74 C;  2W83 C;  1LT9 C;  5M1B A;  2E5Y A;  1KC8 Q;  1RQV A;  2L91 A;  3G6E P;  1KQL A;  1MV8 A;  3GHG C;  4IFD K;  3BCC D;  3HE5 A;  1IJD B;  4LLH A;  3D6Y A;  5KKZ B;  4L75 A;  2KK7 A;  3AEF C;  2YXR B;  5CCG A;  3T97 B;  2M8R A;  1YIJ P;  2MJZ A;  4D6T G;  1PFI A;  1RE3 A;  5GTH H;  2VRS A;  3P8C D;  2KP8 A;  4IFM A;  1GW4 A;  2KLV A;  2GUV A;  1JEK A;  1MFZ A;  1GD2 E;  2KB7 P;  2Y9Z A;  3CCR P;  4H44 C;  1GDT A;  3HD7 B;  3MZW B;  1E79 H;  1GW3 A;  3HE4 A;  1YI2 P;  1P84 H;  1T2K D;  4C7N A;  1NKN A;  1FZC C;  2N1T A;  5APQ A;  2AXT H;  5GTI H;  3H25 A;  5CCH C;  1ZXG A;  1SQV J;  1BDD A;  4N6J A;  2QG4 A;  2IPP A;  2E76 C;  3KDP B;  1ZME C;  3R2P A;  1NTM G;  1SQX J;  3RL0 C;  2AEF A;  3M9B A;  1J1E B;  5KLV G;  3CXH I;  1PGJ A;  1H0T A;  3L74 J;  3L70 G;  1ZRT E;  3HE5 B;  2W6A A;  1RH5 B;  4A7P A;  5AW7 B;  4O9B A;  1KIL D;  3MUD C;  1SQV D;  1NU1 E;  1ZLL A;  1FZB A;  2V4H A;  1DX7 A;  1SQX D;  3L72 E;  1L0N D;  2KXP B;  1G2C A;  3L74 D;  3HUS C;  2R3C A;  2OYI A;  4RJT A;  2KNC A;  1NTZ E;  4RKU J;  3M0D C;  1SQB E;  4DOJ A;  2IBZ D;  2Z5I A;  2O3J A;  1KYO E;  2OQQ A;  4L76 A;  3H1I J;  1NAY A;  3A5T A;  2MKV A;  4CPG A;  1URQ B;  1JY3 O;  4EOT A;  3Q3D A;  1LT1 A;  4XE5 B;  2BCC G;  3CWB G;  2K3R A;  3P32 A;  2JDI H;  3AE6 C;  1K05 A;  5AVZ B;  2C9N Y;  3Q2Y A;  1PGQ A;  1YHQ P;  1NTK J;  1M1K Q;  4PV1 D;  3H1I D;  4H0L D;  1LT9 A;  2Y0E A;  3EWK A;  3L71 E;  4ASW A;  2YO3 A;  3RK2 D;  5BVZ A;  3G71 P;  3GHG A;  1IK7 A;  3AE1 C;  1SQP K;  2W6B A;  1GK4 A;  2V7Q J;  1SFC C;  4U3F J;  2JWA A;  3RBX A;  4L74 A;  1QL2 A;  1Y9B A;  3TF5 A;  2LR2 A;  4XFJ A;  1NTK D;  3F5H A;  1OW7 A;  3RK3 D;  1RHZ B;  2OAR A;  1DIP A;  3CX5 D;  2FY8 A;  3IFM A;  2K1A A;  1JCC A;  2KSE A;  2OYI B;  3H1K E;  3SWF A;  3W67 A;  2KNC B;  3L73 J;  4RES B;  3TNU A;  1NYH A;  3C8V A;  4U3F D;  3MD0 A;  1HWT C;  1FZA A;  2KIK A;  3P8C E;  2M0B A;  2M5A A;  1L0L J;  3E7K A;  5CJ0 A;  1L4A C;  1LP1 B;  1EXJ A;  4KHX A;  2NPS C;  1NGM B;  3L73 D;  1SQQ K;  3CD6 P;  2POH A;  2Z4E A;  1VQ6 P;  5CCH A;  3H6P A;  2DW3 A;  3CCU P;  4UB8 E;  4PD4 H;  1EZV D;  3M9Q A;  3G9R A;  3A2A A;  1L0L D;  3JC2 2;  2B9B A;  2OTJ P;  1Q81 Q;  2PFX A;  2XDJ A;  3GMA A;  2FYU K;  1OZH A;  3M0A A;  1KB9 D;  3NMD A;  2P10 A;  5AVX B;  4C7R A;  5KAF E;  5CBO A;  3MUD A;  1CZQ A;  1GL2 D;  5L8R J;  3WUV A;  4WY4 D;  3H1L E;  4DCK A;  1JY3 P;  1S3J A;  3AE3 C;  5KKZ C;  1SQX E;  3FXE A;  5TIS E;  1LTS C;  3KHU A;  2YMY A;  1KQG B;  4U7J A;  4H44 B;  1HVV A;  1DEE G;  1VQ9 P;  2WTY A;  3S9O A;  1S5L H;  4GKG A;  1VQN P;  1USD A;  3CCE P;  3KXD A;  4IL6 X;  2K37 A;  2JJL A;  2QE7 H;  1EDK A;  1IFD A;  3AEG C;  5CBN A;  3HD7 C;  4KT0 J;  3U59 A;  1KFM A;  2ZYD A;  2WPQ A;  2HOD A;  3N7N A;  1NAF A;  4EI2 A;  2WSC J;  2N1T D;  2FFD B;  1SFC A;  3AE7 C;  1K73 Q;  3BVH A;  2HFE D;  1QVF O;  1S72 P;  1FAV A;  3M9H A;  3JSV C;  1J1E C;  5AW4 B;  3EFF K;  1SQP G;  1S2E A;  4N78 E;  3RK3 E;  2BEQ D;  2J5U A;  3P8M C;  2HR3 A;  5B5E H;  2ZYA A;  3L37 A;  1TU3 F;  3Q5P A;  4U3F E;  3V2Q A;  3WU2 E;  1VF5 D;  4AYC A;  1BE3 J;  2D2C D;  3A7O A;  1HUC A;  2NPS A;  4PJ0 E;  3CPW O;  1YJ9 P;  3CMA P;  1URQ C;  4Y99 B;  3CXH E;  3H1J G;  3SWY A;  4GOD A;  1NJI Q;  2HOD B;  4W7Z A;  1NU1 J;  1SQQ G;  1MFT A;  1KD1 Q;  2WSF J;  1EZV E;  1PGO A;  4I1L A;  1VQL P;  3L72 J;  1FJK A;  1K04 A;  2R5D A;  3MHV A;  2E74 D;  1ZRT D;  1NTZ J;  1K8A Q;  1SQB J;  5AW9 B;  1PP9 E;  3O6Q A;  1KB9 E;  2PP6 A;  2FYU G;  1H8A A;  1L2P A;  3IN6 A;  3TGU G;  1NU1 D;  1T6A A;  1KIL B;  3L72 D;  1S4X A;  3VP9 A;  3B5N D;  1HGV A;  3FWN A;  1NTZ D;  4NPF X;  1SQB D;  1LTG C;  4EDF A;  3SWK A;  1UIX A;  1PZQ A;  1KYO D;  3N4X A;  1BGY E;  3II6 A;  2ITA A;  4IL6 H;  2K88 A;  2IZ1 A;  1KMI Z;  2O01 H;  3TSI A;  3I5C A;  3HD7 A;  3KPE A;  5KJ7 D;  3A0H E;  2HPC A;  1QLE D;  1X79 B;  3L75 E;  2RKL A;  2XNX A;  3L71 D;  1PPJ G;  1FOS E;  4H0L B;  1YQ4 C;  1J1D B;  3H1H G;  5CCH D;  3PRJ A;  3H1K J;  3RK2 B;  5AW5 B;  1BCC G;  1NH4 A;  3CC4 P;  1A02 J;  4JYB A;  1NOH A;  3O6Q B;  4AUW A;  3RL0 D;  2R32 A;  1SQV K;  2P2U A;  2JWD A;  3FX0 A;  2QM7 A;  2PGD A;  2I1J A;  1L0N K;  3H1K D;  3CX5 H;  4MN4 C;  4IOI H;  2FYN B;  4BRY B;  4ZKU A;  3C1L A;  3KZI H;  3CWB J;  5B66 E;  1HH0 A;  3JCU E;  1EQ7 A;  1LTJ B;  3B71 A;  1Q2N A;  1OW6 A;  1URQ A;  2Q3I A;  2HPC B;  1KV4 A;  3U1A A;  2HG5 D;  1OW8 A;  4OGQ B;  3PTZ A;  1AFO A;  2B88 A;  2IX7 C;  5AVU B;  1K9M Q;  2C9L Y;  2FXM A;  3H1L J;  3CWB D;  2Q3E A;  2KOG A;  1BE3 E;  1GK6 A;  5TJH A;  2O1K A;  4W7Y A;  2RN0 A;  1JOC A;  3S1K A;  2YNY A;  1AQ5 A;  1OVR A;  1NTK K;  4BXL A;  2FFD C;  3A0B H;  3BCC G;  3CLQ A;  1R5S A;  4K35 A;  1P84 I;  3AED C;  1GL2 B;  5E79 E;  3H1L D;  3IR9 A;  3BAS A;  3FGA D;  1IFJ A;  4ZMD A;  2WPS A;  4Z1M H;  2FKW B;  1H89 A;  1GU5 A;  1X9V A;  1QGK B;  3OA7 A;  1HJ0 A;  1M7L A;  4GOE A;  1EDJ A;  1VQP P;  1HF9 A;  1YIT P;  4I2L C;  2WPV B;  2QEX P;  4H13 D;  4D6T E;  1Q7Y Q;  4I6M C;  4JBZ A;  2ZT9 B;  1LP1 A;  3GW6 A;  4YTP C;  3Q1M A;  1L4A D;  2YXQ B;  5APY A;  2L5G B;  1S5L X;  1L0L K;  3O8Z A;  1N7L A;  1IZN B;  4Y99 C;  3G3Z A;  1KTM A;  2XZR A;  5K5G B;  2KSJ A;  1DEB A;  3U1C A;  1N73 B;  5H2F H;  1NKZ B;  2KLU A;  5CJ4 A;  1JY3 N;  1JTH B;  2YKO A;  4N78 D;  1M57 D;  2SPZ A;  1ZN5 A;  1N86 A;  1NTM E;  1SQV G;  2YKQ A;  2BEZ F;  3RBZ A;  5KLV E;  3L70 E;  1N7S A;  4LC1 A;  1D7M A;  1KIL C;  1IO4 A;  1L0N G;  1PV3 A;  3L74 G;  2OYH B;  2ZXE B;  1RF0 C;  3BAT A;  1CI6 B;  3AEE C;  2IBZ G;  1OVU A;  5APV A;  3NFQ A;  1VF5 B;  4EIJ A;  2D2C B;  2ZXX A;  1OMI A;  2H88 C;  2XKM A;  4OWF A;  1EXI A;  3PH0 A;  1QVG O;  2E75 D;  1PP9 J;  4JF7 A;  4OH8 B;  2E42 A;  3CXH D;  1DD3 A;  5DJT B;  3SFE C;  4HB1 A;  3TDK A;  3H1I G;  1WMK A;  2PAJ A;  2BCC E;  3CWB E;  4R4M A;  2QA4 P;  2CPB A;  2I8D A;  2FFD A;  4H0L C;  1PP9 D;  1J1D C;  5KLI B;  1USE A;  1SQP J;  1BGY J;  3IF4 A;  4LGD E;  3RK2 C;  1M8O B;  3I55 P;  4YXD C;  1AVO A;  4C46 A;  1NTK G;  4UB6 H;  1EC5 A;  4BWN A;  2WPR A;  1UII A;  5BU5 A;  4PD4 I;  1N7S B;  1IK9 A;  2WT7 B;  2C0X A;  2QRX A;  3B5N B;  1AV1 A;  4Y28 J;  1OX3 A;  1WT6 A;  2G3A A;  2KUB A;  1BSN A;  1SVF A;  1BGY D;  1ZOY C;  2QIW A;  3L75 J;  1T8Z A;  5CCG D;  1VQK P;  2KZJ A;  2AEJ A;  4GT1 A;  1KYO H;  1W5C E;  4GOF A;  3L4F A;  3NXS A;  2LXB A;  1AQT A;  2FYN C;  3NTN A;  2GUS A;  4HKZ H;  3USS A;  5KAI E;  3H1J J;  4DJG A;  3L73 G;  1LTJ C;  3VP8 A;  4IL6 E;  1SQQ J;  3L75 D;  2ZAE B;  3LW5 H;  2N9B A;  1KOR A;  1YTZ T;  4OGQ C;  2OTK E;  3QH9 A;  1LWU A;  4ZNC A;  4N3Y B;  1L0L G;  2WSE H;  2WWW A;  3D6Z A;  1FZG A;  1PGP A;  1IFI A;  1NU1 K;  3TGU J;  3I56 P;  4HH2 A;  2R3S A;  1YJW P;  1VQM P;  2ZVN B;  1IFN A;  2QJY B;  1S1C X;  3RL0 g;  3Q5R A;  2H7H A;  1QL1 A;  3MGN A;  2M3E A;  5CMZ A;  1NTZ K;  4JPZ B;  1H88 A;  1SQB K;  1NWQ A;  2M3B A;  1KIL A;  1GL2 C;  1JM0 A;  2HLO A;  2RH0 A;  3VN0 A;  2GA1 A;  1RF0 A;  1W2E A;  3TGU D;  3R4Y A;  3A3Y B;  1YBK A;  4I7Z B;  5AW3 B;  4YXW H;  3AE8 C;  1OIP A;  2WIT A;  1GU4 A;  1T3U A;  2IYO A;  1AA0 A;  1R5L A;  1VQ8 P;  5GTH E;  3WUT A;  1YJN P;  1CSB A;  2RMZ A;  1KFN A;  1DH3 A;  5APW A;  4QMA A;  5KTB A;  1KN7 A;  2H89 C;  4W80 A;  1FJP A;  2A06 G;  3E1R A;  2QVA A;  4GDO A;  3H1H J;  2ZT9 C;  2A45 H;  4UB8 H;  1LWU B;  1BCC J;  1BE3 D;  5AW2 B;  4EYY Q;  1FOS F;  1P84 E;  1M1J A;  1LTT C;  3HTK B;  3AE2 C;  2Q5U A;  1NHL A;  2AXT E;  1RF1 B;  5GTI E;  2OTL P;  2P1J A;  1Q82 Q;  2PRR A;  1VPC A;  1N73 C;  1BCC D;  1IFP A;  1KZU B;  4GIF A;  2QSI A;  2KYV A;  4HJG H;  4D6T J;  1LGH B;  5DJU B;  1XTC C;  5AVS B;  1HTL C;  3CCV P;  1JO5 A;  2YKP A;  5TIS H;  1N8R Q;  1FS0 E;  3M06 A;  1SQP E;  4BRY A;  2OYH C;  3PJS K; 
#chains in the Genus database with same CATH homology
 1FZA A;  3VMX A;  1T3J A;  1AQ5 A;  1NTK K;  4JYC A;  3B8E B;  3P8C E;  5APU A;  2FFD C;  1LTJ A;  3CLQ A;  1JNM A;  3V5B A;  5AVT B;  1GL2 B;  1LTA C;  5CJ0 A;  4B86 A;  1L4A C;  1N2D C;  5AVW B;  3IR9 A;  3BAS A;  1OXZ A;  1IFJ A;  4KHX A;  2NPS C;  4WY4 C;  2WPS A;  1SQQ K;  2POH A;  2Z4E A;  3MIW A;  3H6P A;  1M1J B;  5CCH A;  5AW1 B;  2FKW B;  1H89 A;  1MUU A;  3HUS B;  1GU5 A;  1JCD A;  1FBM A;  1X9V A;  5AVV B;  3M9Q A;  3V2R A;  3WMM 0;  1CW5 A;  1FU1 A;  2Q9I A;  5CCG C;  3A2A A;  3OA7 A;  5AW8 B;  1M7L A;  1JY2 N;  1VDF A;  2XDJ A;  2FYU K;  2Q7C A;  1SLQ A;  5AW0 B;  1XTG B;  1X8Y A;  1YYC A;  1RE3 C;  3M0A A;  1SQX K;  2H43 A;  3NMD A;  4I2L C;  1HGZ A;  3LIE A;  3RK3 B;  1GL2 A;  5AVX B;  4I6M C;  4C7R A;  1HJB A;  1L4A A;  4XA4 A;  3MUD A;  1CZQ A;  1GL2 D;  1L4A D;  3KQG A;  5APY A;  4WY4 A;  2L5G B;  1L0L K;  3M91 A;  4WY4 D;  3O8Z A;  1ZR4 A;  1JY3 P;  1FDM A;  1N7L A;  3C9I A;  1N7S C;  3H32 B;  2LKM A;  4Y99 C;  3G3Z A;  3B5N C;  2XZR A;  4HYT B;  1NTM K;  1LTS C;  2N1T C;  5KLV K;  2YMY A;  2KSJ A;  4DZO A;  2R5B A;  1DEB A;  3VOP A;  3U1C A;  2J58 A;  1HVV A;  2WZ7 A;  1N73 B;  1SFC B;  1NKZ B;  5CJ4 A;  2P7J A;  2BAS A;  1G1I A;  3OAK A;  1JY3 N;  1JTH B;  2WTY A;  1LTI C;  5APS A;  2ZFC A;  2A45 I;  2YKO A;  4N78 D;  1ZR2 A;  1S9K D;  4GKG A;  1ZN5 A;  1N86 A;  1YTZ I;  2JJL A;  1IFD A;  2YKQ A;  1MZ9 A;  2XV5 A;  5KJ7 C;  1N7S A;  2O1J A;  4LC1 A;  5BU8 B;  3BRV B;  3HD7 C;  1KIL C;  1IO4 A;  3U59 A;  1JUN A;  1WRG A;  1N7S D;  2OYH B;  2ZXE B;  1KFM A;  1RF0 C;  2WPQ A;  3BAT A;  1CI6 B;  3T97 A;  2HOD A;  2I1K A;  3N7N A;  1G1J A;  1NAF A;  1RY3 A;  2N1T D;  2FFD B;  2IFN A;  5APV A;  3NFQ A;  1N73 A;  4EIJ A;  1SFC A;  3VTP C;  3E1I A;  2OYI C;  3BVH A;  1SFC D;  2XKM A;  1JTH A;  1LTB C;  4IFF A;  2HFE D;  1L4A B;  1JY2 P;  3LID A;  1RE4 C;  3VMY A;  2NPS B;  1FAV A;  2CPS A;  3M9H A;  4JF7 A;  4WY4 B;  4OH8 B;  2E42 A;  1J1E C;  5AW4 B;  4AQR D;  2W27 A;  3EFG A;  4N78 E;  5AVY B;  2Z5H A;  3OJA B;  1A02 F;  3P8M C;  3V4Q A;  3VMZ A;  2OYH A;  1J2J B;  2PAJ A;  3L37 A;  3V4W A;  1CI6 A;  5CHX A;  2CPB A;  1Z56 A;  2FFD A;  5AVQ B;  1SP4 A;  3V2Q A;  1J1D C;  1LT9 C;  4AYC A;  4LGD E;  3RK2 C;  3UIA A;  3A7O A;  1HUC A;  2NPS A;  4C46 A;  1KQL A;  1GTW A;  1MV8 A;  2WPR A;  3GHG C;  4IFD K;  2A45 G;  2NPS D;  3HE5 A;  1IJD B;  2J59 M;  5BU5 A;  1URQ C;  4LLH A;  1N7S B;  1IK9 A;  1T2K C;  2WT7 B;  2C0X A;  3HE4 B;  4Y99 B;  3B5N B;  4C7N B;  3SWY A;  5CCG A;  1WT6 A;  2N1T B;  3KYQ A;  1SVF A;  2HOD B;  2M8R A;  4W7Z A;  1LWU C;  1T8Z A;  5CCG D;  4I1L A;  2H8P D;  2MJZ A;  1FJK A;  4GT1 A;  1PFI A;  1RE3 A;  2R5D A;  3L35 A;  3P7K A;  3L4F A;  2VRS A;  3NXS A;  3P8C D;  5APT A;  2KP8 A;  4IFM A;  3NTN A;  1RF1 C;  1GW4 A;  2GUS A;  1IFM A;  2KLV A;  4WB4 A;  5AW9 B;  2GUV A;  2XU6 A;  1MFZ A;  1GD2 E;  2PP6 A;  2KB7 P;  1H8A A;  1LTJ C;  3HRN A;  3VP8 A;  1GDT A;  2P67 A;  4ZKP A;  3HD7 B;  1KIL B;  2WSC H;  2WT7 A;  1JMM A;  1GW3 A;  3HE4 A;  3LW5 H;  3B5N A;  1T2K D;  3EQ2 A;  2N9B A;  4C7N A;  3VP9 A;  1NKN A;  3V2N A;  4WBA A;  1FZC C;  1YTZ T;  2N1T A;  3B5N D;  1HGV A;  5APQ A;  1LWU A;  4N3Y B;  1ZV8 A;  5CCH C;  1LTG C;  2WSE H;  2WWW A;  1G2C B;  3N4X A;  3II6 A;  1FZG A;  4N6J A;  3TK1 A;  2QM8 A;  1IFI A;  1NU1 K;  2E43 A;  2IPP A;  3KDP B;  4HH2 A;  3R2P A;  3RL0 C;  1IC2 A;  3M9B A;  1IFN A;  1J1E B;  1GZL A;  5AVR B;  2O01 H;  3HE5 B;  2H7H A;  1QL1 A;  3TSI A;  3MGN A;  2W6A A;  5CMZ A;  1NTZ K;  1S9K E;  5KJ7 A;  3I5C A;  1H88 A;  1SQB K;  1NWQ A;  2M3B A;  3HD7 A;  1KIL A;  1GL2 C;  1E5W A;  3KPE A;  3L36 A;  5KJ7 D;  2HLO A;  5AW7 B;  2HPC A;  1X79 B;  2C0W A;  3V2P A;  4O9B A;  3VN0 A;  3HD7 D;  1KIL D;  2YO2 A;  1HBW A;  1FZC A;  1RF0 A;  3CI9 A;  1ZLL A;  3MTU E;  1W2E A;  2XNX A;  1FZB A;  1DX7 A;  3A3Y B;  1FOS E;  1M1J C;  5AW3 B;  1G2C A;  1J1D B;  5CCH D;  3HUS C;  2R3C A;  2OYI A;  2WIT A;  1LT9 B;  3RK2 B;  1GU4 A;  5AW5 B;  1T3U A;  1NH4 A;  3M0D C;  3VYI A;  4DOJ A;  1A02 J;  1RE4 A;  4JYB A;  1NOH A;  2Z5I A;  2IFM A;  5AW6 B;  4AUW A;  3GHG B;  3RL0 D;  2R32 A;  1CSB A;  1SQV K;  1KFN A;  2P2U A;  3A5T A;  1FZE A;  1URQ B;  1DH3 A;  5APW A;  1JY3 O;  4EOT A;  5KTB A;  2QM7 A;  2GM4 A;  2WSF H;  2I1J A;  4W80 A;  1FJP A;  4XE5 B;  3RK3 C;  1L0N K;  3P32 A;  2A45 H;  5AVZ B;  1NO4 A;  1LWU B;  3CL3 D;  5AW2 B;  2C9N Y;  1FOS F;  1M1J A;  1LTT C;  3HTK B;  3HUS A;  2Q5U A;  1LT9 A;  3TNU B;  1NHL A;  2HYN A;  1RF1 B;  3M0D A;  4ZKU A;  2YO3 A;  4M3L A;  3RK2 D;  2P1J A;  5BVZ A;  1OWA A;  3GHG A;  1HH0 A;  1FZF A;  1EQ7 A;  1SQP K;  2W6B A;  1LTJ B;  3TYY A;  1VPC A;  1N73 C;  1GK4 A;  1SFC C;  2FYZ A;  1KZU B;  1URQ A;  4GIF A;  2Q3I A;  1QL2 A;  2HPC B;  1URQ D;  5APX A;  2KYV A;  3U1A A;  2HG5 D;  1LGH B;  3PP5 A;  1FZC B;  1XTC C;  2JEE A;  5AVS B;  3RK3 D;  1HTL C;  3BRT B;  2OAR A;  1AFO A;  1JO5 A;  2IX7 C;  2YKP A;  3IFM A;  5AVU B;  2C9L Y;  2FXM A;  3HTK A;  1JCC A;  2OYI B;  3M06 A;  2KOG A;  3SWF A;  3H32 A;  1GK6 A;  4RES B;  2O1K A;  4W7Y A;  3TNU A;  1RF1 A;  1JOC A;  3MD0 A;  3RL0 B;  2OYH C;  2YNY A;  1JY2 O;  1HWT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...