1L4DB

Crystal structure of microplasminogen-streptokinase alpha domain complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
112
Chain Sequence
NNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords PLASMINOGEN
total genus 24
structure length 112
sequence length 122
ec nomenclature
pdb deposition date 2002-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l4dB00
1BMLC 1L4ZB 1QQRA 1C4PA 1L4DB
chains in the Genus database with same CATH superfamily
3JSVB 1E9MA 4IWOA 4G11A 3ZUNA 4NJCA 2Z0EB 4IWQA 1E8XA 2MA9B 3H7PA 1FMAD 1L5PA 3RMKC 1CMXB 1TKGA 3FILB 4TSSA 2BT6A 4II3B 2JY6A 2BYTA 4W9GA 4JLCA 1I4PA 2LJ5A 2MQJA 4GDLB 2MLBA 2ON8A 2O6VB 2JXTA 4NQLB 3V05A 2JUOA 4PS3A 4C7ZA 4KKIA 1PGBA 3FKYA 3R8BA 4ZRJA 5D3IB 1FNVA 3RI7C 1D4BA 4HJGE 2PW9A 4FHJA 4TV3A 1DGJA 1Z2MA 3AM9A 4ICVA 2K0PA 1YMHE 2N9PC 2M8SA 3CSFA 1ENFA 1TGZB 2DZIA 1AYFA 2KMCA 2MBOA 3P42A 2D11A 1KJTA 3A1QA 1SIJA 4GDLA 1VR9A 5KHOA 2WXLA 4PT5A 3ZDTA 4YSXB 1QQRA 2I2YA 3Q14C 2RDBC 3PGEA 2NVUI 1XCTL 4L2YA 1ZKHA 4GMVA 1WGKA 3AEEB 4JL9A 2BVCA 2RPQA 3KWLA 5FR6A 1P7EA 2QSDA 3AV8A 1WF9A 5JZEB 1WJ6A 5AUKA 3H7SA 1KLGD 1XCQL 2JT4B 5C3JB 4LJPB 2GBNA 3BY4B 3A9JB 5BYQA 4KKJA 1U4AA 3QQ8B 2V4IB 2KDFB 2INDC 2KO3A 2HJ8A 2M19A 2INPE 3ZJUA 2WNMA 2V3SA 2X38A 3AMZA 1L4ZB 2BYFA 1TKEA 3U8ZA 3E9SA 4WQOB 3DQVA 1LXDA 2ASQA 4KVGB 3M3JA 2DNFA 1HA5A 4US9A 1SE2A 2L0FA 3OWEB 3RNEC 4BBNF 1NI2A 1E7PB 3RNFC 2IGDA 4NJ7A 3VHTC 4B0EA 4P1BC 2AWTA 1TZOA 3N30A 2WXKA 1OQQA 3KW5B 2EMTA 3DHIC 3RNGC 1FXAA 3ZNZB 2D3CA 3GOEA 2DBYA 2R61A 4RFBA 4XYCA 2M4NA 1TKYA 2DX5B 1JROA 3HIZA 1WXMA 4EUTA 3ZIMA 4EOYA 3BINA 1D5ZC 2SEBD 3EUB2 3Q8AA 3ZXVA 4FN2A 1JWUD 3AB5A 2JXXA 3A4RA 2AL3A 4GOCA 3I57A 1WYWB 2XBBC 1SE9A 4I6NB 4WIPA 4ZYSA 1H8CA 2LEKA 4ANVA 5JXVA 1ROEA 2KX0A 3PLUA 1VZ7A 4W9LA 1UELA 3ETRA 2FBWB 4RNAA 3TEYA 1M4VA 3Q3OC 1K50A 4REZA 2K8BA 3BK1A 2G9HD 3Q8BA 4P7IA 2KWDA 2LASA 1J0GA 2GRIA 1L6UA 4WAFA 2N4FA 4KDIC 2LGDA 2WXHA 4MH8A 1ZE3D 4JX1C 2D5GA 3R7RA 4HXDA 4RGMA 2MBHA 4URKA 1WX8A 4MELA 3ECIA 2GMIC 2MWSB 3U4EG 4PYUA 1SXTA 1WFYA 5CX3A 2D3GA 3R2IA 2MH7A 3PRPB 2UYZB 4GXBA 1RM6C 4TMAB 4MACA 2N7EA 3I5JC 4N59A 2VZKD 5BMHA 1OEYA 5BO4B 2ZNVC 2J7QB 2AYOB 4R3DA 1N6ZA 4C80A 1N60A 5TR5A 5G55A 3Q8EA 3P1MA 2INCC 3MJ5A 1UF0A 1MVKA 1SJED 4KGSA 3W2DA 2HDEA 3PZDA 2JU6X 4B95A 4BZAA 2DYMA 2KYWA 4BKSD 3PT2B 1YJIA 2Z8LA 2W3SA 3RZWC 1KRHA 1WGRA 4KSLC 2W82A 4WJNA 1OFFA 4ZHOA 4GSWA 4XDDA 1YNTE 1WGYA 1S3SG 5AEKB 1UBIA 3DBLI 2KDMA 3JSVA 2VZKB 1T0QC 2ONQA 1I4RA 3AE7B 2I1JA 2L52A 3IFWB 4HKZE 2H88B 4PYZA 4LLGM 1QILA 1TS3A 3LB8C 3T8MA 2LVPA 2DAJA 4OVUA 5FK9C 5DPTA 2QCZA 2GLSA 1FXIA 1WX7A 3MHZA 2BPSA 3LXFA 1QT9A 3H1UA 4MM3A 4H2AA 4F1SA 3DBLB 3NVYA 2CKHB 1SSNA 2B76B 5H92C 3MTNB 3ZTDA 3WIMA 1VZ8A 4LNIA 3VTVA 3DBHB 2PJHA 3A9KB 1QF6A 4HCPB 2WS3B 2QDFA 1VD2A 3PO0A 2VH2A 1V8CA 2IO1B 1OQRA 4ZOHC 3W9CB 1C4CA 5D6JB 2DLBA 4IM3A 2IYDB 3KUCB 2KNBA 3R2TA 4RF1A 1YN3A 3FC4A 2DYOA 4IG7B 4Q2JA 1TZ1A 2GBJA 2LRWA 1MG8A 3GZNI 3Q8FA 2KTRB 5J2RA 2N9KA 4YL8A 5CHFA 3JVZX 2M0AA 4US8A 3D32A 2N9LA 3HHMA 5IN7A 3T3NA 3KYCD 2N0SB 2XNAC 4ARIA 3VDZA 2DZMA 2OJWA 3TJPA 4EZJA 1IP9A 5C2TB 2KC1A 2IZVB 3RN9C 1OTRB 2NBUA 1L6VA 4NJ6A 3BWUD 4WJPA 2D10A 2KFKB 3U30A 2WWZA 2V3NA 5CHWA 4GDKA 2N1VA 4TUUA 1GB4A 2JYTA 2I1KA 1XD3B 4XX5A 1I4HA 1WM3A 4A55A 2PMVA 4ZRKA 1E0ZA 2MJDA 2HE7A 3PVLA 1SJHD 2KTRA 2BS4B 4ANUA 2FUHB 2N7JA 2RMMA 2ZEQA 2QIEB 2JYEA 2WXRA 4HDQA 3M95A 2N9EB 3H9DA 2MP2A 2PIAA 5IO9A 4AUQC 3VFKA 2KDEB 2RDHA 2K6DB 1LQBA 2CU1A 1SF0A 1DOIA 4DDID 3Q6BA 2JRHA 1C4AA 2MSED 3AI5A 4C4VB 4EE2A 1F2RC 2G1EA 3EC8A 4MSMB 1C3TA 3V62A 3NUHB 2BQQA 2ZPYA 4FHKA 4MM3B 4HLEA 1ZDXA 4EFOA 2KJ6A 4FJZA 4HJKA 3IXSA 4DHJB 2LGXA 1FNWA 4KGRA 3NG0A 3OLMD 3Q3FA 5H8YE 3ML8A 2MJEA 3JYUA 5G2NA 4EKUA 1E7VA 1GAQB 3Q3JA 4BVUC 3FILA 2LWPA 1T6BX 4LJOB 5TSSA 4B9KA 1ISNA 2FNJB 1GNUA 2G45B 1IBXA 1TS4A 2K5PA 2QHOA 3ABVB 4K1RB 4WWOA 1JRUA 5EE0A 2O2VB 3WANA 4HCNB 2M17A 1ZOYB 5D94A 4WH4A 2JX5A 2M0XA 3SFDB 4DHJD 1FCCC 1CJEA 5LXHA 3S2AA 2KLCA 1YN4A 3KH0A 4KGTA 2INNE 2WXQA 2WXOA 5DPSA 2OOBB 2BB6A 2MRPA 2NTTA 3GS2A 2L7RA 1NBFC 2JZ3B 4J3OD 2BYEA 2J52A 3O13A 5EDSA 3RNCC 3MC8A 4K7SA 3VR8B 5EE3A 1WJ4A 1WRDB 3AEAB 1EM7A 4L23A 3BIID 3C0RB 3EHVA 3MC0B 2PEAA 3PPAA 1HTQA 1Q0WB 1WMHA 3OAWA 1TIFA 3W1SA 3SEBA 4G3XB 3PLVA 5HG2A 2D07B 2J0KA 5HHDG 2BS2B 3U7ZA 3BYTB 1AN8A 2PE6B 2RR9A 2WXGA 2CU3A 2KAJA 1G6JA 2N7DA 2M1MA 4KZ0A 3HVDA 1L7YA 3CF6E 4JE3B 3ZNGC 1PFDA 3PV1A 1N63A 4N6EB 2WP9B 4B6WA 4M00A 1JWMD 3GB1A 3H6NA 5AZFA 2RSUA 4ZYNA 1WM2A 3RYTA 1K52A 4HWIB 2QJLA 2FAZA 2L00B 3HRDD 2WGSA 2DYBA 3O65B 3B9JA 2FCMA 4TQ1A 3ZVVA 3IG3A 4IDIA 2IY1B 4IC7B 2LUMA 2L3ZA 5BMIA 2BTEA 3B2FA 4W9DA 2X8XX 1K53A 4II2B 4IM2A 1JQ4A 4S17A 3VH4B 3DVNU 3NZSA 2HD5B 1OEYJ 4BFRA 5E6JA 5D2MB 1QLBB 3IAM1 4DK5A 3APDA 4LCDE 3SHQA 4C56C 3WALA 4EZLA 2ICIA 3PZ7A 3NZUA 2V9HA 4OZBA 4DBGA 1ZXHA 3NVVA 1XEEA 4YTMB 3VUWA 5G5GA 4ANWA 2XN9C 3P4QB 4M8NA 3PS6A 2KTFA 4K81A 3QX1A 3ZJTA 2WQYB 4DDGD 4GIVA 2UU7A 3QJZA 1FNUA 4KZCA 2KVRA 2IO0B 4A90A 5GXGB 1P3QU 3U7DA 4AP4C 5AZHA 2ZPNA 1EO6A 1SE4A 2MP2B 3V6CB 3A9KA 3OJ4B 4HVBA 1XO3A 2KWVB 1Q1OA 4ZDVA 4A9AA 2WDVB 5E6OA 3J9CA 2R2QA 4J6IA 1FRRA 4BKTA 2WDTB 3A4SC 2GBMA 4WWMA 2KJHB 4NZLB 5EE9A 4USAA 3FAHA 2HTME 3NVWA 3A9JA 1TBEA 1ESFA 3RZFA 2Q5WD 3CWIA 1SB3C 3BYYB 4IKGA 2MBBB 1I4XA 3B1LX 1ZGUB 1JRPA 1ZW7A 1SE3A 3RPFC 4D2KA 3E56A 1WRIA 2K8HA 1VDVA 2E6XA 2DENB 2KMMA 2GBKA 4KDLB 4XE0A 3DBSA 3NJTA 2BYVE 4CHKA 4F7ZA 2Y5PA 1IBXB 4RMAA 1J7CA 4JGHB 2VH1A 3N1XC 1WXQA 1NENB 2WU2B 2YLMA 1KF6B 1V80A 2QILA 1MFWA 2J4XA 3AE4B 1YQ3B 2LRUA 4FXCA 4IW0A 1MHXA 1R4NB 2KDBA 1CZPA 3W1YA 1JMLA 4HEA1 3VUYA 2D3AA 2YEPB 1M94A 5BYSA 2KANA 2RDGA 2HTHA 4RGTA 4IUMB 1YX6B 3PREA 4C4VA 2AL6A 4AJYB 3B0AA 3N3KB 4JWUC 4JWSC 4LK0M 1WGGA 1LFDA 3TEZA 4KSKC 1RFAA 2A4ZA 2NS5A 1KFYB 3NHEB 3N1YC 1RWSA 3PHWB 3ZQ4A 3T9LA 2PVGC 1UH6A 3WAOA 3UIPB 1ZP0B 5L83A 3AXCA 2Z59B 4A20A 3I9V1 3KLSX 4K7WA 4YTNB 2LXAA 2KFJA 3ZRCA 1VJKA 3AH7A 2LD9A 3T3OA 3KYDD 1QZEA 5LNK1 5CHVC 3X23A 2Y5CA 4MGZE 3QAQA 1HZ6A 4OZCA 2JQRB 1ZPSA 3NOBA 1EU3A 3ZYYX 2YVCA 1GPXA 4OVVA 2FCSA 1Z5SB 4W9IA 3H8HA 1E6EB 3WA0A 2KC2A 3ZNID 3OJ3A 1EF1A 4MT5A 2V3PA 2Y5BB 1HXYD 1RFKA 3ZXRA 1F77A 2KZRA 4MGKE 3VQIA 1KLVA 2CR5A 1C79A 4GDKB 1E7UA 2WU5B 2C9WB 3L0WB 2J53A 4LNKA 2CHXA 3IT4B 1AARA 1GB1A 3UI3A 3HUIA 1WY8A 2JWZA 1Q5WB 5HFYA 3KVFB 3DBHI 2K8CA 4E3CA 5D3DA 1UNSA 2L1AA 1C1YB 5BYRA 1UBQA 2NMQA 1V86A 4KIKB 2GB1A 2KDIA 4LNFA 2WLBA 3BVMA 1JWBD 1V9JA 1GC7A 1NYQA 1CQVA 2KN5A 1KM7A 1VRAB 2EMSA 1QOBA 1LGRA 3ZNHB 3L54A 2L32A 4DHZE 4RGNA 1HE8A 1KH0A 1YOVB 2DHZA 4XWWA 3DOWA 1XT9B 1UWMA 4JPSA 1N5XA 1J8CA 1N61A 2C7HA 1FM0D 4HRSA 2XEWA 3UQBA 3ZGZA 1HEZE 3ONSA 1WR6E 1Y8RC 3ZJVA 1TTNA 3M63B 5IOIA 2WHIA 4NNJB 1V1PA 4A8XC 2ZVOA 4YXDB 3PHXB 2DZKA 1F9JA 1TY0A 3HM3A 2W54A 2QEJC 4ICUA 1HTOA 3Q2AC 1EWYC 2K3UA 1I35A 1V1OA 1RRBA 2ZCBA 4K3BA 4P16A 1F0ZA 2K1FA 4M01A 2KK8A 2O2VA 3TBLD 3MP9A 3V60A 1T5XD 3H7PB 4F8CB 1K51A 4RF0A 4ZRPA 3MHSD 4FJYA 3RNBC 3P4PB 3IHPC 2G4SA 5J17A 2KX3A 4BKGA 4ANXA 3DPDA 2KOXA 4FJVB 1D5MC 1OGWA 4I6PA 1PYWD 1I7HA 3WCQA 4CQNA 3VAWA 1TS5A 4ZRIA 1V97A 1FCLA 2EKIA 4LTUA 3OG5A 1IPGA 2N1WA 3NRZA 1EWCA 3I63C 1MG4A 2FE8A 3VH3B 5MPOA 2LUEA 2KT7A 4MJSA 5AUIA 3IT6B 2ZW1A 4UDUC 2MJ3A 5CTRC 1ZXIA 4K7UA 3L17A 3ALBA 4MGYE 2J42A 4OW0A 3MC9A 5D7GA 3TUOA 1IGDA 4A3OA 2KACA 1EU4A 1WH3A 3DHHC 5L95C 4FADA 2C7NB 1T0YA 4GB9A 3SR6A 2JF5A 2KMAA 4TKNA 4A3PA 3PSEB 3AE6B 1FFVA 4ITKA 4W9EA 5GMVA 2MHJA 2AX5A 2NPTB 3DDCB 4P6VF 1TJEA 3VR9B 4MEMA 3BVGA 4M8MA 4GN1A 3TEWA 3P63A 1P0RA 2PLPA 1YQ4B 3Q69A 2RGFA 2MW5A 5I4DA 1VLBA 3AE2B 4OVZA 4AWJA 2GOWA 2IO2B 2K6QA 3Q3NC 1ZUD2 1BMLC 4BAXA 2KFKA 3R3MA 1UZXB 1IUEA 3DVGX 2LGYA 4LDTD 4XZ4A 4BBNC 3ENEA 2SAKA 3LYYA 1NYRA 1FIQA 2PKOA 4X57B 3P4SB 1P9DU 2AQ3B 3B2GA 1WX9A 1WR1A 4BOZB 2ZNVB 2LFIA 1E8ZA 1GG3A 2IY0B 4DQOC 5IKCM 4PS7A 4MDKE 1TS2A 1WJNA 3R66C 4XC2A 1NVID 1PGXA 4E74A 3UGBB 3MJWA 3LDZE 2ZZPB 1WSPA 3UIOB 3VVWB 4W9KA 5E6PA 1L2NA 2NPTA 2WDRB 2MEKA 3RT3B 1FFUA 3U2SC 3KUZA 1F2RI 2ZCCA 4MGIE 2G4DB 5C1ZA 3BK2A 4MJSB 2NR2A 2K9XA 2FIDA 5BMGA 3DWGC 2MCNB 3AE5B 2BKFA 1TY2A 3MFGA 3NZ3A 3DBRI 4DXFA 3ZKJC 3ZO5B 2H89B 2B3AA 2KWCA 4YWGG 2HJ1A 2A5UA 4WJOA 1RYJA 4HPLB 4IM0A 4M0WA 3NY5A 2L83A 2BWES 3DVGY 2CS4A 5JHBA 2JWUA 1JCKB 2IO3B 1V6EA 3UQAA 4IOIE 2TSSA 2WXJA 1SGHA 3QIJA 1NDDA 1L0XB 2ZW0A 4FULA 3P2BA 3CSTA 3RFZB 1EF5A 4NAMA 4LNNA 1I4QA 3IVFA 4YTPB 3NS1A 3EFCA 1WXSA 2MBEA 3DCGA 1QKZA 1D5XC 4AJWA 3URYA 1WE7A 2L0TA 3W5VB 2RPVA 4BOSC 2Z0DB 1TYGB 4WWPA 4TQ0A 3TEXA 1WGDA 2WYQA 3C8YA 1F1HA 3I3TB 2LI5A 2ACZB 2ZVNA 4G50A 3EA6A 1FO4A 1B9RA 2E3TA 2JVCA 1GC6A 1YJ1A 1R7SA 3CMMB 4K3CA 5G5HA 4RM8A 2BGFA 3QK0A 4DXGA 2R2OA 3RUIB 1WXVA 4AS1A 2KJRA 2ZJDA 4MSQB 2JPHA 3RD2A 4RCOA 3ZRFA 4HDOA 4S0RA 2LZ6A 2V4LA 4DWFA 2WXPA 1XLPA 1E5WA 2LHDA 2CHWA 2FCQA 1WI0A 2WX1A 3HM6X 1R4MI 1YQBA 1ET9A 2W3RA 2NTSA 1SBBB 3TMPB 4ZRQA 3L13A 2IBIB 2KKCA 1D6EC 4M0WB 3ZLZA 1UGJA 2M56B 3PRMB 2OEDA 2OHFA 4CYEA 3AEDB 3WAMA 2IDYA 2MBQA 4BKSA 2KQSA 4P1CC 4PK1A 2K25A 3L4PA 1BXTA 3VTUA 4OHJA 3AE1B 1LO5D 2O6VA 1B1ZA 5E6NA 3GP7A 1V5TA 2LVQA 3R7QA 3TCAA 1GOZA 4N9F4 3C19A 4FBJB 2GBRA 3SDLC 5FKAC 3NVZA 4GGQA 1A70A 4HK2A 1Q10A 3APFA 1MJDA 2L76A 1YIWA 2LVOA 3VUXA 3QWZB 3HVZA 3K9OB 1XLNA 2XK5B 1WZ3A 4A6QA 1V81A 1FXTB 2JRIB 3VTWA 1E10A 1NEKB 4NPNA 1T0SC 1I4GA 2QMTA 1E90A 1E8WA 4GU2A 1EUVB 2GI9A 1FD6A 5DPWA 4I6LB 3Q3MC 1FEHA 3KQ4A 3N32A 1IGCA 3SD5A 4ACFA 1V1PB 3W1SC 1N5WA 3EECA 2RD0A 4AOFA 1WE6A 1OQYA 4LNOA 5J18A 1DYQA 1SEBD 4E71A 2JZPA 4FLHA 4DXAB 1T0RC 2JZZA 1XLQA 3V6EB 3AE9B 1STEA 2OJRA 3K9PB 3QHTA 3Q8CA 1XXGA 3X0WA 4CO7A 1LM8B 3QC8B 3W5UB 2WXIA 2BB5A 1DOXA 1WGHA 2BWFA 5JH5C 4W9HA 4ZHPA 2WXMA 4EZKA 1A5RA 1JWAD 1JW9D 3GE3C 2C60A 4HPMB 4JIOU 3V3XA 2N9XA 3EGRA 1GUAB 4KIKA 2KQ4X 5EE1A 4O1NA 2YEPF 4W9FA 1FRDA 2DWQA 4AQ7A 3TSSA 3B08A 5DPRA 1Y56A 2FIFA 2MX2A 1R4MB 1KLUD 2I38A 3VRAB 2V1YA 3UINB 4DHZB 2W9NA 1JWSD 3ZDMC 4ARCA 3RNAC 3GZNB 4G0NB 1WIAA 3L10B 3L16A 3IAS1 2BF8B 5C23A 2WX0A 1TT5B 2K39A 3SU8X 1WXAA 3EFUA 1ET6A 1PDXA 1UD7A 2AQ2B 5DCNA 1WMHB 2J0JA 1WJUA 2L8JA 4RM9A 3RCZA 2PPHA 2LGIA 4PS8A 3A33B 2K22A 4OZAA 1F52A 2FUG1 2PE9A 4QAYA 3PZ8A 3AECB 1XLOA 4M02A 3DVNV 2CHZA 1D3ZA 3UF8A 2KXJA 3M62B 2LMCA 3N1ZC 5HI1A 3ZTCA 1WWTA 2KQ7A 2V0GA 5IP4D 4IWPA 3VXWA 4W9CA 1YX5B 2D3BA 3N9YC 1QOFA 1BT0A 2NCNA 1MHHE 2AQ1B 2L05A 1FPYA 1QOAA 3NS8A 1PGAA 1UGMA 3ZW3A 1V2YA 2WXNA 4XGAB 2KVZA 3RULA 1P1AA 2KLGA 1UUPA 4YSYB 3AU5A 3LJ3A 2NBWB 3AEGB 1VCBA 5HKHA 2KN4A 3PTFC 3AEFB 2J0MA 2CJOA 3U52E 2D2QA 4JQWC 2PVOD 4WQMA 4B0MA 3TL5A 1NI3A 3KWVA 4XWTA 3QARA 4RH6A 1YD8U 3ML9A 3DHGC 1J7BA 1C78A 3TIXA 5LXIB 3BVZA 4XDCA 4NQKE 1JALA 3AEBB 3AULA 2IJ0A 3AE8B 4YSZB 2G3QB 2BS3B 3VRBB 1E8YA 1R4NI 4HKQA 1SIFA 2REXA 3DWMA 3APCA 1KOTA 1P7FA 4NY0A 2BBCA 4RGOS 3WAPA 4KX6B 2C5LC 2AEHA 5T8IA 2LGSA 3IBEA 2O6VD 4NAWA 2KHWB 1DOYA 1GJZA 1PQSA 1C4PA 4GLSC 1S1QB 4L1BA 1C76A 3JW0X 2C7MB 1MPEA 2LXCA 3DBRB 4C00A 4WAAA 3PRZA 2IGGA 1L0YB 2KWUB 2PTLA 1V5OA 2IGHA 3GE8C 1K8RB 4HROA 1WYGA 3BZDB 5JHAA 1YN5A 1WZ0A 2NBVB 5FR3A 1KTKA 2DAFA 1H4RA 4FA6A 3AU4A 4WJQA 2KD0A 1X1MA 3HK0A 3A1QB 3QCAA 3V61A 3QA8A 1PUTA 1VZ6A 2Y3AA 1L0VB 4LDTB 3CIRB 1IYFA 2LHEA 3KUDB 5IAAC 1J7AA 3L08A 2BKRB 3AE3B 5AZGA 2IPKD 4N58A 1C9FA 2BW2A 1N62A 1XQQA 1C77A 2XK5A 1UWXA 2LJIA 4KV2A 4WWNA 1AWDA 2EELA 4C7YA 4NAWB 1AW7A 1BUIC 1P98A 1YJJA 1XF5L 1HQRD 2CJNA 2WDQB 4W9JA 1RAXA 5KHQA 1J19A 3N20C 1ZDVA 4EEWA 1HZ5A 4HPPA 3SFEB 5IA7A 1MI0A 4ASWC 2W55A 4WURA 2WXFA 1CK1A 1QOGA 4YT0B 1T3QA 1L4DB 2JSVX 2EKEC 2QC8A 4MH0E 2FCNA 2DZJA 1I42A 3P4RB 1RLFA 1ACCA 2UWQA 1V49A 2VRRB 5LLIA 3AN1A
chains in the Genus database with same CATH topology
2JQRB 2RMMA 1E9MA 1SBBB 2QIEB 2JYEA 2WXRA 4ZRQA 1ZPSA 1EU3A 4NJCA 1D6EC 3ZYYX 1GPXA 2PIAA 2RDHA 1FMAD 1L5PA 1SF0A 1DOIA 1UGJA 3H8HA 1TKGA 3FILB 1E6EB 4TSSA 4MT5A 2V3PA 2M56B 2BT6A 2OEDA 2OHFA 2BYTA 1HXYD 3AEDB 1C4AA 1I4PA 1RFKA 1F77A 3VQIA 2IDYA 4EE2A 4GDKB 1C79A 1F2RC 2G1EA 3L4PA 1BXTA 4GDLB 3NUHB 2WU5B 2ON8A 2J53A 3V05A 2JXTA 4OHJA 3IT4B 1GB1A 3AE1B 4MM3B 3UI3A 1LO5D 3HUIA 1B1ZA 3GP7A 1ZDXA 4C7ZA 4KKIA 5HFYA 1PGBA 3R8BA 3IXSA 1GOZA 5D3IB 1FNWA 5D3DA 4KGRA 1UNSA 1FNVA 5H8YE 1D4BA 4HJGE 2L1AA 2MJEA 5BYRA 2PW9A 5FKAC 2NMQA 3NVZA 1DGJA 1GAQB 3AN1A 1A70A 3AM9A 1Q10A 2GB1A 2K0PA 1YMHE 2WLBA 3BVMA 1ENFA 1JWBD 3FILA 1NYQA 1CQVA 1VRAB 1QOBA 1T6BX 1AYFA 3HVZA 5TSSA 1XLNA 2L32A 4A6QA 3P42A 1IBXA 4RGNA 1TS4A 1KH0A 1SIJA 2K5PA 1VR9A 4XWWA 2WXLA 4PT5A 3ABVB 4YSXB 1QQRA 1E10A 5EE0A 1UWMA 1NEKB 1N5XA 4JPSA 2I2YA 1N61A 1I4GA 1FM0D 1ZOYB 1XCTL 4HRSA 2QMTA 4L2YA 3ZGZA 4WH4A 2JX5A 1HEZE 2GI9A 1FD6A 1WGKA 3AEEB 3SFDB 1FCCC 3KWLA 1FEHA 3KQ4A 1CJEA 3ZJVA 1P7EA 1IGCA 2QSDA 1YN4A 3AV8A 1V1PB 1N5WA 4KGTA 2INNE 1V1PA 4A8XC 2WXQA 2WXOA 5AUKA 1KLGD 2BB6A 4YXDB 2NTTA 1XCQL 3GS2A 5C3JB 1DYQA 1SEBD 1TY0A 4J3OD 2J52A 3O13A 2W54A 5BYQA 2QEJC 2JZPA 4KKJA 2V4IB 1EWYC 3VR8B 2K3UA 5EE3A 1XLQA 3AEAB 2M19A 3AE9B 1EM7A 4L23A 1V1OA 2INPE 3ZJUA 2WNMA 2X38A 3AMZA 1STEA 1L4ZB 3BIID 3Q8CA 4P16A 3MC0B 1TKEA 1XXGA 1F0ZA 3E9SA 3W5UB 3W1SA 1HA5A 2BB5A 2WXIA 4US9A 1SE2A 3SEBA 1DOXA 3MP9A 1T5XD 3OWEB 4ZHPA 1K51A 2WXMA 4RF0A 4ZRPA 5HG2A 5HHDG 2BS2B 1E7PB 3U7ZA 2IGDA 4B0EA 1JWAD 1JW9D 3V3XA 3P4PB 3BYTB 1AN8A 3EGRA 2WXGA 1TZOA 2CU3A 2KAJA 2KQ4X 5EE1A 4O1NA 2YEPF 3HVDA 2WXKA 1FRDA 2DWQA 4AQ7A 1OQQA 3TSSA 1D5MC 4JE3B 1PYWD 1Y56A 1I7HA 3WCQA 4CQNA 1PFDA 1FXAA 1TS5A 1KLUD 2I38A 1N63A 3VRAB 4N6EB 1V97A 2DBYA 2R61A 1FCLA 2WP9B 2EKIA 1JWMD 4RFBA 3GB1A 4LTUA 1JWSD 1TKYA 3NRZA 4ARCA 1EWCA 1JROA 1K52A 2FE8A 5MPOA 3IAS1 2QJLA 3HRDD 1ET6A 5AUIA 3IT6B 1PDXA 2ZW1A 2AQ2B 4UDUC 2MJ3A 1D5ZC 2SEBD 3EUB2 1ZXIA 3B9JA 3Q8AA 2LGIA 4TQ1A 1JWUD 3AB5A 2K22A 2J42A 4IDIA 4OW0A 2FUG1 4OZAA 3PZ8A 2LUMA 3AECB 5D7GA 3TUOA 1IGDA 1XLOA 5BMIA 2BTEA 3I57A 3B2FA 1K53A 2KACA 1EU4A 1JQ4A 4WIPA 4ZYSA 2LEKA 5JXVA 1ROEA 2LMCA 5E6JA 1QLBB 1VZ7A 3IAM1 5HI1A 3SR6A 1WWTA 3ETRA 2FBWB 4RNAA 3TEYA 1M4VA 1FFVA 3AE6B 4ITKA 1K50A 4C56C 2V0GA 4REZA 2AX5A 2ICIA 3BK1A 2G9HD 3Q8BA 4P6VF 3PZ7A 1TJEA 3VR9B 4OZBA 2KWDA 1QOFA 3N9YC 1ZXHA 2GRIA 3NVVA 1XEEA 3BVGA 1MHHE 1L6UA 2AQ1B 4WAFA 4YTMB 3TEWA 2WXHA 4MH8A 5G5GA 2XN9C 1QOAA 1ZE3D 3P4QB 1PGAA 3P63A 2D5GA 4JX1C 2PLPA 1YQ4B 3Q69A 4RGMA 5I4DA 2WXNA 1VLBA 3AE2B 4OVZA 3ZJTA 2WQYB 3U4EG 1ZUD2 1BMLC 1SXTA 3R2IA 2MH7A 1UUPA 4YSYB 1IUEA 1FNUA 1RM6C 4TMAB 3AEGB 2KN4A 4MACA 2SAKA 4A90A 3LYYA 5GXGB 1NYRA 3AEFB 1FIQA 4N59A 2CJOA 2PKOA 2VZKD 3U52E 3P4SB 1SE4A 2AQ3B 3B2GA 5BMHA 1XO3A 2LFIA 2PVOD 4WQMA 4B0MA 4DQOC 1NI3A 3KWVA 4R3DA 4XWTA 4A9AA 4C80A 1N60A 4RH6A 2WDVB 1TS2A 1J7BA 1C78A 3J9CA 3Q8EA 3P1MA 3BVZA 4XDCA 3MJ5A 1NVID 1PGXA 1JALA 1MVKA 1SJED 3AEBB 4KGSA 3W2DA 1FRRA 2IJ0A 2HDEA 3AE8B 2JU6X 4YSZB 2BS3B 3VRBB 4WWMA 1WSPA 4NZLB 5EE9A 4HKQA 2DYMA 4USAA 3DWMA 3FAHA 1P7FA 2HTME 1YJIA 2Z8LA 2BBCA 2W3SA 3NVWA 1ESFA 4RGOS 1KRHA 4KX6B 2W82A 2WDRB 1OFFA 2MEKA 4ZHOA 2Q5WD 5T8IA 3CWIA 4XDDA 1FFUA 3U2SC 1SB3C 1YNTE 3BYYB 4IKGA 1DOYA 1C4PA 1F2RI 4GLSC 1I4XA 3BK2A 2KDMA 4L1BA 2K9XA 1JRPA 1C76A 5BMGA 3DWGC 2VZKB 2ONQA 3AE5B 1MPEA 1I4RA 1SE3A 3AE7B 3RPFC 1TY2A 2L52A 4D2KA 3E56A 3MFGA 1WRIA 3NZ3A 1VDVA 4DXFA 2IGGA 1L0YB 4HKZE 2E6XA 2H88B 2PTLA 2IGHA 2KMMA 2H89B 3LB8C 1QILA 1TS3A 4HROA 4LLGM 4YWGG 1WYGA 4XE0A 3BZDB 1YN5A 5FK9C 1RYJA 5FR3A 4M0WA 1KTKA 1FXIA 2L83A 3MHZA 2JWUA 2Y5PA 1IBXB 3LXFA 1QT9A 1JCKB 4H2AA 4IOIE 2TSSA 2WXJA 3NVYA 1J7CA 1SSNA 1WXQA 2B76B 1NENB 5H92C 1VZ8A 2WU2B 1PUTA 1KF6B 1QF6A 2QILA 2J4XA 3AE4B 1VZ6A 2WS3B 2Y3AA 1YQ3B 1L0XB 2ZW0A 3RFZB 1L0VB 4FXCA 3PO0A 4NAMA 3CIRB 1I4QA 1V8CA 1OQRA 1MHXA 4ZOHC 2LHEA 3W9CB 1C4CA 4YTPB 1CZPA 1J7AA 2DLBA 3NS1A 3AE3B 3R2TA 2IPKD 4N58A 4RF1A 1QKZA 2BW2A 1C9FA 1YN3A 1D5XC 1JMLA 1N62A 4HEA1 3URYA 1C77A 3FC4A 1UWXA 2LJIA 2DYOA 2YEPB 3W5VB 2RPVA 4Q2JA 1AWDA 2EELA 4C7YA 5BYSA 2RDGA 1TYGB 4NAWB 4TQ0A 1AW7A 3Q8FA 4RGTA 1BUIC 3TEXA 3C8YA 2N9KA 1YJJA 1XF5L 1HQRD 2CJNA 2M0AA 2N9LA 4US8A 3T3NA 2ACZB 2WDQB 3EA6A 1FO4A 2N0SB 1B9RA 2E3TA 4JWUC 4JWSC 2XNAC 4ARIA 4LK0M 1R7SA 1ZDVA 3TEZA 1HZ5A 5G5HA 3SFEB 1KFYB 5C2TB 1MI0A 2W55A 4DXGA 4WURA 1L6VA 2WXFA 1CK1A 1RWSA 3BWUD 1QOGA 3ZQ4A 4AS1A 2PVGC 4YT0B 2V3NA 4RCOA 1T3QA 1ZP0B 1L4DB 2JSVX 1GB4A 2JYTA 2WXPA 3I9V1 1XLPA 3KLSX 4YTNB 1I4HA 4A55A 2LHDA 2PMVA 3P4RB 1VJKA 1E0ZA 3AH7A 2MJDA 3T3OA 1ACCA 5LNK1 1SJHD 2Y5CA 2BS4B 1ET9A 1HZ6A 2W3RA 4OZCA 2N7JA 2NTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BML C;  1L4Z B;  1QQR A;  1C4P A;  1L4D B; 
#chains in the Genus database with same CATH topology
 3JSV B;  1E9M A;  4IWO A;  4G11 A;  3ZUN A;  4NJC A;  2Z0E B;  4IWQ A;  1E8X A;  2MA9 B;  3H7P A;  1FMA D;  1L5P A;  3RMK C;  1CMX B;  1TKG A;  3FIL B;  4TSS A;  2BT6 A;  4II3 B;  2JY6 A;  2BYT A;  4W9G A;  4JLC A;  1I4P A;  2LJ5 A;  2MQJ A;  4GDL B;  2MLB A;  2ON8 A;  2O6V B;  2JXT A;  4NQL B;  3V05 A;  2JUO A;  4PS3 A;  4C7Z A;  4KKI A;  1PGB A;  3FKY A;  3R8B A;  4ZRJ A;  5D3I B;  1FNV A;  3RI7 C;  1D4B A;  4HJG E;  2PW9 A;  4FHJ A;  4TV3 A;  1DGJ A;  1Z2M A;  3AM9 A;  4ICV A;  2K0P A;  1YMH E;  2N9P C;  2M8S A;  3CSF A;  1ENF A;  1TGZ B;  2DZI A;  1AYF A;  2KMC A;  2MBO A;  3P42 A;  2D11 A;  1KJT A;  3A1Q A;  1SIJ A;  4GDL A;  1VR9 A;  5KHO A;  2WXL A;  4PT5 A;  3ZDT A;  4YSX B;  1QQR A;  2I2Y A;  3Q14 C;  2RDB C;  3PGE A;  2NVU I;  1XCT L;  4L2Y A;  1ZKH A;  4GMV A;  1WGK A;  3AEE B;  4JL9 A;  2BVC A;  2RPQ A;  3KWL A;  5FR6 A;  1P7E A;  2QSD A;  3AV8 A;  1WF9 A;  5JZE B;  1WJ6 A;  5AUK A;  3H7S A;  1KLG D;  1XCQ L;  2JT4 B;  5C3J B;  4LJP B;  2GBN A;  3BY4 B;  3A9J B;  5BYQ A;  4KKJ A;  1U4A A;  3QQ8 B;  2V4I B;  2KDF B;  2IND C;  2KO3 A;  2HJ8 A;  2M19 A;  2INP E;  3ZJU A;  2WNM A;  2V3S A;  2X38 A;  3AMZ A;  1L4Z B;  2BYF A;  1TKE A;  3U8Z A;  3E9S A;  4WQO B;  3DQV A;  1LXD A;  2ASQ A;  4KVG B;  3M3J A;  2DNF A;  1HA5 A;  4US9 A;  1SE2 A;  2L0F A;  3OWE B;  3RNE C;  4BBN F;  1NI2 A;  1E7P B;  3RNF C;  2IGD A;  4NJ7 A;  3VHT C;  4B0E A;  4P1B C;  2AWT A;  1TZO A;  3N30 A;  2WXK A;  1OQQ A;  3KW5 B;  2EMT A;  3DHI C;  3RNG C;  1FXA A;  3ZNZ B;  2D3C A;  3GOE A;  2DBY A;  2R61 A;  4RFB A;  4XYC A;  2M4N A;  1TKY A;  2DX5 B;  1JRO A;  3HIZ A;  1WXM A;  4EUT A;  3ZIM A;  4EOY A;  3BIN A;  1D5Z C;  2SEB D;  3EUB 2;  3Q8A A;  3ZXV A;  4FN2 A;  1JWU D;  3AB5 A;  2JXX A;  3A4R A;  2AL3 A;  4GOC A;  3I57 A;  1WYW B;  2XBB C;  1SE9 A;  4I6N B;  4WIP A;  4ZYS A;  1H8C A;  2LEK A;  4ANV A;  5JXV A;  1ROE A;  2KX0 A;  3PLU A;  1VZ7 A;  4W9L A;  1UEL A;  3ETR A;  2FBW B;  4RNA A;  3TEY A;  1M4V A;  3Q3O C;  1K50 A;  4REZ A;  2K8B A;  3BK1 A;  2G9H D;  3Q8B A;  4P7I A;  2KWD A;  2LAS A;  1J0G A;  2GRI A;  1L6U A;  4WAF A;  2N4F A;  4KDI C;  2LGD A;  2WXH A;  4MH8 A;  1ZE3 D;  4JX1 C;  2D5G A;  3R7R A;  4HXD A;  4RGM A;  2MBH A;  4URK A;  1WX8 A;  4MEL A;  3ECI A;  2GMI C;  2MWS B;  3U4E G;  4PYU A;  1SXT A;  1WFY A;  5CX3 A;  2D3G A;  3R2I A;  2MH7 A;  3PRP B;  2UYZ B;  4GXB A;  1RM6 C;  4TMA B;  4MAC A;  2N7E A;  3I5J C;  4N59 A;  2VZK D;  5BMH A;  1OEY A;  5BO4 B;  2ZNV C;  2J7Q B;  2AYO B;  4R3D A;  1N6Z A;  4C80 A;  1N60 A;  5TR5 A;  5G55 A;  3Q8E A;  3P1M A;  2INC C;  3MJ5 A;  1UF0 A;  1MVK A;  1SJE D;  4KGS A;  3W2D A;  2HDE A;  3PZD A;  2JU6 X;  4B95 A;  4BZA A;  2DYM A;  2KYW A;  4BKS D;  3PT2 B;  1YJI A;  2Z8L A;  2W3S A;  3RZW C;  1KRH A;  1WGR A;  4KSL C;  2W82 A;  4WJN A;  1OFF A;  4ZHO A;  4GSW A;  4XDD A;  1YNT E;  1WGY A;  1S3S G;  5AEK B;  1UBI A;  3DBL I;  2KDM A;  3JSV A;  2VZK B;  1T0Q C;  2ONQ A;  1I4R A;  3AE7 B;  2I1J A;  2L52 A;  3IFW B;  4HKZ E;  2H88 B;  4PYZ A;  4LLG M;  1QIL A;  1TS3 A;  3LB8 C;  3T8M A;  2LVP A;  2DAJ A;  4OVU A;  5FK9 C;  5DPT A;  2QCZ A;  2GLS A;  1FXI A;  1WX7 A;  3MHZ A;  2BPS A;  3LXF A;  1QT9 A;  3H1U A;  4MM3 A;  4H2A A;  4F1S A;  3DBL B;  3NVY A;  2CKH B;  1SSN A;  2B76 B;  5H92 C;  3MTN B;  3ZTD A;  3WIM A;  1VZ8 A;  4LNI A;  3VTV A;  3DBH B;  2PJH A;  3A9K B;  1QF6 A;  4HCP B;  2WS3 B;  2QDF A;  1VD2 A;  3PO0 A;  2VH2 A;  1V8C A;  2IO1 B;  1OQR A;  4ZOH C;  3W9C B;  1C4C A;  5D6J B;  2DLB A;  4IM3 A;  2IYD B;  3KUC B;  2KNB A;  3R2T A;  4RF1 A;  1YN3 A;  3FC4 A;  2DYO A;  4IG7 B;  4Q2J A;  1TZ1 A;  2GBJ A;  2LRW A;  1MG8 A;  3GZN I;  3Q8F A;  2KTR B;  5J2R A;  2N9K A;  4YL8 A;  5CHF A;  3JVZ X;  2M0A A;  4US8 A;  3D32 A;  2N9L A;  3HHM A;  5IN7 A;  3T3N A;  3KYC D;  2N0S B;  2XNA C;  4ARI A;  3VDZ A;  2DZM A;  2OJW A;  3TJP A;  4EZJ A;  1IP9 A;  5C2T B;  2KC1 A;  2IZV B;  3RN9 C;  1OTR B;  2NBU A;  1L6V A;  4NJ6 A;  3BWU D;  4WJP A;  2D10 A;  2KFK B;  3U30 A;  2WWZ A;  2V3N A;  5CHW A;  4GDK A;  2N1V A;  4TUU A;  1GB4 A;  2JYT A;  2I1K A;  1XD3 B;  4XX5 A;  1I4H A;  1WM3 A;  4A55 A;  2PMV A;  4ZRK A;  1E0Z A;  2MJD A;  2HE7 A;  3PVL A;  1SJH D;  2KTR A;  2BS4 B;  4ANU A;  2FUH B;  2N7J A;  2RMM A;  2ZEQ A;  2QIE B;  2JYE A;  2WXR A;  4HDQ A;  3M95 A;  2N9E B;  3H9D A;  2MP2 A;  2PIA A;  5IO9 A;  4AUQ C;  3VFK A;  2KDE B;  2RDH A;  2K6D B;  1LQB A;  2CU1 A;  1SF0 A;  1DOI A;  4DDI D;  3Q6B A;  2JRH A;  1C4A A;  2MSE D;  3AI5 A;  4C4V B;  4EE2 A;  1F2R C;  2G1E A;  3EC8 A;  4MSM B;  1C3T A;  3V62 A;  3NUH B;  2BQQ A;  2ZPY A;  4FHK A;  4MM3 B;  4HLE A;  1ZDX A;  4EFO A;  2KJ6 A;  4FJZ A;  4HJK A;  3IXS A;  4DHJ B;  2LGX A;  1FNW A;  4KGR A;  3NG0 A;  3OLM D;  3Q3F A;  5H8Y E;  3ML8 A;  2MJE A;  3JYU A;  5G2N A;  4EKU A;  1E7V A;  1GAQ B;  3Q3J A;  4BVU C;  3FIL A;  2LWP A;  1T6B X;  4LJO B;  5TSS A;  4B9K A;  1ISN A;  2FNJ B;  1GNU A;  2G45 B;  1IBX A;  1TS4 A;  2K5P A;  2QHO A;  3ABV B;  4K1R B;  4WWO A;  1JRU A;  5EE0 A;  2O2V B;  3WAN A;  4HCN B;  2M17 A;  1ZOY B;  5D94 A;  4WH4 A;  2JX5 A;  2M0X A;  3SFD B;  4DHJ D;  1FCC C;  1CJE A;  5LXH A;  3S2A A;  2KLC A;  1YN4 A;  3KH0 A;  4KGT A;  2INN E;  2WXQ A;  2WXO A;  5DPS A;  2OOB B;  2BB6 A;  2MRP A;  2NTT A;  3GS2 A;  2L7R A;  1NBF C;  2JZ3 B;  4J3O D;  2BYE A;  2J52 A;  3O13 A;  5EDS A;  3RNC C;  3MC8 A;  4K7S A;  3VR8 B;  5EE3 A;  1WJ4 A;  1WRD B;  3AEA B;  1EM7 A;  4L23 A;  3BII D;  3C0R B;  3EHV A;  3MC0 B;  2PEA A;  3PPA A;  1HTQ A;  1Q0W B;  1WMH A;  3OAW A;  1TIF A;  3W1S A;  3SEB A;  4G3X B;  3PLV A;  5HG2 A;  2D07 B;  2J0K A;  5HHD G;  2BS2 B;  3U7Z A;  3BYT B;  1AN8 A;  2PE6 B;  2RR9 A;  2WXG A;  2CU3 A;  2KAJ A;  1G6J A;  2N7D A;  2M1M A;  4KZ0 A;  3HVD A;  1L7Y A;  3CF6 E;  4JE3 B;  3ZNG C;  1PFD A;  3PV1 A;  1N63 A;  4N6E B;  2WP9 B;  4B6W A;  4M00 A;  1JWM D;  3GB1 A;  3H6N A;  5AZF A;  2RSU A;  4ZYN A;  1WM2 A;  3RYT A;  1K52 A;  4HWI B;  2QJL A;  2FAZ A;  2L00 B;  3HRD D;  2WGS A;  2DYB A;  3O65 B;  3B9J A;  2FCM A;  4TQ1 A;  3ZVV A;  3IG3 A;  4IDI A;  2IY1 B;  4IC7 B;  2LUM A;  2L3Z A;  5BMI A;  2BTE A;  3B2F A;  4W9D A;  2X8X X;  1K53 A;  4II2 B;  4IM2 A;  1JQ4 A;  4S17 A;  3VH4 B;  3DVN U;  3NZS A;  2HD5 B;  1OEY J;  4BFR A;  5E6J A;  5D2M B;  1QLB B;  3IAM 1;  4DK5 A;  3APD A;  4LCD E;  3SHQ A;  4C56 C;  3WAL A;  4EZL A;  2ICI A;  3PZ7 A;  3NZU A;  2V9H A;  4OZB A;  4DBG A;  1ZXH A;  3NVV A;  1XEE A;  4YTM B;  3VUW A;  5G5G A;  4ANW A;  2XN9 C;  3P4Q B;  4M8N A;  3PS6 A;  2KTF A;  4K81 A;  3QX1 A;  3ZJT A;  2WQY B;  4DDG D;  4GIV A;  2UU7 A;  3QJZ A;  1FNU A;  4KZC A;  2KVR A;  2IO0 B;  4A90 A;  5GXG B;  1P3Q U;  3U7D A;  4AP4 C;  5AZH A;  2ZPN A;  1EO6 A;  1SE4 A;  2MP2 B;  3V6C B;  3A9K A;  3OJ4 B;  4HVB A;  1XO3 A;  2KWV B;  1Q1O A;  4ZDV A;  4A9A A;  2WDV B;  5E6O A;  3J9C A;  2R2Q A;  4J6I A;  1FRR A;  4BKT A;  2WDT B;  3A4S C;  2GBM A;  4WWM A;  2KJH B;  4NZL B;  5EE9 A;  4USA A;  3FAH A;  2HTM E;  3NVW A;  3A9J A;  1TBE A;  1ESF A;  3RZF A;  2Q5W D;  3CWI A;  1SB3 C;  3BYY B;  4IKG A;  2MBB B;  1I4X A;  3B1L X;  1ZGU B;  1JRP A;  1ZW7 A;  1SE3 A;  3RPF C;  4D2K A;  3E56 A;  1WRI A;  2K8H A;  1VDV A;  2E6X A;  2DEN B;  2KMM A;  2GBK A;  4KDL B;  4XE0 A;  3DBS A;  3NJT A;  2BYV E;  4CHK A;  4F7Z A;  2Y5P A;  1IBX B;  4RMA A;  1J7C A;  4JGH B;  2VH1 A;  3N1X C;  1WXQ A;  1NEN B;  2WU2 B;  2YLM A;  1KF6 B;  1V80 A;  2QIL A;  1MFW A;  2J4X A;  3AE4 B;  1YQ3 B;  2LRU A;  4FXC A;  4IW0 A;  1MHX A;  1R4N B;  2KDB A;  1CZP A;  3W1Y A;  1JML A;  4HEA 1;  3VUY A;  2D3A A;  2YEP B;  1M94 A;  5BYS A;  2KAN A;  2RDG A;  2HTH A;  4RGT A;  4IUM B;  1YX6 B;  3PRE A;  4C4V A;  2AL6 A;  4AJY B;  3B0A A;  3N3K B;  4JWU C;  4JWS C;  4LK0 M;  1WGG A;  1LFD A;  3TEZ A;  4KSK C;  1RFA A;  2A4Z A;  2NS5 A;  1KFY B;  3NHE B;  3N1Y C;  1RWS A;  3PHW B;  3ZQ4 A;  3T9L A;  2PVG C;  1UH6 A;  3WAO A;  3UIP B;  1ZP0 B;  5L83 A;  3AXC A;  2Z59 B;  4A20 A;  3I9V 1;  3KLS X;  4K7W A;  4YTN B;  2LXA A;  2KFJ A;  3ZRC A;  1VJK A;  3AH7 A;  2LD9 A;  3T3O A;  3KYD D;  1QZE A;  5LNK 1;  5CHV C;  3X23 A;  2Y5C A;  4MGZ E;  3QAQ A;  1HZ6 A;  4OZC A;  2JQR B;  1ZPS A;  3NOB A;  1EU3 A;  3ZYY X;  2YVC A;  1GPX A;  4OVV A;  2FCS A;  1Z5S B;  4W9I A;  3H8H A;  1E6E B;  3WA0 A;  2KC2 A;  3ZNI D;  3OJ3 A;  1EF1 A;  4MT5 A;  2V3P A;  2Y5B B;  1HXY D;  1RFK A;  3ZXR A;  1F77 A;  2KZR A;  4MGK E;  3VQI A;  1KLV A;  2CR5 A;  1C79 A;  4GDK B;  1E7U A;  2WU5 B;  2C9W B;  3L0W B;  2J53 A;  4LNK A;  2CHX A;  3IT4 B;  1AAR A;  1GB1 A;  3UI3 A;  3HUI A;  1WY8 A;  2JWZ A;  1Q5W B;  5HFY A;  3KVF B;  3DBH I;  2K8C A;  4E3C A;  5D3D A;  1UNS A;  2L1A A;  1C1Y B;  5BYR A;  1UBQ A;  2NMQ A;  1V86 A;  4KIK B;  2GB1 A;  2KDI A;  4LNF A;  2WLB A;  3BVM A;  1JWB D;  1V9J A;  1GC7 A;  1NYQ A;  1CQV A;  2KN5 A;  1KM7 A;  1VRA B;  2EMS A;  1QOB A;  1LGR A;  3ZNH B;  3L54 A;  2L32 A;  4DHZ E;  4RGN A;  1HE8 A;  1KH0 A;  1YOV B;  2DHZ A;  4XWW A;  3DOW A;  1XT9 B;  1UWM A;  4JPS A;  1N5X A;  1J8C A;  1N61 A;  2C7H A;  1FM0 D;  4HRS A;  2XEW A;  3UQB A;  3ZGZ A;  1HEZ E;  3ONS A;  1WR6 E;  1Y8R C;  3ZJV A;  1TTN A;  3M63 B;  5IOI A;  2WHI A;  4NNJ B;  1V1P A;  4A8X C;  2ZVO A;  4YXD B;  3PHX B;  2DZK A;  1F9J A;  1TY0 A;  3HM3 A;  2W54 A;  2QEJ C;  4ICU A;  1HTO A;  3Q2A C;  1EWY C;  2K3U A;  1I35 A;  1V1O A;  1RRB A;  2ZCB A;  4K3B A;  4P16 A;  1F0Z A;  2K1F A;  4M01 A;  2KK8 A;  2O2V A;  3TBL D;  3MP9 A;  3V60 A;  1T5X D;  3H7P B;  4F8C B;  1K51 A;  4RF0 A;  4ZRP A;  3MHS D;  4FJY A;  3RNB C;  3P4P B;  3IHP C;  2G4S A;  5J17 A;  2KX3 A;  4BKG A;  4ANX A;  3DPD A;  2KOX A;  4FJV B;  1D5M C;  1OGW A;  4I6P A;  1PYW D;  1I7H A;  3WCQ A;  4CQN A;  3VAW A;  1TS5 A;  4ZRI A;  1V97 A;  1FCL A;  2EKI A;  4LTU A;  3OG5 A;  1IPG A;  2N1W A;  3NRZ A;  1EWC A;  3I63 C;  1MG4 A;  2FE8 A;  3VH3 B;  5MPO A;  2LUE A;  2KT7 A;  4MJS A;  5AUI A;  3IT6 B;  2ZW1 A;  4UDU C;  2MJ3 A;  5CTR C;  1ZXI A;  4K7U A;  3L17 A;  3ALB A;  4MGY E;  2J42 A;  4OW0 A;  3MC9 A;  5D7G A;  3TUO A;  1IGD A;  4A3O A;  2KAC A;  1EU4 A;  1WH3 A;  3DHH C;  5L95 C;  4FAD A;  2C7N B;  1T0Y A;  4GB9 A;  3SR6 A;  2JF5 A;  2KMA A;  4TKN A;  4A3P A;  3PSE B;  3AE6 B;  1FFV A;  4ITK A;  4W9E A;  5GMV A;  2MHJ A;  2AX5 A;  2NPT B;  3DDC B;  4P6V F;  1TJE A;  3VR9 B;  4MEM A;  3BVG A;  4M8M A;  4GN1 A;  3TEW A;  3P63 A;  1P0R A;  2PLP A;  1YQ4 B;  3Q69 A;  2RGF A;  2MW5 A;  5I4D A;  1VLB A;  3AE2 B;  4OVZ A;  4AWJ A;  2GOW A;  2IO2 B;  2K6Q A;  3Q3N C;  1ZUD 2;  1BML C;  4BAX A;  2KFK A;  3R3M A;  1UZX B;  1IUE A;  3DVG X;  2LGY A;  4LDT D;  4XZ4 A;  4BBN C;  3ENE A;  2SAK A;  3LYY A;  1NYR A;  1FIQ A;  2PKO A;  4X57 B;  3P4S B;  1P9D U;  2AQ3 B;  3B2G A;  1WX9 A;  1WR1 A;  4BOZ B;  2ZNV B;  2LFI A;  1E8Z A;  1GG3 A;  2IY0 B;  4DQO C;  5IKC M;  4PS7 A;  4MDK E;  1TS2 A;  1WJN A;  3R66 C;  4XC2 A;  1NVI D;  1PGX A;  4E74 A;  3UGB B;  3MJW A;  3LDZ E;  2ZZP B;  1WSP A;  3UIO B;  3VVW B;  4W9K A;  5E6P A;  1L2N A;  2NPT A;  2WDR B;  2MEK A;  3RT3 B;  1FFU A;  3U2S C;  3KUZ A;  1F2R I;  2ZCC A;  4MGI E;  2G4D B;  5C1Z A;  3BK2 A;  4MJS B;  2NR2 A;  2K9X A;  2FID A;  5BMG A;  3DWG C;  2MCN B;  3AE5 B;  2BKF A;  1TY2 A;  3MFG A;  3NZ3 A;  3DBR I;  4DXF A;  3ZKJ C;  3ZO5 B;  2H89 B;  2B3A A;  2KWC A;  4YWG G;  2HJ1 A;  2A5U A;  4WJO A;  1RYJ A;  4HPL B;  4IM0 A;  4M0W A;  3NY5 A;  2L83 A;  2BWE S;  3DVG Y;  2CS4 A;  5JHB A;  2JWU A;  1JCK B;  2IO3 B;  1V6E A;  3UQA A;  4IOI E;  2TSS A;  2WXJ A;  1SGH A;  3QIJ A;  1NDD A;  1L0X B;  2ZW0 A;  4FUL A;  3P2B A;  3CST A;  3RFZ B;  1EF5 A;  4NAM A;  4LNN A;  1I4Q A;  3IVF A;  4YTP B;  3NS1 A;  3EFC A;  1WXS A;  2MBE A;  3DCG A;  1QKZ A;  1D5X C;  4AJW A;  3URY A;  1WE7 A;  2L0T A;  3W5V B;  2RPV A;  4BOS C;  2Z0D B;  1TYG B;  4WWP A;  4TQ0 A;  3TEX A;  1WGD A;  2WYQ A;  3C8Y A;  1F1H A;  3I3T B;  2LI5 A;  2ACZ B;  2ZVN A;  4G50 A;  3EA6 A;  1FO4 A;  1B9R A;  2E3T A;  2JVC A;  1GC6 A;  1YJ1 A;  1R7S A;  3CMM B;  4K3C A;  5G5H A;  4RM8 A;  2BGF A;  3QK0 A;  4DXG A;  2R2O A;  3RUI B;  1WXV A;  4AS1 A;  2KJR A;  2ZJD A;  4MSQ B;  2JPH A;  3RD2 A;  4RCO A;  3ZRF A;  4HDO A;  4S0R A;  2LZ6 A;  2V4L A;  4DWF A;  2WXP A;  1XLP A;  1E5W A;  2LHD A;  2CHW A;  2FCQ A;  1WI0 A;  2WX1 A;  3HM6 X;  1R4M I;  1YQB A;  1ET9 A;  2W3R A;  2NTS A;  1SBB B;  3TMP B;  4ZRQ A;  3L13 A;  2IBI B;  2KKC A;  1D6E C;  4M0W B;  3ZLZ A;  1UGJ A;  2M56 B;  3PRM B;  2OED A;  2OHF A;  4CYE A;  3AED B;  3WAM A;  2IDY A;  2MBQ A;  4BKS A;  2KQS A;  4P1C C;  4PK1 A;  2K25 A;  3L4P A;  1BXT A;  3VTU A;  4OHJ A;  3AE1 B;  1LO5 D;  2O6V A;  1B1Z A;  5E6N A;  3GP7 A;  1V5T A;  2LVQ A;  3R7Q A;  3TCA A;  1GOZ A;  4N9F 4;  3C19 A;  4FBJ B;  2GBR A;  3SDL C;  5FKA C;  3NVZ A;  4GGQ A;  1A70 A;  4HK2 A;  1Q10 A;  3APF A;  1MJD A;  2L76 A;  1YIW A;  2LVO A;  3VUX A;  3QWZ B;  3HVZ A;  3K9O B;  1XLN A;  2XK5 B;  1WZ3 A;  4A6Q A;  1V81 A;  1FXT B;  2JRI B;  3VTW A;  1E10 A;  1NEK B;  4NPN A;  1T0S C;  1I4G A;  2QMT A;  1E90 A;  1E8W A;  4GU2 A;  1EUV B;  2GI9 A;  1FD6 A;  5DPW A;  4I6L B;  3Q3M C;  1FEH A;  3KQ4 A;  3N32 A;  1IGC A;  3SD5 A;  4ACF A;  1V1P B;  3W1S C;  1N5W A;  3EEC A;  2RD0 A;  4AOF A;  1WE6 A;  1OQY A;  4LNO A;  5J18 A;  1DYQ A;  1SEB D;  4E71 A;  2JZP A;  4FLH A;  4DXA B;  1T0R C;  2JZZ A;  1XLQ A;  3V6E B;  3AE9 B;  1STE A;  2OJR A;  3K9P B;  3QHT A;  3Q8C A;  1XXG A;  3X0W A;  4CO7 A;  1LM8 B;  3QC8 B;  3W5U B;  2WXI A;  2BB5 A;  1DOX A;  1WGH A;  2BWF A;  5JH5 C;  4W9H A;  4ZHP A;  2WXM A;  4EZK A;  1A5R A;  1JWA D;  1JW9 D;  3GE3 C;  2C60 A;  4HPM B;  4JIO U;  3V3X A;  2N9X A;  3EGR A;  1GUA B;  4KIK A;  2KQ4 X;  5EE1 A;  4O1N A;  2YEP F;  4W9F A;  1FRD A;  2DWQ A;  4AQ7 A;  3TSS A;  3B08 A;  5DPR A;  1Y56 A;  2FIF A;  2MX2 A;  1R4M B;  1KLU D;  2I38 A;  3VRA B;  2V1Y A;  3UIN B;  4DHZ B;  2W9N A;  1JWS D;  3ZDM C;  4ARC A;  3RNA C;  3GZN B;  4G0N B;  1WIA A;  3L10 B;  3L16 A;  3IAS 1;  2BF8 B;  5C23 A;  2WX0 A;  1TT5 B;  2K39 A;  3SU8 X;  1WXA A;  3EFU A;  1ET6 A;  1PDX A;  1UD7 A;  2AQ2 B;  5DCN A;  1WMH B;  2J0J A;  1WJU A;  2L8J A;  4RM9 A;  3RCZ A;  2PPH A;  2LGI A;  4PS8 A;  3A33 B;  2K22 A;  4OZA A;  1F52 A;  2FUG 1;  2PE9 A;  4QAY A;  3PZ8 A;  3AEC B;  1XLO A;  4M02 A;  3DVN V;  2CHZ A;  1D3Z A;  3UF8 A;  2KXJ A;  3M62 B;  2LMC A;  3N1Z C;  5HI1 A;  3ZTC A;  1WWT A;  2KQ7 A;  2V0G A;  5IP4 D;  4IWP A;  3VXW A;  4W9C A;  1YX5 B;  2D3B A;  3N9Y C;  1QOF A;  1BT0 A;  2NCN A;  1MHH E;  2AQ1 B;  2L05 A;  1FPY A;  1QOA A;  3NS8 A;  1PGA A;  1UGM A;  3ZW3 A;  1V2Y A;  2WXN A;  4XGA B;  2KVZ A;  3RUL A;  1P1A A;  2KLG A;  1UUP A;  4YSY B;  3AU5 A;  3LJ3 A;  2NBW B;  3AEG B;  1VCB A;  5HKH A;  2KN4 A;  3PTF C;  3AEF B;  2J0M A;  2CJO A;  3U52 E;  2D2Q A;  4JQW C;  2PVO D;  4WQM A;  4B0M A;  3TL5 A;  1NI3 A;  3KWV A;  4XWT A;  3QAR A;  4RH6 A;  1YD8 U;  3ML9 A;  3DHG C;  1J7B A;  1C78 A;  3TIX A;  5LXI B;  3BVZ A;  4XDC A;  4NQK E;  1JAL A;  3AEB B;  3AUL A;  2IJ0 A;  3AE8 B;  4YSZ B;  2G3Q B;  2BS3 B;  3VRB B;  1E8Y A;  1R4N I;  4HKQ A;  1SIF A;  2REX A;  3DWM A;  3APC A;  1KOT A;  1P7F A;  4NY0 A;  2BBC A;  4RGO S;  3WAP A;  4KX6 B;  2C5L C;  2AEH A;  5T8I A;  2LGS A;  3IBE A;  2O6V D;  4NAW A;  2KHW B;  1DOY A;  1GJZ A;  1PQS A;  1C4P A;  4GLS C;  1S1Q B;  4L1B A;  1C76 A;  3JW0 X;  2C7M B;  1MPE A;  2LXC A;  3DBR B;  4C00 A;  4WAA A;  3PRZ A;  2IGG A;  1L0Y B;  2KWU B;  2PTL A;  1V5O A;  2IGH A;  3GE8 C;  1K8R B;  4HRO A;  1WYG A;  3BZD B;  5JHA A;  1YN5 A;  1WZ0 A;  2NBV B;  5FR3 A;  1KTK A;  2DAF A;  1H4R A;  4FA6 A;  3AU4 A;  4WJQ A;  2KD0 A;  1X1M A;  3HK0 A;  3A1Q B;  3QCA A;  3V61 A;  3QA8 A;  1PUT A;  1VZ6 A;  2Y3A A;  1L0V B;  4LDT B;  3CIR B;  1IYF A;  2LHE A;  3KUD B;  5IAA C;  1J7A A;  3L08 A;  2BKR B;  3AE3 B;  5AZG A;  2IPK D;  4N58 A;  1C9F A;  2BW2 A;  1N62 A;  1XQQ A;  1C77 A;  2XK5 A;  1UWX A;  2LJI A;  4KV2 A;  4WWN A;  1AWD A;  2EEL A;  4C7Y A;  4NAW B;  1AW7 A;  1BUI C;  1P98 A;  1YJJ A;  1XF5 L;  1HQR D;  2CJN A;  2WDQ B;  4W9J A;  1RAX A;  5KHQ A;  1J19 A;  3N20 C;  1ZDV A;  4EEW A;  1HZ5 A;  4HPP A;  3SFE B;  5IA7 A;  1MI0 A;  4ASW C;  2W55 A;  4WUR A;  2WXF A;  1CK1 A;  1QOG A;  4YT0 B;  1T3Q A;  1L4D B;  2JSV X;  2EKE C;  2QC8 A;  4MH0 E;  2FCN A;  2DZJ A;  1I42 A;  3P4R B;  1RLF A;  1ACC A;  2UWQ A;  1V49 A;  2VRR B;  5LLI A;  3AN1 A; 
#chains in the Genus database with same CATH homology
 2JQR B;  2RMM A;  1E9M A;  1SBB B;  2QIE B;  2JYE A;  2WXR A;  4ZRQ A;  1ZPS A;  1EU3 A;  4NJC A;  1D6E C;  3ZYY X;  1GPX A;  2PIA A;  2RDH A;  1FMA D;  1L5P A;  1SF0 A;  1DOI A;  1UGJ A;  3H8H A;  1TKG A;  3FIL B;  1E6E B;  4TSS A;  4MT5 A;  2V3P A;  2M56 B;  2BT6 A;  2OED A;  2OHF A;  2BYT A;  1HXY D;  3AED B;  1C4A A;  1I4P A;  1RFK A;  1F77 A;  3VQI A;  2IDY A;  4EE2 A;  4GDK B;  1C79 A;  1F2R C;  2G1E A;  3L4P A;  1BXT A;  4GDL B;  3NUH B;  2WU5 B;  2ON8 A;  2J53 A;  3V05 A;  2JXT A;  4OHJ A;  3IT4 B;  1GB1 A;  3AE1 B;  4MM3 B;  3UI3 A;  1LO5 D;  3HUI A;  1B1Z A;  3GP7 A;  1ZDX A;  4C7Z A;  4KKI A;  5HFY A;  1PGB A;  3R8B A;  3IXS A;  1GOZ A;  5D3I B;  1FNW A;  5D3D A;  4KGR A;  1UNS A;  1FNV A;  5H8Y E;  1D4B A;  4HJG E;  2L1A A;  2MJE A;  5BYR A;  2PW9 A;  5FKA C;  2NMQ A;  3NVZ A;  1DGJ A;  1GAQ B;  3AN1 A;  1A70 A;  3AM9 A;  1Q10 A;  2GB1 A;  2K0P A;  1YMH E;  2WLB A;  3BVM A;  1ENF A;  1JWB D;  3FIL A;  1NYQ A;  1CQV A;  1VRA B;  1QOB A;  1T6B X;  1AYF A;  3HVZ A;  5TSS A;  1XLN A;  2L32 A;  4A6Q A;  3P42 A;  1IBX A;  4RGN A;  1TS4 A;  1KH0 A;  1SIJ A;  2K5P A;  1VR9 A;  4XWW A;  2WXL A;  4PT5 A;  3ABV B;  4YSX B;  1QQR A;  1E10 A;  5EE0 A;  1UWM A;  1NEK B;  1N5X A;  4JPS A;  2I2Y A;  1N61 A;  1I4G A;  1FM0 D;  1ZOY B;  1XCT L;  4HRS A;  2QMT A;  4L2Y A;  3ZGZ A;  4WH4 A;  2JX5 A;  1HEZ E;  2GI9 A;  1FD6 A;  1WGK A;  3AEE B;  3SFD B;  1FCC C;  3KWL A;  1FEH A;  3KQ4 A;  1CJE A;  3ZJV A;  1P7E A;  1IGC A;  2QSD A;  1YN4 A;  3AV8 A;  1V1P B;  1N5W A;  4KGT A;  2INN E;  1V1P A;  4A8X C;  2WXQ A;  2WXO A;  5AUK A;  1KLG D;  2BB6 A;  4YXD B;  2NTT A;  1XCQ L;  3GS2 A;  5C3J B;  1DYQ A;  1SEB D;  1TY0 A;  4J3O D;  2J52 A;  3O13 A;  2W54 A;  5BYQ A;  2QEJ C;  2JZP A;  4KKJ A;  2V4I B;  1EWY C;  3VR8 B;  2K3U A;  5EE3 A;  1XLQ A;  3AEA B;  2M19 A;  3AE9 B;  1EM7 A;  4L23 A;  1V1O A;  2INP E;  3ZJU A;  2WNM A;  2X38 A;  3AMZ A;  1STE A;  1L4Z B;  3BII D;  3Q8C A;  4P16 A;  3MC0 B;  1TKE A;  1XXG A;  1F0Z A;  3E9S A;  3W5U B;  3W1S A;  1HA5 A;  2BB5 A;  2WXI A;  4US9 A;  1SE2 A;  3SEB A;  1DOX A;  3MP9 A;  1T5X D;  3OWE B;  4ZHP A;  1K51 A;  2WXM A;  4RF0 A;  4ZRP A;  5HG2 A;  5HHD G;  2BS2 B;  1E7P B;  3U7Z A;  2IGD A;  4B0E A;  1JWA D;  1JW9 D;  3V3X A;  3P4P B;  3BYT B;  1AN8 A;  3EGR A;  2WXG A;  1TZO A;  2CU3 A;  2KAJ A;  2KQ4 X;  5EE1 A;  4O1N A;  2YEP F;  3HVD A;  2WXK A;  1FRD A;  2DWQ A;  4AQ7 A;  1OQQ A;  3TSS A;  1D5M C;  4JE3 B;  1PYW D;  1Y56 A;  1I7H A;  3WCQ A;  4CQN A;  1PFD A;  1FXA A;  1TS5 A;  1KLU D;  2I38 A;  1N63 A;  3VRA B;  4N6E B;  1V97 A;  2DBY A;  2R61 A;  1FCL A;  2WP9 B;  2EKI A;  1JWM D;  4RFB A;  3GB1 A;  4LTU A;  1JWS D;  1TKY A;  3NRZ A;  4ARC A;  1EWC A;  1JRO A;  1K52 A;  2FE8 A;  5MPO A;  3IAS 1;  2QJL A;  3HRD D;  1ET6 A;  5AUI A;  3IT6 B;  1PDX A;  2ZW1 A;  2AQ2 B;  4UDU C;  2MJ3 A;  1D5Z C;  2SEB D;  3EUB 2;  1ZXI A;  3B9J A;  3Q8A A;  2LGI A;  4TQ1 A;  1JWU D;  3AB5 A;  2K22 A;  2J42 A;  4IDI A;  4OW0 A;  2FUG 1;  4OZA A;  3PZ8 A;  2LUM A;  3AEC B;  5D7G A;  3TUO A;  1IGD A;  1XLO A;  5BMI A;  2BTE A;  3I57 A;  3B2F A;  1K53 A;  2KAC A;  1EU4 A;  1JQ4 A;  4WIP A;  4ZYS A;  2LEK A;  5JXV A;  1ROE A;  2LMC A;  5E6J A;  1QLB B;  1VZ7 A;  3IAM 1;  5HI1 A;  3SR6 A;  1WWT A;  3ETR A;  2FBW B;  4RNA A;  3TEY A;  1M4V A;  1FFV A;  3AE6 B;  4ITK A;  1K50 A;  4C56 C;  2V0G A;  4REZ A;  2AX5 A;  2ICI A;  3BK1 A;  2G9H D;  3Q8B A;  4P6V F;  3PZ7 A;  1TJE A;  3VR9 B;  4OZB A;  2KWD A;  1QOF A;  3N9Y C;  1ZXH A;  2GRI A;  3NVV A;  1XEE A;  3BVG A;  1MHH E;  1L6U A;  2AQ1 B;  4WAF A;  4YTM B;  3TEW A;  2WXH A;  4MH8 A;  5G5G A;  2XN9 C;  1QOA A;  1ZE3 D;  3P4Q B;  1PGA A;  3P63 A;  2D5G A;  4JX1 C;  2PLP A;  1YQ4 B;  3Q69 A;  4RGM A;  5I4D A;  2WXN A;  1VLB A;  3AE2 B;  4OVZ A;  3ZJT A;  2WQY B;  3U4E G;  1ZUD 2;  1BML C;  1SXT A;  3R2I A;  2MH7 A;  1UUP A;  4YSY B;  1IUE A;  1FNU A;  1RM6 C;  4TMA B;  3AEG B;  2KN4 A;  4MAC A;  2SAK A;  4A90 A;  3LYY A;  5GXG B;  1NYR A;  3AEF B;  1FIQ A;  4N59 A;  2CJO A;  2PKO A;  2VZK D;  3U52 E;  3P4S B;  1SE4 A;  2AQ3 B;  3B2G A;  5BMH A;  1XO3 A;  2LFI A;  2PVO D;  4WQM A;  4B0M A;  4DQO C;  1NI3 A;  3KWV A;  4R3D A;  4XWT A;  4A9A A;  4C80 A;  1N60 A;  4RH6 A;  2WDV B;  1TS2 A;  1J7B A;  1C78 A;  3J9C A;  3Q8E A;  3P1M A;  3BVZ A;  4XDC A;  3MJ5 A;  1NVI D;  1PGX A;  1JAL A;  1MVK A;  1SJE D;  3AEB B;  4KGS A;  3W2D A;  1FRR A;  2IJ0 A;  2HDE A;  3AE8 B;  2JU6 X;  4YSZ B;  2BS3 B;  3VRB B;  4WWM A;  1WSP A;  4NZL B;  5EE9 A;  4HKQ A;  2DYM A;  4USA A;  3DWM A;  3FAH A;  1P7F A;  2HTM E;  1YJI A;  2Z8L A;  2BBC A;  2W3S A;  3NVW A;  1ESF A;  4RGO S;  1KRH A;  4KX6 B;  2W82 A;  2WDR B;  1OFF A;  2MEK A;  4ZHO A;  2Q5W D;  5T8I A;  3CWI A;  4XDD A;  1FFU A;  3U2S C;  1SB3 C;  1YNT E;  3BYY B;  4IKG A;  1DOY A;  1C4P A;  1F2R I;  4GLS C;  1I4X A;  3BK2 A;  2KDM A;  4L1B A;  2K9X A;  1JRP A;  1C76 A;  5BMG A;  3DWG C;  2VZK B;  2ONQ A;  3AE5 B;  1MPE A;  1I4R A;  1SE3 A;  3AE7 B;  3RPF C;  1TY2 A;  2L52 A;  4D2K A;  3E56 A;  3MFG A;  1WRI A;  3NZ3 A;  1VDV A;  4DXF A;  2IGG A;  1L0Y B;  4HKZ E;  2E6X A;  2H88 B;  2PTL A;  2IGH A;  2KMM A;  2H89 B;  3LB8 C;  1QIL A;  1TS3 A;  4HRO A;  4LLG M;  4YWG G;  1WYG A;  4XE0 A;  3BZD B;  1YN5 A;  5FK9 C;  1RYJ A;  5FR3 A;  4M0W A;  1KTK A;  1FXI A;  2L83 A;  3MHZ A;  2JWU A;  2Y5P A;  1IBX B;  3LXF A;  1QT9 A;  1JCK B;  4H2A A;  4IOI E;  2TSS A;  2WXJ A;  3NVY A;  1J7C A;  1SSN A;  1WXQ A;  2B76 B;  1NEN B;  5H92 C;  1VZ8 A;  2WU2 B;  1PUT A;  1KF6 B;  1QF6 A;  2QIL A;  2J4X A;  3AE4 B;  1VZ6 A;  2WS3 B;  2Y3A A;  1YQ3 B;  1L0X B;  2ZW0 A;  3RFZ B;  1L0V B;  4FXC A;  3PO0 A;  4NAM A;  3CIR B;  1I4Q A;  1V8C A;  1OQR A;  1MHX A;  4ZOH C;  2LHE A;  3W9C B;  1C4C A;  4YTP B;  1CZP A;  1J7A A;  2DLB A;  3NS1 A;  3AE3 B;  3R2T A;  2IPK D;  4N58 A;  4RF1 A;  1QKZ A;  2BW2 A;  1C9F A;  1YN3 A;  1D5X C;  1JML A;  1N62 A;  4HEA 1;  3URY A;  1C77 A;  3FC4 A;  1UWX A;  2LJI A;  2DYO A;  2YEP B;  3W5V B;  2RPV A;  4Q2J A;  1AWD A;  2EEL A;  4C7Y A;  5BYS A;  2RDG A;  1TYG B;  4NAW B;  4TQ0 A;  1AW7 A;  3Q8F A;  4RGT A;  1BUI C;  3TEX A;  3C8Y A;  2N9K A;  1YJJ A;  1XF5 L;  1HQR D;  2CJN A;  2M0A A;  2N9L A;  4US8 A;  3T3N A;  2ACZ B;  2WDQ B;  3EA6 A;  1FO4 A;  2N0S B;  1B9R A;  2E3T A;  4JWU C;  4JWS C;  2XNA C;  4ARI A;  4LK0 M;  1R7S A;  1ZDV A;  3TEZ A;  1HZ5 A;  5G5H A;  3SFE B;  1KFY B;  5C2T B;  1MI0 A;  2W55 A;  4DXG A;  4WUR A;  1L6V A;  2WXF A;  1CK1 A;  1RWS A;  3BWU D;  1QOG A;  3ZQ4 A;  4AS1 A;  2PVG C;  4YT0 B;  2V3N A;  4RCO A;  1T3Q A;  1ZP0 B;  1L4D B;  2JSV X;  1GB4 A;  2JYT A;  2WXP A;  3I9V 1;  1XLP A;  3KLS X;  4YTN B;  1I4H A;  4A55 A;  2LHD A;  2PMV A;  3P4R B;  1VJK A;  1E0Z A;  3AH7 A;  2MJD A;  3T3O A;  1ACC A;  5LNK 1;  1SJH D;  2Y5C A;  2BS4 B;  1ET9 A;  1HZ6 A;  2W3R A;  4OZC A;  2N7J A;  2NTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...