1L4DB

Crystal structure of microplasminogen-streptokinase alpha domain complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
112
Chain Sequence
NNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 24
structure length 112
sequence length 122
ec nomenclature
pdb deposition date 2002-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l4dB00
1L4DB 1QQRA 1C4PA 1BMLC 1L4ZB
chains in the Genus database with same CATH superfamily
2CHXA 3A4RA 3VTUA 3U4EG 4WJPA 3Q6BA 1WR1A 1YN5A 1WXQA 2NVUI 4W9HA 2O2VA 4DXGA 1YJIA 3Q3NC 1C4AA 2WDVB 3EC8A 3N3KB 2TSSA 2N1VA 1XT9B 3APDA 2G3QB 3JVZX 4BZAA 2KVZA 3HVDA 2C5LC 5EE1A 5CHWA 1RYJA 1TZ1A 2AQ1B 2JYEA 4HEA1 4EZKA 3GB1A 1EWCA 2I38A 3DVNU 4KV2A 4FN2A 2WNMA 1VCBA 3ZNZB 5D3IB 1V9JA 1J7BA 2CU3A 4USAA 2MA9B 1CJEA 1JWUD 2RDGA 1HEZE 3T8MA 1MI0A 4IM3A 1FXAA 3L10B 3GE3C 1GNUA 4WWMA 2L7RA 2KO3A 1TKGA 2CS4A 4KGRA 3MTNB 4JL9A 3CSFA 4PS7A 4NQLB 2ONQA 2AQ3B 3NRZA 1WGRA 1WFYA 1TY2A 5IKCM 3JYUA 2DLBA 3MP9A 3JSVA 2KJ6A 3BVZA 1RM6C 2JQRB 1E8ZA 2LGIA 1NYRA 1XXGA 1OGWA 1YQ3B 2KMAA 2WXGA 1MJDA 2NCNA 2BS4B 2WDTB 4LDTB 4KKJA 2SEBD 2G4SA 3A1QA 1ZW7A 1P7EA 2VZKD 4MH0E 4E3CA 1XLPA 1E6EB 3SD5A 4TSSA 3L16A 1I4RA 3R66C 1L0XB 4DK5A 2K8BA 3ZNHB 1DGJA 4F1SA 4GN1A 3AXCA 4GOCA 4BAXA 3O65B 4ZHPA 2IO2B 2RPVA 2CHWA 3AMZA 1WM3A 2G4DB 1ZE3D 2IGDA 2MP2B 2PVGC 2I1KA 2B3AA 2D5GA 2IJ0A 4DHJB 4ZRKA 4K7SA 1Q5WB 1PQSA 1JCKB 1I4PA 4GDKB 5EDSA 3HUIA 1T5XD 3SU8X 3RNCC 3PGEA 1YOVB 4BOSC 1ROEA 3M95A 4R3DA 4LCDE 1YN3A 2KFKA 1WGDA 1AW7A 4HJGE 4G0NB 3U2SC 2DBYA 2KX0A 3WAMA 3VTWA 3WCQA 3GP7A 3QK0A 2IBIB 3IXSA 2ZZPB 2NBWB 4KZCA 3L4PA 2N9KA 5GXGB 2DZIA 2LUMA 4XGAB 5C3JB 2JZ3B 3ZKJC 4ZOHC 3WALA 4JLCA 5FR3A 1PDXA 3DVNV 2ACZB 1AYFA 3AEBB 5FKAC 3DDCB 1ZUD2 1WJNA 3P2BA 3IHPC 1BUIC 2WDRB 3RYTA 3PZ7A 1EF5A 3DVGX 2VRRB 5DPRA 1NDDA 1WH3A 1VZ8A 1OEYA 4YSZB 3V62A 2KWVB 2FCNA 4LNKA 3DOWA 2X38A 1V2YA 3DPDA 4M8NA 2HDEA 3M3JA 4E71A 1PGBA 5E6JA 5JHAA 4W9EA 4GU2A 1S1QB 3ZXRA 1R7SA 3AH7A 3V61A 1L7YA 1FFUA 3NVYA 1GOZA 3R7RA 4GDLA 2B76B 3NG0A 4FXCA 4JX1C 3KWVA 1ZKHA 4GDKA 1IUEA 1QF6A 4HCNB 2C60A 2DHZA 2JRHA 4D2KA 4RGTA 3K9OB 1ZOYB 1F2RC 2XEWA 2KOXA 1J8CA 1QOFA 1OTRB 2HJ1A 4KDIC 5LXIB 1B1ZA 2M0XA 5CHFA 2NPTB 2J52A 1C1YB 3TEWA 2NTSA 2WLBA 1D4BA 3NJTA 1L0YB 1FNWA 4WWNA 4G50A 3HIZA 3DBLB 3E9SA 3T9LA 3MJWA 4RM9A 3ZYYX 4W9CA 2KMMA 3UINB 3ALBA 1XLNA 3QC8B 2C9WB 4MGYE 1UGMA 4FLHA 2LRWA 1KOTA 2LGXA 4EKUA 4ZRQA 3OJ3A 3VH3B 4JIOU 2V3NA 4US8A 3Q3OC 4ZRJA 5G5GA 2BS3B 1WF9A 1J7CA 4NAWB 3PV1A 2L00B 3VVWB 3PLUA 4A6QA 3KQ4A 5HFYA 3LB8C 2JU6X 1WI0A 3GOEA 1C78A 1PGAA 2IPKD 1XCQL 1WSPA 1E7PB 2MCNB 4PK1A 1JRUA 2L8JA 1IGDA 3AN1A 3CF6E 1TZOA 3RPFC 4EOYA 4WAAA 2PLPA 3R2TA 4ICVA 1HTQA 3V60A 4URKA 2DENB 3PPAA 1T0SC 3ZRFA 2D11A 2N0SB 5DPTA 3UIOB 3IFWB 2K9XA 3MC8A 1QT9A 1GAQB 5AZHA 4DQOC 2M4NA 1STEA 2L83A 2KDBA 2WX0A 1UWXA 3NVWA 4BFRA 3H1UA 2J4XA 4P7IA 2EKEC 3AE2B 3RD2A 2DZMA 5D2MB 2FAZA 5C2TB 1WR6E 3QX1A 4ASWC 2ICIA 1FNVA 3VAWA 1T3QA 2ZNVB 4NJ7A 2WP9B 3UI3A 3A9JB 3QQ8B 2BYTA 2Y5PA 2K25A 1ET9A 1K50A 1WJ6A 4KSLC 1L6VA 2O6VB 1IP9A 3DQVA 1QZEA 2PVOD 3APFA 1UBIA 1B9RA 4NAWA 2M1MA 4GMVA 2KT7A 1T0QC 2EMTA 2LZ6A 3BYTB 4HPPA 1QKZA 3DHHC 5DPSA 1QQRA 1S3SG 4J6IA 4UDUC 4LNNA 3TUOA 3C0RB 1V1PB 3Q14C 4B9KA 4MSMB 3AM9A 4GB9A 1XD3B 3AE5B 3RNAC 3P42A 1KLUD 2GBNA 3N1ZC 4JGHB 4RCOA 3V3XA 3VHTC 5HHDG 2MBEA 5TR5A 2KC1A 2XK5B 2BYEA 3QCAA 4EEWA 3OG5A 2M17A 3C19A 2JZPA 4A8XC 5DPWA 1Y56A 1MHHE 1GC7A 2KTFA 2W3SA 2CHZA 3H7PA 4QAYA 2KWCA 2CU1A 1TS4A 3ZNID 3AE1B 2KC2A 1HA5A 3MC9A 1F77A 2MBHA 1SIJA 1SE2A 3ZJUA 4TV3A 1RLFA 4KIKB 2BS2B 4BKSD 3RNFC 2O6VA 1K52A 3KLSX 4GIVA 1WXAA 4JQWC 3A4SC 1V6EA 1ZXHA 3EFUA 2KAJA 2M8SA 2INPE 5EE3A 3BINA 2E3TA 2RMMA 4ARIA 1PGXA 2QHOA 1WYWB 2K6QA 4AP4C 3VFKA 2WXFA 3VRAB 5JH5C 2XBBC 2FBWB 2KQSA 2JRIB 3IAM1 2YVCA 3T3NA 4P1CC 4A90A 1FPYA 1NI3A 3A9KB 1XCTL 2V3PA 4E74A 4MH8A 1CZPA 2ZPYA 3SHQA 2XK5A 1LXDA 2JVCA 2GRIA 2Z59B 5FK9C 2QC8A 3ZDTA 4IUMB 1OQYA 3GS2A 4L23A 4OHJA 4I6PA 1EWYC 4KGTA 1WY8A 2EKIA 3RT3B 5C1ZA 2KDFB 3I57A 4L2YA 2KFJA 2KXJA 2JUOA 4LJOB 2LVQA 3SDLC 2L0TA 3ZW3A 4EUTA 2RR9A 2W3RA 1CMXB 1A5RA 5I4DA 1UH6A 1C9FA 4ZHOA 3FAHA 4KIKA 2FCQA 3RFZB 3W9CB 4YSYB 2QILA 3PT2B 3ZQ4A 3HM3A 3AE9B 4HPMB 1YQ4B 2NTTA 1FM0D 1UBQA 1UELA 1YJJA 3U8ZA 2N7EA 1HXYD 5AZGA 2UWQA 4ANXA 1I4GA 1V86A 4FULA 4IG7B 1L2NA 2RD0A 3L54A 1LM8B 3IBEA 2KK8A 2GBKA 3B08A 3W1SA 1QOBA 2L0FA 4Q2JA 4JE3B 3PREA 3RN9C 2AX5A 1YD8U 4IWPA 2YEPF 3AEGB 3TIXA 4OVZA 3MHSD 2CKHB 4EFOA 3Q2AC 1SF0A 3U7DA 1CQVA 3MJ5A 1FD6A 1TYGB 3A9KA 1JALA 2FNJB 5IN7A 4ANVA 4WQOB 3B9JA 4G3XB 2KLGA 3RZFA 3JW0X 1K8RB 4M0WB 3HHMA 1AARA 3DCGA 2ZEQA 3VUXA 3M63B 4X57B 4OZAA 2ZCCA 4H2AA 1KRHA 1D5ZC 2DAFA 2HTME 2DZJA 3NVVA 2BVCA 2N4FA 1H8CA 1YJ1A 2R2QA 3B2FA 4FHJA 3B0AA 3QIJA 3RMKC 3ABVB 1TTNA 3KUZA 4TMAB 2CR5A 2WXJA 2V1YA 3U7ZA 4XDDA 3AU4A 1FEHA 2L05A 4ANWA 1C4PA 2INDC 3L08A 4A3OA 2INCC 4BBNC 2KLCA 2PKOA 5L83A 2W55A 4HROA 4K7WA 4WJNA 5CX3A 1GG3A 2MHJA 3EFCA 2OHFA 1WM2A 3WAOA 1WX7A 4KKIA 2L32A 1RFAA 4NPNA 1SBBB 5D6JB 3OJ4B 2R2OA 3CIRB 1GJZA 4CHKA 5EE0A 2D2QA 2RSUA 1H4RA 2DX5B 1JWMD 2WXPA 5JZEB 2J42A 4KZ0A 1VDVA 2FE8A 1WE7A 4HWIB 2OJWA 4IM2A 4N58A 1MG4A 4L1BA 4WJOA 4M02A 2WXLA 1NI2A 1WE6A 3AV8A 2BBCA 3LYYA 2GBMA 2K5PA 4IKGA 3W2DA 3V6EB 3E56A 3LDZE 2VZKB 4MELA 3PVLA 3HVZA 4W9IA 4M0WA 3ONSA 4WWPA 4KGSA 1N61A 4ZYNA 2INNE 2AQ2B 3BVGA 5LXHA 1VZ6A 2LXCA 2DZKA 2FCMA 4NQKE 3T3OA 3AULA 2AYOB 2Z0DB 4K3CA 1DYQA 2N9EB 2MBOA 2Y5BB 3S2AA 1E0ZA 1C79A 2MJDA 1WGGA 1GPXA 5LLIA 3CWIA 3AE7B 1SB3C 3WANA 4O1NA 4ZYSA 2PEAA 1WGYA 3TEZA 3Q8AA 1N63A 4HPLB 2ON8A 3QARA 2MP2A 2LD9A 4WH4A 4K81A 2LHDA 3EECA 4FBJB 4TKNA 2D3CA 5G5HA 2NBVB 4TQ1A 2WU5B 4A3PA 3BY4B 3W1SC 2KD0A 3KWLA 3J9CA 4AS1A 2KDEB 5IOIA 3P63A 4AUQC 3DWMA 1UGJA 1VRAB 3RZWC 4F8CB 1E8XA 5BYQA 3NZ3A 2JX5A 1ZXIA 1TKEA 4MDKE 1ZPSA 4C4VB 4OZBA 2JY6A 5JHBA 2QMTA 2JXXA 1I7HA 2MJ3A 2N9PC 3HM6X 2UYZB 2JYTA 2GBRA 4EE2A 1AWDA 5T8IA 2J0KA 2WS3B 2K6DB 4BKGA 2WXQA 3HK0A 3ML9A 4IC7B 4P6VF 3Q3FA 3I9V1 4S17A 1JWAD 4HDOA 4ARCA 2WXIA 4YWGG 2QJLA 3ZRCA 3NUHB 4LK0M 2LWPA 1UF0A 3P1MA 4LNOA 1R4MB 3WAPA 4GLSC 3DHGC 4FJZA 2PE6B 3DBLI 3QWZB 3GZNB 5FR6A 4HLEA 1TGZB 3DWGC 3Q8EA 4PS8A 4NAMA 2DAJA 1EO6A 2N7DA 2O6VD 1P0RA 3AEEB 2I1JA 2KN4A 3W1YA 1R4MI 3P4SB 4IDIA 2JWZA 1F1HA 2G1EA 1YX5B 2ZVNA 3GZNI 1E9MA 1YX6B 1MG8A 1XQQA 2GOWA 2YEPB 3PHWB 3NY5A 2ZW0A 3EUB2 3BK1A 4RGMA 1Z2MA 1QILA 2N7JA 4A9AA 4AWJA 3H6NA 3UF8A 5H92C 3ZJVA 4FA6A 2NPTA 3P4QB 2LGYA 1NENB 3WIMA 4LTUA 2KJHB 5IP4D 4TUUA 1WX8A 4S0RA 1A70A 3OLMD 1L4ZB 2V4IB 3RUIB 3O13A 4PYZA 5D7GA 3ZTCA 4C80A 2KDIA 2FUHB 4XE0A 2HE7A 2LGDA 2WWZA 4I6NB 4BVUC 1UNSA 2OOBB 5E6OA 1T6BX 1JRPA 3ZXVA 2KDMA 2NBUA 2R61A 2REXA 1PUTA 2J0MA 1FRDA 3N32A 2K22A 3LJ3A 3N20C 1BT0A 5BYRA 1P1AA 1PYWD 2KQ4X 4XZ4A 1V49A 5BMIA 1WXMA 3N1YC 1N60A 1G6JA 2DNFA 2Z0EB 1JWSD 2HJ8A 5AUIA 3R2IA 1GB1A 3BZDB 3VUWA 2BWFA 1GC6A 2V0GA 1GUAB 1V81A 4OVUA 5BO4B 4IW0A 4M8MA 1QOAA 4W9DA 3TEXA 1RFKA 1R4NB 2DYMA 1SE3A 5HKHA 4KDLB 3TBLD 5HG2A 3V05A 3P4PB 5L95C 4W9GA 2MRPA 4MT5A 2KNBA 2ZW1A 1K51A 2SAKA 4MM3B 1YMHE 2V9HA 1QLBB 1J7AA 4JWSC 2KTRB 3ETRA 5G2NA 2LRUA 2KWUB 3ZUNA 4HK2A 2IZVB 1X1MA 3WA0A 1PFDA 2WX1A 2WXNA 4RGNA 3Q3MC 1JMLA 1R4NI 1FRRA 4C00A 3I5JC 2RPQA 4YT0B 3AU5A 1P7FA 2J0JA 2D3BA 5CHVC 1E90A 3VXWA 3PTFC 3V6CB 3HRDD 2XN9C 1T0YA 3ZLZA 5C23A 3APCA 3NHEB 4AQ7A 1VZ7A 3ZJTA 2MJEA 4HXDA 3VRBB 1JROA 4II3B 2QCZA 3A9JA 1FNUA 4HJKA 2BT6A 2GMIC 2KN5A 4W9FA 4JWUC 2XNAC 1WXSA 2N1WA 2ZJDA 2JXTA 3NS1A 2V4LA 4P1BC 1QOGA 2PTLA 1RWSA 2G9HD 1C76A 1UWMA 2BKRB 2O2VB 1WXVA 3AI5A 4MEMA 2IY0B 2PW9A 3ZVVA 2BKFA 4RGOS 1WMHB 1FCLA 1RAXA 1HE8A 3Q8CA 1LGRA 3W5UB 4LNFA 5JXVA 2K8CA 2WQYB 4MGZE 1V5OA 4RF0A 1E7VA 4DWFA 1E8YA 1ET6A 4MSQB 5MPOA 2J53A 1V1PA 5D94A 4AJYB 2JT4B 1Q10A 4B0EA 3UQAA 1YQBA 1SEBD 3IAS1 4GGQA 3UIPB 1F9JA 2KWDA 2J7QB 3FKYA 4C7ZA 1P3QU 5BMHA 2QEJC 2YLMA 2W9NA 5E6PA 4FADA 4NJCA 3Q69A 1SIFA 2KACA 1HZ6A 4MM3A 3VDZA 1C4CA 4YSXB 3SFEB 4YTPB 4W9JA 1KLVA 2KTRA 3I63C 1BXTA 1I4XA 3DBHB 1Z5SB 4GXBA 2FIDA 3JSVB 1IBXB 2KQ7A 4KX6B 1F0ZA 1XLOA 4JPSA 3PRMB 4YXDB 1SXTA 5E6NA 1I4HA 4HRSA 3NVZA 3SFDB 4AJWA 3KYDD 1KM7A 1N5WA 3DVGY 3A1QB 1ZGUB 3L17A 4B6WA 1FCCC 4LDTD 2FCSA 2BWES 4MJSB 1EM7A 1F2RI 3DBHI 1EUVB 2RGFA 2JF5A 1ZDXA 1TT5B 2KHWB 3AE3B 1V8CA 1EU4A 1WYGA 1E10A 3AECB 2Z8LA 1D5MC 1VLBA 4RNAA 1YIWA 1NVID 2C7MB 3AE6B 1E5WA 1WMHA 3ENEA 2A4ZA 3KUCB 3SR6A 4NY0A 3X23A 5J17A 3RNBC 1ZDVA 4IWOA 1HQRD 2KX3A 4DDID 2HD5B 2MWSB 1OQRA 3VR8B 4DHJD 4N59A 2C7HA 4K3BA 4F7ZA 2JSVX 3IT4B 4A20A 4HVBA 1L6UA 1XO3A 2LFIA 3U52E 2KFKB 1E7UA 1Q1OA 2GLSA 4J3OD 4K1RB 4XWWA 3KVFB 1LFDA 4WWOA 1DOIA 4HCPB 1SE4A 1IBXA 3PSEB 2MH7A 2G45B 3C8YA 2JPHA 2ZVOA 4YTNB 2ZNVC 2GBJA 3PZDA 1C77A 1WZ0A 3IVFA 4DBGA 2UU7A 3TEYA 1L0VB 1TS5A 2EELA 2GB1A 2IDYA 2BW2A 1E8WA 1YN4A 1OEYJ 4BKSA 3FILB 4MJSA 4A55A 2LXAA 1AN8A 3OWEB 2M19A 2QSDA 1NYQA 1XF5L 2EMSA 1XLQA 5IAAC 2DWQA 1FIQA 1LQBA 3KYCD 3PRPB 4HKQA 2NS5A 4BBNF 1WJUA 1GB4A 4WJQA 3QHTA 4XX5A 2LGSA 1WX9A 4G11A 3RNEC 2JWUA 2W54A 5DCNA 4OW0A 3H8HA 3NOBA 1TY0A 2MQJA 4GDLB 1WGKA 3L0WB 4FJYA 3PHXB 5J18A 4KVGB 4DXFA 4EZLA 3VQIA 1ISNA 4FHKA 1J0GA 2MLBA 1M4VA 3PRZA 2D3AA 3IT6B 3BYYB 4LNIA 3Q8FA 5BMGA 1K53A 2WDQB 2A5UA 1IYFA 3TMPB 3K9PB 3DBRB 3FC4A 2L52A 2MBQA 4KSKC 1JW9D 2N9LA 1IPGA 2WXHA 1M94A 1TBEA 1V1OA 4WIPA 1IGCA 2LHEA 3GE8C 2IY1B 1FMAD 1FXIA 2FIFA 2KJRA 4II2B 1KH0A 3R3MA 4IOIE 3D32A 1I4QA 1WRIA 1V97A 3FILA 4RMAA 3DBRI 2BYVE 4CO7A 2JZZA 1MPEA 4AOFA 2BPSA 1L5PA 5H8YE 3VUYA 1U4AA 2NMQA 1EU3A 3TSSA 2KMCA 3LXFA 3RNGC 4NNJB 4XWTA 5AUKA 2BQQA 3BWUD 3Q3JA 1Q0WB 3DHIC 5TSSA 2BGFA 4N9F4 2X8XX 5IA7A 1ESFA 4RM8A 1N6ZA 3B1LX 2LVPA 4PYUA 2BF8B 2IO1B 2CJOA 1YNTE 2K0PA 1TS2A 5EE9A 2WXRA 1FO4A 2NR2A 1SJED 2M0AA 2RDHA 2AWTA 1SE9A 2KANA 4NJ6A 1TJEA 5IO9A 3QA8A 2C7NB 4XDCA 2K39A 3H9DA 1WRDB 2WYQA 1KLGD 1F52A 2LUEA 3BVMA 1DOXA 4HKZE 3CSTA 3M62B 2BB6A 2H88B 1SSNA 4WQMA 1D6EC 1WWTA 2QIEB 4US9A 2D10A 1JQ4A 2W82A 5AEKB 5LNK1 2HTHA 3AE4B 1HZ5A 1Y8RC 2IO3B 1XEEA 2BYFA 1WIAA 3P4RB 1MFWA 2ZCBA 3TL5A 4WURA 3VR9B 4ANUA 3DBSA 4XYCA 2ZPNA 3NZSA 4YL8A 4M01A 4MGIE 4BKTA 2BB5A 4DXAB 3RCZA 3RI7C 2KZRA 1C3TA 1SJHD 3AE8B 3W5VB 2D3GA 2RDBC 4C4VA 2KKCA 2WXMA 3TCAA 3NZUA 4CYEA 2LMCA 1FXTB 2LASA 2KYWA 3KW5B 5G55A 4RH6A 4PT5A 1VJKA 3U30A 5BYSA 3CMMB 1BMLC 3N9YC 1TS3A 1N5XA 1UZXB 4K7UA 2K8HA 1VR9A 2ASQA 3N30A 3ZTDA 2IO0B 2PMVA 3H7PB 3N1XC 1MVKA 4ACFA 3A33B 4LJPB 2Q5WD 1WGHA 4I6LB 2H89B 1NBFC 2D07B 1D5XC 4WAFA 4BOZB 3MHZA 3KUDB 2WGSA 5J2RA 5KHOA 2MSED 2WU2B 2Y5CA 4B95A 2WXOA 1I42A 3URYA 4OVVA 2IGGA 2PE9A 5HI1A 3UGBB 4DHZB 2PIAA 4FJVB 1LO5D 4MGKE 4ZRPA 2IGHA 1WJ4A 3AEAB 3R7QA 1ZP0B 5GMVA 3BIID 3R8BA 1VD2A 1WZ3A 2GI9A 4N6EB 2AEHA 4M00A 3MC0B 1J19A 4RFBA 4CQNA 4YTMB 1ACCA 3ECIA 5AZFA 3I3TB 2N9XA 2IYDB 3AEDB 4MACA 1N62A 1SGHA 4IWQA 3NS8A 2V3SA 3H7SA 1KF6B 2L76A 3RULA 3ZO5B 1L4DB 3ZIMA 4GSWA 3ZDMC 1V80A 2AL3A 4OZCA 2PJHA 3L13A 4W9LA 2PPHA 1RRBA 2MEKA 4IM0A 1CK1A 2AL6A 1ENFA 4ICUA 1P9DU 3BK2A 4ZRIA 3B2GA 2M56B 2LVOA 4TQ0A 3ZNGC 4LLGM 4P16A 3PLVA 3VTVA 4DDGD 1DOYA 3OAWA 3VH4B 1OQQA 3EA6A 4PS3A 4NZLB 2KVRA 4B0MA 1KTKA 2K1FA 1KFYB 3KH0A 2LJ5A 3AEFB 2OEDA 2WXKA 1T0RC 4ZDVA 1EF1A 4RF1A 3ML8A 4REZA 3QAQA 2LJIA 3EGRA 2Y3AA 2K3UA 1P98A 2MW5A 1TKYA 4C56C 4DHZE 5D3DA 1HTOA 1UUPA 2FUG1 3EHVA 1V5TA 2I2YA 3PZ8A 2QDFA 3PO0A 2MBBB 3QJZA 3AB5A 4C7YA 4HDQA 1TIFA 3PS6A 2L3ZA 2VH2A 2CJNA 1NEKB 2VH1A 1I35A 3Q8BA 3UQBA 1JWBD 4ITKA 2MX2A 5CTRC 5KHQA 3X0WA 1OFFA 3TJPA 3ZGZA 2E6XA 3SEBA 2L1AA 2DYOA 2LEKA 1FFVA 2LI5A 3MFGA 4XC2A 1D3ZA 1MHXA 1UD7A 2BTEA 1KJTA 2WHIA 3IG3A 4W9KA 2DYBA 4EZJA 2OJRA
chains in the Genus database with same CATH topology
3AE5B 3U4EG 3P1MA 4DXFA 1YN5A 3P42A 1KLUD 3VQIA 4GLSC 1WXQA 4DXGA 1YJIA 1C4AA 2WDVB 2TSSA 1M4VA 4RCOA 3IT6B 3V3XA 3BYYB 5HHDG 3Q8FA 3DWGC 5BMGA 1K53A 2WDQB 3Q8EA 4NAMA 3HVDA 5EE1A 1RYJA 2AQ1B 2JYEA 4HEA1 3GB1A 3AEEB 3FC4A 2L52A 1EWCA 2I38A 2JZPA 4A8XC 1JW9D 2KN4A 2N9LA 2WNMA 1Y56A 1MHHE 5D3IB 2W3SA 3P4SB 4IDIA 2WXHA 1J7BA 2CU3A 4USAA 1CJEA 1JWUD 1TS4A 2RDGA 1HEZE 1V1OA 2G1EA 4WIPA 3AE1B 1IGCA 1E9MA 1MI0A 1HA5A 2LHEA 1FXAA 1F77A 4WWMA 1SIJA 1FMAD 1FXIA 1SE2A 3ZJUA 1TKGA 2YEPB 2ZW0A 3EUB2 3BK1A 1KH0A 4KGRA 4IOIE 4RGMA 2BS2B 1QILA 2N7JA 4A9AA 1I4QA 1WRIA 1V97A 3FILA 5H92C 2ONQA 2AQ3B 1K52A 3KLSX 3NRZA 3ZJVA 1MPEA 1TY2A 2DLBA 3MP9A 1L5PA 5H8YE 3P4QB 3BVZA 1RM6C 1NENB 2NMQA 2JQRB 1EU3A 1ZXHA 1NYRA 2KAJA 2LGIA 4LTUA 3TSSA 1XXGA 2INPE 1YQ3B 2WXGA 5EE3A 3LXFA 2BS4B 1A70A 2E3TA 2RMMA 4KKJA 1L4ZB 4XWTA 5AUKA 4ARIA 2SEBD 3BWUD 2V4IB 1PGXA 3O13A 5D7GA 1P7EA 5TSSA 2VZKD 4C80A 4XE0A 2WXFA 1XLPA 1E6EB 1UNSA 4TSSA 3VRAB 1ESFA 1I4RA 1T6BX 1JRPA 1L0XB 2KDMA 2R61A 1PUTA 1DGJA 1FRDA 2K22A 2FBWB 3IAM1 2CJOA 5BYRA 3T3NA 1PYWD 4A90A 1YNTE 1NI3A 2K0PA 1TS2A 2KQ4X 5EE9A 2WXRA 4ZHPA 1FO4A 1XCTL 2RPVA 5BMIA 2V3PA 1SJED 1N60A 4MH8A 2M0AA 1CZPA 2RDHA 3AMZA 1JWSD 5AUIA 3R2IA 1ZE3D 1GB1A 1TJEA 2IGDA 3BZDB 2PVGC 4XDCA 2D5GA 2V0GA 2GRIA 5FK9C 2IJ0A 1QOAA 1KLGD 3TEXA 1RFKA 3GS2A 1JCKB 1I4PA 4GDKB 2DYMA 1SE3A 4L23A 4OHJA 5HG2A 3V05A 3HUIA 3P4PB 3BVMA 1DOXA 4HKZE 1EWYC 1T5XD 4MT5A 4KGTA 2EKIA 3I57A 2ZW1A 1K51A 4L2YA 1ROEA 2BB6A 2H88B 2SAKA 1SSNA 4MM3B 4WQMA 1YMHE 1QLBB 1D6EC 1J7AA 1WWTA 2QIEB 4R3DA 4JWSC 2W3RA 4US9A 3ETRA 1YN3A 5I4DA 1C9FA 1JQ4A 1AW7A 2W82A 4HJGE 4ZHOA 5LNK1 3AE4B 3FAHA 3U2SC 2DBYA 1HZ5A 1PFDA 3RFZB 2WXNA 4RGNA 3W9CB 4YSYB 3WCQA 1JMLA 2QILA 3GP7A 1XEEA 3IXSA 3P4RB 1FRRA 3ZQ4A 3AE9B 4YT0B 1P7FA 1YQ4B 2N9KA 3L4PA 4WURA 5GXGB 3VR9B 3HRDD 2NTTA 1FM0D 2XN9C 1YJJA 2LUMA 1HXYD 4AQ7A 1VZ7A 3ZJTA 5C3JB 2MJEA 1I4GA 4ZOHC 3VRBB 1JROA 1FNUA 2BT6A 5FR3A 4JWUC 1PDXA 2BB5A 2XNAC 2JXTA 3W1SA 1QOBA 4Q2JA 2ACZB 1AYFA 3AEBB 4JE3B 5FKAC 1SJHD 3AE8B 3NS1A 2AX5A 3W5VB 1ZUD2 1BUIC 2WDRB 2YEPF 3AEGB 3PZ7A 1QOGA 2PTLA 1RWSA 2G9HD 4OVZA 1C76A 1UWMA 1VZ8A 2PW9A 1SF0A 2WXMA 1CQVA 3MJ5A 1FD6A 1TYGB 4YSZB 2LMCA 4RGOS 1FCLA 2X38A 1JALA 4RH6A 4PT5A 3B9JA 2HDEA 1VJKA 5BYSA 1PGBA 3Q8CA 5E6JA 3W5UB 5JXVA 2WQYB 1BMLC 3N9YC 1TS3A 4RF0A 1N5XA 5MPOA 1ET6A 4OZAA 1R7SA 3AH7A 4H2AA 1KRHA 1D5ZC 2J53A 2HTME 1FFUA 1VR9A 3NVYA 1GOZA 1V1PA 2B76B 4FXCA 1Q10A 3NVVA 2PMVA 4B0EA 4JX1C 1SEBD 1MVKA 3IAS1 3KWVA 1IUEA 3B2FA 1QF6A 2KWDA 2Q5WD 4C7ZA 5BMHA 2QEJC 4RGTA 4D2KA 3ABVB 4NJCA 1ZOYB 2H89B 3Q69A 1F2RC 1D5XC 4WAFA 2KACA 3MHZA 4TMAB 1HZ6A 2WXJA 1C4CA 3U7ZA 4YSXB 3SFEB 4YTPB 4XDDA 1FEHA 2WU2B 2Y5CA 1QOFA 2WXOA 1BXTA 1I4XA 1C4PA 3URYA 1B1ZA 1IBXB 4KX6B 1F0ZA 2PKOA 1XLOA 2J52A 4JPSA 2W55A 4YXDB 4HROA 1SXTA 2NTSA 3TEWA 2WLBA 1I4HA 2IGGA 1D4BA 1L0YB 2OHFA 4HRSA 3NVZA 1FNWA 5HI1A 3SFDB 4KKIA 3E9SA 2PIAA 2L32A 1LO5D 1SBBB 2IGHA 4ZRPA 3ZYYX 1N5WA 2KMMA 3CIRB 1XLNA 3AEAB 5EE0A 1FCCC 1ZP0B 3BIID 3R8BA 1JWMD 1EM7A 1F2RI 2GI9A 2WXPA 2J42A 1ZDXA 4N6EB 1VDVA 4ZRQA 2FE8A 3MC0B 2V3NA 4US8A 5G5GA 2BS3B 3AE3B 4RFBA 4CQNA 1J7CA 4N58A 1V8CA 4YTMB 1EU4A 1ACCA 4L1BA 4NAWB 1WYGA 2WXLA 3AECB 1E10A 2Z8LA 3AV8A 2BBCA 3LYYA 1D5MC 1VLBA 3AEDB 2K5PA 4MACA 1N62A 4RNAA 4A6QA 1NVID 4IKGA 3AE6B 3KQ4A 3W2DA 1KF6B 5HFYA 3LB8C 2JU6X 3SR6A 1L4DB 3E56A 2VZKB 1C78A 1PGAA 4OZCA 1ZDVA 2IPKD 1XCQL 1WSPA 1E7PB 3HVZA 4M0WA 1HQRD 1IGDA 3AN1A 4KGSA 1N61A 2INNE 1OQRA 1TZOA 3RPFC 3VR8B 2AQ2B 2MEKA 2PLPA 3R2TA 1CK1A 1ENFA 3BVGA 1VZ6A 3BK2A 4N59A 3B2GA 2JSVX 2M56B 3IT4B 4TQ0A 2N0SB 3T3OA 4LLGM 4P16A 1DYQA 2K9XA 1L6UA 1XO3A 2LFIA 1QT9A 1E0ZA 1DOYA 1C79A 2MJDA 3U52E 1GAQB 1OQQA 3EA6A 1GPXA 3CWIA 4NZLB 3AE7B 4B0MA 1SB3C 4J3OD 4O1NA 1KTKA 4ZYSA 4DQOC 1STEA 1KFYB 2L83A 3TEZA 4XWWA 3Q8AA 1UWXA 3NVWA 1N63A 1DOIA 2ON8A 1SE4A 3AEFB 2OEDA 1IBXA 2MH7A 2J4XA 2WXKA 3C8YA 4WH4A 3AE2B 2LHDA 4RF1A 4REZA 4YTNB 5G5HA 5C2TB 2LJIA 3EGRA 2WU5B 4TQ1A 2Y3AA 2ICIA 2K3UA 1C77A 1FNVA 1TKYA 3TEYA 3KWLA 3J9CA 4C56C 4AS1A 1T3QA 1L0VB 3P63A 1TS5A 3UI3A 2WP9B 2EELA 3DWMA 1UGJA 1VRAB 2GB1A 5D3DA 1UUPA 2FUG1 2BYTA 2Y5PA 5BYQA 3NZ3A 2IDYA 2BW2A 2JX5A 2I2YA 1ET9A 1ZXIA 3PZ8A 1K50A 1TKEA 1YN4A 3FILB 1L6VA 4A55A 3PO0A 1ZPSA 4OZBA 1AN8A 3OWEB 2PVOD 2QMTA 2M19A 2QSDA 3AB5A 4C7YA 1NYQA 1XF5L 1B9RA 1XLQA 2CJNA 1NEKB 1I7HA 3Q8BA 1JWBD 4ITKA 2MJ3A 2DWQA 2JYTA 1FIQA 1OFFA 4HKQA 4EE2A 1AWDA 5T8IA 3BYTB 1QKZA 2WS3B 3ZGZA 1GB4A 2E6XA 2WXQA 3SEBA 1QQRA 4P6VF 2L1AA 2DYOA 2LEKA 1FFVA 3I9V1 3MFGA 2JWUA 2W54A 4OW0A 1JWAD 1MHXA 3H8HA 4UDUC 4ARCA 2BTEA 3TUOA 2WXIA 1TY0A 4YWGG 2QJLA 1V1PB 4GDLB 1WGKA 3NUHB 4LK0M 3AM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4D B;  1QQR A;  1C4P A;  1BML C;  1L4Z B; 
#chains in the Genus database with same CATH topology
 2CHX A;  3A4R A;  3VTU A;  3U4E G;  4WJP A;  3Q6B A;  1WR1 A;  1YN5 A;  1WXQ A;  2NVU I;  4W9H A;  2O2V A;  4DXG A;  1YJI A;  3Q3N C;  1C4A A;  2WDV B;  3EC8 A;  3N3K B;  2TSS A;  2N1V A;  1XT9 B;  3APD A;  2G3Q B;  3JVZ X;  4BZA A;  2KVZ A;  3HVD A;  2C5L C;  5EE1 A;  5CHW A;  1RYJ A;  1TZ1 A;  2AQ1 B;  2JYE A;  4HEA 1;  4EZK A;  3GB1 A;  1EWC A;  2I38 A;  3DVN U;  4KV2 A;  4FN2 A;  2WNM A;  1VCB A;  3ZNZ B;  5D3I B;  1V9J A;  1J7B A;  2CU3 A;  4USA A;  2MA9 B;  1CJE A;  1JWU D;  2RDG A;  1HEZ E;  3T8M A;  1MI0 A;  4IM3 A;  1FXA A;  3L10 B;  3GE3 C;  1GNU A;  4WWM A;  2L7R A;  2KO3 A;  1TKG A;  2CS4 A;  4KGR A;  3MTN B;  4JL9 A;  3CSF A;  4PS7 A;  4NQL B;  2ONQ A;  2AQ3 B;  3NRZ A;  1WGR A;  1WFY A;  1TY2 A;  5IKC M;  3JYU A;  2DLB A;  3MP9 A;  3JSV A;  2KJ6 A;  3BVZ A;  1RM6 C;  2JQR B;  1E8Z A;  2LGI A;  1NYR A;  1XXG A;  1OGW A;  1YQ3 B;  2KMA A;  2WXG A;  1MJD A;  2NCN A;  2BS4 B;  2WDT B;  4LDT B;  4KKJ A;  2SEB D;  2G4S A;  3A1Q A;  1ZW7 A;  1P7E A;  2VZK D;  4MH0 E;  4E3C A;  1XLP A;  1E6E B;  3SD5 A;  4TSS A;  3L16 A;  1I4R A;  3R66 C;  1L0X B;  4DK5 A;  2K8B A;  3ZNH B;  1DGJ A;  4F1S A;  4GN1 A;  3AXC A;  4GOC A;  4BAX A;  3O65 B;  4ZHP A;  2IO2 B;  2RPV A;  2CHW A;  3AMZ A;  1WM3 A;  2G4D B;  1ZE3 D;  2IGD A;  2MP2 B;  2PVG C;  2I1K A;  2B3A A;  2D5G A;  2IJ0 A;  4DHJ B;  4ZRK A;  4K7S A;  1Q5W B;  1PQS A;  1JCK B;  1I4P A;  4GDK B;  5EDS A;  3HUI A;  1T5X D;  3SU8 X;  3RNC C;  3PGE A;  1YOV B;  4BOS C;  1ROE A;  3M95 A;  4R3D A;  4LCD E;  1YN3 A;  2KFK A;  1WGD A;  1AW7 A;  4HJG E;  4G0N B;  3U2S C;  2DBY A;  2KX0 A;  3WAM A;  3VTW A;  3WCQ A;  3GP7 A;  3QK0 A;  2IBI B;  3IXS A;  2ZZP B;  2NBW B;  4KZC A;  3L4P A;  2N9K A;  5GXG B;  2DZI A;  2LUM A;  4XGA B;  5C3J B;  2JZ3 B;  3ZKJ C;  4ZOH C;  3WAL A;  4JLC A;  5FR3 A;  1PDX A;  3DVN V;  2ACZ B;  1AYF A;  3AEB B;  5FKA C;  3DDC B;  1ZUD 2;  1WJN A;  3P2B A;  3IHP C;  1BUI C;  2WDR B;  3RYT A;  3PZ7 A;  1EF5 A;  3DVG X;  2VRR B;  5DPR A;  1NDD A;  1WH3 A;  1VZ8 A;  1OEY A;  4YSZ B;  3V62 A;  2KWV B;  2FCN A;  4LNK A;  3DOW A;  2X38 A;  1V2Y A;  3DPD A;  4M8N A;  2HDE A;  3M3J A;  4E71 A;  1PGB A;  5E6J A;  5JHA A;  4W9E A;  4GU2 A;  1S1Q B;  3ZXR A;  1R7S A;  3AH7 A;  3V61 A;  1L7Y A;  1FFU A;  3NVY A;  1GOZ A;  3R7R A;  4GDL A;  2B76 B;  3NG0 A;  4FXC A;  4JX1 C;  3KWV A;  1ZKH A;  4GDK A;  1IUE A;  1QF6 A;  4HCN B;  2C60 A;  2DHZ A;  2JRH A;  4D2K A;  4RGT A;  3K9O B;  1ZOY B;  1F2R C;  2XEW A;  2KOX A;  1J8C A;  1QOF A;  1OTR B;  2HJ1 A;  4KDI C;  5LXI B;  1B1Z A;  2M0X A;  5CHF A;  2NPT B;  2J52 A;  1C1Y B;  3TEW A;  2NTS A;  2WLB A;  1D4B A;  3NJT A;  1L0Y B;  1FNW A;  4WWN A;  4G50 A;  3HIZ A;  3DBL B;  3E9S A;  3T9L A;  3MJW A;  4RM9 A;  3ZYY X;  4W9C A;  2KMM A;  3UIN B;  3ALB A;  1XLN A;  3QC8 B;  2C9W B;  4MGY E;  1UGM A;  4FLH A;  2LRW A;  1KOT A;  2LGX A;  4EKU A;  4ZRQ A;  3OJ3 A;  3VH3 B;  4JIO U;  2V3N A;  4US8 A;  3Q3O C;  4ZRJ A;  5G5G A;  2BS3 B;  1WF9 A;  1J7C A;  4NAW B;  3PV1 A;  2L00 B;  3VVW B;  3PLU A;  4A6Q A;  3KQ4 A;  5HFY A;  3LB8 C;  2JU6 X;  1WI0 A;  3GOE A;  1C78 A;  1PGA A;  2IPK D;  1XCQ L;  1WSP A;  1E7P B;  2MCN B;  4PK1 A;  1JRU A;  2L8J A;  1IGD A;  3AN1 A;  3CF6 E;  1TZO A;  3RPF C;  4EOY A;  4WAA A;  2PLP A;  3R2T A;  4ICV A;  1HTQ A;  3V60 A;  4URK A;  2DEN B;  3PPA A;  1T0S C;  3ZRF A;  2D11 A;  2N0S B;  5DPT A;  3UIO B;  3IFW B;  2K9X A;  3MC8 A;  1QT9 A;  1GAQ B;  5AZH A;  4DQO C;  2M4N A;  1STE A;  2L83 A;  2KDB A;  2WX0 A;  1UWX A;  3NVW A;  4BFR A;  3H1U A;  2J4X A;  4P7I A;  2EKE C;  3AE2 B;  3RD2 A;  2DZM A;  5D2M B;  2FAZ A;  5C2T B;  1WR6 E;  3QX1 A;  4ASW C;  2ICI A;  1FNV A;  3VAW A;  1T3Q A;  2ZNV B;  4NJ7 A;  2WP9 B;  3UI3 A;  3A9J B;  3QQ8 B;  2BYT A;  2Y5P A;  2K25 A;  1ET9 A;  1K50 A;  1WJ6 A;  4KSL C;  1L6V A;  2O6V B;  1IP9 A;  3DQV A;  1QZE A;  2PVO D;  3APF A;  1UBI A;  1B9R A;  4NAW A;  2M1M A;  4GMV A;  2KT7 A;  1T0Q C;  2EMT A;  2LZ6 A;  3BYT B;  4HPP A;  1QKZ A;  3DHH C;  5DPS A;  1QQR A;  1S3S G;  4J6I A;  4UDU C;  4LNN A;  3TUO A;  3C0R B;  1V1P B;  3Q14 C;  4B9K A;  4MSM B;  3AM9 A;  4GB9 A;  1XD3 B;  3AE5 B;  3RNA C;  3P42 A;  1KLU D;  2GBN A;  3N1Z C;  4JGH B;  4RCO A;  3V3X A;  3VHT C;  5HHD G;  2MBE A;  5TR5 A;  2KC1 A;  2XK5 B;  2BYE A;  3QCA A;  4EEW A;  3OG5 A;  2M17 A;  3C19 A;  2JZP A;  4A8X C;  5DPW A;  1Y56 A;  1MHH E;  1GC7 A;  2KTF A;  2W3S A;  2CHZ A;  3H7P A;  4QAY A;  2KWC A;  2CU1 A;  1TS4 A;  3ZNI D;  3AE1 B;  2KC2 A;  1HA5 A;  3MC9 A;  1F77 A;  2MBH A;  1SIJ A;  1SE2 A;  3ZJU A;  4TV3 A;  1RLF A;  4KIK B;  2BS2 B;  4BKS D;  3RNF C;  2O6V A;  1K52 A;  3KLS X;  4GIV A;  1WXA A;  4JQW C;  3A4S C;  1V6E A;  1ZXH A;  3EFU A;  2KAJ A;  2M8S A;  2INP E;  5EE3 A;  3BIN A;  2E3T A;  2RMM A;  4ARI A;  1PGX A;  2QHO A;  1WYW B;  2K6Q A;  4AP4 C;  3VFK A;  2WXF A;  3VRA B;  5JH5 C;  2XBB C;  2FBW B;  2KQS A;  2JRI B;  3IAM 1;  2YVC A;  3T3N A;  4P1C C;  4A90 A;  1FPY A;  1NI3 A;  3A9K B;  1XCT L;  2V3P A;  4E74 A;  4MH8 A;  1CZP A;  2ZPY A;  3SHQ A;  2XK5 A;  1LXD A;  2JVC A;  2GRI A;  2Z59 B;  5FK9 C;  2QC8 A;  3ZDT A;  4IUM B;  1OQY A;  3GS2 A;  4L23 A;  4OHJ A;  4I6P A;  1EWY C;  4KGT A;  1WY8 A;  2EKI A;  3RT3 B;  5C1Z A;  2KDF B;  3I57 A;  4L2Y A;  2KFJ A;  2KXJ A;  2JUO A;  4LJO B;  2LVQ A;  3SDL C;  2L0T A;  3ZW3 A;  4EUT A;  2RR9 A;  2W3R A;  1CMX B;  1A5R A;  5I4D A;  1UH6 A;  1C9F A;  4ZHO A;  3FAH A;  4KIK A;  2FCQ A;  3RFZ B;  3W9C B;  4YSY B;  2QIL A;  3PT2 B;  3ZQ4 A;  3HM3 A;  3AE9 B;  4HPM B;  1YQ4 B;  2NTT A;  1FM0 D;  1UBQ A;  1UEL A;  1YJJ A;  3U8Z A;  2N7E A;  1HXY D;  5AZG A;  2UWQ A;  4ANX A;  1I4G A;  1V86 A;  4FUL A;  4IG7 B;  1L2N A;  2RD0 A;  3L54 A;  1LM8 B;  3IBE A;  2KK8 A;  2GBK A;  3B08 A;  3W1S A;  1QOB A;  2L0F A;  4Q2J A;  4JE3 B;  3PRE A;  3RN9 C;  2AX5 A;  1YD8 U;  4IWP A;  2YEP F;  3AEG B;  3TIX A;  4OVZ A;  3MHS D;  2CKH B;  4EFO A;  3Q2A C;  1SF0 A;  3U7D A;  1CQV A;  3MJ5 A;  1FD6 A;  1TYG B;  3A9K A;  1JAL A;  2FNJ B;  5IN7 A;  4ANV A;  4WQO B;  3B9J A;  4G3X B;  2KLG A;  3RZF A;  3JW0 X;  1K8R B;  4M0W B;  3HHM A;  1AAR A;  3DCG A;  2ZEQ A;  3VUX A;  3M63 B;  4X57 B;  4OZA A;  2ZCC A;  4H2A A;  1KRH A;  1D5Z C;  2DAF A;  2HTM E;  2DZJ A;  3NVV A;  2BVC A;  2N4F A;  1H8C A;  1YJ1 A;  2R2Q A;  3B2F A;  4FHJ A;  3B0A A;  3QIJ A;  3RMK C;  3ABV B;  1TTN A;  3KUZ A;  4TMA B;  2CR5 A;  2WXJ A;  2V1Y A;  3U7Z A;  4XDD A;  3AU4 A;  1FEH A;  2L05 A;  4ANW A;  1C4P A;  2IND C;  3L08 A;  4A3O A;  2INC C;  4BBN C;  2KLC A;  2PKO A;  5L83 A;  2W55 A;  4HRO A;  4K7W A;  4WJN A;  5CX3 A;  1GG3 A;  2MHJ A;  3EFC A;  2OHF A;  1WM2 A;  3WAO A;  1WX7 A;  4KKI A;  2L32 A;  1RFA A;  4NPN A;  1SBB B;  5D6J B;  3OJ4 B;  2R2O A;  3CIR B;  1GJZ A;  4CHK A;  5EE0 A;  2D2Q A;  2RSU A;  1H4R A;  2DX5 B;  1JWM D;  2WXP A;  5JZE B;  2J42 A;  4KZ0 A;  1VDV A;  2FE8 A;  1WE7 A;  4HWI B;  2OJW A;  4IM2 A;  4N58 A;  1MG4 A;  4L1B A;  4WJO A;  4M02 A;  2WXL A;  1NI2 A;  1WE6 A;  3AV8 A;  2BBC A;  3LYY A;  2GBM A;  2K5P A;  4IKG A;  3W2D A;  3V6E B;  3E56 A;  3LDZ E;  2VZK B;  4MEL A;  3PVL A;  3HVZ A;  4W9I A;  4M0W A;  3ONS A;  4WWP A;  4KGS A;  1N61 A;  4ZYN A;  2INN E;  2AQ2 B;  3BVG A;  5LXH A;  1VZ6 A;  2LXC A;  2DZK A;  2FCM A;  4NQK E;  3T3O A;  3AUL A;  2AYO B;  2Z0D B;  4K3C A;  1DYQ A;  2N9E B;  2MBO A;  2Y5B B;  3S2A A;  1E0Z A;  1C79 A;  2MJD A;  1WGG A;  1GPX A;  5LLI A;  3CWI A;  3AE7 B;  1SB3 C;  3WAN A;  4O1N A;  4ZYS A;  2PEA A;  1WGY A;  3TEZ A;  3Q8A A;  1N63 A;  4HPL B;  2ON8 A;  3QAR A;  2MP2 A;  2LD9 A;  4WH4 A;  4K81 A;  2LHD A;  3EEC A;  4FBJ B;  4TKN A;  2D3C A;  5G5H A;  2NBV B;  4TQ1 A;  2WU5 B;  4A3P A;  3BY4 B;  3W1S C;  2KD0 A;  3KWL A;  3J9C A;  4AS1 A;  2KDE B;  5IOI A;  3P63 A;  4AUQ C;  3DWM A;  1UGJ A;  1VRA B;  3RZW C;  4F8C B;  1E8X A;  5BYQ A;  3NZ3 A;  2JX5 A;  1ZXI A;  1TKE A;  4MDK E;  1ZPS A;  4C4V B;  4OZB A;  2JY6 A;  5JHB A;  2QMT A;  2JXX A;  1I7H A;  2MJ3 A;  2N9P C;  3HM6 X;  2UYZ B;  2JYT A;  2GBR A;  4EE2 A;  1AWD A;  5T8I A;  2J0K A;  2WS3 B;  2K6D B;  4BKG A;  2WXQ A;  3HK0 A;  3ML9 A;  4IC7 B;  4P6V F;  3Q3F A;  3I9V 1;  4S17 A;  1JWA D;  4HDO A;  4ARC A;  2WXI A;  4YWG G;  2QJL A;  3ZRC A;  3NUH B;  4LK0 M;  2LWP A;  1UF0 A;  3P1M A;  4LNO A;  1R4M B;  3WAP A;  4GLS C;  3DHG C;  4FJZ A;  2PE6 B;  3DBL I;  3QWZ B;  3GZN B;  5FR6 A;  4HLE A;  1TGZ B;  3DWG C;  3Q8E A;  4PS8 A;  4NAM A;  2DAJ A;  1EO6 A;  2N7D A;  2O6V D;  1P0R A;  3AEE B;  2I1J A;  2KN4 A;  3W1Y A;  1R4M I;  3P4S B;  4IDI A;  2JWZ A;  1F1H A;  2G1E A;  1YX5 B;  2ZVN A;  3GZN I;  1E9M A;  1YX6 B;  1MG8 A;  1XQQ A;  2GOW A;  2YEP B;  3PHW B;  3NY5 A;  2ZW0 A;  3EUB 2;  3BK1 A;  4RGM A;  1Z2M A;  1QIL A;  2N7J A;  4A9A A;  4AWJ A;  3H6N A;  3UF8 A;  5H92 C;  3ZJV A;  4FA6 A;  2NPT A;  3P4Q B;  2LGY A;  1NEN B;  3WIM A;  4LTU A;  2KJH B;  5IP4 D;  4TUU A;  1WX8 A;  4S0R A;  1A70 A;  3OLM D;  1L4Z B;  2V4I B;  3RUI B;  3O13 A;  4PYZ A;  5D7G A;  3ZTC A;  4C80 A;  2KDI A;  2FUH B;  4XE0 A;  2HE7 A;  2LGD A;  2WWZ A;  4I6N B;  4BVU C;  1UNS A;  2OOB B;  5E6O A;  1T6B X;  1JRP A;  3ZXV A;  2KDM A;  2NBU A;  2R61 A;  2REX A;  1PUT A;  2J0M A;  1FRD A;  3N32 A;  2K22 A;  3LJ3 A;  3N20 C;  1BT0 A;  5BYR A;  1P1A A;  1PYW D;  2KQ4 X;  4XZ4 A;  1V49 A;  5BMI A;  1WXM A;  3N1Y C;  1N60 A;  1G6J A;  2DNF A;  2Z0E B;  1JWS D;  2HJ8 A;  5AUI A;  3R2I A;  1GB1 A;  3BZD B;  3VUW A;  2BWF A;  1GC6 A;  2V0G A;  1GUA B;  1V81 A;  4OVU A;  5BO4 B;  4IW0 A;  4M8M A;  1QOA A;  4W9D A;  3TEX A;  1RFK A;  1R4N B;  2DYM A;  1SE3 A;  5HKH A;  4KDL B;  3TBL D;  5HG2 A;  3V05 A;  3P4P B;  5L95 C;  4W9G A;  2MRP A;  4MT5 A;  2KNB A;  2ZW1 A;  1K51 A;  2SAK A;  4MM3 B;  1YMH E;  2V9H A;  1QLB B;  1J7A A;  4JWS C;  2KTR B;  3ETR A;  5G2N A;  2LRU A;  2KWU B;  3ZUN A;  4HK2 A;  2IZV B;  1X1M A;  3WA0 A;  1PFD A;  2WX1 A;  2WXN A;  4RGN A;  3Q3M C;  1JML A;  1R4N I;  1FRR A;  4C00 A;  3I5J C;  2RPQ A;  4YT0 B;  3AU5 A;  1P7F A;  2J0J A;  2D3B A;  5CHV C;  1E90 A;  3VXW A;  3PTF C;  3V6C B;  3HRD D;  2XN9 C;  1T0Y A;  3ZLZ A;  5C23 A;  3APC A;  3NHE B;  4AQ7 A;  1VZ7 A;  3ZJT A;  2MJE A;  4HXD A;  3VRB B;  1JRO A;  4II3 B;  2QCZ A;  3A9J A;  1FNU A;  4HJK A;  2BT6 A;  2GMI C;  2KN5 A;  4W9F A;  4JWU C;  2XNA C;  1WXS A;  2N1W A;  2ZJD A;  2JXT A;  3NS1 A;  2V4L A;  4P1B C;  1QOG A;  2PTL A;  1RWS A;  2G9H D;  1C76 A;  1UWM A;  2BKR B;  2O2V B;  1WXV A;  3AI5 A;  4MEM A;  2IY0 B;  2PW9 A;  3ZVV A;  2BKF A;  4RGO S;  1WMH B;  1FCL A;  1RAX A;  1HE8 A;  3Q8C A;  1LGR A;  3W5U B;  4LNF A;  5JXV A;  2K8C A;  2WQY B;  4MGZ E;  1V5O A;  4RF0 A;  1E7V A;  4DWF A;  1E8Y A;  1ET6 A;  4MSQ B;  5MPO A;  2J53 A;  1V1P A;  5D94 A;  4AJY B;  2JT4 B;  1Q10 A;  4B0E A;  3UQA A;  1YQB A;  1SEB D;  3IAS 1;  4GGQ A;  3UIP B;  1F9J A;  2KWD A;  2J7Q B;  3FKY A;  4C7Z A;  1P3Q U;  5BMH A;  2QEJ C;  2YLM A;  2W9N A;  5E6P A;  4FAD A;  4NJC A;  3Q69 A;  1SIF A;  2KAC A;  1HZ6 A;  4MM3 A;  3VDZ A;  1C4C A;  4YSX B;  3SFE B;  4YTP B;  4W9J A;  1KLV A;  2KTR A;  3I63 C;  1BXT A;  1I4X A;  3DBH B;  1Z5S B;  4GXB A;  2FID A;  3JSV B;  1IBX B;  2KQ7 A;  4KX6 B;  1F0Z A;  1XLO A;  4JPS A;  3PRM B;  4YXD B;  1SXT A;  5E6N A;  1I4H A;  4HRS A;  3NVZ A;  3SFD B;  4AJW A;  3KYD D;  1KM7 A;  1N5W A;  3DVG Y;  3A1Q B;  1ZGU B;  3L17 A;  4B6W A;  1FCC C;  4LDT D;  2FCS A;  2BWE S;  4MJS B;  1EM7 A;  1F2R I;  3DBH I;  1EUV B;  2RGF A;  2JF5 A;  1ZDX A;  1TT5 B;  2KHW B;  3AE3 B;  1V8C A;  1EU4 A;  1WYG A;  1E10 A;  3AEC B;  2Z8L A;  1D5M C;  1VLB A;  4RNA A;  1YIW A;  1NVI D;  2C7M B;  3AE6 B;  1E5W A;  1WMH A;  3ENE A;  2A4Z A;  3KUC B;  3SR6 A;  4NY0 A;  3X23 A;  5J17 A;  3RNB C;  1ZDV A;  4IWO A;  1HQR D;  2KX3 A;  4DDI D;  2HD5 B;  2MWS B;  1OQR A;  3VR8 B;  4DHJ D;  4N59 A;  2C7H A;  4K3B A;  4F7Z A;  2JSV X;  3IT4 B;  4A20 A;  4HVB A;  1L6U A;  1XO3 A;  2LFI A;  3U52 E;  2KFK B;  1E7U A;  1Q1O A;  2GLS A;  4J3O D;  4K1R B;  4XWW A;  3KVF B;  1LFD A;  4WWO A;  1DOI A;  4HCP B;  1SE4 A;  1IBX A;  3PSE B;  2MH7 A;  2G45 B;  3C8Y A;  2JPH A;  2ZVO A;  4YTN B;  2ZNV C;  2GBJ A;  3PZD A;  1C77 A;  1WZ0 A;  3IVF A;  4DBG A;  2UU7 A;  3TEY A;  1L0V B;  1TS5 A;  2EEL A;  2GB1 A;  2IDY A;  2BW2 A;  1E8W A;  1YN4 A;  1OEY J;  4BKS A;  3FIL B;  4MJS A;  4A55 A;  2LXA A;  1AN8 A;  3OWE B;  2M19 A;  2QSD A;  1NYQ A;  1XF5 L;  2EMS A;  1XLQ A;  5IAA C;  2DWQ A;  1FIQ A;  1LQB A;  3KYC D;  3PRP B;  4HKQ A;  2NS5 A;  4BBN F;  1WJU A;  1GB4 A;  4WJQ A;  3QHT A;  4XX5 A;  2LGS A;  1WX9 A;  4G11 A;  3RNE C;  2JWU A;  2W54 A;  5DCN A;  4OW0 A;  3H8H A;  3NOB A;  1TY0 A;  2MQJ A;  4GDL B;  1WGK A;  3L0W B;  4FJY A;  3PHX B;  5J18 A;  4KVG B;  4DXF A;  4EZL A;  3VQI A;  1ISN A;  4FHK A;  1J0G A;  2MLB A;  1M4V A;  3PRZ A;  2D3A A;  3IT6 B;  3BYY B;  4LNI A;  3Q8F A;  5BMG A;  1K53 A;  2WDQ B;  2A5U A;  1IYF A;  3TMP B;  3K9P B;  3DBR B;  3FC4 A;  2L52 A;  2MBQ A;  4KSK C;  1JW9 D;  2N9L A;  1IPG A;  2WXH A;  1M94 A;  1TBE A;  1V1O A;  4WIP A;  1IGC A;  2LHE A;  3GE8 C;  2IY1 B;  1FMA D;  1FXI A;  2FIF A;  2KJR A;  4II2 B;  1KH0 A;  3R3M A;  4IOI E;  3D32 A;  1I4Q A;  1WRI A;  1V97 A;  3FIL A;  4RMA A;  3DBR I;  2BYV E;  4CO7 A;  2JZZ A;  1MPE A;  4AOF A;  2BPS A;  1L5P A;  5H8Y E;  3VUY A;  1U4A A;  2NMQ A;  1EU3 A;  3TSS A;  2KMC A;  3LXF A;  3RNG C;  4NNJ B;  4XWT A;  5AUK A;  2BQQ A;  3BWU D;  3Q3J A;  1Q0W B;  3DHI C;  5TSS A;  2BGF A;  4N9F 4;  2X8X X;  5IA7 A;  1ESF A;  4RM8 A;  1N6Z A;  3B1L X;  2LVP A;  4PYU A;  2BF8 B;  2IO1 B;  2CJO A;  1YNT E;  2K0P A;  1TS2 A;  5EE9 A;  2WXR A;  1FO4 A;  2NR2 A;  1SJE D;  2M0A A;  2RDH A;  2AWT A;  1SE9 A;  2KAN A;  4NJ6 A;  1TJE A;  5IO9 A;  3QA8 A;  2C7N B;  4XDC A;  2K39 A;  3H9D A;  1WRD B;  2WYQ A;  1KLG D;  1F52 A;  2LUE A;  3BVM A;  1DOX A;  4HKZ E;  3CST A;  3M62 B;  2BB6 A;  2H88 B;  1SSN A;  4WQM A;  1D6E C;  1WWT A;  2QIE B;  4US9 A;  2D10 A;  1JQ4 A;  2W82 A;  5AEK B;  5LNK 1;  2HTH A;  3AE4 B;  1HZ5 A;  1Y8R C;  2IO3 B;  1XEE A;  2BYF A;  1WIA A;  3P4R B;  1MFW A;  2ZCB A;  3TL5 A;  4WUR A;  3VR9 B;  4ANU A;  3DBS A;  4XYC A;  2ZPN A;  3NZS A;  4YL8 A;  4M01 A;  4MGI E;  4BKT A;  2BB5 A;  4DXA B;  3RCZ A;  3RI7 C;  2KZR A;  1C3T A;  1SJH D;  3AE8 B;  3W5V B;  2D3G A;  2RDB C;  4C4V A;  2KKC A;  2WXM A;  3TCA A;  3NZU A;  4CYE A;  2LMC A;  1FXT B;  2LAS A;  2KYW A;  3KW5 B;  5G55 A;  4RH6 A;  4PT5 A;  1VJK A;  3U30 A;  5BYS A;  3CMM B;  1BML C;  3N9Y C;  1TS3 A;  1N5X A;  1UZX B;  4K7U A;  2K8H A;  1VR9 A;  2ASQ A;  3N30 A;  3ZTD A;  2IO0 B;  2PMV A;  3H7P B;  3N1X C;  1MVK A;  4ACF A;  3A33 B;  4LJP B;  2Q5W D;  1WGH A;  4I6L B;  2H89 B;  1NBF C;  2D07 B;  1D5X C;  4WAF A;  4BOZ B;  3MHZ A;  3KUD B;  2WGS A;  5J2R A;  5KHO A;  2MSE D;  2WU2 B;  2Y5C A;  4B95 A;  2WXO A;  1I42 A;  3URY A;  4OVV A;  2IGG A;  2PE9 A;  5HI1 A;  3UGB B;  4DHZ B;  2PIA A;  4FJV B;  1LO5 D;  4MGK E;  4ZRP A;  2IGH A;  1WJ4 A;  3AEA B;  3R7Q A;  1ZP0 B;  5GMV A;  3BII D;  3R8B A;  1VD2 A;  1WZ3 A;  2GI9 A;  4N6E B;  2AEH A;  4M00 A;  3MC0 B;  1J19 A;  4RFB A;  4CQN A;  4YTM B;  1ACC A;  3ECI A;  5AZF A;  3I3T B;  2N9X A;  2IYD B;  3AED B;  4MAC A;  1N62 A;  1SGH A;  4IWQ A;  3NS8 A;  2V3S A;  3H7S A;  1KF6 B;  2L76 A;  3RUL A;  3ZO5 B;  1L4D B;  3ZIM A;  4GSW A;  3ZDM C;  1V80 A;  2AL3 A;  4OZC A;  2PJH A;  3L13 A;  4W9L A;  2PPH A;  1RRB A;  2MEK A;  4IM0 A;  1CK1 A;  2AL6 A;  1ENF A;  4ICU A;  1P9D U;  3BK2 A;  4ZRI A;  3B2G A;  2M56 B;  2LVO A;  4TQ0 A;  3ZNG C;  4LLG M;  4P16 A;  3PLV A;  3VTV A;  4DDG D;  1DOY A;  3OAW A;  3VH4 B;  1OQQ A;  3EA6 A;  4PS3 A;  4NZL B;  2KVR A;  4B0M A;  1KTK A;  2K1F A;  1KFY B;  3KH0 A;  2LJ5 A;  3AEF B;  2OED A;  2WXK A;  1T0R C;  4ZDV A;  1EF1 A;  4RF1 A;  3ML8 A;  4REZ A;  3QAQ A;  2LJI A;  3EGR A;  2Y3A A;  2K3U A;  1P98 A;  2MW5 A;  1TKY A;  4C56 C;  4DHZ E;  5D3D A;  1HTO A;  1UUP A;  2FUG 1;  3EHV A;  1V5T A;  2I2Y A;  3PZ8 A;  2QDF A;  3PO0 A;  2MBB B;  3QJZ A;  3AB5 A;  4C7Y A;  4HDQ A;  1TIF A;  3PS6 A;  2L3Z A;  2VH2 A;  2CJN A;  1NEK B;  2VH1 A;  1I35 A;  3Q8B A;  3UQB A;  1JWB D;  4ITK A;  2MX2 A;  5CTR C;  5KHQ A;  3X0W A;  1OFF A;  3TJP A;  3ZGZ A;  2E6X A;  3SEB A;  2L1A A;  2DYO A;  2LEK A;  1FFV A;  2LI5 A;  3MFG A;  4XC2 A;  1D3Z A;  1MHX A;  1UD7 A;  2BTE A;  1KJT A;  2WHI A;  3IG3 A;  4W9K A;  2DYB A;  4EZJ A;  2OJR A; 
#chains in the Genus database with same CATH homology
 3AE5 B;  3U4E G;  3P1M A;  4DXF A;  1YN5 A;  3P42 A;  1KLU D;  3VQI A;  4GLS C;  1WXQ A;  4DXG A;  1YJI A;  1C4A A;  2WDV B;  2TSS A;  1M4V A;  4RCO A;  3IT6 B;  3V3X A;  3BYY B;  5HHD G;  3Q8F A;  3DWG C;  5BMG A;  1K53 A;  2WDQ B;  3Q8E A;  4NAM A;  3HVD A;  5EE1 A;  1RYJ A;  2AQ1 B;  2JYE A;  4HEA 1;  3GB1 A;  3AEE B;  3FC4 A;  2L52 A;  1EWC A;  2I38 A;  2JZP A;  4A8X C;  1JW9 D;  2KN4 A;  2N9L A;  2WNM A;  1Y56 A;  1MHH E;  5D3I B;  2W3S A;  3P4S B;  4IDI A;  2WXH A;  1J7B A;  2CU3 A;  4USA A;  1CJE A;  1JWU D;  1TS4 A;  2RDG A;  1HEZ E;  1V1O A;  2G1E A;  4WIP A;  3AE1 B;  1IGC A;  1E9M A;  1MI0 A;  1HA5 A;  2LHE A;  1FXA A;  1F77 A;  4WWM A;  1SIJ A;  1FMA D;  1FXI A;  1SE2 A;  3ZJU A;  1TKG A;  2YEP B;  2ZW0 A;  3EUB 2;  3BK1 A;  1KH0 A;  4KGR A;  4IOI E;  4RGM A;  2BS2 B;  1QIL A;  2N7J A;  4A9A A;  1I4Q A;  1WRI A;  1V97 A;  3FIL A;  5H92 C;  2ONQ A;  2AQ3 B;  1K52 A;  3KLS X;  3NRZ A;  3ZJV A;  1MPE A;  1TY2 A;  2DLB A;  3MP9 A;  1L5P A;  5H8Y E;  3P4Q B;  3BVZ A;  1RM6 C;  1NEN B;  2NMQ A;  2JQR B;  1EU3 A;  1ZXH A;  1NYR A;  2KAJ A;  2LGI A;  4LTU A;  3TSS A;  1XXG A;  2INP E;  1YQ3 B;  2WXG A;  5EE3 A;  3LXF A;  2BS4 B;  1A70 A;  2E3T A;  2RMM A;  4KKJ A;  1L4Z B;  4XWT A;  5AUK A;  4ARI A;  2SEB D;  3BWU D;  2V4I B;  1PGX A;  3O13 A;  5D7G A;  1P7E A;  5TSS A;  2VZK D;  4C80 A;  4XE0 A;  2WXF A;  1XLP A;  1E6E B;  1UNS A;  4TSS A;  3VRA B;  1ESF A;  1I4R A;  1T6B X;  1JRP A;  1L0X B;  2KDM A;  2R61 A;  1PUT A;  1DGJ A;  1FRD A;  2K22 A;  2FBW B;  3IAM 1;  2CJO A;  5BYR A;  3T3N A;  1PYW D;  4A90 A;  1YNT E;  1NI3 A;  2K0P A;  1TS2 A;  2KQ4 X;  5EE9 A;  2WXR A;  4ZHP A;  1FO4 A;  1XCT L;  2RPV A;  5BMI A;  2V3P A;  1SJE D;  1N60 A;  4MH8 A;  2M0A A;  1CZP A;  2RDH A;  3AMZ A;  1JWS D;  5AUI A;  3R2I A;  1ZE3 D;  1GB1 A;  1TJE A;  2IGD A;  3BZD B;  2PVG C;  4XDC A;  2D5G A;  2V0G A;  2GRI A;  5FK9 C;  2IJ0 A;  1QOA A;  1KLG D;  3TEX A;  1RFK A;  3GS2 A;  1JCK B;  1I4P A;  4GDK B;  2DYM A;  1SE3 A;  4L23 A;  4OHJ A;  5HG2 A;  3V05 A;  3HUI A;  3P4P B;  3BVM A;  1DOX A;  4HKZ E;  1EWY C;  1T5X D;  4MT5 A;  4KGT A;  2EKI A;  3I57 A;  2ZW1 A;  1K51 A;  4L2Y A;  1ROE A;  2BB6 A;  2H88 B;  2SAK A;  1SSN A;  4MM3 B;  4WQM A;  1YMH E;  1QLB B;  1D6E C;  1J7A A;  1WWT A;  2QIE B;  4R3D A;  4JWS C;  2W3R A;  4US9 A;  3ETR A;  1YN3 A;  5I4D A;  1C9F A;  1JQ4 A;  1AW7 A;  2W82 A;  4HJG E;  4ZHO A;  5LNK 1;  3AE4 B;  3FAH A;  3U2S C;  2DBY A;  1HZ5 A;  1PFD A;  3RFZ B;  2WXN A;  4RGN A;  3W9C B;  4YSY B;  3WCQ A;  1JML A;  2QIL A;  3GP7 A;  1XEE A;  3IXS A;  3P4R B;  1FRR A;  3ZQ4 A;  3AE9 B;  4YT0 B;  1P7F A;  1YQ4 B;  2N9K A;  3L4P A;  4WUR A;  5GXG B;  3VR9 B;  3HRD D;  2NTT A;  1FM0 D;  2XN9 C;  1YJJ A;  2LUM A;  1HXY D;  4AQ7 A;  1VZ7 A;  3ZJT A;  5C3J B;  2MJE A;  1I4G A;  4ZOH C;  3VRB B;  1JRO A;  1FNU A;  2BT6 A;  5FR3 A;  4JWU C;  1PDX A;  2BB5 A;  2XNA C;  2JXT A;  3W1S A;  1QOB A;  4Q2J A;  2ACZ B;  1AYF A;  3AEB B;  4JE3 B;  5FKA C;  1SJH D;  3AE8 B;  3NS1 A;  2AX5 A;  3W5V B;  1ZUD 2;  1BUI C;  2WDR B;  2YEP F;  3AEG B;  3PZ7 A;  1QOG A;  2PTL A;  1RWS A;  2G9H D;  4OVZ A;  1C76 A;  1UWM A;  1VZ8 A;  2PW9 A;  1SF0 A;  2WXM A;  1CQV A;  3MJ5 A;  1FD6 A;  1TYG B;  4YSZ B;  2LMC A;  4RGO S;  1FCL A;  2X38 A;  1JAL A;  4RH6 A;  4PT5 A;  3B9J A;  2HDE A;  1VJK A;  5BYS A;  1PGB A;  3Q8C A;  5E6J A;  3W5U B;  5JXV A;  2WQY B;  1BML C;  3N9Y C;  1TS3 A;  4RF0 A;  1N5X A;  5MPO A;  1ET6 A;  4OZA A;  1R7S A;  3AH7 A;  4H2A A;  1KRH A;  1D5Z C;  2J53 A;  2HTM E;  1FFU A;  1VR9 A;  3NVY A;  1GOZ A;  1V1P A;  2B76 B;  4FXC A;  1Q10 A;  3NVV A;  2PMV A;  4B0E A;  4JX1 C;  1SEB D;  1MVK A;  3IAS 1;  3KWV A;  1IUE A;  3B2F A;  1QF6 A;  2KWD A;  2Q5W D;  4C7Z A;  5BMH A;  2QEJ C;  4RGT A;  4D2K A;  3ABV B;  4NJC A;  1ZOY B;  2H89 B;  3Q69 A;  1F2R C;  1D5X C;  4WAF A;  2KAC A;  3MHZ A;  4TMA B;  1HZ6 A;  2WXJ A;  1C4C A;  3U7Z A;  4YSX B;  3SFE B;  4YTP B;  4XDD A;  1FEH A;  2WU2 B;  2Y5C A;  1QOF A;  2WXO A;  1BXT A;  1I4X A;  1C4P A;  3URY A;  1B1Z A;  1IBX B;  4KX6 B;  1F0Z A;  2PKO A;  1XLO A;  2J52 A;  4JPS A;  2W55 A;  4YXD B;  4HRO A;  1SXT A;  2NTS A;  3TEW A;  2WLB A;  1I4H A;  2IGG A;  1D4B A;  1L0Y B;  2OHF A;  4HRS A;  3NVZ A;  1FNW A;  5HI1 A;  3SFD B;  4KKI A;  3E9S A;  2PIA A;  2L32 A;  1LO5 D;  1SBB B;  2IGH A;  4ZRP A;  3ZYY X;  1N5W A;  2KMM A;  3CIR B;  1XLN A;  3AEA B;  5EE0 A;  1FCC C;  1ZP0 B;  3BII D;  3R8B A;  1JWM D;  1EM7 A;  1F2R I;  2GI9 A;  2WXP A;  2J42 A;  1ZDX A;  4N6E B;  1VDV A;  4ZRQ A;  2FE8 A;  3MC0 B;  2V3N A;  4US8 A;  5G5G A;  2BS3 B;  3AE3 B;  4RFB A;  4CQN A;  1J7C A;  4N58 A;  1V8C A;  4YTM B;  1EU4 A;  1ACC A;  4L1B A;  4NAW B;  1WYG A;  2WXL A;  3AEC B;  1E10 A;  2Z8L A;  3AV8 A;  2BBC A;  3LYY A;  1D5M C;  1VLB A;  3AED B;  2K5P A;  4MAC A;  1N62 A;  4RNA A;  4A6Q A;  1NVI D;  4IKG A;  3AE6 B;  3KQ4 A;  3W2D A;  1KF6 B;  5HFY A;  3LB8 C;  2JU6 X;  3SR6 A;  1L4D B;  3E56 A;  2VZK B;  1C78 A;  1PGA A;  4OZC A;  1ZDV A;  2IPK D;  1XCQ L;  1WSP A;  1E7P B;  3HVZ A;  4M0W A;  1HQR D;  1IGD A;  3AN1 A;  4KGS A;  1N61 A;  2INN E;  1OQR A;  1TZO A;  3RPF C;  3VR8 B;  2AQ2 B;  2MEK A;  2PLP A;  3R2T A;  1CK1 A;  1ENF A;  3BVG A;  1VZ6 A;  3BK2 A;  4N59 A;  3B2G A;  2JSV X;  2M56 B;  3IT4 B;  4TQ0 A;  2N0S B;  3T3O A;  4LLG M;  4P16 A;  1DYQ A;  2K9X A;  1L6U A;  1XO3 A;  2LFI A;  1QT9 A;  1E0Z A;  1DOY A;  1C79 A;  2MJD A;  3U52 E;  1GAQ B;  1OQQ A;  3EA6 A;  1GPX A;  3CWI A;  4NZL B;  3AE7 B;  4B0M A;  1SB3 C;  4J3O D;  4O1N A;  1KTK A;  4ZYS A;  4DQO C;  1STE A;  1KFY B;  2L83 A;  3TEZ A;  4XWW A;  3Q8A A;  1UWX A;  3NVW A;  1N63 A;  1DOI A;  2ON8 A;  1SE4 A;  3AEF B;  2OED A;  1IBX A;  2MH7 A;  2J4X A;  2WXK A;  3C8Y A;  4WH4 A;  3AE2 B;  2LHD A;  4RF1 A;  4REZ A;  4YTN B;  5G5H A;  5C2T B;  2LJI A;  3EGR A;  2WU5 B;  4TQ1 A;  2Y3A A;  2ICI A;  2K3U A;  1C77 A;  1FNV A;  1TKY A;  3TEY A;  3KWL A;  3J9C A;  4C56 C;  4AS1 A;  1T3Q A;  1L0V B;  3P63 A;  1TS5 A;  3UI3 A;  2WP9 B;  2EEL A;  3DWM A;  1UGJ A;  1VRA B;  2GB1 A;  5D3D A;  1UUP A;  2FUG 1;  2BYT A;  2Y5P A;  5BYQ A;  3NZ3 A;  2IDY A;  2BW2 A;  2JX5 A;  2I2Y A;  1ET9 A;  1ZXI A;  3PZ8 A;  1K50 A;  1TKE A;  1YN4 A;  3FIL B;  1L6V A;  4A55 A;  3PO0 A;  1ZPS A;  4OZB A;  1AN8 A;  3OWE B;  2PVO D;  2QMT A;  2M19 A;  2QSD A;  3AB5 A;  4C7Y A;  1NYQ A;  1XF5 L;  1B9R A;  1XLQ A;  2CJN A;  1NEK B;  1I7H A;  3Q8B A;  1JWB D;  4ITK A;  2MJ3 A;  2DWQ A;  2JYT A;  1FIQ A;  1OFF A;  4HKQ A;  4EE2 A;  1AWD A;  5T8I A;  3BYT B;  1QKZ A;  2WS3 B;  3ZGZ A;  1GB4 A;  2E6X A;  2WXQ A;  3SEB A;  1QQR A;  4P6V F;  2L1A A;  2DYO A;  2LEK A;  1FFV A;  3I9V 1;  3MFG A;  2JWU A;  2W54 A;  4OW0 A;  1JWA D;  1MHX A;  3H8H A;  4UDU C;  4ARC A;  2BTE A;  3TUO A;  2WXI A;  1TY0 A;  4YWG G;  2QJL A;  1V1P B;  4GDL B;  1WGK A;  3NUH B;  4LK0 M;  3AM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...