1L4UA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(ii) at 1.8 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 58
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4uA00
2DFTA 5FR1A 4JYCA 1K8RA 1ZM9A 3EZ2A 1Y3AA 4JKIA 1NLZA 4YMVA 3ZIAD 4US2R 1SVSA 1ZU5A 3SYKA 2IEYA 4GZMA 2EVWX 3A4MA 2NZ8A 4UXJA 2FMXA 2PZEA 4KCGA 1AJEA 1XBTA 1QF9A 4TYQA 5EZ5A 2ZYUX 3MCAA 3OEHA 2FZ4A 5FOVA 1KMQA 2BCJQ 1GL6A 5K8UA 5LD2B 1DAIA 3L2OB 2D74A 4Y0AA 4Q7KA 2YKGA 1GM5A 1SXJE 3KXIA 4KHZA 1AKYA 3NHAA 3ZVRA 1GKYA 2JLRA 2XTZA 3D8BA 4Q01A 4CEIA 1DE0A 2YHSA 3TUIC 1YHNA 1E2FA 2EFGA 1XTQA 1IN7A 1AZSC 2WWYA 1IN8A 3Q5DA 2JASA 3UIEA 1E2DA 1ZNWA 1UPTA 4JLBA 4ZV4A 1KMHB 4JLNA 3U4QB 3KKOA 3AUXA 3NC1C 5EE1A 1E2HA 1EFHA 3U7FB 1NMYA 1UM8A 2IWRA 3GLFA 2JLVA 4YXWD 4JZKA 3C7KA 1Z0JA 4MYUA 1E9CA 1TU3A 5HE9A 2EQBA 3ICQB 4KJZA 1CEEA 4LJ6A 4WOPA 4LHXA 4NBSA 4QG7A 3A1UA 4TZ0A 3MLEA 3TW4A 1BYUA 2RGNA 1XMVA 4M1WA 1XF9A 1Q0UA 5SZKB 3W8NA 1PLJA 2BBTA 4LDJA 3B13B 2FEOA 4A8JA 4YMUA 1PUIA 4GOKA 4KU4A 2J7PD 3TLXA 4ZIRB 3K09C 1RW4A 5EE9A 3LVQE 1SXJD 2Q9BA 4DCNA 1C1YA 1G19A 2C96A 3QUSA 1NJFA 4TMZA 2P2LA 3T1TA 5EP4A 4AK9A 1TQDA 2ZM5A 3IHLA 4OL0A 1S1CA 1SVWA 3NEYA 3WNBA 2V6JA 3LY5A 1CR2A 2J46A 4YXWA 3W8RA 4N1AA 1NMZA 5B2ZA 3B2EA 4HAWA 3P20A 1XXHB 3U3JA 3CF2A 3OEED 4GBMA 2CHVA 3IILA 4LRWA 3D6TB 3PIRA 4KYIB 2YWGA 1KIMA 2RGCA 2H92A 3NG1A 5J4VA 1TNDA 3ZVMA 2R6CA 4A36A 3HU2A 1Z0IA 1E2MA 1XCGB 2ZQ5A 2H7VA 1UFQA 3JVUA 2CLSA 1XB2A 4HYYA 3QPWA 2JIZD 1SXJA 3WXMA 2VHJA 4NTZA 4L4UA 5L8VA 5FH9A 2DWOA 3X1WA 4DCVA 3AF1A 2Z0MA 2R6DA 3QEJA 3SEAA 5J4HA 1VPLA 1U9IC 2WKQA 3C5HA 2ZJZA 3DEFA 2VIIA 4NCKA 1SGWA 2CEAA 4F4JA 4IVQA 4L5BA 5FOXA 1EX7A 4YQFA 2H18A 2D4HA 4ZCMA 2C03A 1KSHA 4ITRC 2FH5B 1NVXQ 3AVQA 4OJKA 5CJ2A 3IQWA 2VHTA 3KUDA 1XWIA 1PZNA 3A1TA 3NEJA 2GJ9A 4W5JA 3R9IA 3I4LA 5FTLA 4Q7JB 3WYGA 1JPNA 5FPYA 1NN0A 3WMEA 3FE2A 2JIZA 4AWXA 2WWHA 3T1OA 4HSEA 1Z0FA 4BFYA 2ECKA 3NH9A 3KL4A 2R65A 1Z6AA 4B35A 4B74A 1KJYA 3N70A 4OYHA 4JLAA 2ZI4A 4FMBB 2BKEA 3UMRA 4DUGD 4RKFA 3ZQJA 1G4UR 2XITA 5KYKA 3L43A 2OEPA 2VPPA 4AYXA 2G0TA 1LFDB 4HATA 3B6EA 4AKEA 1U8AA 3AKCA 3LRPA 1OIWA 3T61A 1ZYUA 4ZCIA 3P4XA 3QKUA 2QAJA 4ARZA 2FG5A 3OFND 4Q1AA 5JEDA 1E9FA 1U0HC 3KZ1E 3KB1A 2FSIA 4Q1CA 1W1WA 1Z22A 1F2TA 1QHHB 4PPQA 4JBXA 2EFDB 2WJIA 3SHFA 5A0FA 1L2TA 4ZKEA 4LYAA 3I62A 2H16A 4PTLA 2R9VA 3TIFA 2AK3A 3CX7A 2WWGA 4QHSA 421PA 2DFKB 3E2IA 4HDOB 3LXXA 2I1VB 1VG8A 1W48A 2QT0A 3UMFA 2QRZA 4XWOA 3I92A 2EFEB 1NKTA 2QA5A 2CBZA 2XJ9A 3KJIA 4DUGA 5JSZA 3QKTA 1IJFA 5AUQA 4Q21A 1DTSA 2QGNA 3BOSA 1ZM3A 2QP4A 1KO1A 3GEHA 3W5IA 3PUZA 3K0EA 3HPRA 1OFIA 1GNQA 2FA9A 1OH7A 1JAIA 2P67A 3AKDA 4TQ9A 4BASA 4MYTA 3OFNA 1VHTA 3QE0A 2JLYA 4LJ8A 1N0VC 2ZS8A 2OHFA 3CPJB 2YNMA 2P65A 3SE0A 4NCJA 4BECA 3PCRB 4HLUC 2REOA 4LV5B 4TLEA 5H68A 3QF7A 2WSMA 1T5IA 4Q48A 1FFHA 3KKPA 3OIYA 5KDLA 2GZDA 3VMFA 1NMXA 1KYIA 1VG0B 1BOFA 4WAUA 5B64A 4I81A 1QHNA 2IHYA 1KK1A 2ORVA 3KJEA 1JQJC 4XVQA 5EQTA 1RZ3A 3BXZA 4GDFA 1H65A 4TWZA 1VYTA 4P3YA 2CCGA 3IEUA 4B3FX 2KBFA 4G1UC 1FTNA 1LNZA 1Q12A 4M8NE 4JLMA 2XNDD 3NBFA 4C2UA 2QORA 1AA9A 1OFTA 3RWMB 1P7CA 3CIOA 4Q4JA 1RRGA 4HB4A 2VF7A 4NZYA 3MSXA 2B8TA 1VCOA 3SHWA 2WIBA 3LBHA 2IYRA 1QVAA 2XSZD 1LS6A 4KBFA 4DSNA 2VF8A 1MO4A 3NBZC 4QJ3A 1AQUA 5JJKA 1GUAA 1P62B 3HJNA 4JT2A 1T8UA 1I2MA 2FFHA 2JEOA 4N3NA 4R2HA 3K0CC 4HI0E 5TV2A 3EPKA 3JZAA 4URUR 1M1YE 4CYMA 3K9NA 4DLZA 1EFUA 1ODFA 2J87A 3IPXA 2QQ0A 3T15A 5FBVB 3GLFB 1U99A 1GFIA 4MGYR 4C3ZA 1OLOA 2OBNA 2W2TA 1P3JA 4G5QA 4TTRA 3DKPA 4UJ5A 3DO6A 5AUNB 1Q22A 1BMFA 1NNEA 3LBIA 2XXAA 2WSSD 4B3GA 3Q7QA 1TUIA 3MD0A 3G5UA 3EASA 2ONJA 2XNDA 1UEIA 2ATXA 4PC6A 5P21A 5KNDA 4ABYA 5B30A 3MJHA 1N3BA 1OH5A 3WBKA 4DLUA 4A8JB 1S3SA 4NYMR 3CKLA 2ZRIA 3LH5A 4DT1A 2XSZA 2BIFA 2NO6A 1TMKA 5IT5A 2JATA 1WA5A 2IYXA 1M6NA 4X8LA 2FPKA 3T34A 1XTSA 4P0TA 1JXOA 3I72A 5ELXA 2X77A 4DLXA 4W7SA 4KLNA 1T3HA 3ZZ0A 5SZIA 4UKDA 3PEYA 1Q20A 8OHMA 2ZU6A 3AF3A 3V4FA 4BFZA 2QGZA 2QMOA 4K81B 5KHOC 3GPLA 4H9GA 4DDVA 2WSSA 5DYGA 5HE8A 5JI3E 2IYSA 3H84A 2PEYA 4RD2A 4Q03A 1FPMA 3S1AA 3UK6A 3MWYW 3TRFA 3QOFA 4G01B 3WMGA 1Q1ZA 4HDQB 1TQ4A 5JWRA 2NPFA 3PVSA 1ZRHA 2OXCA 4AC9A 4TMWA 3B60A 2YC4C 3BIFA 1DOAA 5JCZA 1E9BA 2ZRKA 1SXJB 2B7BA 3AM1A 1PJRA 1COWD 2X2EA 3U3RA 5C46F 4B2LA 2FPLA 4BE7B 5TDHA 2Q0HA 4HB0A 3KFVA 2WJJA 1IOZA 1DG1G 1TX4B 3NBYC 1BKDR 1B23P 1A82A 4D4JA 1RC8A 3BD9A 1YZLA 2A9KA 1OV4A 4ASUD 4TT3D 3LD9A 5HCIA 4NYJR 3EX7C 3BRWD 3FMFA 4PO1A 1QHYA 3TGPA 5FUXA 1HTWA 5JEEA 1WQ1R 1XPUA 3RVBA 3AF0A 2ZAMA 3DOEA 5TARA 3WP0A 1RRCA 3ICEA 1L8QA 4EFNA 4NCNA 3IUYA 1XNJA 4S2EA 4BFUA 3QEOA 4EIWA 721PA 4DC9A 4CIDA 1E98A 3FWYA 3TBKA 1COWA 5CDFE 1UDXA 2QL6A 1OB5A 4L8GA 2CCKA 3VX3A 2OO7A 4B3DA 1G6OA 3I32A 1S9HA 2BMDA 4NMMA 4D2IA 2J5XA 2BBSA 1OIVA 2BWJA 3FHCB 3KKNA 2ZRAA 4TL7A 3W90A 2IUUA 1VG9B 1P73A 4ACBA 1E32A 1G18A 1W5SA 4IW3B 4TT3A 4ASUA 1VIAA 4TYNA 3Q3JB 4ARZB 2UZIR 1F6BA 2ZTSA 1KOFA 2ZITA 2W58A 4U5XA 2AR7A 3CZQA 4OHZA 4U00A 4EUNA 2IXFA 3QVVA 2REBA 2XB2A 1FUUA 5DO9A 5SZHB 3AF4A 1F2TB 1L4UA 3AP1A 3TNFA 1RKBA 1GRQA 1FUKA 2NIPA 2ZJYA 3SQXA 4MDFA 2A5DA 2ZIAA 4CEIB 3ZJYA 2Q9CA 1BH2A 2ZRPA 2BMJA 4NHOA 3WRXC 1E94E 3BE4A 2X19A 3IIKA 3A4LA 2JLUA 4PC2A 1E2PA 2XGJA 2I4IA 1UADA 2IYQA 3SBEA 3ZH9B 3EPJA 1G7TA 5AJWA 4E07A 5FPHA 1HH4A 2IUSA 5IK2D 3EZ6A 3LX8A 1SVKA 1N5IA 4C9BA 3QBVA 1GP2A 5CK4A 1U0LA 1S8FA 1LVGA 2GTPA 2JA1A 5DE3A 2W0MA 2G1JA 2GCPA 2HDNB 4QGFA 1DARA 1JI0A 4MUAA 4Z8XA 1KMHA 4TMTA 2VSXA 3U4QA 1KDRA 4BLRA 5JECA 1OE0A 1ZW6A 4UNRA 2A5YB 2CK3D 5EP2A 1NF3A 1KTVA 1U90A 2PZGA 1O3YA 3ADBA 3LLUA 4HAXA 4DJTA 4BLOA 1J70A 4MKGA 3QVUA 5GVSA 3OAAD 5BXQC 2J3EA 2FE4A 4TQUS 4MH0R 4MGKR 2BCGY 3GJ3A 3WRYC 2WIAA 4YMWA 4Q19A 4DKXA 1HV8A 2NO9A 4DZZA 1E2LA 2C5LA 5IK2A 5CDFA 2ZI3A 3IIMA 3CRRA 1FZQA 3AKYA 4QGHA 1X8JA 5HCNA 1S3GA 4EFLA 3VKHA 1PV4A 1K5DA 1KY3A 1ZNYA 2DFLA 3BBPA 2ZSDA 4TQAA 4NPHA 1N6OA 1KK0A 2GAAA 4Q4JB 2GDJA 2EFCB 4B32A 2WWXA 3VR4A 4FI3C 2OSBA 5LB2A 4G5GA 5FTKA 5L3SA 1EGAA 2QMUA 2X8AA 1IXSB 5DLQC 1ZMXA 1ZUHA 1ELOA 1XMIA 3PJRA 3AVYA 3NDPA 4TSFD 5KSPA 2WMOB 1VTKA 1QBKC 3FFBA 1KAOA 4V0ME 4Q00A 3ZGXA 2CJWB 3OAAA 4CEJB 4N0EA 1FP7A 4HB2A 4GSYA 2E87A 5G3YA 3THWA 1EG7A 3RABA 1E9EA 4TTPA 2ZJBA 3C41J 1AM4D 2E1RA 4BUJA 1US8B 5DHFA 1CS4C 2KWIA 3F3YA 4TL9A 2OAQ1 4WZ6A 2NG1A 5FPTA 4NP6A 1N6IA 1XMJA 2IA5A 1KDTA 3JZMA 2QN6A 1CR4A 1HY3A 4M1TA 5EE0A 5FTJA 3ZVNA 1E2GA 3FMPB 4DB4A 1XJQA 2EU8A 3A1VA 4ILEA 4BFWA 4GI7A 1YVDA 1S0UA 4E09A 1CR1A 4CT4B 2FSHA 1GL9B 1D2NA 4DT1B 1OB2A 1KK2A 1DAHA 4QL3A 3W34A 2RGEA 2RCNA 4D0NA 4QBIA 2BDTA 3TUZC 1S4QA 2V1XA 4TSFA 1GNRA 2D3WA 3VR1A 4AIIA 1NL3A 1U81A 2BV3A 2EWWA 4UXHA 2FF7A 2YVUA 2V1UA 1E0SA 1A1VA 4LX0A 1JJ7A 2ZE5A 3K70C 3KQKA 1DAFA 2BKUA 1YKSA 2WKRA 4KVAA 2IF2A 2AL7A 4M9QA 1YZUA 3UKDA 3SFZA 4B3BA 4JIMA 1II8A 1ONBA 3KX2A 2JJ1D 5C4GB 1JXMA 4BEBA 4Q1FA 1E4YA 1XRJA 2QMHA 4IEIA 2HYIC 4AYTA 5H8WA 1KNQA 4Q4LA 1Q3TA 1RRPA 2A30A 2A7QA 4D4KA 3SYLA 2FN4A 2G88A 1G3MA 2YWFA 4UXIA 5AJYA 1MR3F 1XTKA 4LJYA 4W5WA 1JJVA 2WOJA 2ZI9A 3OESA 1DO0A 1OFHA 4AD8A 2R62A 4QGAA 3GLIE 5KDDA 5GJCA 1EX6A 2ZVQX 4Q18A 4KO8A 2WBLC 3NDBB 2A78A 3X2SA 4WBSA 2W0SA 3BB1A 4ZDJA 5EXXA 4LJAA 5FOSA 1FMLA 1KSFX 4XIGS 3EARA 1F3OA 4HDCA 3AVXA 3T06B 4FMDF 2ZRHA 2D62A 1TEXA 2F1RA 4V0MA 3Q85A 2ZYWX 2JJ1A 1QHHA 1G8YA 1G291 1XD2B 2F3RA 1GKUB 3GEEA 5LBIA 1C9KA 2GRJA 3HYTA 4P4TA 1JALA 4HAZA 4PSVA 2YC2C 1W2GA 4F7WA 4LCBA 3SR0A 4F4IA 3SQWA 5HR5A 2GVDC 1S1MA 2F6RA 3RWOA 2ZYVX 5DSZA 4HUQA 2CE7A 4JLVA 3TVTA 1R10A 1LS1A 3DHWC 3EA5A 1GTVA 1GILA 5L3VA 3BC1A 1P2SA 2XZPA 3LV8A 2RGGA 2PCLA 2QMEA 4YLGA 1KK3A 1GG2A 1MRSA 3THXA 3E5HA 3A1WA 4FXPA 4PAQA 1AS3A 3Q72A 3PEWA 5C4MA 3MJRA 5TVKA 2XZOA 2GCNA 2VP9A 4V03A 3CRMA 1C4OA 4BPBA 2RHMA 1CIPA 1G17A 1NY6A 2FU5C 4ZPXA 2OCPA 1AK2A 1R0WA 2BJWA 3PXGA 4XD7D 1FP6A 4C0AC 5EUQB 3LQRA 1WP9A 3CBQA 3P1JA 4AKHA 1HQYE 2ODBA 1G5PA 3NIBA 4Q7MB 4DIEA 2F9MA 2GEDA 5HTKA 4LHVA 4D26A 1ETUA 1Z0DA 2D7CA 1NVVQ 4C0SA 1ZUNB 1ZCBA 4NYIQ 2C8VA 5KPJA 1N0WA 2NOAA 3GFPA 2N42A 2VHUA 2XOKD 2JLXA 1Z0KA 2DHRA 3M0EA 3FPAA 1VMAA 4HLCA 1T5LA 5JZVA 2QE7D 4OI2A 3KQNA 1N6RA 4OJQA 2H5EA 2GBLA 3FOZA 2QENA 4JVMA 5M04A 3SN6A 3GLIA 3FB4A 3U44B 2VTKA 3L0IB 4K46A 3EA0A 3UPUA 3VNUA 1RIFA 3SJCA 3ND9A 4BQSA 1UF9A 1G5RA 4QBFA 2CVHA 4DCTA 1E9SA 4XD7A 3GLHE 3AB3A 1U8YA 4O25A 4ZI3A 1TF7A 4IDHA 1YRBA 5JRZA 3QNUA 4Q9HA 4HZIA 4ACAA 1DEKA 1G3IA 2PH1A 2G9NA 5L3QA 3ZIAA 1IJEA 2FWRA 2W6JD 4Y0VA 1IN4A 5FL7D 2NMVA 1TQ6A 2FV8A 3TMKA 5IRCD 3HU1A 2XOKA 4PHHA 1P2TA 2QTFA 3CPHA 1G7SA 4LV8B 3T1QA 2QSYA 2QE7A 5FTMA 3C5CA 1L7VC 4IXNA 1R5BA 4P33A 4RFSA 1E69A 2WKPA 4XWAA 1XPRA 1FTSA 2ODNA 1GNPA 2IYTA 4OI4A 3CB4A 5FUYA 4DLTA 3WBJA 2ZRNA 4D80A 2HCBA 2YWEA 5J47A 2C78A 3RC8A 2HXYA 4F4CA 3U6KA 2PX3A 2RMKA 1ZD1A 2Q3FA 3R8CA 4DSTA 1SULA 3LDAA 4OK5A 2IK8A 1ESMA 2QI9C 1ZIOA 5CM9C 4MA4A 5L3SB 3KQLA 2O8CB 2QZ4A 1ZM7A 4IFBA 4Q5IA 1KGDA 2OLKA 2IC5A 3BORA 2P6RA 2DCUA 4KBGA 1CP2A 3LO5A 3AVOA 2WICA 1EWQA 4LC0A 2OXRA 2W6JA 5FL7A 2J45A 3SI7A 4A2WA 1UDWA 1Z28A 3T5DA 2JJ2D 2W00A 3B1VA 3FYHA 2AKYA 1JEDA 2P6UA 3KKQA 3THWB 3CX8A 1IHUA 1QG4A 1E96A 3THOA 2WTUA 4M0LA 1ZC3A 5IDVA 3T5GA 2LKDA 1WF3A 2QM8A 4URZR 4Q9LA 5F98A 3BB3A 1D5CA 2ZXUA 1IM2A 2J7PA 2J7KA 4A2PA 4WA7A 2WJVA 4X8HA 3TR0A 2R6GA 1CXZA 1LV7A 4OI0A 1E9AA 2ZRJA 5E95A 2AWOA 3SOPA 2GA8A 2W2XA 1U94A 4PFSA 3GLHA 4R7ZA 5JLJA 3MGCA 2IYLD 3CH5A 2FOLA 2XJ4A 3BFKA 3ZS8A 3U7HB 3TQCA 2V9PA 3ADCA 3BK7A 1T3SA 2W6ID 2P6NA 3IPYA 3OEEA 4I1SA 2JJ2A 3H0KA 1A2BA 2LCFA 2Q3MA 1WE2A 3P4YA 1IY0A 4PPFA 4LWZA 2Q6TA 1OKKD 2J0QA 2PZFA 4M53A 4Q9JA 1II8B 2OESA 3AUYA 1IBRA 2ODEA 5BN3A 2JLQA 2TMKA 3D3QA 4LZZA 1YR8A 4UNQA 4LPSA 1RE0A 4H1UA 3TUJC 5AJVB 4JKYA 2HXSA 3DMDA 3CR8A 1YZQA 2CMKA 5E7MA 4EDHA 1IXZA 1XEWX 2OZEA 3K53A 4Q1BA 4IKEA 1J2JA 5DH9A 3IBYA 4LSGA 4RVCA 3MFYA 4XTCS 1WBDA 4PXAA 4GT1A 3U7GA 4CDGA 2QPTA 2RHDA 1FQJA 2Z5FA 1MOZA 1EFTA 1R8SA 1E2JA 1KHTA 3VHLB 2ZJ2A 3EPLA 4GMDA 5FR2A 2W6IA 2ZS7A 3U3MA 1B0UA 1W0KD 3LNCA 1G1MA 3K9HA 4HAVA 2PT7A 2V54A 5LD2C 2IUTA 4F92B 1OKKA 3G0HA 1W2HA 3MWJA 4JL5A 2G0NA 3T35A 2I3BA 1LB1B 3NVAA 3THYA 1P2UA 4POAA 2FGKA 1CTQA 2XTNA 1KKMA 2GXAA 1H8HD 3O8DA 1Z0AA 4K8OA 4B44A 3A1SA 4I99A 1G3RA 3GFTA 2IXEA 3QF4B 1MT0A 3SJBA 3TH5A 2GAOA 2WHXA 4HUQB 2FX3A 4EJSA 1FNNA 1P4SA 1EESA 2ZSFA 2Z6VA 2H17A 1E9RA 2QG6A 3I8SA 3HU3A 1ZIPA 1ZD9A 3PV0A 2V6IA 4C0HA 1HE8B 1SKQA 1VCIA 2AD5A 3THXB 5JCPA 5FTNA 1AN0A 4TLAA 3KQUA 1JEEA 1W0KA 5GJWC 4BLPA 5FL3A 4EPWA 2ZS9A 1P6XA 1TF5A 5FUWA 1G7CA 2JLSA 4MKHA 3EZ9A 1N5KA 3L0SA 1M2OB 4QGGA 1KI6A 4RFVA 4DEXA 1D9ZA 2P5TB 3LX5A 2ZR7A 3ZQ6A 2VHQA 3CUEF 5E7JA 3CNLA 1H8HA 1W36D 5F9FA 1EFCA 4B6FA 2HJVA 2FZLA 1ZCAA 2NO7A 4EFMA 4C7OA 4LBVA 1RFLA 5H70A 3KKMA 3B8HA 2ZSAA 3P27A 1U98A 5JHHB 1TADA 2AHOA 5AUOB 2IHBA 2C9YA 3L8YA 4DLRA 1D8TA 1OXVA 5AUPB 4FWIB 4TYWA 2O8FB 3IO5A 1Z08A 2CVFA 2GXQA 3GLIB 5CIQA 1E0AA 5DN6D 3WP1B 2IX3A 2YYZA 1XTIA 3AQ4A 4LJ9A 2J0VA 2YOHA 1FQKA 1R5NA 1G20E 3K9GA 4TLBA 2GJ8A 3LXRA 3HDTA 4CW7A 2GVZC 3GJ7A 4D25A 2YOFA 1P60A 2XNSA 2HUPA 3ASZA 4WIAA 3TK1A 1M8PA 4WZAE 1ZBDA 2ERXA 3HR7A 3AGPA 4EAQA 4PO8A 1GRRA 5ANRB 2CJWA 4CEJA 5L3QB 3OE7D 4A0RA 1O87A 1M34E 5FBQB 4BFVA 1XPOA 1QHXA 4I4LA 1JECA 1US8A 3FGNA 4A6PA 2YV5A 2ANBA 1OXTA 2JGNA 5G53C 3I61A 4RFSB 5BW8A 1Q1EA 2A3RA 1JBKA 3BFVA 4RJLA 4KSCA 4GP7A 4XVRA 4JJKA 1AKEA 2QT1A 5DN6A 4IHQA 1Y63A 1KZGB 4PHFA 1P2VA 1MKYA 3A4NA 1NIPA 2GXUA 1P9NA 2QTVB 2QY9A 4PQYA 2C77A 1V43A 3E1SA 2GWHA 5HZHA 2YJTD 3I8XA 4CF7A 4UQOA 1KJZA 3Q5EA 4NDZA 2XZLA 1G8PA 1KAGA 3MMPA 4PC3A 3HYRA 1N6KA 2N1BA 4V02A 4HZUB 5AJXA 3SYNA 1GRNA 4Q9KA 2EFHB 3OE7A 4GPTA 2QAGB 3H86A 2FFAA 5A4JA 1HT1E 2IL1A 2OBLA 1DADA 1J8MF 1W0JD 3K8YA 4FCWA 1QHIA 4BLSA 4URVR 2HCJB 1AGPA 5KPDA 1ZNZA 4O3MA 1W7AA 4LOAA 3GFOA 1TU4A 4P32A 3PUVA 1P72A 1L4YA 2GHIA 3NBXX 4UNNA 1U2RA 2QPOA 2CXXA 3RRYA 2HEIA 2OLJA 1ESNA 1DAGA 1NY5A 3EIEA 3EZFA 2HV8A 1UAAA 3BAFA 3PFIA 2IS1A 4DLVA 3C8UA 4Q47A 5DISB 3KXKA 2MMGA 2A5JA 4RD4A 4LGMA 3CRQA 3ADDA 3R20A 3Q8XB 2NTYC 3GLHB 3LBNA 4Q1EA 1J99A 2ZRMA 1D6JA 1GWNA 5SZJA 3WHKA 1OIXA 1W0JA 4GP6A 2F3TA 5CK5A 1N2CE 2ZUCA 4TL6A 3AV0B 1XD2A 2RH5A 1NJGA 3PQCA 2D06A 3RAPR 4C30A 3U3OA 1YRAA 2P3SA 3RANA 1LW7A 1HUQA 4NE2A 5A5GA 1QDEA 3B1WA 1F5NA 1SVOA 2RAPA 2F1HA 2GESA 2GF9A 3AF2A 3ONWA 3AH8A 5D3MB 2DY1A 3AP3A 2D7DA 3VHXA 4N0DA 1SVMA 2YZ2A 4KSBA 4M2LA 3ZYCA 1X1RA 3QY0A 3BS4A 2Z43A 1YJ5A 2J41A 2R2AA 3CWQA 2QPAA 3SU8A 3HP1A 4DCSA 2WWWA 3L82B 1WB9A 2VYFA 4KFSA 2F1IA 2QBYA 1OPXA 3NWJA 1IY1A 821PA 1OHHD 4M22A 4B3XA 3BFXA 3VR6A 1FX0B 1X8KA 3GQBA 5DGXA 5CB6A 2PBRA 1U9IA 4YMSA 4FWTA 1G3QA 1OJLA 2AFIE 5L3RA 1OXUA 3J81k 1CJUC 1Q44A 4DBLC 1NVVR 3WYFA 4NYIR 1G5TA 3M6AA 3THYB 2YINC 1GOTA 5H1YA 4LK2A 4B33A 2OT3B 4TYYA 4XH9B 1X6VA 2PT5A 4RKEA 2XB4A 4Q02A 4HEJA 4EPYA 2ZRCA 4PPNA 2F7SA 4RD0A 4BZPA 1MO6A 1KI3A 2ZJ5A 1XEXA 1E9DA 2J0UB 4X8OA 5HKKD 2QTHA 2WVJA 4US0R 1ZD8A 3CRW1 4OI1A 4EJSB 2C04A 3K1JA 5J4LA 3I73A 1ZC4A 5KNCA 3U44A 1NN3A 1OHHA 1SHZA 3EW9A 5E4FA 2ZETA 4B43A 5JJIA 1KO5A 3C16C 3VU9A 4LUCA 2NGRA 4JSYA 1I4LD 4PR0A 5LB4A 2CL7X 2VLIA 4LYFA 2RGNC 4WW0A 1Z6TA 4B75A 4A8JC 5JHGB 2FSFA 4PHGA 1KI6B 5G40A 3DL0A 4DXAA 1VYUA 1DAEA 2V4ZA 4JVNA 2ZRFA 3REGA 1KI2A 1WMSA 3PG5A 4V0NA 1XD8A 2FJUA 5G3ZA 3ZD6A 3BB4A 4LY6A 4C0JA 1HE1C 3CH4B 3FKSD 4GRAA 5HKKA 4C7OB 4P4SA 5CITA 2ZVPX 4FINA 2PMDA 5EXPA 3CNNA 1X86B 3NH6A 1S9DA 1E2IA 1R5OA 2Q9AA 2VH5R 5DNYB 1LF5A 1KJWA 3SFVA 1AZTA 2LWIA 3H2YA 4V0OA 4IVRA 3IHWA 1GSIA 1W46A 4D0LB 1KO4A 4AKGA 3TAUA 3EXAA 5DI3B 2O8CA 1ZM2A 1YR6A 2VP5A 1XEWY 3REFA 2CK3A 4M9XA 3GJ6A 3MAAC 5CLQA 1KO8A 2OUKA 3AVVA 1SXJC 4FN5A 1T9HA 4B34A 1R0ZA 1W36B 4HLUA 5AK0A 5JWOA 3FKSA 4O2RA 4AI6A 4RZUA 4W5HA 5KOYA 1VCNA 3TVDA 2AXPA 2QU8A 2IEZA 1IXRC 1NIJA 4QFMA 2GETA 2XAUA 4GMXA 2G6BA 2VSFA 1DBSA 2MSEB 3RS4A 2OFWA 3EG5A 4I1VA 1DELA 2OFXA 1FW6A 2VL7A 2AK2A 4Q4AA 2REXB 4BWYA 621PA 3CM0A 4WZBE 2MSCB 2J59A 4JL8A 3QKSA 1MO5A 1QHSA 3DZ8A 1HA3A 2C9OA 4JLPA 3NKVA 4YDHB 3WYAA 5E3HA 4G5SA 4IRUB 3CX6A 4S35A 3U60B 2ZJ8A 3LWNA 2ZJAA 4GZLA 4TZ6A 1W4AA 3QENA 5HPYB 3QPUA 5KO2A 3QG5A 3G82C 4Z8YA 1GIAA 5K8TA 3UATA 3AVUA 5GADl 1G6HA 1RVDA 2UVQA 3ND8A 1P75A 3EC2A 4LHZA 1KI8A 2O0HA 3PITA 2O8DB 3RS0A 3SS8A 3K0CA 4MKIA 1H8ED 2NO0A 4URXR 3W6NA 4LPKA 4IEEA 1N6PA 2V3CC 1JPJA 2NPIA 4FMCB 4U02A 3RS7A 3QI2A 3BERA 2PJRA 2IYWA 1IN6A 4JYBA 3A37A 2JDID 3QPVA 4TN1A 5CM8B 1EWRA 3P32A 1ZUIA 3R8FA 3HWSA 3ZZTA 2ZPTX 2X2FA 2ZUDA 4EPTA 3MRSA 3CR7A 3B1ZA 1IN5A 2QEQA 1NN1A 1T91A 4LC1A 2KSQA 1QVRA 3QQ5A 1JB1A 3I1FA 4D0GA 4PSAA 2GKSA 1S2MA 2W2VA 3CZPA 1Q1QA 4IFEA 3VQTA 5JS8A 1TQ2A 2L0XA 5KNBA 1DAKA 1E0KA 5FOTA 3V4RA 1RYHA 1SHKA 1VCMA 4DDTA 4GL2A 4TTQA 4RD1A 1H8EA 1YR7A 3AGQA 3OIWA 3RHFA 4QJ4A 1XD9A 4B47A 1Z83A 4DB2A 2P0EA 2RB4A 4XOIA 1NI3A 1E0JA 3UG7A 3I3SR 4LHWA 4OKSA 3IO3A 2JDIA 2F55A 3LQQA 1IONA 3ZVLA 4CGZA 1W49A 3QF4A 1ZU4A 3CONA 3DDCA 2EWVA 1CJMA 2GNOA 2CNWD 2ZYTX 4XVUA 1MH1A 2Z83A 4L9SA 1GDDA 5FOWA 2A5GA 4Q7LA 5GJBA 4G5OA 3OIVA 4PAMA 2QBYB 2ZROA 4IXMA 4OK3A 4XWKA 5BYKA 4TMVA 1NN5A 4XTRA 2IYUA 5DIFA 2VA8A 3P26A 1RYFA 1OF1A 1W4BA 3NHBA 4RZ2A 1R0YA 2CLDX 3TW8B 3GLGE 2OCBA 2DYKA 3K0FB 3WNCA 4BLQA 1Z47A 4KODA 1ANKA 4HUTA 1JR3E 1IY2A 3B9QA 1RRFA 4D4LA 2CNWA 5JJLA 1T0JB 5J4KA 1XEXB 3T12A 521PA 4Q66C 1SVLA 1E2QA 4NCIA 3BGWA 1CKEA 2O8FA 4NU0A 2PCJA 4TMKA 2IW3A 2OM2A 3DPUA 3RRMA 2AKAB 1AS0A 2YWHA 4JVLA 1W4CA 3VU9B 5DHAA 1ZJ6A 1OXXK 2ZI6A 4YDSA 4CEHA 1RJ9B 2O5VA 2GEVA 1KKLA 3LFUA 4AYWA 4M1YA 2AFHE 3TQFA 4KV9A 4MYCA 3TSOA 2QM7A 3NXSA 1XCMA 5FOUA 3UWOA 3D7MA 3QG1A 1YQTA 1DPFA 1CLUA 3RS2A 4BEJA 1EFRD 2KI5A 4QKQA 2VSOA 2FSGA 4M1MA 1G41A 5JMTA 2JCSA 3R7WA 4BZQA 4A0HA 2CE2X 2PLRA 2QQEA 2UZ3A 4HB3A 1AGRA 3SZRA 2WAXA 4FMCF 1F2UA 4P4SB 4A9AA 3GP8A 1JR3D 5LPNA 5GJVC 1JR6A 4M1OA 1CRQA 5EE3A 4FIDA 3I5XA 1OH8A 1G4AE 3PUWA 4NH0A 1Z6GA 2VP2A 4FW9A 4LJ5A 2ZI5A 2WJGA 2OFOA 2RGXA 3KXLA 4EKDA 1XJCA 2DFNA 3N2EA 1E4VA 2WPDD 1DS6A 1SKYB 2ZRGA 4B48A 5FPSA 4OHYA 4JLKA 2F43A 4M4SA 3CO5A 4ESVA 1SQ5A 2O0JA 1N5JA 2WAYA 1LF0A 1P61B 2G1KA 4QHTA 3BH7A 1EFRA 2XTMA 4HZUA 3ZDQA 1P5ZB 3W3AA 2CLCX 3GJ8A 3GLGA 2QAGA 4QRHA 1FMJA 1Z29A 3GJ5A 3TAHA 1F48A 3AP2A 2VQSA 1P9WA 2ZUBA 1TAGA 2GZHA 4B73A 3AVTA 5CJPA 3NC0C 1XX6A 1JR3A 2GJSA 3FVQA 3QKRA 4W9MC 4JBWA 5IF9A 4YC7A 4IDNA 2MSDB 2B7CA 1J7KA 3C15C 3F8TA 3VAAA 2VHCA 2IYZA 1TUEA 3EWAA 3K9LA 4RY2A 5EZ6B 4HAYA 4Q4AB 5TB5A 3ZZUA 3TE6A 1Z2CA 2WPDA 2ORWA 3SDZA 3QKSB 3PR1A 4A0GA 3X1YA 1FNMA 2P5SA 4KYUA 2HLDD 1MABB 2B92A 2NZJA 3GJ4A 1ZM4A 4MRNA 5AWFC 1I2DA 3RSOA 4BZXA 3QXXA 4JMPA 4C0KA 1J90A 2ZAOA 3CWZA 4IVPA 2ZR0A 1ZAKA 2RGBA 2GCOA 2GILA 5F2EA 4A2QA 3C14C 1XMSA 4BLTA 1UKEA 1X3SA 4DSUA 1N6NA 3AVWA 1N0UA 3EIHA 4PO9A 3LW7A 3W6PA 4OHXA 3K70D 2PEZA 2IS2A 3RRZA 4LJ7A 2ZI7A 1HURA 2HT6A 1K6MA 5D3MA 5FI0B 1TL7C 3QXJA 2PMKA 2ZE8A 5AJZA 4IOLA 2N46A 2O8EA 1I4DD 3H4MA 6Q21A 1UBEA 4C4PA 1R6BX 3B7GA 1D2MA 1R4AA 2IYVA 4QNRA 2HLDA 4OQNA 3GEIA 1SVIA 1BS1A 5B57C 1BO6A 1VECA 4H1VA 2WZQA 5E7IA 3O47A 1HYQA 1FX0A 1N6LA 3F0TA 4V0LA 2QP3A 2UKDA 5JWHA 1HEIA 4Q4HB 2GXSA 5EJEA 4RZ3A 1X1SA 4Q1DA 5AR1A 1TTTA 4MRVA 3EWSA 2BVNA 4EPXA 4HLQB 2VP6A 4E22A 1N25A 4LV6A 1GL7A 4ZKDA 4PHTA 2FEMA 2ZEJA 3EZ7A 3PEVA 2CHGA 2XX3A 2JLWA 4QC2A 1JNYA 3F5FA 4BFXA 4AG6A 4WXRA 4PC1A 4B76A 1OYWA 3O8RA 4KLZA 2CDNA 2WM9B 1MRNA 3B85A 4DDUA 2J0UA 3ECCA 3AVPA 4IOKA 3AKEA 4J0QA 1AIPA 2H1LA 4LYHA 4DIDA 3KQHA 1X8LA 1G16A 4ZDWA 1T0HB 2FPMA 4A4DA 3IGFA 4AURA 1U0JA 1UEJA 5EP3A 1XU4A 1ZNXA 2RGDA 2FNAA 2G83A 2GJAA 4CVNA 1J8YF 4MYHA 1XFAA 4Z51A 2IYYA 4JLDA 1E6CA 4M9SA 1CJVC 4CZ2A 1AQYA 1CBUA 1IAQA 2BM0A 3FDIA 1UBCA 2KJQA 3V9PA 3KB2A 3SC3A 1D2EA 2QRNA 4M1KA 1XDBA 3N5CA 4QOSA 4JJZA 3VR2A 1XZQA 4WVFA 2QNRA 2H57A 3FMOB 3CRVA 4I1UA 4NCHA 3UG6A 1WDTA 1N6HA 2XEXA 3VX4A 1DG3A 3IKJA 4LHYA 2F9LA 4R9UC 1K5GA 3CLVA 5C18A 5D3QA 1CR0A 2OV2A 1LTQA 4DLWA 3WY9A 4NL4H 1KI9A 4GFDA 2HT1A 2GJKA 4ERNA 3QBTA 1W47A 3SJZA 1P9RA 2BMFA 1UBFA 5DI3A 4KI0A 2OILA 2LKCA 2C2HA 1HT2E 3CF6R 3KFXA 1F60A 1R0XA 3MWKA 4CEHB 4GOJA 3GD7A 2BM1A 3DMNA 1XTRA 3VKGA 4C0LA 1W4RA 1A7JA 1BMFD 2F1JA 2NQ2C 2OBMA 1Z8FA 2NO1A 3OIUA 1II9A 1Q1BA 1YU9A 2KBEA 3RSLA 2ZE7A 5F3WB 1HQCA 4LI0A 4DVGA 2H8KA 4BRWA 4YONB 1OFUX 3TR5A 1W44A 3R7WB 5EUMA 2BOVA 4MITA 5KTYA 4A6XA 4C0QC 4URWR 3K0AA 4DHEA 4JLJA 1U8ZA 2B6HA 2HYDA 1F2UB 1Q57A 3DM5A 3Q7PA 3GJXC 4OBEA 3JVVA 5CYPA 3IIJA 4B3CA 1DO2A 2Z4RA 4DDWA 4PQRA 1T8TA 2FFQA 4Z54A 3DZDA 3RRNA 3MG9A 3LVRE 4PANA 5HZKA 4MRSA 1E1QD 1Z5ZA 4QBGB 1WRBA 2ZSBA 3W3ZB 5EXTA 1BIFA 4CT5A 5FI1B 3ASYA 3LW8A 3RDPA 3B78A 2R44A 2ZANA 2WJYA 5CYOA 1G8GA 1JAHA 3TSZA 5JRJA 4FD2A 4D4MA 4FCVA 2AX4A 2F43B 2IT1A 2ERYA 1MV5A 2JAQA 3A8TA 2IXGA 3MUFA 2D2FA 3QXHA 5JFGA 2ASEA 2EW1A 3WMFA 4L16A 3CF0A 3O8CA 1Z63A 4PZLA 3CW2A 5TY0A 4IOMA 4LBZA 3EPHA 2BBOA 4L15A 4BFSA 4DLYA 2IF0A 3Q9LA 1AS2A 3GLGB 3R9WA 2O8DA 4GNKA 5TMPA 1XP8A 2ZRLA 3C4JA 4B71A 3AEZA 3OHMA 1LY1A 5G41A 5EP1A 1R2QA 3A6PC 3WNDA 4EQ6A 2ZRBA 1CJTC 1M74A 5KDOA 2R6AA 3GJ0A 4MGIR 3KJHA 3QKRB 3V00A 5JS7A 4KVGA 2PX0A 4M21A 1E1QA 1G3UA 1GKIA 1NLYA 1NG1A 4OK6A 2O0KA 4TLDA 4GOXA 4US1R 4HLDA 4U7DA 4NONA 4X8MA 4PC7A 5J4YA 3GCGA 1KI4A 4HAUA 3RNLA 5BWMA 4OQXA 1E2EA 1CULC 2JJ8A 5JBQA 2A5FA 3O8BA 1VYVA 3K09A 4OQLA 3W6OA 1E99A 3IBGA 1XTJA 1II0A 2PL3A 4DWJA 2VRWA 5BN4A 4JT4A 5TXGA 2VP4A 4QBHA 2Q3HA 2I1QA 5FBRB 3M4YA 1RPZA 1Q21A 2GCOB 1W5TA 3DM9B 5FPKA 2FGJA 5GVRA 4F93B 1Z6YA 2ZSEA 3BH6A 2BC9A 3WHLA 2PJZA 1NRJB 2ZR9A 3GMTA 3X1XA 5B58C 1NBME 3PEUA 5BQ5A 2OE2A 2ZREA 2DB3A 3UANA 4F38A 1QG2A 1Z2AA 4TL8A 4UNPA 1PUJA 3OF5A 1KNXA 4MRRA 3B5JA 4P31A 4B2PA 2BEJA 2HF8A 3CPEA 3B9PA 1A2KC 2WWFA 1NVUQ 2O8EB 4MRPA 4IJMA 3QIAA 4KITB 1GZSA 5DI9A 4ZO4A 3R9XA 2Z4SA 4KFRA 5KU1A 3IDQA 3DOFA 4B2IA 4PQFA 3ETLA 4JBYA 2E9SA 1SKYE 1G21E 4KAXA 3I5YA 1Z3IX 4R2IA 3U3KA 4MDEA 2B21A 4BRUA 2R8RA 2V55B 3CNOA 2VO1A 2GBLC 1OT3A 3D31A 1G7RA 3EAQA 4CRWB 3VTKA 4QXAA 2AWNA 1KI1A 4C0BA 3ZLJA 3IQXA 3K0FA 2CCJA 3KTAA 2O8BA 2ATVA 3K70B 4F91B 4ZCLA 1KI7A 1OYYA 4M1SA 4ZDIA 2V8OA 4FCTA 1NBMD 1N5LA 3RYTC 4AKIA 1WBBA 4A0FA 1NP6A 1FOEB 2Y8EA 4XSGA 4TYPA 4RCZA 4UJ3A 4QM6A 1CU1A 1KSGA 1YZNA 1BYIA 1M7GA 1MO3A 2RKOA 2Q21A 3BWDD 3UMSA 1UKVY 1VHLA 221PA 2GZAA 2BJVA 1E2NA 4B6EA 1XXHE 3PUYA 4BGDA 2EYUA 3B1YA 3FFAA 3OZXA 4ESHA 1RJ9A 3VFDA 5DYIA 4O0MA 4KFUA 2QP9X 4MKFA 5FBLB 1PLKA 2J9RA 4AY2A 2R6FA 1XCPA 4PX9A 2IS4A 1VIYA 3W9YA 3TSWA 3B82A 4A1FA 3VR5A 1YZGA 4ON9A 3HPQA 4PSKA 2IWHA 1PLLA 2J1LA 5JSZB 2OAP1 1NBMA 5KSOA 4PAOA 3ADKA 3DKVA 1JQLB 2GF0A 1T4GA 2A2ZA 1G8FA 1KDPA 1Z6XA 5JI2E 4JSTA 3QXCA 2D2EA 2O52A 4G0NA 3LLMA 5EXSA 2VBCA 1QHGA 3RS5A 2QAGC 3FHTA 4FMDB 2WOOA 2FDCA 3KUCA 5F9HA 2VP0A 1GITA 4JLOA 3SNHA 1S96A 4PPGA 3NTUA 2WJHA 2JLZA 1ZP6A 4NKRA 3U61B 3FHOA 121PA 5FBWB 4MUBA 2B8WA 2K5UA 2ANCA 4EPRA 5BN5A 1XJ0A 3EC1A 5FFMA 3IEVA 4PZYA 1R7RA 1NLFA 1Q3HA 3ZS9A 2X1VA 1KZ7B 2BHRA 2OG2A 4V0KA 4I1OA 3LAWA 2ONKA 4RSGA 4LBWA 1IQPA 2FFBA 4JS0A 1KY2A 4ZIRA 4AG5A 4KFTA 5K8LA 3MWLA 2GK6A 3W5JA 4M9ZA 4LBYA 4D6PA 1CJKC 3K0AB 4Q9IA 4ZI2A 3RC3A 1EXMA 4MQBA 5FUVA 4DRZA 4WXPA 4KXFB 3VR3A 1YZTA 4QNMA 2SHKA 4RCYA 4RD3A 4ZDKA 4OHWA 1E1RD 1TF2A 1E3MA 1Z06A 2IBMA 3BJIC 4G5RA 2QSZA 4OQMA 4EPVA 1XXHA 4YMTA 4A15A 4IDOA 1MABA 1GVNB 4XJXA 2J0SA 1KO7A 1CF4A 1KDOA 1XZPA 2BEKA 5J5CA 1Z07A 2XXAB 1VG1A 1TPZA 1VDZA 1TEVA 3N2IA 2KB0A 1CRPA 3FTQA 5BYJA 3L8ZA 5CIWA 2DWPA 2C95A 1G9XA 1QRAA 2PLFA 2QUZA 4OHVA 1NVWQ 2CHQA 1OSNA 3E70C 4EQ6B 4JVSB 1NG9A 2ZU0C 4D81A 1G8HA 3QJYA 4NYMQ 3X1DA 3PENA 2DPXA 2C9CA 1E1RA 3RS3A 4TMXA 4XSHA 2ORIA 2W83A 3A58B 4URYR 3T1VA 1M7BA 4IDQA 2C98A 4R98A 2ODWA 3FKQA 5CB8A 5KSZA 1A4RA 4LYJA 1KSJA 3A36A 3KJGA 2RGAA 3ZD7A 4E03A 4MGZR 5UKDA 4DCUA 3H1TA 1NSFA 1YR9A 4Q4HA 2C99A 3TKLA 4EJSC 1ZINA 3S1AB 1M7HA 3HR8A 5KUTA 3LA6A 2WV9A 4QHYA 1A5TA 1T3LA 4II7A 3B1XA 4RD6A 1NSTA 3SBDA 1YE8A 1D9XA 1OXSC 2WWIA 1FL9A 1E2KA 4LJ4A 4RZXA 1E79D 2CL0X 2VEDA 4UNSA 3VNVA 2HF9A 1EK0A 3U6BA 1VKJA 1UBGA 3X1ZA 3PUXA 3QXSA 4E5UA 1UJ2A 4IDPA 4Z1MD 2ZE6A 3BH0A 3DVLA 1ZVQA 2GEUA 4DSOA 1WCV1 1I4TD 4G3XA 3UXMA 3KDSE 3VKWA 2OCYC 2DBYA 1NKSA 4R71A 5EE5B 4DEYA 1DVRA 2V7QD 3UWKA 4TLCA 4QM7A 2MMCA 1OH6A 2OCAA 2BMEA 3FMIA 2DWQA 4IOJA 3GLFE 3L0OA 2HJGA 3SJAA 5CLLA 4NYJQ 1R8QA 2ZJOA 1DAMA 1T6NA 2YOGA 1G64A 3TJZA 4D82A 2ZRDA 3RLFA 5K8IA 5KSYA 4L9WA 3U2QA 3M1IA 2IS6A 1XEFA 4BFTA 5C2JB 1E79A 2EYQA 4P4UA 1GAJA 1UKZA 4C2TA 5C1BA 3U5ZB 1YZKA 5IHPA 4Z1MA 5LDDC 4OQFA 2DR3A 2GK7A 2O8BB 3KTAB 3OEHD 3K0SA 1SZPA 2AXNA 3EIQA 4PZZA 2G3YA 2QROA 4O2LA 4JL6A 2G77B 4DLSA 1PVOA 1QZXA 1UKYA 4A92A 4QJ5A 2CL6X 1OW3B 3QSYA 1V5WA 5J40A 2AN9A 2V7QA 4A82A 2KE5A 3U7EB 2WMNB 3L0PA 1W36C 2AD1A 1WXQA 2BBWA
chains in the Genus database with same CATH superfamily
4X71A 1GJRA 5FR1A 5KZMB 1MQAA 3DB1A 4JYCA 2LR0A 3SEQA 3V3KA 2QLMA 4EG6A 3K6SB 2NSDA 4R9NA 4LSMA 2W2NA 4ZJYA 2VJNA 1NZDA 3CJTA 3IEXA 3QW4B 4RTOA 3GT0A 4Z0PA 1E9VA 2YZMA 2EVWX 4V0RA 4AXXA 4MR7A 1WD7A 3LP8A 4UXJA 2FMXA 2FZVA 3II6X 4OG2A 4PU0A 1NV8A 2GK3A 5AICA 5TSDA 5IAKA 1OBOA 1QF9A 4ER6A 1OBHA 5JPCA 3Q0TA 1YWGO 2JJYA 2W2LA 3O93A 4XQCA 3R76A 2AV6A 2L69A 4AUMA 2VDLB 1KS9A 1DCFA 1TC1A 1VE1A 1PT6A 1E1DA 2BCJQ 5F23A 1GL6A 1I9GA 2P30A 1GPJA 4L75A 3CF4A 3TNLA 1QCZA 1C4XA 1HE3A 1QRRA 5EQFA 4KHZA 5THKA 3E2PA 2GN8A 1E6KA 3U9LA 3FW1A 1GKYA 3A6KA 4JJGA 3ORRA 4CEIA 1YVUA 1DE0A 4KIUA 4QXRA 4LQCA 3TQSA 1XTQA 3ETJA 1L7OA 3QUAA 1PE0A 4EA8A 1KZ1A 2WWYA 3C8ZA 2X5OA 4K03A 2N3ZA 4OV6B 4JLBA 5AP9A 1UPTA 1EDBA 2VJPA 3S8MA 4ZTZB 4JLNA 2WHPB 3WRXA 3KKOA 3CT4A 3CTPA 2VDJA 3MINA 5DRTA 1MEEA 1ZEMA 4BNLA 3HWRA 4AJPA 4Z5XA 4FFMA 4YXWD 1QG6A 1P4RA 2ASVA 4MROA 1ORVA 1XDZA 4MO9A 3VMMA 4CCWA 4V1CB 5B1DA 1N5RA 3DDZX 1PQPA 2GBCA 4MYUA 4RH0A 4CG3A 4CETA 5A0TA 1MIOA 5DXFA 5HE9A 1HSZA 2EQBA 3DAFA 1HE5A 5A3QA 3ZJTA 1PTKA 1PT5A 1SBCA 4LHXA 3A1UA 4QG7A 4YBRA 1L4HA 2WK1A 1U1GA 3TW4A 1A72A 3CLUD 4CKWB 4D8VA 1XMVA 3USCS 4KQFA 4OTZA 5AMXA 1UBOS 5SZKB 2BBTA 4LDJA 3B13B 4J43A 1LVHA 2C5EA 2QZ9A 2ZWIA 3NHWA 1H93A 4A8JA 4UHDA 4YMUA 2GTHA 4Q3EA 5LA6A 5LP6B 1T35A 4GOKA 1Q7GA 2J7PD 2R00A 2P6PA 5EE9A 3X0DA 5J2UB 3WK7A 3ZWCA 4Y2RA 4I5FA 2Q9BA 2A4KA 1QZZA 2XMSA 3FPGA 2JRCA 4PLCA 3A2KA 3IP5A 3QUSA 1NJFA 3F78A 3KYDA 3QVWA 2IELA 4NF2A 1U1FA 1IG3A 2C59A 2IZ5A 3WJ7A 3S2YA 1X1DA 3QLVA 4FJ2A 4OL0A 3NEYA 4RPHA 3WNBA 5EXDA 4B3JA 2FR8C 2J46A 1EWTA 3IDOA 3HMQA 4CG0A 4DQKA 1JIIA 4N1AA 3LOPA 2C1XA 2J9GA 1Q2UA 4HAWA 5TF4A 2CZQA 2JIQA 2VYQA 1AB5A 1Z2EA 1ZN7A 2X0IA 1U0EA 4GBMA 4DBZA 2OZLB 1VKHA 5AKKA 1K97A 2YMLA 5E2AA 3EQ9A 3ZDYB 1I3KA 4CM3A 1W29A 1KIMA 1KC3A 1KR2A 3D6JA 1HKHA 1OWPA 3OM0A 2PYDA 1DBIA 5ICSA 1SOVA 4PLPA 3ZVMA 1GZDA 1FYXA 4M0KA 1Z0IA 1E2MA 2ZQ5A 3NOOA 2H7VA 4D9KA 2YL2A 1HDEA 2A1UB 1XB2A 3OPXA 3OZBA 3PR3A 4LZOA 5CVVA 3E9CA 1YUBA 4EG3A 4CM7A 5HVNA 1WVMA 2WRZA 3Q1KA 3WXMA 3C43A 4JEUA 1MHPA 1FBNA 1K9SA 3JQ6A 4L4UA 2DWOA 5AHKA 4I1YA 5T41A 4DIOA 5FH9A 4QGSA 4P4GA 4I08A 1JDBC 1P29A 2GERA 4E5VA 1VKOA 5AVRA 5J4HA 1U9IC 2WKQA 3FROA 2ZJZA 3H3FA 4LF8B 2VIIA 3NQ41 3V8MA 4P5EA 1RYBA 4F4JA 4GUDA 2V6BA 1F6WA 1FTQA 1MFZA 4DLLA 4IVQA 2V4UA 1R27A 2O6LA 1XALA 2PUTA 2Q2QA 4IKOA 5MN6A 1JFRA 2GVNA 3NV9A 4KNVA 2BGTA 3KJZA 3HXQA 1LLFA 4UULA 1DQNA 2VHXA 1NVXQ 4M7WA 4OJKA 1E1YA 2IPLA 1BHQ1 3OZTA 1T34A 1JFTA 4L50A 5DYTA 3C3XA 1E3LA 3IQGX 1XWIA 3VYVA 2MYPA 3K72B 4QIHA 1ZGJA 4FGZA 5FTLA 3N8GA 5ILOA 3M5PA 1PWHA 3DE0X 1O9GA 3WYGA 3ZU6A 2OVBA 5CDHA 3VOBA 2JIZA 5FOQA 5H4GA 4MUXA 4N7JA 5HMLA 4Z1OA 4BFYA 2J3MA 1TVKA 5AVTA 1ZR4A 4B35A 1KJYA 3C3WA 4OYHA 2VCYA 1BDHA 3WWCA 4JLAA 2ZI4A 3D5QA 3MS4A 4GVXA 4M37A 3K2IA 1AMUA 1K68A 1UK8A 1UBTS 1NBAA 1X7ZA 4TXMA 1LBEA 2BFFB 2O1XA 4RGBA 4YH1A 3BILA 4AYXA 3T3GA 4AKEA 5AW4A 3GBPA 1IHYA 2UVDA 3AKCA 1OIWA 3LRPA 1W8IA 3PEFA 4GYKA 5DHQA 5DT2A 3T38A 2QAJA 3JWJA 1TDJA 1WUTA 1JJIA 2FG5A 4ARZA 4Q1AA 5JZ9A 1UWLA 5HA5A 5KQRA 2JIOA 3SKXA 3KB1A 1VCHA 2YNMD 1V8DA 2FSIA 4JWTA 4YLEA 3ZW9A 1XPJA 3LVBA 5I7OA 3WGIA 4Q1CA 1Q0SA 1XKXA 4IJQA 4YIKA 1VJRA 2PVCA 1F2TA 3AR9A 2VF2A 4JBXA 4PRKA 2IU3A 2EFDB 1G2OA 4AP9A 5FCDA 4EI8A 3SHFA 5A0FA 5HJEA 5DM70 3I62A 1U3FA 4PTLA 4G8JA 2AK3A 1LBSA 3CX7A 4OSOA 1L5SA 3EJ6A 1EMDA 4ZJZA 4S2UA 3KQSA 1KOGA 1V1JA 1OD6A 2MWMA 1W48A 5LOVB 2QT0A 1RNLA 2QRZA 3LHSA 3M33A 1ZK0A 3A0UA 2O0MA 2V7PA 2ZXFA 2OC9A 4L5YA 4G86A 2YWXA 2XJ9A 3KJIA 3QFHA 1IJFA 3PD0A 1QZUA 1ZKDA 1Z6QA 2FFJA 2M1ZA 3BOSA 4LQLA 4ND7A 4FFSA 3K0EA 1NYLA 3PHCA 2ACWA 2FA9A 3EN0A 1RCFA 1AB6A 2BGJA 1Q7RA 4LF4B 4MYTA 2IOFA 2PPLA 1V4BA 3NDJA 1RPTA 3MELA 2JLYA 2CMDA 2OYRA 2OHFA 2P65A 2WI8A 3OQMA 1XR3A 4BECA 1KERA 3HN7A 1SA0B 3EQ2A 4TLEA 3UUWA 5B3LA 5GGXA 1TEZA 1IB6A 1SCJA 5JMWA 3KKPA 3LCVB 1KMNA 1RBQA 1YCFA 3EBLA 1NQOA 1U1EA 1M72A 2NYUA 1SMKA 2AIRA 3X2FA 2C57A 2ON6A 1Y8QA 3KJEA 4YR7A 3C8MA 1VSUA 2EZ4A 2X0KA 2ZAYA 2F8MA 2X22A 3BWYA 4MR7B 4M7RA 4TWZA 5DYNA 1V47A 2PK3A 1WUIS 3I0MA 4EENA 1SIOA 1VB5A 1Y7HA 2X4IA 3N05A 1JHOA 1ZWKA 3HJRA 1Q12A 2O2XA 1QYIA 2VYVA 1U3DA 1YBHA 3HKCA 3NBFA 1CIVA 4JLMA 2Q4OA 3WK8A 2IBSA 2PX6A 1AA9A 1OFTA 1O03A 3I42A 5DXJA 1MLDA 1Z6ZA 3C39A 4IGAA 3ZHYA 5EMJA 1BD3A 3I2IA 1HE2A 5DEOA 1QQ6A 1PEYA 3K4HA 4Z53A 2VQDA 2QL5A 2B8TA 1VCOA 4AO8A 5M34A 1ZDMA 2JAUA 3LBHA 1UFKA 2IYRA 3I0ZA 4RHUA 4H6XA 2AI1A 4QDUA 1V3UA 3LPNA 1JMYA 5JJKA 1GUAA 1P62B 3LHIA 5AXAA 2FFHA 1EJ2A 3HYNA 2YQZA 1JSXA 4DIMA 2O20A 4CDNA 2PVPA 2YJNA 5AM2A 3EISA 4N3AA 2RHBA 1BE0A 3JW8A 3MINB 3EPKA 5JISA 4OLJA 3SSMA 1DKLA 4DWOA 4CYMA 5LWHA 1ODFA 2J87A 4C29A 1U99A 2I78A 4MTCA 3TCNA 4X85A 1RWWA 3QNMA 1WXXA 1ZMRA 3L1IA 1QKIA 2V5AA 1MIOB 1Q22A 1F0KA 1K92A 4ZZ2A 3PYMA 1GNSA 2PSHA 4F0JA 2VJLA 1W25A 3MD0A 3IBSA 3WDLA 4GM1A 3WOVA 5LMUB 3I64A 2WU3A 3O4HA 3LECA 3VJRA 1CV2A 2D5LA 2ZIXA 5EKDA 5JZOA 3FUWA 4PC6A 4OXQA 1OH5A 3WBKA 4B4VA 2BEWA 3A4YA 3HV0A 3ICPA 4DLUA 4A8JB 3WDMA 5CLHA 2C7PA 3EZGA 4UTOA 1M1ZA 2XNKA 2ZJ6A 2XSZA 3DGFC 1IZ8A 2BIFA 3IQHX 4LXGA 2NO6A 5JU6A 5DNVA 4QUIA 3WIBA 5IT5A 1M5TA 1QM5A 2BKVA 2LE0A 3DOJA 1M6NA 1C0PA 2CZGA 3KYDB 1Z4KA 3HN6A 2ETXA 4LF7B 4M1QA 2X77A 3O7MA 4PTZA 4DLXA 4MDHA 4KLNA 1T3HA 1UQRA 4RPLA 4WV3A 3ZWDA 3IP1A 4NBWA 5KB3A 2W48A 2QMOA 4C43A 2HW8A 1QP0A 2Y1GA 4MP6A 2W37A 5TEWA 1PFGA 5DB4A 2XUKA 4JC5A 5HE8A 5JI3E 5F7JA 3TIGA 1APBA 4J0CA 1NUTA 1ZN9A 4Q03A 3TTXA 1IB0A 2QN3A 3DDWA 5ICFA 1SXGA 1JGTA 3KWLA 4QREA 4N5HX 4QVKA 3Q7TA 1O5IA 2Y1OA 4DQLA 1X42A 1QQBA 2PY6A 2XWJI 3GPDG 1ZJ5A 3LT2A 1QPZA 3AK4A 1JWBB 3TTVA 2FCRA 4DBVO 5ADVA 5C46F 1O95A 3ROZA 4B2LA 2AS0A 3UGJA 2HZ7A 4BE7B 1A97A 1MNQA 4OP2A 1GLGA 1HKUA 2PUVA 5A2QA 3G7UA 5LL6P 1DG1G 1TX4B 3NBYC 2SCUA 4L3WA 1A82A 3SIXA 3AJDA 1SG0A 1TXGA 2HPZA 2A9KA 4ASUD 2F8LA 5A4AA 1M2NA 2H48A 4MQUA 3KBOA 2Q0XA 4RPJA 5K0EA 4PO1A 1XRRA 3E4CA 1OWLA 5KEIA 5IKPA 4XGRA 4PQGA 4P80A 1H2BA 1WQ1R 3AERA 5EN4A 3DOEA 5BN3B 3ICEA 3RU7A 2GNPA 3DE4X 4YV7A 4R5HA 5JH7A 5IDYA 1O6GA 5K05A 1L8QA 4EFNA 1XNJA 3V1TC 1PV1A 5FNVF 1HO3A 3KE9A 1JWAB 4EIWA 721PA 3IJRA 1OUMA 2PX2A 4FQ7A 4MULA 4ZEVA 5CFRA 2I22A 2W6MA 3FWYA 3TBKA 1COWA 5CDFE 4B17A 2QL6A 3G9QA 1TVKB 1U3CA 4YI5A 3KOYA 2P4QA 1S7GA 3MWGA 4GI2A 2OO7A 2XRMA 5BUQA 2B2NA 4B3DA 4YHHB 1D1QA 3I32A 1S9HA 3FF4A 4JQSA 1A5ZA 3EVCA 4YRIA 4CDRA 1OIVA 2BWJA 1SZCA 3BFPA 3PFBA 5FAXA 1X7ZB 3W90A 3DCYA 4FE4A 2IUUA 1ISGA 1FSGA 1Z5PA 2P90A 4RTPA 2V03A 1VIAA 3VNAA 3DZJA 1M67A 2OZPA 3HHPA 2UZIR 1F6BA 1X2EA 1T1IA 4YRDA 1KOFA 1C0KA 2ZITA 5T6MA 1RM0A 1XQ1A 4BP8A 1U3VA 2AR7A 4XE5A 5BOSB 3QEBZ 2K7ZA 2GQ0A 2O7RA 1OI2A 3QVVA 3ULKA 3N7UA 3UAVA 3VTZA 1A7KA 4EHLA 5SZHB 4F7DA 1M6EX 2WNIA 3QA9A 1F2TB 1CQJA 1L4UA 1AUXA 3AP1A 3DUFA 3GIDA 4QUEA 5AVSA 2HX1A 4BVLA 1NVEA 2HNKA 2NIPA 2ZJYA 5EIFA 2VS1A 4WD3A 1TVEA 4BVKA 2A5DA 2ZIAA 3IP6A 3MT7A 2QNIA 1SPXA 3A6GA 3DMHA 2Q9CA 2ZRPA 3ZJYA 2BMJA 4NHOA 3TG2A 1SXHA 1H6AA 4JBLA 4KE6A 4MI9A 2XGJA 2Y2VA 1SHJA 1ZA1A 2J4CA 4QPNA 5JARA 1N9ZA 1G7TA 5DJ5A 5K01A 1FXWA 1D2GA 5C3MA 1OXKB 2X2OA 2EJBA 2GM3A 2JFBA 3HGQA 3EIXA 1ZSVA 2QD4A 3I9V6 5G0SA 3L4BC 5CK4A 3SVZA 4RKYA 3CUYA 2PU7A 2GTPA 1MB3A 3H5TA 2G1JA 5IJ9A 2GCPA 5CAEA 1KMHA 1L7QA 3U4QA 2WHRA 1KDRA 1RFGE 1FLNA 1NNUA 2CY0A 4WKBA 4LXXA 1WO8A 3VSAA 5ES4B 2A9VA 4R81A 1LDMA 2XMBA 3I2GA 1CZHA 1W87A 3UQYS 3ADBA 1XKLA 4HAXA 4E21A 1RACA 1J70A 2HJWA 4BLOA 2B34A 1NBEA 5BT8A 2J3EA 2FE4A 1Y8QB 4MH0R 4DR1B 1ND5A 2WR8A 4OHRA 4BRZA 5H3LA 1GARA 3PZBA 3WRYC 3U5TA 2WIAA 1PJSA 2HF2A 5CT4A 4B4WA 1E2LA 2C5LA 2X58A 3WS7A 1Y5IA 3JRWA 1FFEA 3A2MA 1KWKA 3ACCA 4BKMA 3IIMA 5EERA 3HKCB 3SZMA 4QGHA 5JXGA 2ZJ1A 3EH2A 3EQ7A 5KJCA 3GOQA 1WXIA 3VZQA 3L07A 1QR6A 4WKOA 1K5DA 1ILEA 2DFLA 2ZZKA 3BBPA 2IU0A 4I9HA 1KK0A 1Q3KA 3AC0A 3KWJA 2VNJA 2GDJA 4JLUA 5FA8A 4B32A 3T52A 5HP4A 4A0QA 4FI3C 2OSBA 3AFIA 5CGQB 1M2HA 1YA6A 2WM3A 3QOYA 4YRPA 1EGAA 4LZJA 1YCGA 2IEIA 2X8AA 3IMGA 2XB9A 3VZDA 4D9GA 1ZUHA 4HX9A 4BAUA 2GBFA 3UOGA 1OV6A 2HHAA 1OBVA 2WMOB 2FUG6 2P3QA 5HQTA 4FFBA 1IWBB 1KAOA 5TMEA 1KDVA 1A4XA 5HQJA 1KMCA 1LC0A 3PE6A 4N0EA 4HB2A 3D7RA 1SCBA 1D5WA 1MDBA 2E87A 3ELBA 3FZYA 5G3YA 3UEOA 3S2FA 4FS3A 3RABA 4KREA 1E9EA 1NPDA 2ZJBA 3CXRA 4FD3A 2PDAA 3M4ZA 5IC4A 1AM4D 2CXPA 2PT9A 1L8LA 3OQJA 2QRKA 1CS4C 2YZKA 4QFDA 3REOA 4PG5A 1WAMA 5AKYA 2NG1A 1UJNA 3BSFA 1RIIA 4BWYA 3UB2A 2VF5X 1E6MA 1GAEO 4KUGA 1HPLA 1HY3A 2BZSA 4YGXB 3V80A 3ZVNA 2ZIXB 1T15A 3FMPB 3MWEA 3RNOA 1DV1A 1XJQA 4MW7A 3A1VA 4PIPA 1HOTA 1Z8DA 2NPOA 1JAYA 3BMXA 5EJFA 2DHEA 1P45A 4AX4A 4Q4DA 3IMCA 1RWMA 1CR1A 1RYMA 3AB8A 4GZ6A 4NZPA 4MJLA 1O96A 1SURA 3EFOB 3KEOA 1OB2A 2HTFA 3WRWA 3RT7A 1YIDA 4MX8A 5IDQA 3TUZC 2PRSA 5CDYA 3IRUA 1Z5UA 4JEHA 5CFMA 4HLNA 1N2HA 1NL3A 1K4MA 2BV3A 1BXGA 2EWWA 4UXHA 3QVLA 4BVAA 1FDSA 1FMTA 2GSWA 3G2IA 3INNA 2V1UA 1KFJB 5ECDA 3SLRA 1JJ7A 2P68A 1AH2A 1IQRA 3Q8WA 4IUDS 4XVHA 3WMXA 3A05A 2BSQA 1Y1SA 2Y1XA 2Q3LA 3D2CA 1DLIA 2Z3ZA 4YT8A 2QRGA 3NOVA 5SYMA 3LWZA 4FGLA 4LKRA 2HMTA 1R0LA 2YFQA 3AIKA 2RGWA 2QMHA 1MHTA 1MX3A 3NATA 2HYIC 3WIVA 1EI9A 1Q3TA 1DLJA 2WB2A 3NTRA 3MJVA 2PLNA 2FN4A 2G88A 1G3MA 2WQZA 3L1HA 2G9RA 5LZ5A 1DRUA 2OO3A 1XTKA 4J1NA 1WXWA 2HRZA 2PKCA 1JJVA 3OIDA 2MSKA 3OE5A 4FE7A 5I8ZA 3H1BA 1OFHA 1YHZA 2Z2JA 1B8PA 4L5JA 4XZ3A 3ROFA 1K7FB 3O21A 3QFSA 4HWGA 4M55A 4N6OA 5GJCA 3GLIE 1EX6A 2ZVQX 4TPKA 1TJNA 2VJMA 2PBFA 4D3ZA 2A78A 4AZ0A 1QTRA 4B7ZA 2XQVA 2W0SA 3BB1A 4E31A 4ZDJA 5B1YA 1EHYA 1GLNA 3PD7A 3LA8A 5M2QA 2SCUB 4XIGS 1J20A 5IYZA 5FLXA 1RZRA 3LL7A 1UJ4A 5EJMA 4FMDF 4WZAB 5GAJA 4GOOD 2F1RA 3BDVA 6GPBA 3NDRA 2JJ1A 4X91A 1HSOA 3ZV4A 1XD2B 4BRSA 2F3RA 3IVRA 3GEEA 3ROMA 4B9EA 1C9KA 2GRJA 4UOEA 2HO4A 2A33A 1PDOA 3GGPA 4P4TA 4DV0B 3AERB 3FSJX 1JF8A 3I6ZA 4HAZA 3OKFA 3W05A 3GGDA 4LCBA 2GUWA 2G07A 5HZGA 5J2TA 2GVDC 1S1MA 2XLCA 3H4IA 1VE5A 4PZEA 5CT5A 4QLBA 4ND3A 1T8YA 3R5XA 1SOAA 2CE7A 4FR2A 4AMBA 3LUPA 1IY8A 2GLTA 1ZK4A 3DHWC 4P53A 3EA5A 2L17A 4V1CI 3BC1A 1P2SA 3LV8A 4TS3A 3PXBA 5CURA 5FKJA 5L7YA 3D7KA 3THXA 5HUQA 2J09A 3E5HA 4EHIA 1NZFA 1FUIA 2Y99A 3L4EA 1G5HA 1G0NA 3ZWXA 2OCGA 4P5DA 4XM1A 3GYGA 3H4VA 4LDQA 3OZWA 3O0TA 1C4OA 1E6LA 4RX1A 3AR3A 2JI9A 1Y6QA 2RHMA 3IV6A 1CIPA 1NY6A 4UUQA 5CJJA 4ZPXA 1BU8A 4CNQA 1JDBB 1EFPA 4D92A 2IRWA 4DOMA 1SXPA 2BJWA 2FFRA 4HQ6A 3LO8A 4IIBA 2ARKA 3W5AA 3LSYA 3HCNA 1XLTA 5EUQB 2ZFUA 1W88B 3P1JA 5HRCA 2JC3A 4Z0NA 1IVNA 3IAAA 3MVEA 1HQYE 1IEQA 3KETA 4H08A 1EFDN 2PBZA 2BFWA 4DIEA 4EJMA 3U3XA 4KH1A 1CQJB 2I6UA 2OBFA 2WC1A 3DUFB 1JFLA 4QYXA 1ETUA 5COAA 2E48A 1H0RA 1Z0DA 2D7CA 2N1MA 3IAS6 3M5DA 1DIGA 2IIVA 1ZCBA 4QRDA 3ZHCA 3QGMA 3AY0A 4UDOA 3Q0IA 4JJ7A 4G41A 4U4AA 2FJ0A 4XR9A 1N2OA 4JI3B 1VMAA 2WSBA 2BZ1A 3T95A 1JHPA 5T57A 2J48A 3LWBA 3ZN2A 2VQEB 3OT1A 4U7PB 2H5EA 1IBKB 3M5WA 3EPPA 3DKKA 2GBLA 4JODA 6CHYA 3FOZA 1YASA 2JA2A 4G85A 4JVMA 5HIJA 1LDBA 1JKFA 5G0TA 3FDZB 1Y1KE 4K46A 1HI9A 3QVMA 4AS1A 3E53A 3EA0A 4YV2A 3UPUA 3OZGA 3GGOA 4H3SA 3SJCA 4JI4B 3C4VA 1UF9A 1ENZA 3UFBA 2C00A 5LXTA 2O1SA 3FCAA 3OM8A 4HNVA 4MUGA 4AF6A 2Y1LA 5IJ9B 2C4VA 4V24A 1EE1A 4OMDA 4O25A 4IDHA 1IEXA 2H11A 3RVRA 4ZRDA 5K51A 3WAJA 1KZ6A 1N2CB 5ELMA 4HZIA 5FUQA 3EXHB 1DEKA 3S68A 2HWUA 3GA0A 5L3QA 1IJEA 4M0CA 3A6FA 3G02A 5F1KA 4BFCA 1TQ6A 1N92A 3GNSA 1NYRA 2FV8A 3FIUA 2G80A 2XOKA 1P2TA 3WIUA 3F8WA 4I4TA 4G84A 4U9UA 2BDUA 2QSYA 3KEGA 5DX8A 3DEAA 4XWAA 4DLTA 2PQ6A 1VJ0A 4YCBA 1CUBA 4C4AA 3H19A 1UK6A 2FPUA 2WUDA 1P9OA 2YWEA 3IJPA 3LE8A 1V37A 4D80A 1UPBA 5FP0A 5LQMA 2HQSA 4H3KB 4FYVA 4ZTUB 3DOHA 2GBPA 2PX3A 5DBIA 2R60A 4XLZA 1C9DB 3M1LA 3IQZA 5ENVA 4DJAA 1SULA 1TJ3A 3QVOA 4OK5A 3MZ0A 4ZZ3A 4Y2SA 3ZE6A 4MA4A 2Q49A 1Y5NA 2H51A 5JAPA 2FI1A 2ILVA 1T2CA 4D43A 4IFBA 4Q5IA 5CX4A 1KGDA 4C6TA 1ZH0A 2P6RA 2DCUA 1GY8A 1CP2A 3LO5A 1YMVA 4MAAA 3NO4A 2WICA 2Y0EA 1TYEB 1F0PA 3H9JA 1RPNA 3GRKA 2Z58A 2J45A 4YHBA 3ROTA 4BN0A 1AF4A 2IHKA 2HA7A 2ZUUA 4XCQA 2VJAA 1IMJA 3T5DA 3FRJA 3E3NA 2AKYA 3A3KA 2G5GX 2X41A 1H4SA 3KKQA 3IR5A 4GAEA 2PV7A 4RF2A 3OF2A 2FP4A 3NHRA 4FONA 3EMVA 4OJTA 3VRHA 2EDAA 3MT9A 2WTUA 3RROA 1JBEA 4Z4FA 4AQDA 4HVLA 2WJ6A 3HEMA 3T5GA 1V7CA 1RTKA 1R0CA 1JV2B 3AEYA 3JARA 3ZZMA 1R6AA 5BVGA 3FUVA 4GU5A 1L1EA 4XUGB 3VU8A 3OCJA 1ORHA 3MWEB 2VDNB 2RG1A 3LRTA 2J7PA 4K6MA 1NQ5A 1XTBA 1XF1A 2WJVA 1NGSA 1W1IA 2HJRA 3EOAI 3H9QA 2YV3A 4MUIA 5J63A 5A4KA 5HYVA 2DTEA 4UVIA 2VAVA 2ZRJA 3V8PA 2CF6A 1XZEA 4XXHA 1R6UA 4Y18A 1UXGA 5JRJA 1HX7A 1U94A 2Q29A 3PWZA 5JLJA 2I65A 4N01A 2HCRA 2ZJ4A 1U65A 3ZV7A 2Q5EA 2H00A 5JS2A 2V9PA 4NIMA 1KA9H 2AW3A 3W2FA 1IUOA 2LCFA 2Q3MA 4BE4A 3P4YA 3EEYA 1IY0A 1AD2A 3RPEA 2Q6TA 2PO7A 5FLKA 2X8JA 3GCZA 4RESA 3NWOA 3DEHA 3MBIA 4OFWA 2ODEA 4RM3A 4L4ZA 4ALIA 4LISA 1ZK2A 3FYUC 1CRWG 4LZZA 1BHJA 1YR8A 2VNSA 1RE0A 3PFFA 1EDEA 1KEUA 1CJCA 1MC5A 1EXNA 2H65A 3CR8A 1NXTA 1OILA 3HB4X 3P97A 3K53A 1XEWX 2OZEA 4XYBA 4ZO8A 5EEGA 4YMLA 4DR3B 2Y4NA 5DH9A 4YRLA 2NZYA 4FNAA 1BX1A 4IY1A 4UPVA 4RVCA 4BB9A 1WBDA 3U3DA 4WSOA 3TFOA 4GT1A 4I1RA 4W1PA 4F86A 2RHDA 5FBZA 2M6RA 2B30A 3J81A 4EF5A 4IMRA 4FPXA 4OATA 5KYXA 2IEDA 4L27A 3KUUA 3IP9A 3O3NB 4PG7A 2APJA 1PQYA 1T0IA 1KXJA 1WCYA 4LX8A 4AZ0B 3U3MA 2W6IA 2ZS7A 3R5TA 1BVUA 1W0KD 3LNCA 1G1MA 1P1RA 4RW0A 1LA2A 4CUKA 1GR1A 5IYZB 3F49S 2PT7A 2V54A 3HMKA 3GO4A 3URMA 1UWVA 4BGIA 5I48A 2C5FA 4FDTA 2IE8A 4QXMA 3IOMA 4ARSA 2GN2A 3MWJA 1LB1B 1MENA 4O59O 1P2UA 1JPUA 3QE4A 4OOFA 5FV7A 2NO5A 1LPNA 1OAOC 2J4FA 3KVVA 1CTQA 2GXAA 3MGBA 3VPGA 3D02A 5DBGA 1NONA 2DLDA 2J07A 3RVJA 2Y1KA 5LU9A 4M49A 1GPDG 2CDRA 4B44A 4ZANA 3QFRA 1YNSA 3CX4A 3IUEA 4I99A 4XOUA 5IARA 5J2TB 3HVHA 4EYKA 1RDFA 4RVNA 1E5LA 4ZAGA 1MT0A 1SG6A 3SJBA 2FX3A 4J0IA 1FNNA 1P4SA 2P9BA 3PA6A 3RYFA 3SQMA 1I7QB 5FXMA 2Q3BA 3UMMA 2ZCJA 3DBVO 3K4PA 2RGUA 2JGLA 4BY9E 1ZH6A 2XTJA 1P3Y1 5FDFA 4TMYA 2V6IA 5TLSA 4IM7A 1SKQA 4EB0A 3THXB 1NXOA 5JCPA 5T4HA 4TLAA 2W70A 2P0AA 3KR2A 1AF7A 1V4VA 3M82A 3OLYA 5GJWC 5J2UF 4K0KB 4FOPA 2ZS9A 4ZEMA 1TF5A 1CFZA 7GPBA 5CUQA 4MKHA 5KTTA 4UCWA 3LHFA 1KI6A 4C0WA 1VYHA 4DEXA 3KR1A 4KZKA 1LBTA 1Z4PX 2DQZA 2Q3DA 4F71A 3SXUB 2ZR7A 4EI9A 2OORC 2UYQA 1YZYA 1B43A 4H15A 5DN9A 3GCWA 5DSTA 5JSYA 2JLBA 2Z8YA 4OYLA 1MX5A 2VHEA 3WKEA 5F9FA 1EFCA 5JUWA 3BHMA 2ZB7A 1FYEA 2VEOA 2FZLA 5L4SA 4C7OA 1NE7A 3NHPA 1Y8ZA 3P5SA 2JIPA 1QMPA 3CNEA 3L92A 1ZOLA 3EDMA 1SIBE 1FYWA 3P27A 4IJ6A 5JHHB 3AHIA 4K87A 4C05A 1TADA 1LH0A 3AJ8A 1PK8A 1YBAA 3PFCA 5AUOB 4TWAA 2QF7A 4HNAA 3OT1B 3TKYA 4DLRA 4Q9DA 4AULA 4FWIB 2NV6A 2OBBA 4DMGA 2CVFA 3OZ7A 3OUUA 5GTDA 4JELA 1E0AA 3EG9A 3UHJA 5DN6D 3WP1B 1L7EA 3PX3A 3ZY6A 1T5DX 5KOHB 3R7BA 3MBOA 3UOWA 1R5NA 1YFLA 3UC9A 1G20E 4TLBA 1YS4A 4AO6A 3PEWA 3PNVA 1GFZA 4BU0A 1W52X 1Y6FA 1N7GA 5FWXB 4V38A 3MAJA 2XNSA 2HUPA 3KQQA 3ASZA 4WIAA 3TK1A 4WZAE 1ZBDA 2P9CA 3HCAA 5BQOA 1PJTA 3KKZA 5G2OA 1D03A 4X64B 4F2WA 2H2FA 1D0VA 4OBWA 2WIKA 3QYAA 5L3QB 4A0RA 1NW6A 4CKYA 1DC4A 3KPJA 3E9EA 1NQTA 4MXDA 3BULA 1XPOA 1I4OA 4I4TB 3GZNA 2D5CA 3A0RB 2UZAA 5G53C 2XDQA 5IKOA 4CQLA 3DMRA 2A3RA 3INTA 4L8WB 4CHTA 3HYLA 4KSCA 4JJKA 2C2YA 1Y5LA 4FIZA 4CMIB 1XZNA 1Y63A 3C5VA 3HCPA 4IHQA 5E7QA 3ODGA 3RF7A 3LOQA 5J3JA 1U0TA 4Y9UA 1GD1O 3EBPA 1Z7BA 4FFLA 4Y1GA 4P36A 1GG8A 4RS4A 4PQYA 3VDXA 2JL1A 2Z95A 5C1PA 3UUEA 4EVQA 4CF7A 4UQOA 4B6PA 3LUDA 1G8PA 4BV3A 4C6TB 2WZDA 4MO2A 4PC3A 2N1BA 4X1YA 5AJXA 4BAZA 4WJLA 1GRNA 3PFWO 3IERA 4ZC1A 4MRAA 3USZA 2F8TA 2HQ1A 5EXEA 2IHVA 2FFAA 1FVXA 5G0VA 1KEKA 1HT1E 1LJ8A 1DZIA 2YY5A 4ZXPA 2FQQA 3U0BA 4BLSA 2HBZA 4UCFA 5JZSA 2FP4B 3HBAA 4Z9FA 4LOAA 2B0JA 3U26A 5DK4A 2V9ZA 1P72A 2I7TA 3A6EA 1UDBA 4F6LA 3WL8A 1U2RA 2QPOA 3JARB 4X90A 3JWEA 3PE4A 4OXIA 4YP9A 4BO3A 2HEIA 3GJYA 3I4CA 1NY5A 1PVVA 3KPWA 4ZQHA 3RBVA 2DZDA 2BM9A 2HV8A 3KQYA 2IS1A 4DLVA 1PJAA 3C8UA 1CUVA 1MX1A 1U1CA 1Y6JA 2C97A 3CEAA 2MMGA 2L82A 2A5JA 3BGDA 1NWHA 3KYCA 3H9EO 2Y77A 4AJNA 1W6RA 2X42A 3OWOA 3ZD8A 5TQ2A 3M1YA 3KPYA 4XASA 2VK1A 3N0XA 3Q15C 1V48A 5D51S 4CMEC 1D6JA 4C03A 1GQSA 3GI1A 5JVDB 5SZJA 4PVCA 2PYZA 3FSEA 1IJBA 1TA9A 2CDCA 3WLHA 1AKWA 4CLEA 2QJWA 2X0JA 5CT8A 1N2CE 4YP5A 1A50B 4TL6A 3HLYA 4MARA 4F3TA 3PPYA 1M34A 3SVLA 3ANTA 1DSSG 2BTOA 2X8JB 3JSXA 3WQBA 2ZSUA 1VL6A 3AG5A 4NENA 1E3DA 2OBYA 5TEVA 3VPFA 2XBUA 4DDHA 3JWPA 1YFJA 2GF9A 3AF2A 5FJIA 3UMCA 2V7WA 3AP3A 5D3MB 3VHXA 4BB5A 2QYSA 4N0DA 4H7PA 4KSBA 2PM8A 3MUNA 1L5WA 4Q9NA 1AZLA 1X1RA 2DTDA 4LZPA 1N0HA 1YJ5A 2J3QA 2J41A 4XYEA 3U9TA 1LPAB 1N9GB 2QPAA 1J7JA 1PW7A 2VT2A 2WWWA 5KC9A 4WFKA 4KFSA 1JP7A 1DTWB 1GNVA 1GTJ1 1RQLA 3OP1A 3KZVA 3R5JA 3AXSA 4FC7A 3U4IA 4INJA 821PA 4RACA 1PWXA 4Q3BA 5TJ9A 2F59A 1WZNA 3EVZA 4K9DA 3GQBA 2X8LA 1EIZA 2GGSA 3NM5A 4OO3A 2W22A 4PZDA 3H2SA 4I1IA 2WJPA 1Q6ZA 3LY9A 1G59A 4EY5A 1G3QA 1KE2A 3CNHA 2OZVA 3J81k 4A8TA 1CJUC 3O8QA 1NVVR 1SO8A 2QTWB 2QTAA 2WV7A 4KX5A 4NYIR 4TGLA 1JLLA 3EXEB 3MFQA 1Z35A 5H1YA 1JLRA 4A23A 2DETA 2HK9A 5ALNA 4TYYA 4XH9B 4GMKA 1ECFA 3YASA 4HEJA 1RXWA 5EHQA 3I1JA 4RD0A 1MO6A 4L22A 2NZ2A 5CBPB 3WXBA 3KZKA 1E3EA 1TZMA 4KRGA 3AEQB 1GYPA 4RLQA 2V58A 4LXHA 4OI1A 2W6NA 2GZ3A 3B9BA 3RYFB 4GPBA 4K1LA 4LJKA 5ERXA 5D1NA 1MAAA 4DR5B 4RUKA 3U44A 1OHHA 1TIKA 4ZJPA 5JOQA 4MLCA 1EB9A 4B43A 5CDGA 3OLZA 1QO0D 5EMHA 5JJIA 2EKDA 2VDWA 4M83A 1S6YA 3DZHA 5L45A 4R16A 4PR0A 1I4LD 5LB4A 3TF5A 3S44A 3W5CA 2VLIA 4LYFA 2O9JA 2RGNC 3BREA 3D64A 4YQZA 1NFRA 1SQGA 3ICOA 3MLBA 4MQ6A 4AY6A 1I13A 2JGFA 1Z6TA 1P7ZA 1K8YB 2ZQYA 2B4AA 1THGA 4XARA 5F7ZA 2FSFA 4PHGA 1V26A 1XDUA 2I6TA 1KI6B 2Q45A 3UUFA 4N8EA 2B98A 1C8VB 3N07A 3UBTA 2OMKA 2GMWA 4BCCA 2W5UA 4ETWA 4JVNA 2C82A 4M3NA 3OQIB 2G5CA 3JQAA 4IO0A 4IV8A 4IDAA 2XUDA 3VI4B 4C7OB 3QELA 4P4SA 4Y8VA 4AJHA 3STVA 3GBSA 5LNK1 2PGLA 1T6BY 4G1FA 2PMDA 2C3OA 3CNNA 3WLOA 1X86B 3C6XA 2EIHA 3RD5A 1R5OA 2YBEA 5DNYB 1LF5A 1LTHR 1KJWA 2AQIA 3TBHA 4ZVUA 2GM9A 1P3DA 4WINA 2NTEA 2QJOA 2OB1A 4BAGA 3CMMA 3WGGA 2Z8YM 5IH7A 1FVOA 5LCXA 4CM8A 3EG9B 1ZA2A 2FKNA 1CIJA 3KQVA 3OY7A 2G06A 3EXAA 5H02A 2Z09A 2GF2A 1S3FA 5LYJA 2C42A 2O8CA 1ZM2A 1YR6A