1L4UA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(ii) at 1.8 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 58
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4uA00
3ZIAD 2BDTA 2BBWA 2WIBA 3SZRA 5H8WA 5CM9C 1BH2A 1IHUA 2OXRA 1DAEA 2VHUA 3D7MA 3UWKA 2QMUA 4DEXA 3ICQB 1LS1A 2EVWX 1YKSA 1KGDA 1N6OA 2RMKA 1MH1A 3IILA 3VFDA 5CITA 521PA 5F98A 2GBLA 3TBKA 4JLOA 5GJWC 1VKJA 1X86B 3CX8A 4M53A 1E1QA 3VR1A 1UAAA 1QHNA 2XNDA 1AS3A 2ZS9A 1P72A 3KKOA 3UWOA 4MKHA 2IEZA 2QEQA 1RZ3A 4JBXA 1VIAA 2ZR9A 4FXPA 4PPGA 1KKLA 4WBSA 5FTNA 1TAGA 3T1OA 4Q9IA 4AD8A 1SGWA 5FH9A 3QKUA 5KU1A 2V3CC 5HE9A 2GXUA 5EP2A 3LQQA 3C16C 3RS2A 1DAIA 4QHTA 3BB3A 3VU9B 1B23P 3B1WA 3BS4A 2AN9A 3LV8A 2NMVA 1H8HD 2AHOA 3SHFA 2QRNA 4ZIRB 1SHKA 2QU8A 3EZ7A 3IPXA 3V4RA 4O3MA 5BYJA 3VKGA 1DOAA 1NLZA 1J2JA 1HUQA 1Q3HA 2AD1A 4US2R 1SVIA 2QP3A 5AWFC 3QEJA 5LBIA 3WXMA 1NY5A 4IDHA 2WAXA 5BN3A 2UZ3A 1R2QA 3BH0A 1L2TA 4ZO4A 1XPRA 4TL7A 3ZD6A 2FA9A 4X8HA 1GL9B 4S2EA 4A2PA 2GJ9A 3KKPA 3UK6A 2VP0A 4I81A 2IXGA 3SJZA 3RVBA 2P0EA 1JPNA 2OG2A 1KMQA 2B7BA 2CL6X 2QUZA 3EARA 4J0QA 2H92A 2P5SA 3MWYW 1DO2A 1NVWQ 3AVQA 1ESMA 4Q7JB 4FMBB 4MRRA 1AKEA 4C7OB 2JJ2A 4KVAA 4XVUA 2HF8A 4M1KA 2JGNA 3OIWA 2V4ZA 4ZDJA 2Q3MA 2O8BA 4KCGA 2NZJA 4Q4AB 2DFNA 2OZEA 5E95A 4A0HA 4F38A 3KJEA 2PJZA 1KI8A 1HT2E 2VQSA 1GWNA 2MMGA 2V54A 3LBHA 4GPTA 4MYUA 2IF2A 2EFGA 5FPYA 1R6BX 1GL6A 2QRZA 4DC9A 4FCTA 1XJQA 5HTKA 5CK5A 1XFAA 1Q1QA 3H2YA 4KODA 4B35A 3WNBA 4TMTA 4YMVA 1S4QA 1XJ0A 4TLAA 4A15A 4RD3A 2EU8A 2IUTA 1IXZA 3R9IA 1CLUA 1P75A 4MGIR 2VL7A 4FIDA 3P20A 4MH0R 3IDQA 1N5LA 3LO5A 3VMFA 1OH5A 2KSQA 2FZ4A 2VP9A 3Q85A 3GJ5A 1IN5A 1CJUC 1TQ6A 3CPJB 2XJ4A 2WMOB 3WY9A 4W5JA 4TLBA 2JLZA 4Z8XA 1ZM7A 4GT1A 1YVDA 3ZVRA 4TTQA 2ZRJA 4O25A 3ZGXA 4H9GA 2ZEJA 1OFIA 1RIFA 1T8UA 1M2OB 2D74A 3W5IA 3X1XA 3U6BA 1EFRA 2QAGC 4DIDA 4IVRA 1N5IA 2FX3A 3U4QB 2O8FB 1Z2CA 2B8TA 1G21E 3VR4A 2WKQA 2ZI6A 2P3SA 3U3KA 2VSFA 4Q1BA 5AUOB 1SVLA 4A2QA 1SKYB 1G19A 1JJVA 1WDTA 1ZUHA 2ZUCA 1Q12A 5JCPA 2ZSAA 4NBSA 1TPZA 3TNFA 3BERA 4AIIA 3THXB 2Z4SA 4C0BA 4PPNA 1F3OA 1EFUA 3MJRA 3CH4B 1MABB 3SJAA 5GJVC 5C46F 1VMAA 4KFTA 4LV8B 2WJVA 3O8DA 1W4RA 1T3LA 1C9KA 3THYB 5UKDA 3ASZA 1AK2A 2OXCA 4KSCA 2IL1A 1GAJA 1WXQA 3H0KA 2HCJB 2ZQ5A 4JVLA 2IWRA 2HJVA 1G20E 1J8MF 4B44A 4KSBA 1G3IA 3IUYA 1RYHA 3JZAA 3ZVMA 3L0SA 5LD2B 5IRCD 3TUJC 2ZRHA 1FW6A 3LLUA 2XX3A 2RHDA 1XMSA 1K6MA 2IUSA 2Y8EA 3CRMA 3KTAA 1NN5A 3GLHE 3B85A 2WICA 4OHZA 1NN0A 1HV8A 2ZUBA 3RYTC 5FR1A 2BEJA 2G3YA 5FOSA 2BJWA 3LQRA 2VHQA 2ORIA 2PX0A 3G5UA 2PMDA 4IVQA 4UNSA 3KUDA 2GJAA 1W46A 4HAZA 1E2MA 2F6RA 1D5CA 1LY1A 1YRBA 3HWSA 1ZD9A 4JS0A 3RANA 1KMHB 4D0GA 3U60B 2VO1A 1E2KA 1W36D 1FX0B 4KI0A 4O2RA 1RJ9A 3AF0A 2ORWA 2PT7A 1CKEA 3B1ZA 4HSEA 3P4XA 1Z0IA 5KDLA 5JLJA 2ZRDA 4U7DA 3W6OA 2JJ1A 2ASEA 3GPLA 5EP1A 3N2IA 1U9IC 1PLLA 1RW4A 5IF9A 2J0QA 3KQNA 1KHTA 1KO5A 3AP3A 3Q7QA 3SHWA 4NE2A 1ZM9A 4HUQB 1CJTC 3P27A 1YZKA 4Z51A 1IOZA 3NC1C 2HUPA 2YVUA 4TMWA 4TYWA 2ZRIA 4Q48A 5FBRB 4XWKA 1EXMA 4PR0A 4Y0VA 2C95A 4MGYR 3JVUA 2Q0HA 2QTHA 3O8BA 1F2UA 2VHTA 4P4SB 2V8OA 3EIEA 4B6FA 1XEXA 3RS7A 3KQUA 1A1VA 4GMXA 3WMFA 3GJ3A 4Z1MD 3DL0A 4DLVA 2NZ8A 3K53A 3DPUA 1XNJA 2BMJA 3BB1A 3OFNA 1TF5A 2ZI9A 3IEUA 4NYJR 1UADA 2NPFA 1GILA 4L5BA 3UANA 4V03A 2W6JA 2ZANA 3NBYC 4DXAA 3U3OA 1QDEA 2BEKA 4CEJB 2VRWA 4IDNA 3UPUA 4HUQA 2V1XA 1DVRA 5FI1B 1G7RA 4Q01A 1ZYUA 4DLRA 1E4YA 1T8TA 3MSXA 4BFXA 5FPHA 3B82A 3IQXA 1I2DA 4G01B 4PZLA 2HXSA 1R0ZA 2XOKA 4M9XA 4EJSB 2GJ8A 3NBFA 2ZJZA 1LF5A 3MUFA 4D4LA 2HLDD 3LAWA 4ZDKA 4D80A 4L16A 1NMXA 1AGRA 2QP4A 4OQNA 2IYVA 2ONJA 1II0A 1OJLA 2D4HA 5J4VA 2PZFA 4P0TA 2A5DA 3GEHA 4MITA 1COWA 1J70A 2QROA 4GSYA 3TVTA 2PX3A 3VNVA 1W5TA 4WZ6A 2O0HA 5G3YA 5F9FA 2C96A 4W5WA 2UKDA 4RZ2A 3VU9A 4DCTA 5IT5A 2CE2X 2J5XA 2IYTA 4D26A 2QQEA 2QMEA 1QVRA 2FU5C 2ZRLA 1YQTA 2W58A 4AYXA 2EWWA 4URXR 1OHHD 5KO2A 1T91A 2J41A 2OM2A 4PHTA 2KBFA 4NZYA 3AVPA 3ZVNA 5KPJA 1HEIA 4LHVA 5SZIA 1OIVA 2GCPA 3DOEA 5FOVA 3TIFA 4N3NA 3VKWA 1HYQA 4LCBA 4JVMA 1Z6XA 2FH5B 2DCUA 4JBYA 2WPDA 1W4CA 1XTQA 4Z54A 2QE7D 5CYPA 2OHFA 2NOAA 4IEEA 4LJ8A 4RVCA 3THYA 5C4MA 2YZ2A 4Q03A 1M7HA 4YQFA 1TEVA 2GAOA 2I3BA 1R5OA 4DLUA 1U0HC 2XITA 3IO5A 4JVNA 2Q3FA 2ZE7A 4DB2A 1G6HA 1J99A 3HP1A 2I4IA 3QF4A 4M4SA 5FTMA 3UMFA 4OL0A 4WVFA 3GP8A 2DPXA 4V02A 1E2PA 4DLTA 3OEHD 3CWZA 4GP6A 1F2UB 2A2ZA 3LVRE 4PZZA 4Z8YA 1DPFA 1JJ7A 2JLQA 3HU3A 2IYYA 1Z0JA 3TR0A 3TKLA 1AKYA 3ADBA 3L0OA 4XD7D 2H8KA 2C9CA 2CNWA 3T61A 3A4MA 2HV8A 2O8DA 1KAGA 1JAIA 4NYMQ 3KZ1E 4PQRA 4AK9A 1MO5A 5HKKD 1KMHA 1ZNXA 1KSFX 2HXYA 2OE2A 3E1SA 3L8ZA 2W00A 4NTZA 1I4LD 4EPVA 5LB2A 5LB4A 3SEAA 3B60A 4B43A 4WXPA 3R8CA 2FE4A 3AGQA 4F92B 3QF4B 3RSLA 1SULA 4UJ5A 1DADA 1GVNB 4KV9A 4QFMA 3KQHA 2GCNA 4OI1A 1TU4A 1I2MA 2OFXA 5TY0A 2NO9A 5BYKA 5CDFA 3A1UA 1DAFA 2CEAA 3K8YA 3IIJA 5E7MA 2OLJA 1Z6YA 4O2LA 3LVQE 2GDJA 2GCOA 4TWZA 3MAAC 4F4JA 3T1VA 3ND8A 2SHKA 5AJWA 2IYLD 2WJJA 3K0AB 5J40A 4AYWA 1E99A 4G5OA 3B13B 4GNKA 2O0KA 1NIJA 2EYUA 3F5FA 1G41A 3IHLA 4I99A 4Q21A 2ZU0C 1SXJD 3IGFA 4WIAA 1PLJA 2ODWA 3Q72A 3Q7PA 3VX4A 2YV5A 3HR8A 3T1QA 3TRFA 3WP0A 1DBSA 4CEJA 2PL3A 4DHEA 1ZINA 2WKPA 1E2QA 2ZJYA 5TDHA 3SNHA 4JL5A 4JL8A 1YR6A 3CPHA 4S35A 4RZUA 5BN4A 5JRZA 4V0OA 4YLGA 3AKEA 3TSOA 1OFUX 1P60A 3THXA 1L8QA 1UKZA 5FOXA 1U90A 3ZDQA 3AQ4A 4P4TA 2MMCA 4QJ5A 2XTMA 2PCJA 3NH6A 1W2HA 2ZRKA 5FPKA 2GILA 1GNPA 1G17A 1DE0A 3I8SA 3AVYA 2HLDA 2J0UB 1HQYE 2X2FA 721PA 5KNDA 4CDGA 3R8FA 1NG9A 3FE2A 1M7GA 2OILA 2GXQA 5CK4A 1FTSA 4DCUA 2GESA 2QQ0A 4LSGA 3W5JA 5CDFE 4AKIA 3ZH9B 3NEJA 5FBWB 4EJSC 1CR1A 2RGNA 1W48A 1HURA 2C9OA 3LA6A 4O0MA 4C0AC 2Q9AA 3PJRA 2ZRGA 3A58B 4CGZA 1UDWA 1HE8B 3CM0A 4AYTA 3IKJA 4EPRA 3I1FA 3ZLJA 2GNOA 1E9CA 5E7JA 3F0TA 3IPYA 4DSUA 2VP6A 3AF4A 1MR3F 3PUWA 4XH9B 3WBKA 2JDID 5KSZA 1WBBA 5TVKA 1R10A 4KVGA 4BZXA 2QT1A 1E0JA 1EWQA 1YE8A 3CLVA 3LX8A 3B1YA 2R44A 2QT0A 1QRAA 1QHGA 2ZJ2A 4IW3B 4P33A 1KJWA 5AJXA 3T34A 3F8TA 4OK5A 4XTCS 3T12A 4G1UC 4I1OA 3HYTA 5SZKB 1Q44A 1DARA 3GLFE 3WHKA 1NSFA 5BWMA 1YZLA 1LTQA 3TLXA 4F4IA 2WWHA 5KNCA 3E70C 4LBVA 3AEZA 3DZDA 3GMTA 4B2PA 1XXHB 1NVXQ 2QMOA 4RD6A 5E4FA 1NN1A 1XCPA 1OXXK 3ZQ6A 2CMKA 4HDCA 4QHYA 5JHGB 1E9DA 1LF0A 5ELXA 1U2RA 4XWOA 3RDPA 2OEPA 5CM8B 2O52A 2G88A 3MD0A 2VP2A 4DWJA 3FMPB 1AZTA 2WJYA 1NBMA 2D62A 2RGNC 4HAVA 1GM5A 2JLUA 4ERNA 2ZIAA 4BZPA 2QAGA 3KQLA 5TARA 2A9KA 3ZYCA 1V5WA 1IJEA 4LHZA 1CJKC 1QHSA 3K9GA 2Z6VA 2P65A 1JR3D 4CW7A 3PUXA 3SU8A 1W4BA 4RD2A 4WXRA 3QENA 1NN3A 2Z5FA 1KI2A 1ETUA 4HLDA 2HYIC 1XDBA 3R7WA 1B0UA 2GVZC 1FFHA 4LBZA 1NBME 1U8YA 2A7QA 1TF7A 3KXKA 3I4LA 5DE3A 4B33A 5HZKA 3O8RA 1P3JA 2LCFA 2MSCB 4HZUA 3AVVA 4IHQA 4B3DA 4F7WA 3G0HA 5FTKA 4B3FX 4K8OA 4A6PA 4D6PA 5EXPA 4E03A 1QG2A 1PUIA 5K8UA 2J59A 4NDZA 2PLFA 4QGFA 4ZCIA 2GXSA 1S0UA 4TYQA 621PA 2F9MA 1VDZA 1XD2A 1ZU4A 5AJZA 2WOJA 4Q9JA 4QGGA 3BK7A 3EA5A 5FPSA 5DI9A 1VCMA 1NKSA 3MGCA 4QBGB 3FFAA 5JZVA 3CRVA 4P31A 3UATA 1NY6A 4KYIB 2IUUA 4IVPA 5B57C 3W8NA 2VF7A 1F48A 1SKQA 2CK3D 2O8CA 4RFSB 5JHHB 4ZDIA 3KJHA 2ORVA 4P4SA 1SXJC 3U5ZB 1Q1EA 2XGJA 2XNDD 3TSWA 1KZ7B 2PZEA 4AURA 2DFTA 5DYGA 2PJRA 2IK8A 3K0CA 4BLRA 4HB2A 4JSYA 1Q20A 3SJCA 3FKSA 1XTSA 1UEJA 1D8TA 3H1TA 1G4AE 2X8AA 3K9HA 3MLEA 3OE7A 1XPUA 1S3GA 4QC2A 2FSHA 4HI0E 3ZIAA 4DKXA 3QPWA 4IOKA 2BOVA 2YC2C 3U7GA 3BC1A 1OV4A 2G77B 4TT3A 3PXGA 2WV9A 3MWLA 3T35A 1KOFA 1L4YA 1ZBDA 4UNRA 4EIWA 2PZGA 2YOGA 2GBLC 1HA3A 3QXXA 5GADl 2ZRNA 4HZUB 4FMDF 4RY2A 5FL3A 3A6PC 4KHZA 2YJTD 4D4JA 2HDNB 1MABA 4LPKA 1N6RA 5JS8A 4Q1CA 5FI0B 4OQLA 1KI1A 4YONB 4LV6A 4A36A 2NQ2C 5JI2E 2CHGA 2P6RA 4B76A 4OJQA 1E79A 2GA8A 4V0KA 1EESA 1C4OA 3F3YA 3E2IA 4KITB 1KI3A 4II7A 2YWEA 3DM5A 1LV7A 1RKBA 3OE7D 1Z0AA 3GCGA 4R98A 5DYIA 1ZIOA 3X1DA 1E2IA 1DAHA 1SVKA 4TLCA 4BASA 2XEXA 4LJAA 4TTPA 1G4UR 2N1BA 3WYFA 4YMTA 3R7WB 3W6PA 2D3WA 4PAMA 2BVNA 4YXWA 1ZM4A 5F3WB 1XWIA 1E2HA 4PSKA 3AVWA 1FTNA 4GP7A 2AXNA 3PIRA 2FF7A 3WYGA 2FZLA 1NIPA 1KY2A 3CB4A 1NKTA 1XEWX 2A5YB 5G40A 2QBYB 1KNXA 2VP4A 1D2EA 2AKAB 3Q8XB 1QF9A 2D7DA 2R6AA 1ZU5A 3SE0A 4MRSA 4TMXA 3WNDA 4C3ZA 3PCRB 2O8FA 3HR7A 1XD2B 1IONA 3A4LA 3C5CA 3C7KA 5DI3B 4XSGA 2GEVA 3CNOA 3I73A 4ON9A 4TL6A 4AWXA 3TW4A 2N42A 2ZITA 3PG5A 2QAJA 4IRUB 3HPQA 1IBRA 4PPQA 4WAUA 4DRZA 3N2EA 4F93B 5KYKA 1L7VC 3C8UA 2X19A 4B47A 5GJBA 4ITRC 4B34A 2VYFA 5H1YA 1G64A 3K70B 4JKYA 1E69A 1XD8A 5CYOA 1GNRA 4OK6A 2ATVA 4A0GA 4TSFA 1R5NA 2E87A 1YR7A 3AP2A 1GNQA 4Q02A 4I1VA 4UXIA 3QSYA 3T5DA 2QBYA 2IYZA 1F60A 4QBHA 3FFBA 2HJGA 1G8YA 1XB2A 2OCYC 3NVAA 3QQ5A 4HLUA 4CRWB 4CIDA 3KDSE 1Z47A 1F5NA 2P5TB 4AC9A 1JPJA 3K9LA 2ZRMA 1JQLB 1NVUQ 3LY5A 1ZUIA 3NKVA 2CBZA 3EZFA 5K8IA 4MA4A 1IN7A 3OIVA 1N25A 4DJTA 3KXIA 3U3MA 4URWR 1WF3A 2ZETA 2WTUA 2HEIA 4LJ7A 3N5CA 4LUCA 5C4GB 4D4KA 1E9RA 1U94A 4JBWA 1CJMA 1JEEA 5ANRB 1P6XA 1KK1A 3SYNA 3CRQA 1N6PA 4ACBA 2OCAA 2Q3HA 3AF2A 3THWA 2O8BB 2ZS7A 4I1SA 5CLQA 3QG5A 3UIEA 2N46A 3LW7A 4OHYA 1E96A 4IOLA 4Q7MB 1W4AA 4BECA 3C14C 2RGGA 3M1IA 1CIPA 2BWJA 1XCGB 1Z28A 1Z07A 5AUPB 1VYVA 2IS2A 4A8JB 4W9MC 5FR2A 1IXSB 2P6NA 3LWNA 3BIFA 4AG5A 2IBMA 3ZZTA 3RAPR 4ZKEA 5B2ZA 1UBCA 4QXAA 5DLQC 3CZQA 2B92A 3LX5A 5BW8A 4AG6A 3P26A 1DG1G 1AM4D 2REBA 1II8B 5DHAA 1IN6A 1N6KA 2RGAA 1DAKA 1Z5ZA 3T06B 3RLFA 1E9BA 1G9XA 4MQBA 4DZZA 3MJHA 1WBDA 2O8DB 1FQKA 1K5DA 1QVAA 3CZPA 3RHFA 2YHSA 1W5SA 1YZNA 5TMPA 2EFEB 3ETLA 1OT3A 4CEHA 1HQCA 1R4AA 2CLDX 4KAXA 1A5TA 2V6IA 4URUR 1G291 2EWVA 1G1MA 4Q1EA 1SHZA 4Y0AA 4C7OA 4ILEA 2KI5A 5J4LA 4MDEA 5JWRA 1UBEA 2XZPA 2MSDB 3EXAA 2IYSA 1H8EA 2J7KA 2VEDA 2WMNB 4UXHA 1T3HA 1BO6A 4EAQA 5AR1A 3MWKA 3U2QA 4TSFD 4RFSA 1P5ZB 1Z2AA 4KBFA 4LBWA 4RFVA 5DN6A 3LBIA 2JEOA 4M9ZA 1E2NA 3K0CC 4PAOA 4X8OA 3QXSA 3BE4A 1E9SA 3A37A 4LHYA 1MT0A 4GOXA 3FKQA 5TXGA 1XBTA 2WPDD 3QBVA 4M1YA 4CT4B 1KK2A 4MDFA 3AF1A 2CE7A 2GWHA 1ZC3A 2NG1A 1UKVY 2VHJA 4PXAA 4BEJA 4RCZA 2A5JA 1U0JA 4OHWA 3Q9LA 3CONA 1II9A 3VNUA 1ZD8A 2O5VA 5EE9A 4FWTA 4A8JA 5DNYB 1ZW6A 2QP9X 2DFKB 3MFYA 4BRWA 4D0NA 3FYHA 3QI2A 1BMFD 4MUBA 3UKDA 4V0MA 1TQDA 3T1TA 1Z6TA 4CEIA 5EXTA 3BFVA 1FNMA 3AP1A 2GXAA 2XAUA 4NU0A 3W90A 1C1YA 5CLLA 3THWB 3IQWA 2ZYUX 2AR7A 3U61B 3PEYA 3L2OB 1FP6A 1WRBA 1AN0A 1UBGA 3PQCA 5KSPA 4PC3A 5HPYB 2P67A 2LKDA 3BD9A 1R0YA 1ODFA 3EG5A 3K0EA 2GAAA 5H70A 4C2TA 3U7HB 1OSNA 1N0UA 3J81k 3C5HA 4HLQB 4NCIA 2NO7A 4E22A 4OHVA 1ZNYA 3WRYC 4TL9A 4C0JA 4NP6A 4PO1A 3VHXA 3W6NA 1G3QA 4KXFB 1IJFA 1GIAA 4OQMA 4A6XA 4EQ6B 2GETA 2FSIA 2P6UA 2IS4A 4A0FA 2QM8A 1Z0DA 3U3JA 1VYTA 1ZM2A 1CF4A 1L4UA 3OIUA 3AV0B 4RD0A 2W6IA 2QGNA 4TL8A 3BRWD 4IXMA 3WYAA 2JLVA 2OAP1 3RS0A 3VHLB 1ZCAA 4L15A 1S9HA 3OAAD 1Q21A 2ODNA 5AK0A 1AS2A 2GEDA 1J7KA 4CT5A 4D25A 2IEYA 2DYKA 2ZR0A 4MRVA 3FKSD 4PC2A 4PSVA 4AKHA 3A36A 5FTLA 1BKDR 4IOMA 1BMFA 4XTRA 3GLGB 1II8A 3RRNA 1W0JD 2R65A 2ZJBA 2GKSA 2ZYVX 4LI0A 3FHOA 3TQCA 5KOYA 4I4LA 2YWHA 1XTIA 1W2GA 4BZQA 1H8HA 4EQ6A 4BLPA 3CF6R 2FFHA 4NMMA 4NCKA 2ZE5A 2R6FA 2ZRAA 3HU1A 5G3ZA 5DISB 4N0DA 4C0KA 4Q4HB 2HT6A 2C04A 3W34A 2YC4C 5A0FA 2FWRA 4PANA 1XTRA 3GFOA 3W8RA 2IC5A 5A4JA 3ONWA 1ZVQA 4TMKA 2WAYA 4GOJA 2R6DA 2CNWD 1UJ2A 1SXJB 2YNMA 4QJ4A 4TYNA 1ZNZA 3FPAA 4MRNA 2DFLA 4US0R 4IKEA 1EGAA 2DY1A 4QG7A 4UNNA 3H84A 1Y3AA 1OW3B 3OESA 4C0LA 5KPDA 3KKMA 2BBOA 2ZVQX 4DVGA 4HEJA 4FWIB 1GP2A 2BV3A 4RD1A 1NP6A 2W83A 1DELA 1MV5A 1TUEA 1IAQA 1XXHA 3KQKA 2QPAA 1VG9B 2F1IA 4RZXA 4G5GA 5CJPA 3CNLA 1D9ZA 4A92A 1JAHA 4Q00A 3DHWC 4JLBA 4U00A 2HYDA 1G3UA 2R8RA 5FL7D 2REXB 1XMIA 4A82A 1QHIA 4RCYA 1RPZA 1DS6A 1KNQA 4PHGA 3BBPA 2ZJAA 5FL7A 5LPNA 3HDTA 2FDCA 5L3SB 5HKKA 3M0EA 4QGAA 2GZDA 3GLFB 1JR6A 1P9WA 1NL3A 3GFTA 1FUKA 1CR4A 5IK2A 4AY2A 1J90A 2ZI7A 3AUXA 1U8AA 2R2AA 3FGNA 1KAOA 2ONKA 5F2EA 3UMRA 3I5XA 2IS1A 4FD2A 2BCJQ 1T3SA 4M1SA 4DB4A 2F3RA 3FMOB 1T6NA 2C2HA 3IHWA 1VCOA 3HPRA 1KO7A 2L0XA 4LYHA 4LX0A 3IEVA 3TGPA 1MRSA 1W49A 4M9QA 3TH5A 2E1RA 4KFRA 4G5SA 2ZRBA 2PCLA 4Q7KA 1OB5A 1OXVA 1G5RA 3IIMA 1OH7A 3ADKA 1R5BA 1SVMA 2RB4A 4Q1DA 5EE1A 4B3CA 5JMTA 4FW9A 5L3SA 3L0IB 3NG1A 1U9IA 2PMKA 3GJ0A 5SZJA 2KBEA 3BWDD 3P4YA 5D3MA 4DLSA 2Z4RA 1OF1A 4LWZA 4BFWA 1X1RA 5FTJA 5BQ5A 2B8WA 4QBFA 2YKGA 2R6GA 1M1YE 1YR9A 1G6OA 1P2VA 3K0AA 5FUVA 3REFA 3RRZA 1GSIA 2BM0A 4GI7A 1G5TA 4M1OA 4F91B 3LXXA 4QKQA 2XB4A 2KWIA 1SQ5A 3EASA 2G9NA 1TX4B 2J0VA 4TMZA 4RSGA 1E79D 3SJBA 1E2FA 3TUIC 3LNCA 1E1RA 4LYAA 2NIPA 1M74A 2CL0X 5JSZA 2IS6A 4K81B 1GOTA 1SKYE 3GLFA 4MGZR 2BM1A 3CIOA 3TVDA 2BIFA 4YMSA 2X1VA 3I72A 4UQOA 1X8KA 1TQ2A 4QJ3A 3TE6A 1OKKA 1GG2A 3VR3A 2QMHA 1G3RA 2ZE8A 3T5GA 2NPIA 5HCIA 3GJXC 5CJ2A 1GZSA 1FNNA 4LYFA 2TMKA 1XEXB 3REGA 1Z8FA 1X8JA 3ZZUA 1AZSC 3VR2A 3A1SA 3NHBA 4Q9LA 2BHRA 2J9RA 4K46A 1OYWA 2QE7A 2VHCA 1VPLA 4QOSA 421PA 4GZMA 4FINA 2WJIA 3AKDA 1FUUA 2ZXUA 3FMIA 3RRMA 3QKSB 1Z29A 2OESA 2XXAB 4AI6A 2JATA 4X8LA 3EW9A 2QENA 3CWQA 3QJYA 2H7VA 4HLUC 4KFUA 4Q5IA 5EP3A 2FNAA 2WSMA 1N6NA 2ZAMA 1NVVQ 4CF7A 1T5LA 3DKPA 4BFTA 4LPSA 1LFDB 1CRQA 2ZAOA 1ZCBA 3IBGA 3OIYA 2XSZD 2PBRA 1Z3IX 3KB2A 1I4TD 3X2SA 5KSYA 1XU4A 4P3YA 5KNBA 4D2IA 2JLRA 1CTQA 3EA0A 5EUMA 6Q21A 3LXRA 2ANCA 4R71A 4QM7A 2VF8A 2AK2A 3A8TA 2HCBA 3IO3A 4Q4AA 3M4YA 3LH5A 3KL4A 2F43B 3D31A 3EWAA 3WNCA 3GD7A 2IYRA 4PHFA 4IJMA 3PUZA 5JWOA 1HY3A 2PLRA 4YC7A 3QE0A 1E1QD 1NNEA 1GRNA 4JLPA 2WWIA 2G1KA 1R0WA 1TADA 3HYRA 4PPFA 4Q9HA 5EZ6B 4NL4H 2IHYA 2B7CA 2Q21A 4IXNA 1Z22A 1UDXA 4ZI2A 2A5GA 4IDPA 5AJVB 5DH9A 4M8NE 4JLJA 4DSNA 2R62A 2JLSA 1LVGA 5GVSA 2ECKA 1KK3A 4HAWA 4MYCA 2XTNA 2GZHA 1Q3TA 4OI2A 3SFZA 4C0SA 1DG3A 4LZZA 2CVFA 2J3EA 3I3SR 3SI7A 1US8B 1TL7C 2YYZA 1E2LA 1S2MA 4NYIQ 2F1HA 4HDOB 3TW8B 3EPKA 1W1WA 3L0PA 2J46A 3U44B 2ODEA 3SQXA 3K09C 1CEEA 3N70A 4V0NA 4ZI3A 1FL9A 3PV0A 4G3XA 1EWRA 1AA9A 4L4UA 1H65A 3Q5EA 4GOKA 4URZR 2QGZA 3QXJA 3SOPA 3W3ZB 1WA5A 5D3MB 1KSJA 2ZSFA 3EIHA 1E6CA 2ZS8A 2B21A 1GDDA 1X3SA 1OKKD 3QIAA 2QG6A 1Z6AA 4KJZA 5KTYA 3OHMA 4V0LA 2F9LA 4TZ6A 3PFIA 1HH4A 1ZMXA 5BN5A 3CH5A 4OHXA 4OK3A 2ZPTX 4TT3D 1KI7A 2PH1A 1JQJC 2CCKA 3QNUA 3L8YA 1TEXA 2QTVB 4NHOA 3AVUA 3DZ8A 1E9AA 1UKEA 5G41A 2VPPA 2YOFA 1BYIA 2YWFA 4NCNA 1KTVA 1P9RA 3ZS9A 4TMVA 2WWGA 1Z08A 2YWGA 1N6LA 5FOTA 4A1FA 2WOOA 3P1JA 1O3YA 1JBKA 2ATXA 2DWOA 4DUGD 2ERXA 2C03A 2H57A 4QHSA 2OBNA 1E9FA 1XMVA 3KUCA 3GEEA 1PZNA 3NWJA 3HU2A 3VTKA 3NBXX 4M1WA 2DBYA 1I4DD 1G3MA 2V6JA 1YJ5A 3AVOA 4EPYA 2BBSA 2ZTSA 2CLCX 5L3VA 2QPOA 5HZHA 4G5RA 1E0SA 4Q7LA 3U6KA 5KSOA 4HDQB 4JLVA 1XCMA 2I1VB 3K09A 4B71A 3NBZC 1GTVA 5C2JB 1D2MA 4CVNA 1DO0A 4DBLC 1P62B 1TUIA 4WZAE 2V1UA 4D81A 121PA 3GJ4A 3K70C 1E0KA 2JCSA 3C4JA 3V00A 4LRWA 1JECA 2FN4A 2QM7A 5B30A 3V4FA 5J4KA 3QBTA 5JFGA 1PVOA 4A8JC 2W6JD 3CX7A 2GJKA 3B1XA 1XPOA 3L82B 1U99A 4F4CA 4QM6A 1XTJA 3OFND 3VX3A 4BFZA 3EPHA 2H17A 4ZCMA 2XOKD 4B2IA 5D3QA 4GZLA 1ELOA 2ODBA 2J7PD 2FEMA 2G6BA 4BFYA 1CU1A 1S3SA 4B75A 3I62A 2JLWA 2IXEA 4W5HA 2AWNA 5E7IA 1YR8A 1ZP6A 1RRPA 1IQPA 1U0LA 4DLWA 5FUXA 5B64A 3BJIC 5AUQA 3QEOA 3ICEA 5FBQB 1U81A 1VCIA 2WWWA 5C18A 1NBMD 3CR7A 1SXJA 4XWAA 4PFSA 2IWHA 2WM9B 4BWYA 1RC8A 1KO8A 4BGDA 3SBDA 1X6VA 3X1ZA 1R0XA 1F6BA 1W0KD 5L3RA 1MKYA 3BB4A 4DDUA 1J8YF 1FQJA 1YZUA 2GZAA 5JS7A 3KJIA 1NSTA 3QPVA 2BMEA 2E9SA 4B74A 1PUJA 2RCNA 1KYIA 3K0FA 1Z0KA 2W6ID 4L8GA 1UBFA 3SR0A 2O0JA 1YZGA 2FPMA 3FTQA 5HR5A 1KO4A 1EFCA 1YU9A 4KBGA 4BEBA 3QKSA 1HE1C 2JJ1D 2FPKA 3QUSA 4Q4JB 4MYTA 2QL6A 1HT1E 2BBTA 2FGKA 3SDZA 2IYWA 5J47A 1ZIPA 2OSBA 2CDNA 1DAMA 1KK0A 3SBEA 2AL7A 1S96A 5FBLB 4JLNA 4KFSA 5F9HA 1T0JB 4BFVA 5DGXA 4TYYA 1X1SA 4R7ZA 4GRAA 1E2DA 2WWXA 2VBCA 2XSZA 4XVQA 4BLTA 3BOSA 4BFSA 1P2TA 1XEWY 4JLDA 1H8ED 4G5QA 4HB3A 3W3AA 3OF5A 2IYQA 1XP8A 2FSFA 2H16A 2WBLC 1PV4A 3G82C 3EZ2A 4B3BA 2GK6A 5EJEA 1CR2A 2GTPA 1KIMA 4M0LA 4WZBE 3B7GA 2OFWA 1A2BA 1VTKA 2OBMA 3BGWA 5EZ5A 4R9UC 3R9WA 1HTWA 2B6HA 1CBUA 2CLSA 1A7JA 5FPTA 4LYJA 4NYIR 1EG7A 1OXSC 3GLGA 1CRPA 2RAPA 3K1JA 4DDWA 1KI6B 1V43A 4WA7A 4ASUA 1KKMA 3AKCA 5JJKA 4LHXA 2WJGA 3I5YA 1G16A 4AKGA 1IN8A 4LDJA 2K5UA 1G7TA 4XOIA 4DIEA 1G8PA 1YHNA 2LWIA 1ZNWA 3B1VA 2EW1A 2QPTA 1OH8A 1Z6GA 1XF9A 4AKEA 2H5EA 1BIFA 1KSGA 4BFUA 4QNRA 1E94E 3V9PA 2RGEA 3ZS8A 1KI9A 3NDBB 2Q9BA 5DSZA 3DOFA 4OQXA 4NKRA 5DI3A 2ZUDA 3EC2A 4Q4HA 3BFKA 4LOAA 4MRPA 4DLYA 3MMPA 3FHCB 3OZXA 3TR5A 3RC3A 5E3HA 4JYCA 4JLAA 4D82A 4ZPXA 5EP4A 1OFHA 3A1VA 3D3QA 3THOA 3GLHA 2QN6A 4HB0A 4ASUD 2IA5A 5CB8A 3W9YA 3K0SA 1CJVC 3SN6A 3QKRB 2DWPA 2WWFA 1N6HA 5CIQA 4LK2A 2J0SA 3AB3A 1US8A 2PEYA 4BLQA 1OPXA 4NH0A 4PX9A 3FMFA 4BLOA 1OH6A 3FB4A 3E5HA 1VYUA 3KXLA 2H18A 4IOJA 1ZRHA 3T15A 2FG5A 4QGHA 4HLCA 3H4MA 4DLZA 3B9PA 1JB1A 1VECA 1W44A 4B3XA 3O8CA 5J5CA 2C99A 1KZGB 1E1RD 3AVXA 2AX4A 3TAUA 3LRPA 2O8EB 4BRUA 3AF3A 4ESVA 4JZKA 1NRJB 2H1LA 1BS1A 1VHTA 2CJWA 1XZPA 2ZSEA 1AQUA 4EKDA 4NONA 4RZ3A 1P7CA 3NEYA 3X1YA 4OBEA 4ZKDA 2ZRCA 3QF7A 3KTAB 4UKDA 3BORA 4ZCLA 1G5PA 2GF0A 3I92A 3OEEA 1MO4A 4UXJA 3S1AA 1MO6A 1TQ4A 1K8RA 3EAQA 4OKSA 1OE0A 4YDHB 1Q1BA 2JLYA 4Q4LA 2ZI3A 2C77A 2JDIA 2XZOA 3GLIB 1TTTA 4W7SA 2RGCA 1T0HB 1BOFA 2P2LA 1VG8A 2JIZA 1EFTA 3AKYA 1QBKC 3D6TB 4Q47A 4EFMA 3WHLA 3PVSA 3U4QA 3LFUA 4DUGA 5K8TA 5EE3A 3B6EA 1W0KA 5KUTA 2W2TA 4B73A 2F1RA 3NXSA 2CJWB 2RKOA 5JI3E 2OUKA 3NTUA 4EFNA 4Q66C 4XJXA 4YXWD 4ARZB 1P73A 3IIKA 1ESNA 3PUVA 4FMCB 4R2IA 2V55B 3CO5A 2KJQA 3QG1A 1RE0A 1G18A 4Q19A 1UPTA 1OIWA 2QSYA 2HT1A 3SYLA 1KJZA 2CXXA 1IXRC 2EFHB 2G83A 4MKFA 2J87A 3GJ6A 3CKLA 2NTYC 4TQAA 1GITA 1XRJA 3DM9B 4FI3C 1RRGA 4DSTA 3GLIA 3Q3JB 3B78A 4UNPA 4GDFA 4B3GA 2CHVA 2G0NA 1IY0A 3K9NA 4FMDB 5M04A 1OFTA 4U02A 1KDRA 4DT1B 4JKIA 2ZE6A 2FSGA 5JRJA 1VIYA 3QVUA 3VQTA 1LS6A 4NCHA 5CB6A 1W0JA 3DDCA 2NGRA 3RS5A 2WVJA 1W7AA 3I32A 3UG6A 4CZ2A 1FZQA 3Q5DA 3BXZA 5FBVB 2AK3A 3EPLA 1E3MA 1T4GA 2RH5A 2X2EA 4E09A 4HUTA 3AVTA 1YRAA 4Q18A 5AUNB 3P32A 4JLMA 1WCV1 2BCGY 4LC1A 2W2VA 4M22A 3EPJA 2F43A 3TK1A 4ESHA 4PTLA 1JNYA 2YOHA 4Q1FA 4BE7B 3EZ6A 3ADDA 2GCOB 4TYPA 4JSTA 4PAQA 3BH6A 3PEVA 5EE5B 2DB3A 1OYYA 2AFHE 3WBJA 2WSSD 4NPHA 1LB1B 4EUNA 2IW3A 2WSSA 4Z1MA 4FCWA 2WJHA 2GEUA 4JVSB 1EFRD 2CL7X 1Z63A 5JEEA 3CNNA 3QKRA 1E32A 2QTFA 2BKUA 3B9QA 2DWQA 1ZAKA 2BJVA 1S1MA 2XJ9A 1GKIA 1Z06A 2VP5A 3QXHA 5P21A 3RS4A 1OXTA 3A1WA 5AJYA 3RRYA 2R6CA 1R8QA 1ZC4A 4NYJQ 3U7EB 5TV2A 1P2UA 2JASA 3FHTA 1N5KA 4DCSA 5G53C 4D4MA 5GVRA 3WMEA 2A5FA 1AIPA 1UFQA 3H86A 4Q4JA 1F2TA 2CHQA 1N5JA 4PC1A 2CCJA 4PO9A 1KO1A 4PZYA 1GL7A 1TMKA 5C1BA 3EIQA 2IHBA 3B2EA 5H68A 5FUWA 1PJRA 3CF2A 4P32A 1R8SA 1PLKA 3NC0C 1SVOA 4HZIA 3ZVLA 5KDOA 4LJ5A 2XB2A 3EX7C 2FJUA 2WKRA 3C15C 4KYUA 1WE2A 3RABA 1ONBA 1QHYA 1OB2A 3R9XA 1XMJA 3A1TA 1XJCA 1FP7A 1AQYA 8OHMA 1E2EA 2XTZA 3LW8A 3QPUA 5EXXA 2ZROA 5GJCA 1GKYA 3GFPA 2CCGA 4M21A 1XX6A 5L3QB 4URYR 3FVQA 3UXMA 1KY3A 4IFEA 1T5IA 4JJZA 1NLFA 1T9HA 3QVVA 3LD9A 5JJIA 4NYMR 2GK7A 3GJ8A 1QZXA 3SC3A 2FGJA 4YMUA 2YINC 4RKEA 5J4YA 2FMXA 4C9BA 1KI4A 2BKEA 3PITA 3PEUA 4I1UA 2BC9A 2VSOA 1GRQA 1Z0FA 2ZI4A 2QA5A 2ZI5A 3MG9A 5JBQA 3PUYA 1S1CA 3WP1B 2OV2A 1VG0B 2FFAA 2A78A 3OEHA 2A30A 3KFVA 2KE5A 3OEED 3K70D 4C2UA 3UMSA 2AXPA 1X8LA 1S8FA 3IBYA 1OHHA 4C0QC 1RYFA 3TUZC 3CR8A 5A5GA 1NG1A 2W0SA 2W0MA 4MKGA 1CS4C 5EE0A 2ZSDA 2DHRA 3FOZA 1XXHE 2JIZD 2LKCA 2QZ4A 221PA 1JALA 1D6JA 1NMYA 2ANBA 1F2TB 3TSZA 4ACAA 2OCPA 4TTRA 2RGDA 1XEFA 1DTSA 1EK0A 2NO0A 2ZU6A 5TB5A 3TQFA 2NO1A 1JR3E 5EQTA 3FWYA 4GMDA 3GLHB 4WOPA 2VLIA 2F1JA 4LJ4A 1UEIA 2D7CA 4N1AA 2FV8A 3M6AA 4Q1AA 3PEWA 4A9AA 1JXMA 1JXOA 3TAHA 5DN6D 1P4SA 2IX3A 3AM1A 3VR6A 3X1WA 1LNZA 5IK2D 4DCNA 5L3QA 3OAAA 1M6NA 3U44A 4LBYA 4N0EA 2OLKA 1D2NA 1GUAA 4MKIA 1TU3A 1BYUA 1ZJ6A 1IY2A 2G1JA 1QHHA 4YDSA 3BFXA 1DEKA 2MSEB 4B6EA 2J0UA 3MWJA 4M9SA 1NMZA 4B48A 3GEIA 4V0ME 2W2XA 2WWYA 1N0VC 3BH7A 1FMJA 3TMKA 4OQFA 4D0LB 3CRW1 4B2LA 5JSZB 1E9EA 1ZUNB 2AKYA 2UZIR 2VTKA 3KKNA 4DSOA 4PQFA 5FFMA 2NO6A 2UVQA 3QXCA 4MUAA 4GL2A 2JJ8A 4C0HA 1UF9A 2RGBA 4LHWA 4H1VA 1D9XA 1JR3A 2QORA 4PQYA 821PA 5KHOC 2ZM5A 4OI4A 4MYHA 1Z83A 3ADCA 4ZV4A 4DDVA 1UKYA 4KLZA 2VA8A 3DKVA 4ABYA 4EJSA 1G7CA 1WMSA 2IXFA 3DEFA 4MGKR 1Q1ZA 4YMWA 2FPLA 2IF0A 3MCAA 4WW0A 1A4RA 3HJNA 3NHAA 4LC0A 2JA1A 3CX6A 2XNSA 2XXAA 4EPXA 1TNDA 1G8GA 4LJ9A 3KJGA 3CBQA 3DO6A 4LGMA 2QY9A 1FX0A 4UJ3A 5FOWA 1RJ9B 4GFDA 4KLNA 2Z0MA 1EFHA 1CXZA 1CULC 4ARZA 2Z83A 4QL3A 4TLEA 4OJKA 3GJ7A 1AGPA 3VKHA 1NVVR 4XIGS 5DHFA 1KJYA 2GHIA 2Q6TA 3CF0A 4KO8A 3UG7A 2D2FA 4E07A 4RD4A 3RC8A 2C8VA 3NDPA 2GRJA 1QHXA 3VAAA 4E5UA 4L9SA 5JEDA 5HCNA 4DT1A 4UNQA 4PC6A 4M1MA 2O8EA 2VSXA 1K5GA 4QBIA 2KB0A 4B32A 4HAUA 3RSOA 4A0RA 1AS0A 1MOZA 1OIXA 2Q9CA 2QAGB 3TJZA 1DAGA 1E2GA 2C9YA 5CIWA 5IDVA 3CPEA 5BXQC 5EUQB 4L9WA 1WQ1R 1Q57A 3ASYA 3CRRA 3ND9A 3PENA 5JECA 1SXJE 4PHHA 4ZIRA 2C98A 3BAFA 2J1LA 1GRRA 4QRHA 2FEOA 1E98A 2ZSBA 4TN1A 4BUJA 4BLSA 5EXSA 3ZD7A 2CK3A 2OBLA 1NI3A 2CVHA 3VR5A 2DR3A 3EC1A 4RKFA 1MO3A 1XD9A 4DEYA 3DVLA 2RGXA 4URVR 1P61B 3O47A 1RRFA 1UM8A 1KDTA 4R2HA 2RHMA 5SZHB 1Q0UA 3QOFA 4IEIA 1SZPA 1Y63A 3QY0A 1P2SA 2OO7A 2Z43A 4G0NA 1YZTA 1KI6A 4A4DA 3EWSA 4NCJA 4TQUS 3EZ9A 1E4VA 2J7PA 1EX6A 1ZD1A 4H1UA 2WZQA 3KB1A 1XZQA 2ZJ5A 3ECCA 3GQBA 5JJLA 2AD5A 3K0FB 4FN5A 2JLXA 4XD7A 1QHHB 4PSAA 1ANKA 1ZM3A 3SFVA 4JLKA 1WB9A 3I61A 3WMGA 4TZ0A 5LD2C 1SVWA 2O8CB 2AFIE 2JAQA 2C78A 1COWD 1QG4A 1FPMA 4US1R 2GVDC 1TF2A 4C4PA 1VG1A 1VCNA 2OFOA 1NLYA 2ZVPX 1E2JA 3I8XA 3KX2A 2X77A 3U3RA 4RJLA 1XTKA 2VH5R 4LJYA 3RWMB 2ZRFA 1M34E 2FFBA 3KKQA 4CEIB 2EFDB 2V7QA 1E0AA 4BPBA 4LY6A 2EFCB 2C5LA 5K8LA 1A2KC 4P4UA 4BQSA 3QKTA 4DCVA 4C30A 4POAA 1IM2A 3ZQJA 3S1AB 5JWHA 4HAYA 2V7QD 4ZDWA 4EFLA 1A82A 2ZYTX 2JJ2D 2ZREA 3PR1A 3LBNA 4JYBA 2OT3B 3GLIE 1KDPA 2F3TA 4QNMA 4XVRA 2EYQA 4JT2A 2D06A 4EDHA 5IHPA 3RS3A 4Q9KA 2ZRPA 4PC7A 5DO9A 2PT5A 2OAQ1 1Q22A 1LW7A 1G7SA 2BMFA 5B58C 1GKUB 2FOLA 2IYUA 4OI0A 4TLDA 4HB4A 1N2CE 3ZJYA 5JCZA 1GFIA 3CW2A 4GBMA 4CYMA 2GF9A 1RRCA 3LLMA 1U8ZA 2PEZA 2WIAA 3SYKA 4IFBA 4U5XA 1NJFA 4XSHA 3RWOA 1NF3A 2QNRA 3R20A 4JL6A 4JJKA 4M1TA 2VIIA 2AWOA 1OXUA 1M8PA 1JI0A 1VHLA 2REOA 1JEDA 1NJGA 3L43A 4IDOA 3AH8A 4LJ6A 4X8MA 1N6IA 4JT4A 3B5JA 2F7SA 3FDIA 3JZMA 2G0TA 4LV5B 3MRSA 5L8VA 1U98A 1P9NA 3JVVA 1W36C 4DLXA 2D2EA 2I1QA 5HE8A 3WRXC 1W36B 1M7BA 3A4NA 4HAXA 4KU4A 4IDQA 1WP9A 3AUYA 1G8FA 1FMLA 1EX7A 2R9VA 1KDOA 4TQ9A 2IT1A 4CEHB 2V9PA 2FFQA 3B8HA 4FCVA 3AGPA 4M2LA 5KDDA 2A3RA 1S9DA 2GJSA 2HF9A 2J45A 2WHXA 3NH9A 4FMCF 3ZZ0A 2ZYWX 2OCBA 2ZR7A 3GLGE 3C41J 1CR0A 1FOEB 4JMPA 3NIBA 1RVDA 1KSHA 5FUYA 3DMNA 4EPTA 3SQWA 1IN4A 3RNLA 4DDTA 1IY1A 4HATA 5DIFA 2ZJOA 1YZQA 1N3BA 4PO8A 1OLOA 1N0WA 1SVSA 3U7FB 4EPWA 1R7RA 1AJEA 2QI9C 1RFLA 2QSZA 2ERYA 3CUEF 2BMDA 3LDAA 1CP2A 4JIMA 3KFXA 5J4HA 5LDDC 2ZJ8A 4A2WA 2EQBA 2F55A 1W47A 3D8BA 1G8HA 3DMDA 1O87A 2IYXA 1MRNA 5FOUA 2XZLA 3SS8A 4HYYA 4OYHA
chains in the Genus database with same CATH superfamily
3ZIAD 1XMXA 2QVYX 2R6JA 2WIBA 3EFOB 3S7ZA 3OP1A 1IHUA 3E58A 1ZRSA 5I7AA 1RZUA 4HDNA 4HYEA 1JU9A 5HUJA 3RADC 4UAVA 2EVWX 1FU8A 3OPYI 3G7SA 1KGDA 1PR1A 2RMKA 3HB7A 3VFDA 3K35A 4L5YA 5A02A 5F98A 2IU4A 2O1WA 3G49A 4H4CA 3UFBA 4QOJA 3RREA 2XODA 3K92A 3O38A 1VGVA 3SFTA 3TFQA 1E1QA 3VGJA 3H19A 1YA8A 1QHNA 1BRMA 4N8SA 1AS3A 1WG8A 2ZS9A 2C9BA 2IEZA 1F7UA 1RZ3A 3AHDA 4JBXA 1VIAA 1IBSA 1YSCA 2IKQA 1KKLA 3IODA 1YQ9A 1TAGA 4FXPA 2XDWA 4PPGA 1SGWA 1ESDA 2BFEB 3A6HA 3L84A 5EJGA 2V3CC 3MAGA 1GV1A 2DH5A 2WHQA 1EFLA 3C16C 1DAIA 1T6YA 4QHTA 4JI6B 1XLTA 2C0PA 2QRQA 3BS4A 2IW1A 4L9AA 3GH3A 1FXWA 5EJ7A 2WI8A 2ZYDA 2ZW9A 2AHOA 3IP9A 1TZKA 1SC1A 2NVBA 4KB5A 4ZIRB 3IPXA 3EZ7A 3PIDA 5ESRA 3PQ2A 1CZKA 4W63A 3VO1A 4MKRA 5BYJA 1S01A 4E33A 4WBNF 3EW7A 1RJEA 4G0YA 1YS6A 3TEJA 2Z5GA 4BVGA 2DETA 1HUQA 1M66A 4EJ2A 5FNVA 1FP4A 4NENB 1JQAA 5LBIA 4HEQA 3BSYA 3I1YA 1LJ8A 1NY5A 4IDHA 1HK7A 2I91A 3M4XA 1I6WA 2FWIA 4G63A 2FMFA 1QIEA 5BN3A 2UZ3A 1R2QA 1TTQB 3ACDA 5IJ9B 1XPRA 4TL7A 1GPH1 1K7EB 2MR6A 4J29A 1KXZA 3ZD6A 4UBNA 3W2FA 4ZQHA 1I0LA 4HR7A 5AHOA 5ALYA 1J4AA 1P9OA 2VNKA 3W06A 2AJDA 2AZMA 5LA6B 1KMQA 2HSJA 4X6XA 1XLVA 1AGXA 2IZ1A 3ANYB 3R5TA 4J0QA 4XA8A 2H92A 3T3EA 3V1LA 1U2GA 3JWGA 4MV8A 3MWYW 3SVLA 4Z0TA 3GLSA 5COAA 3C3MA 3CHYA 1CRWG 3Q6IA 4IQFA 3FDFA 4HGOA 3VH1A 1QIHA 2TMGA 3EFOA 3VNAA 3DLBA 4MWBA 2NZWA 3OI7A 3WGKA 1DLIA 5HOQA 2VTBB 1CS0A 1V7QA 3IB6A 4YFYA 5LQKA 3E15A 4NFHA 1NUUA 4X20A 4JI4B 3ZV3A 1USIA 2V4ZA 4L78A 3STWA 4BMDA 3GCZA 3KJZA 3DE6X 4O2BA 4RF3A 2BGJA 4BNVA 3BIXA 2ZVDA 3OZRA 3WRVA 3PFBA 2PN1A 4I4IA 4A0HA 4MO2A 4PGAA 4GR5A 2FRXA 1HT2E 1GWNA 3UJPA 4MYUA 3QBJA 1JVSA 1O95D 2C8LA 1N5OX 2J9XB 4L6CA 3HXMA 3ZDAA 1GL6A 2IXAA 3I2JA 3USCS 4LVOA 1RWWA 3F67A 3H2YA 3M5WA 4KODA 3WNBA 4JI0B 3UHFA 4YMVA 1XJ0A 4ZVMA 1ACJA 4EY4A 5A2GA 3AO0B 2R8YA 2W2KB 4RD3A 2I3ZA 3VI4B 4KK4A 1P75A 3LHSA 4GSLA 1J09A 1QFYA 2VDNB 2B5OA 3PDUA 4J9VA 3IP6A 3C5VA 3E5NA 1JVNA 3IDQA 5IBQA 4YRPA 3LO5A 3VMFA 4CUZA 3WMRA 1N4AA 4S0XA 3VZQA 1C3OA 3CNQS 3KQYA 3PCXA 1VZ3A 3GJ5A 4P4GA 4OX9Y 4BXOB 1ND5A 1YUMA 3AHIA 1IHOA 4C06A 5A0TA 1WZUA 3LXMA 2CFTA 5JQGF 3IOBA 2QXYA 1IH8A 1YE5A 4GT1A 1FFEA 4RLHA 3ZLUA 5EZQA 1LNSA 1NF8A 1AUOA 1ULZA 3B9BA 3OX3A 2ZEJA 4HVCA 3RU7A 1T8UA 2DFVA 5TQ0B 5M3BA 1FSZA 3W5IA 2AZ4A 3U26A 4CMGA 2QAGC 2PL5A 4DIDA 5KTTA 3K6SB 1RVV1 1N5IA 2FX3A 5CFPA 1HNXB 2B8TA 1G21E 1L9XA 4KRYA 3S44A 4MMYB 2WKQA 3VR4A 1I1NA 1OWPA 1PYGA 3VR5H 4N5IX 3V46A 3EJWA 1B7GO 3G1TA 2VSFA 3G6KA 3MTIA 3SSMA 3C3WA 2A9JA 5EUBA 5AUOB 2FP3A 1DIHA 1SVLA 5BSWA 4BGUA 4YT5A 1JJVA 1N2GA 2XMRA 1FYWA 1BFDA 1ZUHA 1WXWA 1EBUA 2HN9A 2OC9A 3DR5A 2ZSAA 4NBSA 4HGZA 5JCPA 3ST7A 2GZRA 1YVUA 3VSBA 4PPNA 1DL5A 5B6JA 2YJNA 4C14A 3CH4B 1MABB 4NATA 5LQJA 4H6XA 1O9HA 2DPHA 4JFRA 3NHUA 3KZVA 4FB5A 3RS9A 3HUEA 3D8NA 3THYB 3D0OA 3GLRA 4AF8A 3EVNA 2OXCA 3CG0A 1WXQA 3H0KA 3HYSA 2HCJB 1VE5A 2NUBA 1J8MF 1TMOA 4ZEMA 1MQAA 1J25A 4HOYA 3JZAA 4B4KA 5KKCA 1E6UA 3FPCA 1WS6A 1Y1TA 1XTTA 3EJ6A 4LF5B 1PJBA 4F72A 2WJ4A 3RU3A 2BR3A 1YJ8A 3FYSA 4CM4B 3HEAA 2RHDA 1XMSA 3C3AA 1ENOA 3JATB 3KTAA 4OREX 4UAUA 3UTCA 2C4KA 1CQIB 2OV8A 1NBEA 3B85A 4OHZA 1PIWA 4I1RA 3E48A 1HV8A 4YP1A 4OHPA 4ND4A 3OCZA 3TOXA 5FOSA 3PDCA 2HZBA 4YN3A 4IZ6A 3ZJ4A 1HLGA 2HRBA 5I47A 2BFFA 1A9TA 2ORIA 1MVLA 3PNBA 1ISPA 4IVQA 3BHNA 3CKYA 1M1XB 1EVQA 1T15A 4R2MA 2VDJA 1UC8A 2CD7A 3TNJA 5KYYA 4JS0A 4YRQA 2VS1A 3A9RA 2RE8A 4FEAA 4KI0A 4O2RA 5KVQA 3ENQA 1V3VA 3TN7A 1Q17A 1UWVA 2R5FA 4MB0A 5KDLA 1UJCA 4U7DA 4PQGA 3W5BA 3F6EX 3VR0A 2C3UA 3GPLA 3N2IA 1MTOA 1U9IC 2XUKA 2RB5A 1PLLA 3W1EA 2J0QA 2C42A 3CMMA 4Y98A 3AY7A 5AK3A 3SHWA 4Z9XA 3P27A 1SOAA 1SCBA 1IOZA 1GU0A 2HUPA 4C6TB 1RMYA 3WGQA 2D6FA 4TMWA 3KAJA 3C3KA 3GGPA 2JIRA 2P35A 5FBRB 2JAXA 2IVFA 2WE8A 1R3DA 4L1KA 4PR0A 4Y0VA 4UVGA 5ALHA 5EOVA 2CV1A 1NU8A 3HKBA 3RVKA 2COUA 1E3EA 2JIPA 2OENG 4O6VA 4CQNA 3EIEA 4A5OA 1XEXA 3HI4A 1C3JA 3QE4A 2WTAA 3K0BA 3KSUA 4I9FA 5REQB 2P2CA 4JEUA 5A5VA 2R7AA 4NBRA 3D2LA 5EKSA 1ACLA 4GMXA 3VPFA 3P9PA 3GJ3A 3WMFA 4CKBA 2XMGA 1VKNA 2Q2OA 2XVZA 3UMVA 4Z1MD 4U9IS 4NYJR 1AOXA 1UJMA 3O75A 2W43A 4N3BA 4QTUB 5DTRA 1N8NA 2APJA 3D54D 3VO9A 3ZCXA 4EJ0A 3I6BA 4C43A 4L5BA 4QQKA 2VDMB 3NBYC 4MP3A 2BEKA 2QLBA 4A10A 1YZYA 1CY4A 3W8FA 3WB0A 1XZGA 2VRWA 4IFTA 5A6SB 1SVUA 3GRRA 3QBDA 3QOXA 4JP5A 4HUQA 2V1XA 5HX7A 5FI1B 1E4YA 3PKIA 3PS9A 3DL4A 4RK5A 3RG2A 4BFXA 4D41A 2PSDA 4E2ZA 3GVCA 2K7ZA 4ZQCB 1XZCA 1I2DA 4KGVA 3EGEA 4M9XA 2HIMA 3TDMA 1X7ZB 3G7NA 2P9YA 2VXYA 3NBFA 4KR2A 3VR3D 2ZJZA 2O5EA 2XDAA 4J16C 4DPKA 2HLDD 3ZE0B 4ZDKA 1SD2A 2VNJA 4RLSA 3UAXA 1NMXA 1J8VA 1SQ0A 3SP1A 2G80A 3JYOA 1Y48E 2OGWA 3COZA 2D4HA 5J4VA 3EAFA 3GEHA 1XKQA 4P82A 4D3YA 2QROA 4GSYA 4RU1A 1GCIA 4WASA 1W5TA 5AVXA 2EJTA 2FDRA 4ZRMA 1T35A 4GG1A 2UKDA 4DCTA 2D1QA 3UAVA 5IT5A 5F9FA 1MG5A 3WGZA 2CE2X 4M1QA 2J5XA 4ZN6A 1JU4A 2IYTA 1YDGA 4DJFC 2WFAA 2NU6A 2QQEA 1F8XA 5ADWA 1QVRA 2R1VA 3PQDA 2D5LA 4AYXA 5B2FA 3FUUA 2YZ7A 2Q5OA 3N2LA 2Q62A 4URXR 5ALNA 3LOQA 5KOJB 5KO2A 1T91A 1QMPA 1YVEI 2OM2A 2PUVA 4TWBA 4NZYA 4EG6A 3PC4A 1EWYA 4F84A 3ZVNA 3KV1A 1ZR2A 3O4JA 2WTEA 5ECWA 1O4VA 3D6AA 4DBVO 1Q1NA 3QEBZ 2CLFB 1M6YA 4JVMA 1H93A 1Z6XA 4U2EA 5FLKA 3G89A 4MIKA 1YWGO 2WPDA 3A2LA 4Z54A 4ND8A 2OHFA 4RVCA 2BUBA 4YRZA 5K51A 3THYA 4GVLA 1QQ5A 1FRNA 3QVOA 1M7HA 2EJUA 4BMXA 1H6BA 4G86A 2PMBA 4TYMA 4EG8A 5AKGA 4KXWA 1VP9A 3S5UA 2EKZA 3CURA 4DB2A 1FY2A 3DLIA 1J0BA 4I9UA 4E4TA 1X15A 1QSGA 2DQ4A 2ID7A 2PKCA 2Y1CA 4ZHSA 1IJBA 1RP7A 1X3LA 2FPXA 3DCYA 5FTMA 3U09A 1E59A 3UMFA 3PF9A 2ZTHA 1JR2A 1JIQA 2GD0A 2Q6VA 1YDFA 3M4ZA 4I55F 2QSUA 4GP6A 1F2UB 4I50A 1UOEA 5MGNA 5K3BA 3NNDA 4ENTA 1SY7A 1NUQA 4MUXA 4PZZA 1I0ZA 3FLMA 4Z8YA 1DPFA 1Z62A 1ZJ5A 1KVTA 2VOEA 3NPAA 3GK3A 3TR0A 3TKLA 2EJBA 3KD3A 4FQ7A 5F3DA 2XVMA 3D7SA 5HEKA 1FE8A 1UQTA 3L0OA 1SHJA 2PHZA 4F8YA 2CNWA 4RQTA 1V7ZA 3S2GA 1V95A 3A3PA 3ROQA 4FNMA 5EWJB 4ZEOA 5E9JA 1JAIA 3HMQA 1NW3A 3K4PA 3L1HA 4PQRA 5K0SA 3BN3A 5HKKD 3E1SA 1J8DA 2OE2A 3GN2A 4CIBA 1YAJA 4PRZA 1YC2A 4EPVA 5LB2A 3SEAA 4WXPA 3V8EA 2I8AA 1NVDA 3IJEB 4DXHA 3RSLA 5DYWA 4UJ5A 1DADA 5KTMA 4QFMA 1NXOA 1P1JA 2GCNA 1EJ2A 4WLUA 3OD1A 5BR8B 1N7HA 1WSBA 1GUBA 4KXVA 3UJHA 3FVVA 5E7MA 4IDEA 4F85A 5LL6P 4O2LA 3LVQE 1FX1A 5FBHA 4TWZA 4ZU3A 4D98A 1HNWB 1SQ6A 3SZ3A 5K0EA 2HU2A 2SHKA 1MP0A 2IYLD 2NAPA 2ODTX 3K0AB 5H3CA 5ARBA 1E99A 1K6JA 2H00A 1HSZA 1QKIA 4PCAA 1YJCA 1PSZA 4ADSG 3IHLA 3IGFA 4WIAA 4FHGA 3C8DA 3HADA 3WP0A 2R8PA 4MUJA 2C4NA 1PGJA 2WKPA 3Q9NA 3I2IA 2ZJYA 3IPLA 4HQNA 5TDHA 5IN4A 2VSYA 4S1VA 1NVKA 3EVDA 3HCEA 4NZZA 2DSTA 3W3AH 1VIDA 1LWNA 4GL4A 4DM3A 2QKYA 1OFUX 2H59A 1L8QA 2JFOA 1UKZA 3AMVA 2MOKA 1H94A 1Z8DA 3KB8A 4ENPA 2HMYB 4P4TA 2MMCA 5J63A 4MNTA 3V2IA 3GZJA 1ZVVA 2GILA 3HLTA 1DE0A 1X7YA 3IJ5A 3A2KA 3V5NA 3FI0A 4W1RA 1TMYA 5K4HA 2PUGA 5ICEA 3DULA 5DNWA 4QFDA 2E49A 3CW8X 5K3DA 1HQYE 2EEPA 4REQA 4IDBA 3L4JA 4E31A 3FE2A 3LUDA 4CLHA 3G5AA 2GXQA 1I3NA 1Z7BA 5CK4A 1FTSA 2J9ZB 3GUZA 3OQPA 2QQ0A 4LMPA 3LQFA 3K5WA 4S1OA 5CDFE 3KSBC 4KDFA 3W2TA 1BU8A 1ID8A 4HEA1 3ZWCA 2RGNA 1W48A 5C8YA 4Q15A 1IMOA 4GPBA 4WFJA 1SUCA 2FW8A 3LA6A 4P3PA 2VNIA 3AUUA 4R0VA 4X7BA 5E9QA 1GZ6A 1V25A 2PRYA 2ZRGA 4MVCA 1Q0LA 3VNBA 4Q4CA 3H5RA 1DDIA 3D7LA 4IKOA 4QYWA 1GPKA 3WWOA 1H1LB 2PLWA 5EQJB 4YXFA 2IXTA 3OZWA 3K9CA 1E9CA 5E7JA 3ESBA 3I58A 3SPXA 3IPYA 1VKOA 2VP6A 3WBKA 2YN0A 4U2CA 4X97A 3E9EA 3RROA 5FHQA 1RRKA 4U7PB 3HCBA 2QT1A 3LCMA 3R75A 4D5GA 3HTXA 1NAIA 4QRIA 5JH7F 4NFYA 4J16A 1EFDN 1O5OA 3WDMA 2DC1A 4OXKA 4ZVUA 3UA3A 4DJJA 3JQ9A 2G63A 5E1OA 2QT0A 1E3TA 3KEGA 3X0DA 1R0CA 3T34A 4R9VA 1NR5A 1B0PA 1SC9A 3T12A 4I1OA 4KXNA 4CNBA 5K7SA 1JXAA 1NSFA 5BWMA 5HF6A 5BQFA 2I7CA 2PUEA 1OI4A 4F4IA 4HPWA 2WWHA 3BMQA 2QL5A 4WKGA 1FJXA 2JI8A 2X8BA 1Z15A 3AEZA 4P8RA 4FFRA 3BL8A 2P8JA 4AF6A 4W6QA 3T3OA 5BR4A 4B2PA 1DFIA 2QMOA 2YFQA 4RD6A 4WOJA 2OCGA 4ZGWA 1AY0A 3BMCA 2I54A 2IIQA 5JPDA 4A8PA 1AC5A 3AFIA 4QHYA 1YK0A 4H4EA 1U7HA 4LYEA 4NZNA 5GGYA 4CQMA 5JHGB 4M0DA 4Q39A 4XWOA 1W85B 4YUAA 4CUKA 3EXG1 4C4SA 1FSGA 2ARKA 5HCUA 3FMPB 2D62A 3QOWA 4M89A 3BSWA 3UWMA 2JF0A 1J0EA 5TEVA 3EIXA 2CFRA 4PVDA 1Z7WA 3H1EA 2Y0CA 2BEVA 2QAGA 5TARA 4EO9A 1GRVA 1JHYA 4KAJA 5AM1A 3V80A 1JIKA 4UOQA 2O7NA 1IWBB 1IJEA 4XAQA 1CJKC 4QBTA 1Q92A 1QHSA 2ZBQA 3K9GA 1CB7A 1XDDA 5EVJA 5ESXA 2DM6A 3VNQA 3NOXA 5MN5A 3QMWA 4C21A 1FDWA 4EYQA 1BDIA 2VT6A 1TCUA 3A9UA 3K9BA 1SKBA 1POWA 1UFKA 3LNTA 3NNNA 3QENA 3FYUA 4IDFA 4JDPA 3UAOA 3Q12A 3WWDA 1Z4MA 1QCCA 4FOLA 2BFDB 1XDBA 2HYIC 1VC2A 2QTVA 5F4ZA 1NBME 1USVA 1UJ4A 2UUPA 2A7QA 4FFBB 4R7GA 5J5VA 4B33A 3O8RA 3QLUC 4JI8B 2LCFA 3CLHA 2CEKA 1YASA 3UAGA 1A7UA 2GF2A 4IHQA 4JJGA 5HKBA 2RKBA 3MXOA 1RSZA 1CNFA 1PBNA 2PYDA 4G8CA 4QU5A 4A6PA 1BW9B 3E3MA 3IELA 1QG2A 1PUIA 2YICA 1QAOA 4KQMA 4RIIA 4YT2A 4AZWA 3LE8A 3WIBA 5LUAA 1ZA1A 3FBTA 2GXSA 2OHGA 3LPCA 3G8CA 2HDOA 5IKMA 3AOEA 3NBKA 4NR0A 3JQAA 3ZK7A 1ZU4A 3P9RA 1IBCA 3JPYA 2O50A 3BK7A 1JS1X 1YIDA 2C2BA 4H08A 4N8EA 5DI9A 5FPSA 1U8CB 4I36A 4P31A 4MV6A 4EA7A 1Z5UA 4RV4A 1NVEA 4Y1GA 4H17A 2X6QA 1NY6A 1U2TA 2X86A 3QELB 2I6FA 5DLDA 4B3IA 1B6GA 5KX5B 1O0CA 1WCYA 4ZICA 2OZKA 4FGUA 1YK1A 5JHHB 1KZHA 3JASB 1Q1EA 1TCVA 4UDOA 3OCXA 1J56A 1SCQA 4Q05A 3VYWA 2VUUA 3EMBA 5B1YA 2XNJA 3MPUA 5K0BA 3SJCA 3GRAA 3MYYA 3EF0A 5D1HA 4LF4B 2AXEA 3AEXA 1D3AA 4QWWA 2FPPB 4J7CA 2W93A 4RKRA 2XY4A 1N9KA 2X8AA 4O59O 5KNLA 3R3XA 1CRLA 2FSHA 1ZIDA 2FPGA 3RSZA 3PT5A 2SKDA 1M34B 3QPWA 1JHOA 4FTWA 5E6RA 5EKXA 2C7PA 1USKA 3GAZA 3NTRA 3A6GA 3O03A 3Q7IA 5JG7A 2N47A 2PO5A 1U8XX 3AOGA 1NC3A 3VPSA 1WEHA 3ZKWB 3JCZA 3R4VA 3DQZA 1XEAA 2HMUA 3KR0A 1MCZA 3KZOA 3RH0A 1WMAA 4C0XA 3ZN2A 4GM0A 2IV2X 1ZBDA 3OO0A 4UNRA 1T8RA 2GBLC 2ZJ1A 4RY2A 4FMDF 5EMMA 2ZIFA 1V16B 3OJEA 3CKMA 1JHZA 1CZUA 1S2IA 3Q0TA 3T9CA 2DQSA 5JH7A 4NJEB 4A36A 2PSJA 1XQYA 4MCIA 3DEHA 3GBPA 2CHGA 3P5SA 2EKQA 1E79A 4FGSA 1C4OA 3UENA 3PHIA 1QANA 1V5GA 1Y1RA 1RWQA 3OBBA 5CVEA 3N86A 5A04A 2YWEA 3DM5A 1RZVA 2O2YA 3ZHTA 3ZNQA 2JGEA 4MUEA 3OE7D 2Z58A 5AKHA 3GCGA 2X1LA 4FS8A 2C61A 3ES9A 2XEXA 3VVMA 2P9GA 4YMTA 5EUCA 4YXWA 3BMQB 3SQNA 5FEUA 2PWAA 1JG1A 1NXVA 2JLCA 3MTAA 3PXEA 4OY3A 4P7BA 2X0NA 3U7FB 2FVXA 1FTNA 5KTKA 4GX2A 3PIRA 1NF9A 2FZLA 4WXHA 4EGCB 3NB0A 4P3NA 5HG0A 3L5OA 1TO2E 1XEWX 4MLDA 1A8HA 5G40A 4GVPA 3E7PA 1T24A 1ZDMA 1D2EA 3AJ8A 3E8SA 4I1IA 3VO8A 1RHMA 3Q8XB 4QTTB 5LQSA 4KJXA 2JFGA 4DMRA 1B43A 2XUGA 4XYLA 3HGMA 4AQ7A 3QZUA 1FTWA 3WG9A 5CDHA 3U9LA 5IARA 1UINA 1CE8A 3BEOA 4MR9A 4MPPA 4N7JA 3HR7A 4RL4A 1BS9A 4DMHA 1K7SN 5HIJA 5EI5A 1WKCA 4MVJA 4L5IA 4ON9A 3CNOA 1L5QA 3BIWA 4M98A 5HBGA 3TW4A 4D4IA 5KWIA 4IO0A 4EHDA 3PC3A 1BHJA 4W8OA 4PPQA 1K4YA 4QWMA 2IY7A 2GHRA 4F93B 1EU1A 1M8FA 2O06A 1WV1A 3ZCVA 3LDHA 2X19A 4O8CA 1DX4A 2MT9A 3H18A 4ITRC 3T7RA 1QRTA 4UUBA 3IAS6 1G64A 1P44A 1S6YA 1K89A 3E9CA 2NU8A 3OT4A 4MAMA 2JBAA 1E69A 4CM1A 3JU3A 4DADA 2B2NA 4OK6A 3ONVA 2ATVA 2RAVA 3OWXA 4A0GA 3D1VA 4Q02A 1R00A 5CXXA 2AOUA 3HKEA 4I1VA 1EB9A 1FF9A 5HUQA 1LDGA 4UXIA 2Q6LA 2XWQA 4UHBA 3QSYA 3KYBA 3NDIA 3R0XA 4N5NA 2IYZA 3H1PA 4NEQA 4WVLA 2PZAA 3T5DA 5JDIC 2J6CA 1YDEA 4QBHA 4P2GA 3OLYA 1XB2A 1QLWA 4HLUA 3KWFA 3RVJA 2YW2A 1MO2A 3DTVA 3WSVA 1F5NA 4DMKA 1DWPA 2R8ZA 3GDGA 1JQLB 1D4FA 1PZHA 1NVUQ 1FTYA 3L01A 3JAWA 3NKVA 1ZUIA 3H42B 2CBZA 4GS5A 3BMOA 3RVLA 5JXJA 5K8IA 3MRVA 4MA4A 3MOGA 1EAYA 2QRVA 4GGPA 1ZHOA 3KXIA 5TRTA 1FDRA 1KFCB 5D00A 2OM6A 1W76A 2ZETA 2HEIA 1J0XO 1KZ1A 2X0DA 5ECYA 4CTNA 3E9NA 4TN5A 1X70A 3LSTA 4PF1A 3QSGA 5E8RA 1EK6A 2HFKA 1E9RA 5T4EA 4JBLA 1GCUA 1JZTA 1K7FB 3GRFA 1L7AA 1JP7A 1QIJA 2Q3DA 3CRQA 3JTEA 4XFJA 3VJLA 4ACBA 5K1ZA 4BUZA 4DWWA 3WA7A 4DR7B 2QGFA 3M83A 3PPYA 4I1SA 2OFPA 5CLQA 4BLWA 1OGJA 2ZUVA 3MLAA 2H1WA 4IV0A 4IIDA 3DUFB 1RQRA 3MCZA 4YBZA 4B79A 5A6VA 1RHUA 1CIPA 2XDQA 1Z28A 3FTEA 1Z07A 2PBFA 2B4AA 2HBZA 2R8BA 1BE8A 1DEOA 1I6KA 1P1BA 1PR0A 2IJGX 3DWFA 4GSKA 4A8JB 3UOAB 2P62A 4HDRB 5FR2A 4J9UE 3H9CA 4UVHA 1XLUA 4U2DA 4FDVA 4N7RA 2G70A 5B2ZA 1UBCA 2PGOA 3PHLA 4J2TA 5DLQC 1DJOA 3LX5A 4C3OB 5F4BA 1VI5A 1P6UA 3P26A 3ENKA 2XXJA 4FDLA 1AM4D 3BTVA 1L1QA 1II8B 4G6ZA 2FFRA 2NU8B 2WNSA 4G89A 3KKLA 1EMDA 4F4FA 3H11A 3U0VA 5LFAA 2M6LA 1QP0A 3DGEC 2Q3LA 1RLOA 3RLFA 1E9BA 1EM8B 2IYPA 2WSBA 3D0KA 5FJJA 5CBPA 1UQUA 3W7BA 1M0SA 1C14A 1JQBA 2Y1LA 4PSDA 3DV2A 3RFTA 1Y8CA 3R7FA 4FHZA 3TLKA 5JH7B 1OT3A 4DPMA 3TTXA 4RXUA 2CLDX 1A5TA 3NTXA 1CSEE 2V6IA 4RH0A 1H3NA 1ESZA 4URUR 1W93A 2PY6A 1SHZA 2NUTB 1C7EA 2B78A 2OO5C 3DL7A 4IGFA 1Q83A 2UYCA 4NC9A 4ILEA 3W1VA 1C1XB 1Z6PA 2JI9A 4EEZA 3WFIA 4OJTA 3NAGA 2DPMA 1CHDA 3WBFA 3KT3A 1GTJ1 4BO3A 2WMNB 4XM1A 1U3FA 3I53A 4C6TA 4EAQA 5AR1A 3MWKA 3ZBPA 3U2QA 1C4XA 3UPTA 3G8BA 3E4DA 5ITSA 3AETA 4RFSA 1BEZA 2WF9A 1DJLA 1Z2AA 4LBWA 1RADA 2CFIA 2ZBEA 3LBIA 3TIIA 3ITDA 1E2NA 2BFMA 3VSCA 4PAOA 2PD6A 4X8OA 3GIDA 1PFQA 1SKAA 3CTPA 4HDKA 3NM6B 4LJKA 1E3IA 1UIMA 1DAPA 1E9SA 1WB6A 1VXRA 3A37A 3JRNA 3PX3A 3T7DA 3VZPA 5KVSA 1MT0A 4GOXA 4B82A 3FKQA 4RKWA 5EHGA 2GZ1A 3H5TA 2WPDD 1W4ZA 3UVEA 4MDFA 2XE6A 5EERA 1JLKA 1C1DB 1ZC3A 4IDAA 2PGJA 5CA1A 1U0JA 1H6CA 1MFZA 1N2ZA 1Z38A 3DDZX 4G36A 3TIVA 1OFUA 4F3CA 3BFJA 2RHJA 3NHZA 1ZD8A 2ZDQA 3UGJA 4A8JA 4M0CA 3CCCA 2DFKB 4BRWA 1A2OA 1CUGA 1JG4A 2ZT7A 1BMFD 3PC7A 3QYFA 2FW0A 3T1TA 5ES4B 5JZSA 3BX1A 4D96A 4GYKA 2Q1TA 2FSUA 4BWFB 1MT3A 4YVFA 3H5NA 5DHPA 3MAJA 4UCXA 2H2DA 3G17A 4LDRA 4IS3A 4UTXA 1M9NA 4R84A 2H5IA 1RTTA 5CA1F 4BV2A 3PQCA 3ASUA 3EDCA 3V4PB 1LU9A 2LKDA 3N8GA 3ICCA 3GB9A 3EG5A 3NWEA 5BNFA 3WADA 1XWWA 1RE1A 1YFZA 4F3KA 4EX7A 3I05A 2X9LA 3QFFA 3K0EA 4DEVA 1MB2A 3HXQA 3IAM1 1OSNA 5NLLA 5D5PA 1EWKA 4E22A 2ETVA 4L5AA 5KNCH 3JQ8B 3BCSA 2XKBA 3WRYC 2F8SA 2YWBA 3VHXA 2VSNA 1G3QA 3DW3X 3OM1A 4KXFB 3OLZA 2J6IA 2XOEA 1VSUA 2GETA 1R15A 3K30A 2C8JA 2P6UA 5I4KA 5KWEA 3GFVA 1NMQA 2CDAA 3KLBA 4PG6A 3OIDA 4ND6A 1VYTA 4MJXA 2A6PA 1L4UA 1A0OA 3L1KA 3OPNA 3SQMA 2QI9F 3HK2A 1P1HA 5CFMA 1Y42X 3BRWD 3IKTA 3I6QA 1Q84A 3RIHA 2JLVA 5K0ZA 1TA0A 2I0FA 4OO3A 1KVSA 4OHOA 3V9AA 4LY9A 5E1BA 1QFZA 3RSHA 1P7YA 3AONB 3DF9A 3OAAD 2H0RA 1BWSA 1CZNA 1L6RA 1ZKMA 3CLUC 3COVA 1RBMA 3O4RA 3I76A 4G5XA 4UTZA 5FADA 3ZWWA 4A8TA 5ICMA 4GYYA 4D25A 1V9SA 2WD7B 3FKSD 1NZDA 4PC2A 4PSVA 6ADHA 3FLAA 5BW6B 3A36A 5IJAA 2DCMA 3WGMA 1Y6RA 1OX5A 3TOZA 3VR4D 3ZDXB 3L0BA 2HNKA 2IPXA 3TQCA 4REOA 3FHOA 1JL3A 2GFQA 2R1UA 3ETNA 3KQQA 3ORHA 4I5DA 3T9DA 3DE5X 3U4GA 1EVYA 1W2GA 1PQUA 1OFGA 1AXGA 4NMMA 1VSTA 2R47A 2R6FA 1GO2A 2V7WA 1RBQA 1C50A 2BDUA 2ZRAA 3HU1A 4J7UA 2I4LA 4AMVA 3D59A 3QVXA 4LXUA 4Y1RB 2VYCA 3IDOA 4JBHA 1R6VA 2FWRA 1SEVA 4Z0HO 3W8RA 2IC5A 1GKKA 2IHTA 4XUGB 4TMKA 1V8BA 5FI5A 4BJHB 1F2DA 4GOJA 3IKMB 5AXAA 1TYAE 3RGGA 3U9TA 4QPPA 2Q3JA 1T36A 2YNMA 4TYNA 4QJ4A 1NW5A 1QH1A 1ZONA 2XCIA 2Y1EA 4GIBA 3B2NA 4EHLA 4US0R 5JIBA 3ED5A 3OE1A 1QYRA 2GN0A 2DY1A 5IH3A 4JCOA 4HWKA 1HI9A 1MDFA 4FWBA 4HNAB 3SGLA 1UMCB 2Q0SA 3OESA 3AHFA 4Z4FA 3QEMA 3KKMA 2FPUA 2ZVQX 1IYZA 2DH6A 1ULTA 3DH0A 3EYAA 3LF1A 4HEJA 3RHSA 4YAFA 4DVGA 1CDDA 5ENZA 1U4NA 2W83A 1YE3A 3QYJA 2WUWE 5GV7A 1KOJA 3VTZA 2PUHA 3MILA 3NAMA 1E63A 5CJPA 1D9ZA 3OCVA 1JAHA 3Q41A 1PN3A 1I0IA 1T8YA 2H3EA 4OM8A 4Q00A 4GPD1 1DGQA 1FVFA 1OWMA 2V6FA 4HQ0A 5SYAA 4EFDA 1G3UA 4F1KA 5KNDD 1V5FA 4CF4A 5PGMA 4UBJA 1E1YA 3Q8MA 2OD7A 1QHIA 3LIPA 4AROA 3AUJB 2AA3A 2NYAA 4PGMA 5FL7A 5L3SB 3V1KA 5HKKA 4G85A 4MPTA 5DNCA 4MJLA 1P0FA 1BQ4A 5LQUA 3EPPA 3FB1A 4J1TA 1VKHA 4DV2B 2EEZA 2I55A 1JG6A 2ZP1A 3I9NA 4FZVA 2P69A 2ZI7A 1Y37A 4BO2A 2R2AA 2NP6A 3FGNA 3ZBTA 2F3SA 2P77A 3KYDB 2JFFA 1A76A 3U3ZA 3F97A 4YUWA 4FD2A 3MGBA 1K8ZB 1LDNA 1XZHA 4FGZA 1SBZA 4ZOLA 5E6UA 1JLLA 4DB4A 2HHLA 1J42A 2C2HA 2BFPA 3F6RA 4LOIA 4DQDA 3T52A 1KIAA 1OQAA 4MWSA 3TGPA 2VC2B 5KX5F 1Z5NA 1MRSA 3GU3A 3KZCA 1XQXA 3TH5A 1OZHA 4MZDA 3QLVA 1YULA 2PCLA 2WDZA 5IF3A 1UC5B 4MVJD 3C7DB 5JISA 1OB5A 4RY0A 1E3LA 2W70A 1R5BA 2GBPA 1SVMA 4UVDA 1VLJA 3DBOB 3B5IA 3IMCA 3TE7A 5EJ4A 4GF5A 3ZNPA 1F1BA 2XWPA 3BUSA 1N2IA 4UD2A 8MHTA 4HNGA 5A9SB 2KBEA 1XELA 4C01A 2FRDC 5JZBA 3EVGA 4HNAA 3BWDD 4MCAA 3VSDA 2X8LA 2QK4A 1OF1A 4LMBA 1OWLA 5F1OA 1N3IA 2CD9A 4O5OA 1V16A 5FTJA 2PA3A 3WQBA 2B5VA 5FWXA 5TVGA 1O4WA 1XAJA 4JDUA 3VR4H 2KW5A 4HDMB 4CCAA 5CDYA 3HGQA 3EZXA 1MAHA 1XU9A 3KTOA 3K0AA 3T4EA 5HGXA 2AFHB 3DZKA 5FUVA 4TLLB 2B0JA 4YAJA 4M1ZA 4D4GA 1G5TA 2PS0A 2WF7A 3E9ZA 2GEJA 4CM3A 1TPYA 2DR2A 2P3QA 3EASA 1LTKA 4Z0NA 4TMZA 1PZFA 2G9NA 4LXTA 4DGSA 5BVHA 4IDGA 3RT1A 4CN9A 3LNCA 1E1RA 5H3LA 1I01A 1Y89A 5K0CA 5KHLB 4MHTA 5JSZA 3M49A 3EEYA 1V3QE 1ZWKA 3C2QA 1GPDG 1ESEA 2BM1A 3PNYA 2GX6A 5CPBA 2BIFA 4RTOA 1PJSA 2HQOA 4UQOA 5DSXA 2GH1A 3OBIA 2C54A 2OYSA 1W1IA 1OKKA 5DCYA 4UASA 1GG2A 2P1RA 2O6LA 3GX1A 4YI3A 2O5RA 3TL3A 1KF0A 2W6QA 3UT5A 2O9JA 4BU1A 3REGA 1Z8FA 3O9ZA 3AEQA 5THKA 3BMXA 3NU1A 3VOTA 1NE7A 1NT4A 1QB8A 3KXPA 2YS7A 2WY2D 3TVYA 4QULA 3VR2A 3NHBA 4D4KA 4OHMA 4DIFA 4CXMA 1BCRA 1OYWA 2QE7A 1VPLA 2WE7A 3RYHB 3E3AA 2Y67A 3GNSA 2WJIA 3LKDA 1SUIA 3N0VA 2FW1A 3NJ8A 1NXWA 4Y6OA 4AI6A 3IDFA 3QKSB 3DMTC 4O29A 3N0XA 2OYCA 1JG3A 1FYVA 1L4HA 4X8LA 1Z74A 2O7RA 5EP3A 1NC1A 4Q5IA 2K2WA 2VHZA 3FYCA 4HLUC 2JHFA 1PNOA 4FP9A 4KFUA 3SM9A 2AMYA 2ZAMA 3WK6A 5BMOA 3L4KA 1JMVA 1GA4A 1NR7A 1JDUA 1M2OA 2HC9A 4I5GA 1CRQA 4LPSA 4YDRA 2ET6A 3H3FA 2GPNA 2O05A 2XSZD 1B15A 2XVYA 3OIYA 4IH9A 4P5EA 1XU4A 1BMQA 3TLCA 2BCEA 5I4IA 5I7VA 3SCZA 3EA0A 2WJ3A 2H08A 1C7RA 2HA4A 2QTRA 2JBAB 3N28A 2HPVA 4ZOCA 4QYIB 1G0OA 4ZJZA 1A4XA 4QM7A 4JYZA 2Q49A 2PRJA 4BB9A 2Q29A 3BTOA 3M4YA 3LH5A 4PV7A 1PFYA 4ALIA 4DYHA 3BWYA 5HWSA 2IHUA 3L4EA 1RQ7A 2RBKA 3TRIA 5ITWA 1SR8A 2AG5A 4GO1A 2BM8A 3HN6A 1VSVA 2IYRA 2LUOA 2BF7A 1I2AA 4PHFA 2OORA 3JYPA 3AL3A 4XB2A 1RQGA 3AI3A 1NNEA 4XCVA 2YVKA 1PR9A 4JLPA 4L3WA 3DEJA 5AP9A 1XO1A 1KEEA 2DAPA 3HYRA 4DV3B 1EP1B 4L72A 4EABA 3LT1A 5EXDA 1HF3A 2B7CA 1L5HB 2CNDA 2IHYA 2PPVA 3CUUA 4X92A 2VHEA 1UDXA 4OYLA 4ZI2A 2DWUA 2AZXA 5E4YA 4DSNA 2Q1XA 4DZTA 1FSSA 1KYWA 1LVGA 1OASA 4MKZA 4PLWA 1E6KA 1HDZA 3T4PA 1I5OA 4N12A 3IULA 2JPDA 3H5OA 3E5MA