1L4UA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(ii) at 1.8 angstrom resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
165
structure length
165
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 58
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4uA00
2GK6A 1E1RD 1GNPA 4RZUA 2V1UA 2G1JA 3LH5A 4DCUA 2J9RA 2NQ2C 3GEHA 3VNUA 5EUQB 3DKPA 3BERA 3RVBA 3JZAA 2Z43A 3R8CA 3BB1A 4Q4AA 3DOFA 1Z8FA 2QRZA 3M4YA 4HLUA 3ZQJA 4V0NA 5IF9A 2ZROA 5DH9A 2F55A 4BLRA 1LY1A 1ZIPA 3IDQA 2CJWA 2YV5A 5BN5A 4TYYA 1SXJE 2GJKA 2IUUA 4W9MC 1XTRA 1XNJA 4JLJA 2NPFA 1RFLA 4FIDA 4HB3A 4TLBA 1Q12A 1UBFA 3AP1A 5AJXA 1GM5A 3DVLA 4JS0A 1W2GA 5JHGB 2IEYA 1W4AA 5F98A 2FFAA 4PZYA 2ZSFA 5CJ2A 3WNDA 4LV8B 5SZIA 4BZPA 3OEHA 2GBLA 2J7PA 1E69A 2C2HA 3BH6A 1TEVA 5JZVA 2I1VB 1T3LA 4JLAA 4LBVA 5CLLA 5D3QA 3UG7A 5L3VA 4JL8A 5L8VA 1U8YA 1OFHA 2D06A 4OI1A 2N42A 2OAQ1 3SNHA 3S1AA 5FUWA 5ANRB 4NHOA 1T3SA 3RDPA 2QAGA 1ZAKA 3CNLA 3TSWA 1ZYUA 4LI0A 1IN5A 2P6RA 2ZI6A 4G1UC 3A4MA 3SYLA 1E3MA 5D3MA 2C9OA 2OE2A 1CR2A 2J7KA 5FR1A 4KITB 1ZUIA 1HH4A 4CEJA 1FOEB 1VMAA 3RWOA 4OHVA 4S2EA 4B3DA 2EFCB 2CLDX 3ZZUA 2X1VA 5J4YA 3GLHE 3QXXA 2QZ4A 4Q1EA 1WB9A 4PSAA 1M74A 2UZ3A 1W2HA 4A6XA 2D74A 2OZEA 2IYWA 4RD3A 2GEDA 3U3OA 2D4HA 2ZYWX 4Y0AA 4YMVA 1DAMA 4BFZA 4BE7B 3EARA 2WV9A 3GLGB 5FH9A 2BBSA 2DFTA 1SKYB 4LZZA 1CKEA 1G1MA 2TMKA 1RYFA 2R6FA 3BJIC 3QG1A 4KLNA 1BKDR 1P73A 2ZYTX 2GDJA 2FSIA 2ZTSA 3ZZ0A 3ADKA 4RCZA 1CJMA 2IWHA 4RFVA 2WVJA 3Q8XB 2PEZA 2MSCB 5A0FA 1GKYA 4IDQA 4MYTA 1HTWA 1X8LA 3BH0A 4LGMA 1E0KA 2ZANA 1XEWX 5JMTA 2FWRA 4O3MA 1FUUA 4WZBE 3TE6A 3FFAA 4PO9A 4D82A 1KHTA 1NMXA 2WJVA 2YWEA 4LYFA 3I8SA 1WXQA 4BZXA 1EX7A 1AKYA 5DHFA 3FFBA 3CX7A 4RJLA 1ELOA 2V8OA 4JVLA 4ARZB 2XB2A 1VCOA 2AD1A 2VEDA 1U98A 3KB1A 3JVUA 2ZM5A 1U90A 5K8IA 3HDTA 2OBNA 4OQXA 4ZO4A 4QG7A 5CK5A 2PZFA 4GZLA 4JYBA 4BLQA 1B0UA 4MGYR 5EZ6B 2R8RA 5CM9C 2WPDA 4B76A 1GOTA 2AFHE 3OAAD 4NYMQ 3R9XA 1G291 4OJKA 2I4IA 2WIAA 2JDID 4FWTA 3B85A 4H1VA 4HLQB 5TV2A 1CR4A 2O8FB 2W83A 3CBQA 4X8HA 3MJHA 2GXSA 2BKUA 2W2TA 2HXSA 2C77A 1BYIA 3M1IA 5KTYA 2IXGA 4BFXA 5IDVA 2CJWB 4HDCA 1LV7A 5L3SA 2ZQ5A 4LYJA 2F1IA 1E2DA 4BECA 1E79A 2XSZA 1LNZA 3MWLA 4G01B 1UKVY 2VLIA 3KKPA 2WJIA 3VU9B 2J0SA 4EFLA 4R71A 1XEXA 1NI3A 2GZHA 4CT5A 2XAUA 1IY0A 3DZ8A 2YC4C 1D8TA 1Z08A 5EUMA 4MRVA 3RRNA 4LUCA 4QKQA 2Y8EA 4V02A 5E7MA 5DLQC 4LJAA 1P61B 1NVWQ 2X2EA 2YYZA 1FTSA 2QP4A 4CT4B 3QI2A 3LQQA 4GOJA 1X1SA 2QT0A 3WYFA 4OI0A 5GJBA 1S1CA 3CX6A 4X8OA 1U8AA 3FB4A 3FKSA 3S1AB 4Q9IA 4YMWA 4TMXA 4MGZR 4HAUA 1Q0UA 3TRFA 1US8A 3SC3A 2JASA 2VBCA 2E1RA 1OH6A 5J5CA 1SGWA 3QBTA 1OH8A 4LJ8A 4C7OB 1N5KA 3EIQA 3X1WA 4TZ0A 2NG1A 1KK0A 4PANA 4E03A 2H57A 1OPXA 3B5JA 3U7HB 3PEYA 4DVGA 4CEJB 1NVUQ 2XOKA 4QJ5A 3CWZA 1P60A 4PR0A 5IHPA 5KPJA 1ZU5A 2W2VA 4LC1A 3NH6A 3T5GA 4QBGB 2B7BA 1JQLB 4MYHA 4FW9A 5B57C 1Q3TA 2EFHB 1CRQA 2D7CA 2VSOA 4A92A 1XPOA 1DARA 1E1QD 1KKLA 1XTQA 1Z6GA 1XDBA 1E96A 4LJ9A 5DYIA 1AS0A 2F1HA 2PT5A 1NMYA 3QF4A 2IXFA 4NYIQ 1MO6A 3TUIC 4C0LA 2GZDA 2FOLA 3LBIA 4K81B 3VHXA 1J2JA 1N6HA 4RFSA 2VTKA 3FOZA 3LLMA 1NY6A 1EESA 1F2TB 2LWIA 2AKYA 1FQKA 3AUXA 3PUYA 2OT3B 2VSFA 2AK3A 2X77A 2RB4A 2WSSD 1XFAA 1MOZA 1UM8A 1P7CA 1K5DA 2H16A 3W8NA 1E0AA 1ZNWA 4HLDA 4QXAA 2WWYA 4OJQA 1CBUA 5JJIA 4DLUA 3BAFA 1PVOA 1VCIA 2O0HA 1KIMA 2BJVA 3THYB 221PA 1OKKA 1ZVQA 3I62A 1N5IA 1R8SA 4DLSA 2JLRA 4RD1A 3LNCA 3WY9A 2EFDB 3ZYCA 1TUEA 1W0KD 2AXNA 3LWNA 3IEVA 2A78A 3CNNA 2OSBA 2J46A 3QENA 5E7IA 4G3XA 3QVUA 1TF5A 1UDXA 1M34E 5E95A 2CK3A 3B82A 4HAXA 1G20E 1PZNA 2Q9CA 2YOHA 3B9QA 5HTKA 3T15A 2W0SA 4A1FA 2G6BA 4MRNA 1X3SA 1VKJA 1T91A 2GJSA 1T5LA 3EAQA 521PA 1G16A 3RLFA 721PA 1LS6A 1G7CA 1O87A 4PO8A 4M22A 5EP2A 4Q1AA 2J0QA 4W7SA 3TR5A 3EPHA 5FBQB 2CK3D 1JEDA 3T06B 4L9WA 3IIMA 2GESA 1H65A 2W6IA 4TTQA 3OFND 1C9KA 1NBME 1E9AA 3CF0A 2PBRA 5KOYA 4WVFA 4PQRA 3RC8A 2RGNA 4IDOA 4PO1A 2XB4A 3QE0A 1R4AA 1EG7A 2IF0A 3U2QA 3PUZA 3GFTA 1WP9A 3SQXA 4GDFA 3U3MA 2CVFA 1XWIA 5JFGA 3KTAA 4KFSA 4JBYA 3R9WA 4ASUA 3U3KA 2X19A 1TU3A 5E4FA 3QKRA 1TUIA 3AGQA 5TY0A 3WMFA 4URXR 3D8BA 4AURA 1GVNB 3K0SA 1M7GA 2P6NA 3C41J 1VDZA 3NC0C 4TL6A 1KAOA 4IVQA 3LXXA 3QSYA 3TUJC 3ICQB 3EZFA 1CEEA 4B3GA 2J59A 2JEOA 2QBYB 2IS6A 2GXUA 2XNDD 4V0MA 3EG5A 2O8BA 4BFSA 1IXSB 1W7AA 5FTMA 1R8QA 4F4IA 1YZGA 2WM9B 3LAWA 2V7QA 3EPKA 2EFEB 4Q1CA 2PL3A 4DUGA 1G41A 1SKQA 2DCUA 3A4LA 5AJYA 2QAGC 3A36A 1LB1B 2C9CA 1E94E 3CPHA 3H86A 4GFDA 4JJZA 1N25A 4RCYA 2J1LA 5EE3A 3T61A 5C1BA 4FMCB 4NYJQ 4B2LA 2AHOA 4ZI2A 3TMKA 2ZJ2A 1G18A 1JXOA 4A8JA 1N2CE 1U2RA 3QPWA 1BYUA 1II0A 1E2FA 2HYDA 3AKDA 3RS3A 5KUTA 3U44A 4WZ6A 5KO2A 2GEVA 4D80A 3VR5A 1RRCA 1R5BA 2J0UB 5FPKA 1GFIA 3PEVA 4YMUA 4QJ4A 3A1WA 2ZYVX 4XTRA 4FINA 1E9FA 4ZIRB 2GXAA 2ZI5A 4UJ5A 1M2OB 5CDFE 3ZJYA 5DN6A 4F93B 3P1JA 1W36D 1W49A 4JKIA 2JJ1A 3NEJA 1GRQA 3GLFE 1G21E 4YDSA 4G0NA 3K0FB 3PR1A 2PX3A 3NG1A 3RSLA 1UF9A 2DY1A 4QHYA 4DDUA 5JLJA 4PQFA 4LJ5A 4DB2A 1RIFA 2H18A 5FR2A 1Z07A 1NF3A 1E4VA 1GL6A 2NZJA 3GJ8A 4ZCLA 2OM2A 4L9SA 5FPYA 4OHXA 4R2IA 4TLAA 5CB8A 3GJ3A 1DBSA 4JT4A 4JT2A 4B43A 2ZRAA 4B2IA 1K6MA 1CLUA 1N6RA 3CX8A 4DWJA 1F48A 5UKDA 1ZP6A 4M53A 1AM4D 2F1JA 2GKSA 2FX3A 5K8UA 2O5VA 2ZXUA 5J4LA 2R6DA 4LCBA 4AWXA 3DDCA 4UJ3A 5C18A 1DAGA 4EQ6A 4RSGA 2VHUA 5CYPA 1H8ED 3SJBA 2BDTA 3FE2A 4IEIA 2FG5A 1QHHB 4RD4A 4C0HA 2OCAA 3W3AA 2HF8A 4M9XA 5FUYA 4CZ2A 2PH1A 2QG6A 2REXB 3CPJB 4TTRA 4CEIB 5F9HA 1G8FA 3EA0A 1TQ4A 4PPGA 3SE0A 3GJ4A 2YNMA 2YWGA 3CRMA 4F4CA 4ITRC 5DI3A 4M9SA 1T0HB 4LBWA 4HUQB 4TSFA 1NY5A 4P4SA 1QHIA 1XMVA 3THOA 4TYPA 2D62A 2ODNA 4OHWA 2F6RA 3FHOA 3NC1C 3IBYA 3OIYA 4HAYA 5FOWA 1JR6A 1DVRA 3D7MA 3K70C 2ORIA 1OE0A 4RVCA 1RRGA 2ZR0A 3NBXX 4NKRA 1EFRA 4OQLA 4NCHA 1TTTA 2V3CC 1OFIA 1U0JA 2DWOA 4HI0E 5LD2C 1KI3A 2B6HA 1JB1A 1FP7A 2CVHA 3GLIA 1AS3A 1X6VA 3K0AB 1GTVA 2B7CA 2H5EA 1YRBA 1IONA 1W36B 1OYYA 3D3QA 1E32A 4QHSA 1TQ2A 3RSOA 1G3IA 2IBMA 1DE0A 4U7DA 3THWA 4AKIA 4AI6A 2QY9A 4I4LA 5IRCD 1AQUA 3E70C 1N0VC 3PEUA 1P9RA 2IT1A 1AIPA 1P72A 1UKYA 2EQBA 1G6HA 2AR7A 3DL0A 5CYOA 3PXGA 3Q5EA 3WMEA 3U4QA 2GVZC 1FNNA 2HT6A 1KAGA 1LF0A 4MDFA 2WHXA 3QKUA 1MABB 2F9LA 4TL8A 4BWYA 4Z54A 2HJVA 3FMFA 5J40A 4DDWA 2VF7A 3ONWA 1RJ9B 1QHYA 3SFZA 4XWAA 3W34A 3TAUA 2JATA 1ZCBA 1NMZA 5H8WA 4KLZA 1FX0B 2OCBA 1MRSA 1VCMA 2DWPA 4C0JA 1G8YA 3OF5A 2NMVA 2O8DA 1E2GA 3BORA 4FI3C 1TMKA 3A58B 1KZGB 3Q85A 4KFRA 4MUAA 4N1AA 4L5BA 4NYJR 1AJEA 1XF9A 2BMJA 1E2PA 4QOSA 2IHBA 1S3GA 1FMLA 1G5RA 1KI8A 5EXTA 4OYHA 4DJTA 2ZITA 1C1YA 4YQFA 4NPHA 3K9LA 1Z0DA 3ZD6A 1Q3HA 2WAXA 3IHLA 1YE8A 2CDNA 2GCOB 1E2EA 2A30A 4TN1A 4V0KA 3ICEA 3UMRA 1OXVA 4I1OA 1ZW6A 3UXMA 4PPNA 2XZPA 4DLZA 1Z28A 1WDTA 2WTUA 3GJXC 3VMFA 4JSYA 4DCNA 3VKWA 2ANBA 3TQFA 1P75A 4Q9KA 2BCJQ 3VR4A 1T9HA 2I3BA 2O8EB 1IN6A 2CBZA 5JS7A 2WMNB 4PXAA 2QL6A 3E2IA 2IYSA 3I8XA 3TSOA 4KFTA 4DSOA 3QPVA 1I2MA 4C0QC 1YR7A 1BH2A 1N6KA 1J70A 4JLPA 4QGFA 2OG2A 3PCRB 5DI3B 3K0CA 2PZEA 4Q48A 1GSIA 5J4HA 5EE1A 4RKFA 1ZNYA 1QRAA 3TAHA 4P4SB 2YINC 3V9PA 1IAQA 2AD5A 3OE7D 1NN3A 2IEZA 4ZKEA 1XTSA 4IOMA 4DSTA 1HEIA 3WNBA 1VYVA 4Q7KA 1MT0A 5IT5A 1S9DA 4FXPA 4MKIA 1IN4A 621PA 3O8RA 2VP2A 2ZRNA 3BRWD 2VPPA 3RRYA 1UJ2A 3X1ZA 3THXB 3BXZA 1OH7A 1W44A 1JR3D 2CMKA 2RGNC 4FCTA 2QORA 3NXSA 1GNQA 2AWOA 5KHOC 4BLTA 4B74A 2BMEA 3B2EA 5HR5A 4FMBB 3GLIB 4XH9B 2ZRKA 1FZQA 1AKEA 2BHRA 1F5NA 1HQCA 2ZE8A 1Z6XA 4PZZA 2RMKA 2CHVA 2ZSBA 2R6AA 1KO8A 1SXJA 2JLSA 2W58A 1KI7A 2B21A 3NBYC 4Z8XA 1ODFA 3AVUA 5KU1A 1MKYA 1SVMA 4H9GA 2V6JA 2W6JA 3BB4A 4KBFA 5FPSA 1R0ZA 1NP6A 3QXSA 5B64A 2QTVB 3ADDA 4AKEA 3I92A 3U4QB 4IFBA 1OIXA 3HJNA 1KTVA 2CL6X 2F3TA 2DFNA 1JPJA 4AIIA 1Z6TA 2VO1A 3I32A 1HT2E 3GEEA 2ZVPX 1KSFX 4Z1MD 1KO1A 3M0EA 3TR0A 4RKEA 3EWSA 1MR3F 2IWRA 3VAAA 3TBKA 1OF1A 4W5WA 5KDOA 1YZQA 2XEXA 2ZUBA 3MRSA 3GLGE 1SKYE 3V4FA 3MAAC 2GVDC 1VCNA 1XBTA 2BOVA 2JA1A 2ONJA 3VHLB 3KQUA 1FW6A 2OHFA 5GJCA 2OO7A 1W36C 5F3WB 3BK7A 2J0VA 4HSEA 3HR7A 4OBEA 3OEEA 3LD9A 4US2R 4JMPA 3O8BA 3ZVMA 5LBIA 2BM0A 4Q4LA 2QENA 4EPYA 1OXTA 2CE2X 1E9RA 1D6JA 2A5FA 1XXHB 2Z0MA 4IDNA 1G3UA 4DLVA 2C5LA 2CCJA 2R6GA 4KU4A 3CWQA 3SHFA 3IQXA 2AL7A 2UVQA 1IXZA 4UKDA 5AJVB 2IK8A 4BRUA 3KQKA 1YRAA 3LLUA 3R7WA 3LX5A 4BFVA 3I73A 5J47A 1OXSC 4OI2A 3DHWC 2P67A 1SVIA 2G0NA 1Z6AA 3EZ6A 3P20A 1YR9A 1CR0A 4NP6A 4A15A 2YZ2A 5EJEA 3C7KA 5LB2A 4FMCF 1WF3A 2F3RA 1I4LD 4NDZA 1N6IA 1OH5A 2ATVA 4XVQA 3A1SA 5JRZA 4BFTA 4ZPXA 1HUQA 1XD8A 3FHCB 2DB3A 3PUXA 2Q9AA 3QEOA 3QNUA 4NCNA 1XCMA 1SVSA 2P2LA 3OEHD 3KJGA 2J7PD 4O2RA 2FA9A 3QKSB 4LPSA 4LHWA 3LBHA 5TB5A 5AUOB 1JAIA 1HYQA 1KI1A 1VG0B 1XPUA 2E9SA 3ND9A 4FWIB 3L8ZA 3P27A 3O47A 1IXRC 5L3RA 2BV3A 3D6TB 3KJEA 2WKRA 2BCGY 3VR6A 1P2VA 1R2QA 1FP6A 4FMDB 4TQAA 3A8TA 4KHZA 4D4LA 2ZRHA 1OB2A 4EAQA 1ZNZA 1U8ZA 4JLOA 2P0EA 2FNAA 5EE0A 5FTJA 4PTLA 4DC9A 2VRWA 1GL9B 5C4MA 3AQ4A 1E9CA 1VG1A 5FBLB 5CIWA 4MRPA 3WBKA 3RC3A 1TEXA 4KI0A 2IYYA 1XTKA 3ZVLA 4MYUA 3GEIA 4JZKA 4DZZA 1VTKA 4Q01A 1EFTA 2ZVQX 4Q1DA 2H1LA 3F8TA 2OFXA 5KSPA 3SOPA 3OIVA 3NKVA 4NMMA 1NVVQ 4EPXA 2R9VA 1OYWA 2BC9A 4KAXA 4D26A 2FFQA 2F1RA 1NJFA 2Q0HA 2OILA 5KDLA 4Q7JB 2IX3A 1IJFA 4PSVA 5AUQA 4EPWA 3AF1A 1RKBA 4U5XA 3IIKA 1IM2A 4BPBA 3U7GA 4LSGA 2P65A 1Z83A 4JSTA 3CR8A 3IPYA 2RGBA 2UKDA 3P4YA 1EXMA 4Q4AB 3G0HA 3BB3A 1I4TD 4P4UA 2BIFA 3LXRA 2X2FA 4LV6A 4BGDA 4Q9LA 1IHUA 1WQ1R 4ABYA 5FTNA 1BMFA 1YQTA 1JECA 4LBZA 5FOTA 4PC6A 3AP2A 4DT1A 1KY2A 3SDZA 4A9AA 2WPDD 1E9DA 3LO5A 4LPKA 3A6PC 3BIFA 2QM7A 2QQEA 1XJCA 4CEHA 1UDWA 3LRPA 2Z4RA 4ZDJA 1Q1BA 4AY2A 3AVTA 1GZSA 3MCAA 5HZHA 2NO6A 2XNSA 1VYTA 4URWR 2DFLA 4D6PA 2ORWA 4JLDA 4UNNA 2IUSA 2ZPTX 5GVSA 4TMZA 1P3JA 3AM1A 3MFYA 1OV4A 3B9PA 1W5TA 2WWFA 1E79D 2XSZD 3WYAA 5BXQC 3FHTA 1NRJB 2Q3HA 3UK6A 3EIHA 4UNPA 5GADl 1J8YF 3W9YA 2QAGB 1O3YA 2QSZA 4EUNA 4HAVA 5EXSA 2ZUDA 2VHJA 4DLYA 1N6OA 1Z3IX 4B33A 2OCYC 3ZVRA 5D3MB 2NO0A 2IS2A 2JLZA 5DIFA 3W5IA 2H17A 4JL5A 3C14C 2ZJOA 3PG5A 5JSZA 3K70D 1U0HC 2QPOA 4WZAE 4B44A 2ZRJA 1WMSA 1L4YA 2ZSEA 3FYHA 4MUBA 1OSNA 4PQYA 3FKSD 4IFEA 4NH0A 2CCKA 5DSZA 2GZAA 3NEYA 1J99A 4M1WA 1XMIA 1S96A 4DSNA 5DE3A 2WAYA 2ERXA 2ZE6A 2PJRA 4M0LA 4JLKA 3AGPA 4M1SA 5FOXA 1NL3A 1DELA 2QPAA 1U81A 1KDOA 3L0PA 2XOKD 3EA5A 4Q47A 3CRW1 1CXZA 5C4GB 1QVAA 2ZSDA 2FH5B 3MUFA 1IQPA 2HYIC 3IO3A 4XD7A 5TARA 1SULA 1II9A 3AKCA 3UPUA 4GBMA 1Q1ZA 4B3XA 4HB2A 3B1WA 3K0CC 1KZ7B 3K9GA 3L0SA 3NIBA 4PC2A 4KSCA 4BEBA 2ZRIA 3SJCA 3N70A 3SJZA 1GWNA 1NLZA 1W0JA 4HZIA 4R2HA 5FI0B 5G41A 3TVTA 3ZH9B 4PHFA 3UIEA 2ZI7A 2BBWA 1KKMA 1NN1A 3NHBA 4II7A 1PLJA 3T34A 4RZ2A 4EJSA 1KI9A 1TQ6A 2EYQA 1EFUA 1SVLA 3DMNA 2Z5FA 4M2LA 3TW4A 4PHHA 2NGRA 2R2AA 4M1KA 4Q4JA 2J87A 1PLKA 1Z6YA 2OUKA 4XVUA 2QPTA 5KDDA 3CZQA 1NBMA 3SEAA 2WSMA 3AVQA 1QZXA 1YHNA 4CF7A 2H7VA 4L4UA 3IGFA 2SHKA 1E2NA 2CLSA 2ERYA 2CCGA 4JLBA 4B3FX 5FL7A 3EZ2A 3QOFA 1LFDB 5L3SB 3AV0B 2L0XA 1JALA 1G7SA 6Q21A 4JVSB 4Q19A 3BS4A 1PUJA 3ZD7A 3GFPA 1SXJC 1OKKD 2HLDA 1G3MA 2ONKA 4B32A 4DIDA 1D2EA 1XEXB 1KI6A 3VKGA 1YU9A 1W47A 1QG2A 2G9NA 4F92B 5G3YA 1J7KA 3T5DA 1DAEA 5E7JA 2PZGA 5TVKA 3ZQ6A 1KO4A 1PJRA 2VH5R 2CXXA 1NVVR 2RAPA 2ZAMA 3B6EA 1E9BA 3K09A 3I4LA 4OK5A 2IA5A 1ANKA 1P4SA 2CEAA 3R8FA 3SYNA 2G83A 3K70B 2HF9A 1RRPA 3C4JA 4I81A 5M04A 1X1RA 3AF3A 1DTSA 3AP3A 1S3SA 4GRAA 1II8A 4NYMR 1NIPA 1ZRHA 2HLDD 3KUDA 1US8B 5A5GA 3J81k 2IYTA 5LD2B 4HLUC 5JI3E 1DPFA 2QT1A 1S9HA 4MRSA 3TLXA 4IVPA 1GKUB 4BFUA 2CL7X 5EZ5A 3A1VA 4FD2A 2V6IA 2OAP1 2REOA 3WP0A 4TT3A 2FPKA 3KKOA 2W6ID 1E4YA 3A37A 1Z0JA 5EE5B 1AQYA 2JJ2A 4JBXA 5DNYB 4I1VA 1DAIA 1JJVA 1V43A 3W8RA 4C2UA 1ZIOA 1K5GA 3CZPA 2JLVA 3TIFA 5HPYB 1G6OA 2ZJAA 2FPLA 4EPRA 1G19A 1R0XA 1D5CA 2ZE7A 3ADCA 4LHYA 4A2QA 2EVWX 2GBLC 4ASUD 5J4VA 3RANA 1Q57A 3O8DA 3CF2A 4OHZA 2A5JA 4GP6A 3QF4B 4TT3D 3PUWA 1XMSA 4M1MA 5CLQA 3X1YA 4PZLA 1KK3A 2AN9A 5EP1A 3U61B 1Z29A 3MWKA 4RFSB 5IK2A 3GLFA 1DOAA 1M1YE 2F9MA 5SZKB 3EASA 3KUCA 2VA8A 2JLQA 4HB0A 1IJEA 2ZREA 4JBWA 3FPAA 5EXPA 4N0DA 2BMDA 4CGZA 2VHQA 4WA7A 4CIDA 4A36A 2GHIA 3REGA 3HU3A 2V7QD 2QEQA 3CIOA 1XD2A 5TXGA 8OHMA 3CF6R 2WJJA 4LJ7A 4LY6A 5TMPA 1A1VA 4TTPA 4O2LA 3LQRA 1DG3A 5FBVB 4DUGD 4BFYA 4QM7A 4BLSA 1F2UA 2FE4A 2OEPA 4LHZA 4BZQA 1Q1EA 1Z0FA 3SS8A 3OESA 4Q4JB 3QQ5A 1DG1G 1FL9A 4E09A 2G77B 1XU4A 1JAHA 3FKQA 1KNXA 3LDAA 1M8PA 3MJRA 4WBSA 4URVR 1XTJA 1UBCA 1T8UA 3PIRA 2ZUCA 2XTNA 3WXMA 4V0ME 3ZLJA 4X8MA 4NBSA 1G8GA 2QQ0A 5JCPA 4C9BA 4NYIR 3GD7A 2O0KA 1UEJA 1KDTA 1KY3A 4GMDA 2FSFA 2ZE5A 1N6LA 4ILEA 2O8CA 4LYAA 5JJKA 1NLYA 4LYHA 3KDSE 3IPXA 2ZU6A 1WE2A 3IIJA 5BYJA 4Q4HA 1E2JA 4G5OA 1NIJA 5DN6D 2F43A 1ZD8A 1LF5A 2JJ1D 4FMDF 2G3YA 1ZCAA 4R98A 4IDHA 1QG4A 4GT1A 4GNKA 1T0JB 1P2TA 4M9ZA 2VSXA 3L0IB 2IC5A 3LV8A 5JRJA 1T5IA 5HKKA 4MKFA 2RGCA 1SZPA 3FMIA 3KXLA 3G82C 2HUPA 1GRNA 3MWJA 1ZINA 4DLWA 4EIWA 4V0OA 2ZR9A 1D2NA 3C16C 3KTAB 4GI7A 1TADA 1P6XA 1GG2A 1OHHA 3QKTA 4RD6A 3GQBA 3QKRB 1XX6A 3AKEA 3KKQA 5BYKA 2ECKA 3UWOA 2FN4A 4U00A 1D9ZA 3BFKA 2YOFA 3A1UA 2CNWA 1COWA 3AVWA 1NJGA 1QHSA 5SZJA 4D2IA 3IBGA 2G0TA 2YHSA 4TYNA 2FEOA 5DI9A 3X2SA 2O8BB 2GNOA 1VECA 1OFUX 2WBLC 4KVGA 4YONB 1E2HA 2GJAA 2QNRA 2YJTD 3DM9B 2WWHA 3I72A 3K1JA 3MD0A 4QGHA 5JI2E 1G3QA 5L3QA 2AFIE 1Z06A 3KQNA 1Q21A 1YR6A 2J5XA 2NO9A 2R6CA 2ZSAA 4M21A 3CONA 1FPMA 2PMDA 5KSZA 1N5LA 3G5UA 4MA4A 4NCKA 1DAFA 1ZMXA 3C15C 4A6PA 4TSFD 1U9IA 2RCNA 1IN8A 2V55B 2WICA 5JS8A 4HZUA 4XSGA 1ZJ6A 1XJQA 2ZS9A 1KOFA 3PFIA 4TL7A 1OIWA 1ZM4A 2HCBA 4HAZA 5FOSA 2IW3A 1T4GA 4M1OA 3U3RA 1Z5ZA 1UAAA 4A8JB 1F60A 4G5QA 4B6EA 4MGIR 2A7QA 4HDQB 1RRFA 4ZDIA 1XD2B 2H92A 3U44B 2OFWA 2XJ4A 3H0KA 2FFHA 2QU8A 3R20A 1EFRD 2C9YA 1TX4B 3IKJA 3Q9LA 5EXXA 4LJ4A 4RD2A 2FEMA 3L82B 3U6KA 3PENA 4IJMA 1L2TA 1NN5A 2QTHA 2XXAA 1CJKC 1QHNA 4DSUA 2WWIA 3PV0A 1PV4A 2GILA 2KBFA 5KNDA 1YZUA 4D0LB 4D4JA 3QVVA 3CR7A 4QJ3A 2VIIA 2VF8A 3KJIA 4Q1BA 2LCFA 4BUJA 1MV5A 2H8KA 4ZKDA 2GAAA 4A4DA 3K9NA 2HV8A 4MQBA 4B75A 2KBEA 3FGNA 3UKDA 1AGRA 2OLKA 5HCIA 2YKGA 4C0AC 4JVMA 1EX6A 2NO1A 4A0GA 2HDNB 3B60A 4TLCA 2WKPA 1ESNA 4Q18A 4IDPA 4PC3A 3WRYC 3KKNA 3ZIAA 4URUR 5CITA 1ZD9A 1H8HA 3H2YA 1QF9A 1VPLA 2WWXA 4LV5B 4QC2A 4DEYA 5DYGA 2VP4A 4LHXA 3GLIE 1KO5A 4US0R 2ZJZA 5FUXA 4EJSC 4HUTA 1X8JA 3KJHA 3MWYW 3HPRA 1D2MA 4ON9A 2A2ZA 1FMJA 2IHYA 1CF4A 3QXHA 1HV8A 2PJZA 1N0WA 2RGGA 1N3BA 4EQ6B 3NWJA 1RW4A 2ZRMA 4I99A 4URZR 1E9EA 1LS1A 1OW3B 5J4KA 5LDDC 121PA 1Z47A 3F3YA 1I4DD 4Q5IA 2HT1A 2YWFA 3KFXA 4XWOA 2CHQA 4ESVA 4RY2A 2XGJA 4CDGA 3TW8B 2IF2A 1AZTA 4TMTA 1ZM7A 3BE4A 2ZEJA 2GCNA 3H84A 1RYHA 4PSKA 2DBYA 1EWQA 1PLLA 3W3ZB 1HE1C 1Y3AA 2W0MA 1DS6A 3L2OB 4YLGA 2XTMA 2FU5C 3VQTA 1ZM3A 3Q5DA 3GJ0A 4A2PA 4QRHA 2ZETA 4G5GA 3Q7PA 3RS5A 3K09C 2AK2A 1T8TA 3LY5A 1AK2A 2VP9A 2ODBA 3LVRE 2R62A 3ADBA 2BBOA 4Z51A 5CB6A 3B1YA 4LWZA 1ETUA 4PC1A 4PAMA 1MO4A 4AG5A 4RD0A 2EW1A 3GMTA 3PQCA 3VNVA 5FPTA 5HE8A 3VTKA 4HZUB 3AB3A 2BM1A 1HQYE 1CJVC 2V1XA 3CNOA 4KFUA 2J45A 1G9XA 1XXHE 2I1QA 1CRPA 1MH1A 5FI1B 4DKXA 3GLGA 3PITA 4D25A 2Z6VA 3THWB 5KYKA 1N5JA 2J3EA 3T1VA 4B71A 4DLRA 3M6AA 4P3YA 2FV8A 1I2DA 3CUEF 5K8LA 5H70A 2Q3FA 5TDHA 3SHWA 2VQSA 3VR1A 3IILA 1KNQA 2IYRA 4V0LA 1DO2A 2E87A 4XTCS 1TQDA 5CJPA 1R6BX 2FPMA 1CJTC 3KXIA 1E1RA 2XXAB 1G64A 2FJUA 4M1TA 5JEDA 3ASYA 1GRRA 1VIAA 5EQTA 1JR3E 1SHZA 1S0UA 4D81A 5H68A 4C2TA 1S1MA 2PLFA 3AVPA 4YMTA 5JWRA 4EFMA 1UEIA 1SXJD 1HURA 4DDVA 4BEJA 4ARZA 1ZC4A 3RHFA 2W6JD 3W6OA 2PX0A 4DCTA 1Z63A 4ACAA 2C04A 4EFNA 1Q22A 3IQWA 4BRWA 4JLVA 2C98A 3MSXA 2C99A 4MKHA 2QTFA 4E22A 2QN6A 2O8DB 1YZTA 4A8JC 1ZU4A 4R9UC 4EKDA 1VYUA 3AVXA 3SFVA 1MO5A 4D4KA 4HYYA 2MSEB 2Q9BA 3NBZC 5JWHA 1P9WA 2MMCA 2O8FA 3GLHA 3KB2A 4XJXA 1SVOA 4LJYA 1IY1A 2IYUA 1L4UA 2QI9C 1E2IA 3GJ7A 4CW7A 2C8VA 2QE7A 2HEIA 2FFBA 4B6FA 3PUVA 3UANA 1HE8B 1OXXK 2FZLA 3N2IA 3IUYA 1YR8A 1KYIA 4PHGA 2Z83A 2F7SA 1S4QA 4ZCMA 1EK0A 1R0WA 1KSHA 1E9SA 3OEED 4PAQA 3TH5A 3VU9A 1FQJA 2GWHA 5FFMA 3DPUA 1Z2AA 1QBKC 1Q1QA 4TQ9A 4TYWA 1NG9A 3AVYA 2QE7D 1E0JA 1DADA 2AX4A 5HZKA 4MDEA 5LB4A 3ZVNA 4S35A 2C96A 1AGPA 4NL4H 4B47A 4XD7D 4Q03A 1BOFA 4TQUS 5DISB 5JBQA 4QFMA 1X8KA 1RVDA 1AA9A 2QUZA 2BVNA 3AVVA 3WRXC 4C7OA 1EFHA 2IYZA 4POAA 2FSGA 2VHCA 4EPVA 4LRWA 2VL7A 2YC2C 2OBMA 4OQFA 3DMDA 3QY0A 3CLVA 2YWHA 2HJGA 3VFDA 2FF7A 2ZS8A 2GF0A 4R7ZA 1ESMA 2NTYC 4KSBA 2W2XA 1W46A 3AUYA 1NLFA 2GF9A 3IO5A 4C0SA 4N0EA 1CU1A 5P21A 3CW2A 2XZLA 2CL0X 3WP1B 3HR8A 2ZR7A 3Q3JB 2BJWA 4A2WA 2JIZA 3B1XA 1KMHA 1SXJB 3E1SA 3KL4A 2CE7A 1YVDA 3FTQA 4NTZA 4FCWA 4TMVA 4KVAA 3NDBB 4G5SA 2ZRCA 4IXNA 3VX4A 5AR1A 1XEWY 1IY2A 4OI4A 4LC0A 3KKMA 3OAAA 2PLRA 1E99A 1YJ5A 1KJYA 2JDIA 1OJLA 1VIYA 2JIZD 4Q21A 1F2TA 1N6PA 1P9NA 3MMPA 2NO7A 2FSHA 4P0TA 2REBA 3A1TA 3W6PA 1U9IC 3QJYA 4LBYA 3QG5A 5B2ZA 2IYVA 3KQLA 2GJ8A 3RRMA 2GXQA 4WIAA 2ZJ5A 3NTUA 2QGNA 3BFXA 1QHXA 1Z22A 3B78A 3EXAA 4XOIA 3K53A 4JYCA 3THYA 2OV2A 3CB4A 2QSYA 3ZDQA 1KI2A 1OT3A 3H1TA 1WRBA 4Q1FA 2WKQA 2J41A 2DWQA 1MO3A 3GLHB 3TVDA 3ETLA 4A0HA 3AF2A 3EIEA 4UNSA 2Q6TA 3LVQE 2EWVA 3RWMB 2NPIA 4PPQA 3C5HA 1G4AE 4A0RA 2JLWA 2OBLA 4P4TA 4QBFA 4PC7A 1BMFD 2RGXA 3LFUA 1R5NA 4KXFB 2IXEA 3R7WB 3W5JA 3WHKA 2BEJA 4MITA 1Z0IA 1SVKA 1NSTA 2ZIAA 3UG6A 1HT1E 2ZRFA 4QGGA 3DOEA 4QBIA 5BW8A 5LPNA 4KYUA 4D0GA 3K0EA 5EE9A 3I3SR 5DGXA 2P3SA 2KJQA 3KXKA 1E2LA 4MH0R 1G7TA 4URYR 3WBJA 1UPTA 5EP4A 4K8OA 3RNLA 2JGNA 1A2BA 3RS7A 3P32A 5AWFC 3ECCA 1OB5A 2ZJBA 1G17A 4DCVA 2PMKA 2C78A 1GNRA 2YVUA 4MRRA 4OQNA 1XZPA 2RGEA 3BD9A 4KCGA 3AH8A 4AKHA 5FTKA 1AN0A 4J0QA 4QNRA 3T1QA 2V4ZA 1VHTA 4HB4A 1KO7A 3TGPA 2QGZA 2FGJA 3RS0A 4C0BA 2AXPA 3EZ7A 2IYXA 4H1UA 1E98A 5ELXA 2ZRLA 4GSYA 3TNFA 3U6BA 4LX0A 1HA3A 3UMSA 4O25A 5FTLA 5A4JA 2KE5A 1E1QA 2PCJA 2QMHA 4N3NA 5AUNB 2ZRGA 4NU0A 2GETA 5KNCA 1N6NA 4WOPA 3BBPA 5AJZA 2WJHA 2JLUA 4XVRA 3B7GA 1NN0A 4AD8A 2NZ8A 1ZUNB 4LDJA 2QBYA 2HCJB 3ZGXA 3EX7C 1KMHB 4IKEA 1UFQA 4M9QA 1R0YA 3E5HA 2WSSA 1XB2A 4JLMA 4NONA 1GL7A 1TU4A 2XZOA 4UXJA 4B34A 1NKTA 4XSHA 1JXMA 3X1DA 1RPZA 5FUVA 2ODEA 4CVNA 2Z4SA 1JPNA 4JLNA 3SI7A 3TJZA 1KSGA 3SN6A 1M7HA 3WMGA 2B8TA 2VP0A 1ONBA 1NVXQ 4L15A 4UQOA 1KJZA 1PUIA 2HXYA 2Q3MA 1GAJA 4IVRA 4WXRA 2LKCA 2D2FA 4HLCA 1RZ3A 1TPZA 5JWOA 1W0KA 3HYRA 4IXMA 4TLEA 4IHQA 4EDHA 4G5RA 1LVGA 1W0JD 4Q7MB 4UNQA 1TNDA 5FOVA 3BGWA 1SQ5A 1W48A 3UATA 4DT1B 2P6UA 3EPLA 2A5DA 3T1TA 5DHAA 3I1FA 3QEJA 4CEHB 2J0UA 1NG1A 5HE9A 1T3HA 3LX8A 2X8AA 4B48A 4HATA 1P62B 1C4OA 1GP2A 2ZI4A 4QGAA 4ZIRA 2QA5A 1TF7A 1G3RA 1NBMD 2WJYA 3CKLA 4KBGA 2GCPA 4TMWA 2N46A 2GK7A 4TMKA 5C2JB 3C5CA 3RRZA 4B73A 3KX2A 5FL7D 1J90A 1KSJA 5JECA 4ERNA 3K0FA 3NDPA 1QDEA 4IRUB 4F38A 3OFNA 3UWKA 2G88A 3FDIA 3EW9A 4KYIB 3TK1A 2XITA 1B23P 2EFGA 1S8FA 3HYTA 1WCV1 4LK2A 5FBRB 2V54A 3U7EB 2DR3A 3SZRA 1CS4C 2PT7A 4PPFA 4O0MA 2KSQA 1XD9A 1J8MF 3WYGA 1TL7C 1P5ZB 2PEYA 3DZDA 3VR3A 4UXIA 2QMEA 1E2QA 2VP6A 5JSZB 2JCSA 3HPQA 3JZMA 2C03A 2ZRPA 2GRJA 4X8LA 1XEFA 2JAQA 2IYQA 1KGDA 2QP3A 3U7FB 5K8TA 3NVAA 5AJWA 3PJRA 3CRVA 4Y0VA 5G3ZA 4F91B 2MSDB 2XNDA 4PFSA 3IHWA 4TL9A 2DPXA 1AZSC 2GA8A 2BKEA 3HU2A 1QHHA 2WJGA 1CR1A 2P5SA 4D0NA 2O0JA 2OFOA 2FZ4A 4CEIA 3CRRA 3OIUA 5CIQA 4WAUA 4Q7LA 3GP8A 2IS1A 1X86B 2ZRBA 4DLXA 3TUZC 2R65A 1CULC 1Q44A 3O8CA 3QF7A 4ZDKA 5CDFA 1BO6A 1Z0KA 2AWNA 3LW8A 4HUQA 2GAOA 3HU1A 2JJ2D 3GJ6A 3PVSA 2WMOB 4Q9HA 4W5JA 4PX9A 4OHYA 1BIFA 3V00A 4ZDWA 2ODWA 5F2EA 4AC9A 1KDPA 1UBGA 2Q21A 3SBEA 3RABA 2GTPA 4CRWB 1RC8A 4OKSA 2QMOA 821PA 2IS4A 4DB4A 3BWDD 1FUKA 3CO5A 4BASA 1XJ0A 3K9HA 4QHTA 1K8RA 4EJSB 2B92A 3SU8A 3NHAA 4AYTA 5JEEA 1KDRA 2QP9X 3REFA 5IK2D 2D2EA 3K0AA 2OCPA 1U0LA 1M7BA 1YKSA 1G8HA 3CH5A 1EWRA 1CJUC 3ASZA 4JIMA 5FBWB 5SZHB 3GJ5A 2ZRDA 4I1SA 4Q9JA 1WBBA 5GVRA 3EC1A 1JBKA 2OLJA 4Q66C 5EP3A 5BQ5A 3F5FA 3GFOA 4MGKR 4WXPA 1FTNA 3VR2A 1Z0AA 2NIPA 4IW3B 3DO6A 4B3CA 1NSFA 1R10A 3GCGA 4B35A 1HY3A 3ZS8A 2ZJ8A 1F3OA 3LW7A 1E6CA 3QBVA 4GL2A 3U5ZB 3PEWA 4Q00A 4QL3A 1OIVA 4DHEA 2G1KA 1KI6B 3GPLA 3EC2A 4KO8A 1MABA 1R7RA 1KMQA 2FGKA 3IEUA 4OQMA 1R5OA 2P5TB 2JLYA 3I5XA 4GZMA 4F7WA 1GUAA 1W4BA 2PCLA 1Y63A 1P2UA 4IEEA 4JL6A 1RJ9A 3KZ1E 1JEEA 2GEUA 3ZZTA 3VKHA 1G5TA 3Q7QA 1II8B 2WOOA 4CYMA 1FX0A 2K5UA 4LJ6A 1JJ7A 2O52A 2WWWA 3NBFA 3R9IA 1DAHA 1FFHA 1H8EA 1VG8A 3FMPB 5FOUA 5B58C 3LBNA 2RHDA 1LW7A 3OHMA 4JKYA 2IYLD 3QPUA 4B2PA 3SYKA 2QMUA 1YZNA 5HCNA 4BFWA 3WHLA 1XTIA 1VHLA 2ZYUX 5GJWC 2IL1A 3FMOB 4GPTA 4IOJA 4V03A 1NNEA 3NH9A 4C30A 4C3ZA 3KQHA 3SQWA 4TZ6A 4PHTA 2GCOA 4ESHA 3H4MA 1UBEA 2XJ9A 4M8NE 3WNCA 2BBTA 421PA 5HKKD 1W4RA 3RAPR 4F4JA 1W4CA 1YZKA 4NCIA 3SR0A 1XMJA 1SHKA 2XX3A 2ORVA 3BH7A 2O8EA 1QVRA 1ZNXA 4Q02A 3FVQA 5KSOA 3MGCA 4NCJA 2A9KA 4KODA 4PAOA 3DKVA 4U02A 2D7DA 3QXJA 2A3RA 1OHHD 3CRQA 3T1OA 3CH4B 4AK9A 1ZD1A 2ZS7A 2QRNA 1LTQA 3D31A 1G8PA 2CNWD 3DM5A 3AKYA 1COWD 3FWYA 5BWMA 5KPDA 3GLFB 4BLPA 2RGDA 4GP7A 4L8GA 3I5YA 4XWKA 3CPEA 4LOAA 3AVOA 2ZI9A 3I61A 1A7JA 4DLTA 4HAWA 2MMGA 3QUSA 1AS2A 3MLEA 1XCGB 2DHRA 2ATXA 1KK1A 2WOJA 4RZXA 3AEZA 1L7VC 5CM8B 3THXA 4AKGA 1A5TA 1F2UB 1DEKA 4BQSA 1N0UA 2C95A 1XCPA 1UKEA 4EPTA 2R44A 4AG6A 1GIAA 2QROA 1UKZA 2BEKA 4TWZA 2FMXA 3T35A 1E2KA 2QAJA 4KJZA 3VX3A 3B8HA 1XZQA 1A82A 4OK6A 4QM6A 1MRNA 4I1UA 1TF2A 1QHGA 2VYFA 2EWWA 1CTQA 4E5UA 3EPJA 1T6NA 2VHTA 5AK0A 4OK3A 2IUTA 2B8WA 3A4NA 2V9PA 1U94A 3L43A 4TLDA 5B30A 2O8CB 4L16A 2OXCA 2OESA 4P31A 2VP5A 1RE0A 2EYUA 4OL0A 2ZAOA 4IOKA 4QBHA 4Q4HB 4AYXA 4DRZA 4LHVA 2KI5A 2F43B 4IOLA 1XRJA 1ZC3A 4JJKA 1S2MA 2NOAA 4MKGA 4TYQA 3X1XA 4A0FA 4E07A 3U60B 5FPHA 3KFVA 5G53C 1A4RA 1Z2CA 3EZ9A 4ACBA 1WBDA 3LA6A 4GOXA 1ZUHA 2WWGA 1EGAA 1TAGA 1A2KC 5GJVC 1V5WA 4DXAA 1FNMA 2YOGA 1G5PA 3TKLA 5DO9A 4DIEA 1OFTA 4NE2A 3ZIAD 4NZYA 1XP8A 3N2EA 1G4UR 1H8HD 2XTZA 5JCZA 1CP2A 2ASEA 4Z8YA 4A82A 2RHMA 1ZM2A 1SVWA 4HEJA 3MG9A 1NKSA 5E3HA 1XXHA 2WIBA 1KI4A 5F9FA 2A5YB 1IBRA 1EFCA 3P4XA 4WW0A 1DO0A 2CHGA 5KNBA 4YMSA 2A5GA 3OIWA 3OE7A 5JJLA 4JVNA 1CIPA 1F6BA 1Q20A 1E2MA 5H1YA 3UMFA 4C4PA 3JVVA 4YDHB 4B3BA 4KV9A 5L3QB 1JQJC 3AF4A 3BFVA 4QNMA 1W1WA 2N1BA 1GKIA 2LKDA 2KWIA 2UZIR 3BC1A 3Q72A 2GJ9A 1P2SA 1L8QA 1ZM9A 4FCVA 4K46A 3OZXA 3RS2A 5FL3A 3RYTC 3SJAA 3U3JA 1JR3A 3B1ZA 4XIGS 1JNYA 4ZI3A 3P26A 2JLXA 4RZ3A 3HWSA 1E0SA 2RKOA 4FN5A 3RS4A 4DBLC 3BOSA 1U99A 1GITA 3SBDA 3QKSA 2DYKA 1VG9B 4ZV4A 1XPRA 4US1R 3B1VA 4P32A 5G40A 2WZQA 3C8UA 4BLOA 1IN7A 4UNRA 5AUPB 2BWJA 4GMXA 3AF0A 2BMFA 3L0OA 2KB0A 3B13B 2ZU0C 3K8YA 1JI0A 4P33A 5KSYA 5JHHB 2D3WA 2CLCX 3HP1A 3W6NA 1W5SA 2ZJYA 1KJWA 3W90A 4DEXA 4DDTA 1IOZA 1WA5A 2RH5A 1M6NA 4ZCIA 4YXWA 1BS1A 3EWAA 4M4SA 4YC7A 5C46F 2RGAA 4DCSA 3ZS9A 2JJ8A 4M1YA 3TQCA 1GDDA 2W00A 3TSZA 4Z1MA 2ANCA 3V4RA 1D9XA 5CK4A 5BN4A 3T12A 3ND8A 1ZBDA 2EU8A 4UXHA 4C0KA 3QIAA 4D4MA 2DFKB 2QM8A 3CM0A 4MYCA 3DEFA 1UADA 2ZI3A 1OXUA 3F0TA 1KK2A 1G7RA 4GOKA 1OLOA 3L8YA 2FDCA 5BN3A 4HDOB 4YXWD 1GILA 3QXCA 2OXRA 1YZLA 2AKAB 4AYWA 3N5CA 1DAKA 4W5HA
chains in the Genus database with same CATH superfamily
2GK6A 5A03A 3TQHA 1H2RS 1GNPA 5TE9A 2PTHA 4L07A 3DLAA 1VB3A 1ISFA 1OV6A 2WJPA 2XMGA 2OMEA 3LH5A 2V1UA 2FMHA 4DCUA 2YJZA 2J9RA 3E53A 3GEHA 3MBKA 3VNUA 2NV2B 4Y98A 4DM3A 1A5SB 4B45A 3HN6A 2C7GA 1TZMA 4D8TA 4L5IA 2OP1A 1JH9A 2YMMA 1H42A 2QRZA 5EXDA 4JD5A 3JVDA 2HSJA 1HM5A 2FPIB 3A28A 4YXFA 4QOIA 2J67A 5KS2A 2E55A 3HWWA 3ROXA 5BN5A 5K6RA 1MEOA 2IUUA 5IAGA 1QO0D 1XNJA 3FSGA 4RADA 4HAIA 2NPFA 2YRFA 4K9QA 4TPKA 4F2GA 2E6KA 1EUQA 4MSUA 1I3MA 4J16A 3ZD9A 3AP1A 4RF2A 1KHHA 5ELLA 1CUGA 4Q15A 5JXWA 4MR8B 3ZY5A 1GUBA 4JS0A 4TXJA 4YJ2A 2O2EA 1W2GA 1ZONA 4X6XA 2QPLA 3QEMB 4DXHA 5C3MA 5JHGB 1N77A 4LZLA 3DTNA 3RODA 1MD9A 3PJFA 3FDZB 4H3HB 1RQGA 1CDDA 4LV8B 4A73A 1R27A 4HGQA 3GH3A 2GHTA 3S5UA 1NQTA 1V9CA 2J7PA 2C2HA 3BXFA 1P6UA 4Y6PA 3UG7A 2HZ7A 4LBVA 1D04A 2QX6A 5L3VA 5L8VA 4JL8A 4MR7A 3HU5A 5CUQA 2WC1A 3SNHA 2VBIA 1DQZA 4DCMA 1AF4A 2FUG1 1T3SA 4EYEA 5JAOA 3BVPA 3HXTA 3INRA 1VP9A 1S2NA 3L8MA 3O2QB 3VSAA 4HR7A 1K92A 4XKJA 3P94A 2QUAA 3VYSB 4RV5A 4FBLA 4GKVA 5D3MA 1E3MA 1PX0A 3ORQA 1GQRA 1E63A 1HFJA 3L06A 4NABA 4C7JA 3U3XA 1JN0A 4NDNE 4EMSA 1F7VA 1NM5C 4RY9A 1T35A 2CLDX 2GZ1A 2NXNA 3ZZUA 3KHUA 2YICA 1E1CB 2V5UA 5DOVA 4PCVA 2VDKB 3JYHA 4QU0A 1WB9A 1RMQA 4A6XA 4XFKA 5T3YA 4EL0A 5I7EA 2OZEA 2F3QA 2IYWA 3CKYA 3FSEA 3WK6A 2GEDA 5EEHA 4ZEMA 2ZYWX 2V0NA 3G9ZA 2BGGA 4BE7B 5ALJA 1KRHA 4HQNA 2BBSA 4ZK2A 2BDEA 1BD4A 1BXGA 1GYPA 2R1UA 2YY6A 1UC8A 4ZO9A 4DG8A 2UUCB 3I6BA 5EPOA 5EJ4A 3ER8A 1I30A 2TMKA 3F46A 1DC3A 1OFVA 1P73A 2BM9A 2GDJA 2X9QA 2X9NA 3C8MA 3GT0A 3LPNA 4Z2YA 5DYNA 3VGPA 3ZZ0A 2PMBA 1CZUA 2O59A 4RCZA 4GGPA 1HDEA 3GUYA 4IV8A 4OHUA 3EXEB 1E5DA 1GKYA 4MYTA 1JHMA 1QKIA 3KQYA 4ARBA 2ZANA 1VJ5A 4O3MA 3WL3A 4WZBE 3RJ9A 4ZTZB 2O2XA 5DW0A 1KHTA 1HZJA 2EKZA 2VH2A 2WJVA 3I8SA 1WXQA 3JTMA 2O1SA 3L49A 2PWAA 1O94C 3LHIA 3TCNA 3L8FA 1E5VA 3PUKA 1RYZA 2AC7A 2O3SA 5ALWA 2SBTA 1R64A 1X7WB 2OQIA 1VCOA 2AD1A 2YIDA 1OD6A 2CHEA 2RK6A 3JVUA 1ZN9A 4I5DA 5KOHA 1NVAA 5MGNA 3UCEA 3HDTA 2G0AA 3EZGA 1LZLA 2QV7A 3GHYA 1HRDA 3SD7A 4BLQA 2I62A 1GPWB 4FZRA 5EZ6B 2R8RA 1VSVA 2GAIA 4BQRA 3E9RA 3HB9A 1RLTA 2CMGA 3BT7A 1E5TA 4G8DA 3C3JA 3BKXA 4NYMQ 1ZH2A 1G291 3FNRA 1KAEA 1UANA 2RB5A 1PD1A 1GVHA 2DRIA 3B85A 5D5PA 4QVIA 5TV2A 1PZEA 2VHXA 5CAEB 2B2XA 5GV7A 1SBHA 1L5FA 2W83A 2Y67A 3CBQA 3GLVA 3MJHA 4MHSA 2WV7A 4WL0A 4MWSA 4BX0A 1QPGA 3V1LA 2HXSA 4BQEA 3PWZA 3FOFC 5HW0A 5IAEA 1BYIA 3M1IA 1SBZA 1W29A 3PTAA 1TM2A 2IXGA 3BJEA 1MJGA 2P2ZA 4BFXA 2FLVA 4A03A 1GNVA 5BN5B 3NM5A 1IATA 3AO0B 3WKBA 1SQGA 4Q12A 4XUDA 4HDKB 5IJAA 3Q88A 3JD1A 3N3AC 1WSBA 1A9TA 4WHMA 4JOQA 1ZI9A 2PHZA 3IQHX 3KKPA 4LK3A 5AKJA 4Z4IA 1ZH8A 4IMPA 3QLEA 1NI3A 4WNIA 5JYBA 4ZHQB 4BP8A 3T9AA 4JI4B 1D8TA 2Q6KA 1XTBA 3RRNA 4Z2AA 2ZLBA 4CQMD 3ESXA 2HTFA 1ZOIA 3IP3A 1FW8A 2OR3A 2R8YA 1P61B 4V02A 5GY7A 5BSMA 3SR4A 2OBYA 2X2EA 5DX1A 2YYZA 4QT0A 2QP4A 3RSSA 3TZBA 3VKVA 3WAKA 3CJTA 4CT4B 5GIOE 2B5OA 3LQQA 3PJEA 1X1SA 1WHTA 4Y9DA 2JRCA 3STTA 1H2YA 1BCSA 1M1UA 5CVVA 3WYFA 4LWQA 1T13A 5E3JA 3D6AA 2B8EA 3FB4A 2G71A 2WF6A 4ZT4A 4LDQA 4Q9IA 4TMXA 4MGZR 1JU9A 3FTEA 1Q0UA 2NZ2A 2G67A 1GTG1 1Z12A 2JASA 3FTNA 4OHKA 2E1RA 1BXZA 3I2IA 1OH8A 3QBTA 4C7OB 4YP6A 3DV9A 4TZ0A 2NG1A 1KK0A 4BO4A 3JVEA 3LCMA 3W4IA 3LDFA 1PFGA 3DOCA 1W2WB 3CEJA 1TLTA 3JW8A 4IUBS 1RABA 4FX5A 3R5HA 4PR0A 2G25A 1SXGA 4WKCA 5BOSA 3DONA 1KVSA 4GYYA 1KJJA 2Z9CA 3QYJA 1GV1A 4FW9A 3DFIA 1IWPB 3D0OA 5B57C 2ZT7A 1BXGB 3LGXA 3ID6C 1U1CA 1KJNA 1H94A 1YCDA 2D7CA 2FAXA 2VSOA 3MNFA 4RVFA 4RXTA 4WOKA 5T6MA 3COWA 4BE9A 2NP6A 1EGQA 2DKNA 4F8EA 1EX9A 1I1NA 4MVJE 1KKLA 5D7NA 4X5OA 1WPGA 3T7TA 3TTTA 1NQXA 5KYGA 1IBMB 1ECJA 4M0UA 3P9YA 1VYHA 3S40A 1E96A 1PWXA 4TZTA 3F6SA 4ZJYA 1I6WA 1V45E 2PT5A 2P6MA 4FNOA 3I2FA 2IXFA 4QPCA 3LLSA 2ZYRA 3SE7A 3PQDA 5ARCA 3OWXA 3LBIA 2NN3C 4KMOA 1J2JA 2C7QA 2JFPA 1NW7A 4RFSA 1IQ0A 2VTKA 4JBLA 4DJEC 2CNBA 1EESA 4MB0A 3D43A 1TI7A 1GGVA 5ICSA 1AHHA 3GRKA 3SLRA 1IBSA 4IV5A 4ANFA 5BR7A 2OT3B 3UFXA 4FYXA 2WG2A 2AK3A 3RT9A 2FW7A 2JJMA 2XNKA 1XFAA 1UM8A 3EW7A 3H6KA 3LUGA 4KIUA 4YPVA 3GLKA 1MF7A 3N53A 3R24A 4J9UE 4KQCA 1RWWA 4C4SA 4A10A 3PXBA 2XRMA 4HLDA 2IP1A 4QXAA 4AXXA 4WKPA 2OAGA 1FYVA 1H0RA 4XDGA 1G42A 1HYGA 2IEIA 2JFOA 3NJ4A 1C80A 1N1EA 3A9VA 4IWYA 4OXKA 1VCIA 1GGEA 3OETA 4PXSA 1P1JA 4AUMA 1KIMA 2BJVA 1PFQA 2FZKA 2O3RA 3THYB 1ZVQA 3AFGA 1T2FA 1YULA 2D0PB 4A0QA 4Y2PA 2HIAA 1RAIA 3DTYA 3LNCA 4MP3A 5CB4F 3UGKA 4WZAB 1THGA 2W6ZA 1IRXA 2O2GA 3OCWA 3LUHA 1TUEA 3OD1A 3P2KA 4CQMB 2NVBA 5E7IA 3QENA 4JJ6A 2VPWA 4LOKA 4DG9A 5AJHA 3L79A 4TWJA 1UDXA 4MCJA 2JC3A 4HH0A 4HAXA 1KQFA 2DEUA 1PZNA 1ZL2A 2Q9CA 3DLTA 4XYMA 2W0SA 3KQQA 4Y2UA 4BNWA 4X64B 4MRNA 2JBWA 2JAOA 4I50F 5HM8A 1T91A 5DN9A 2A1UB 3P0FA 4AO6A 2NUTB 3FNFA 2Z04A 4OB7A 5JD3A 2XH8A 521PA 1U7OA 3KSDO 5C51B 4PLGA 5GGXA 1STOA 1GYRA 3RLFA 3UPDA 1LS6A 3DCYA 4KQFA 2HDHA 5HOEA 1C7QA 1FDTA 2WNSA 5CEFA 3AUUA 1IBCA 2HDOA 3GI1A 1U7HA 4FQ8A 3CN9A 3UMJA 1SR8A 1ZOSA 2Z1DA 3D02A 3HM9A 1JMVA 8ADHA 1J56A 4MI9A 2E4AA 2DUWA 2H0QA 4FFOA 2W6IA 1G5QA 1BCSB 3O2NA 5F64A 1NBME 2IZ1A 1P0CA 2PXXA 2PT6A 4WVFA 2A1TR 2VPIA 2RGNA 4IDOA 4BO5A 3X1KA 1JAZA 1VGVA 2G63A 2W11A 2IF0A 3D4IA 4L8LA 4YRDA 2Q1YA 3SQXA 4N5IX 3BWBA 2KPOA 4YJFA 3SS9X 2PXHA 4KFSA 3FA2A 1ZH6A 1IVSA 1YZ3A 5F78A 3U3KA 3SNKA 1QDLB 2F8SA 1HE5A 4URXR 3WMFA 5EMLA 3K0SA 1PKXA 1SK9A 3P9KA 4R83A 4TL6A 2CF5A 3NC0C 3IMGA 1U0NA 4IVQA 3KL2A 5D7BA 3ROMA 1TJNA 2Q6LA 3CB2A 3EZFA 5CHEA 4MAFA 1Q0RA 5IMSA 3D6FA 2QBYB 1KQOA 4BJ1A 2IS6A 2GXUA 1GYQA 2WSBA 1QIDA 1OUMA 2XNDD 3EG5A 4GOMD 4KIGA 3L18A 2GPJA 3I4CA 5F23A 2RK4A 3O9VA 4YAGA 4O63O 4FUQA 4F4IA 2EKDA 2QHXA 3V34A 1KC1A 4B3JA 3DE5X 4YRGA 2V7QA 4EWLA 4C08A 1Y37A 3IIEA 4WKGA 4L0DA 2B9EA 5EFOA 3BUSA 1FFEA 4W8GA 2DUNA 2Q49A 5TSDA 3TDNA 3UCFA 2PL3A 3C5EA 4HP8A 1SKQA 4ZAXA 1JR4A 4OHRA 4BX2A 3AF6A 2D1TA 3ZIDA 4IDFA 2FRDC 2H48A 1N4AA 1ZIYA 3H86A 4GFDA 3GCDA 4TS4A 3QNWA 3OTIA 4NOJA 5EE3A 4FMCB 1DCTA 1Q83A 3QX9A 4B2LA 2WUFA 1NFFA 2M1XA 4NICA 2BFPA 4PFJA 1BKYA 1G18A 1JXOA 2HA3A 2ZJ2A 4FCCA 4K03A 1CDZA 1N2CE 2H2IA 3OF2A 4LHEA 1BDJA 4U0JA 2HYDA 3U44A 1QGDA 3DAOA 3WXBA 4C04A 1QR6A 2EATA 4Z49A 1FTWA 1UMCB 2C2BA 4ALMA 4C4YA 3NFYA 4D80A 3B6JA 2ATCA 3WDSA 5FPKA 1HMYA 4HNAA 3PUJA 5EQJB 3ZLBA 4DC0A 3A1WA 2X7JA 3WI7A 4JU9A 1D3AA 4RAQA 5DNDA 5IDQA 4XTRA 3EPPA 4ZIRB 2PKWA 2PS1A 2GXAA 4CN9A 1FSZA 3N1UA 2DBVO 1M5TA 1P0MA 1EK6A 2AVDA 2IELA 4UJ5A 4HC4A 3P1JA 3AETA 4B8YA 4NCXA 4QNNA 3V7FA 4F93B 5LJLA 1B42A 1N9GA 3P0RA 1P4RA 1MB0A 2JJ1A 3G9XA 4RTJA 1ZITA 2FFRA 4YDSA 3RU9A 4PLYA 2UYOA 1R4ZA 1YA8A 1NQOA 1XE3A 4RETA 2PX3A 4UMDA 1UBHS 4EA8A 2BMAA 3OLQA 2Q8PA 3UK2A 4AZSA 5JXIA 1MHTA 4AS3A 1ZZEA 1CZHA 4P4NA 4G5FA 4PQFA 4DB2A 1QIEA 4DQVA 3X44A 2GNAA 1WTAA 4RGYA 4CCSA 2PUDA 2QQGA 2J4CA 2QXYA 1WKBA 3ENVA 5DHTA 1B6GA 4N8EA 4C5AA 3KALA 3R7LA 1YTLA 1U8FO 1MH9A 3GLQA 10MHA 5AVUA 2XUZA 3V4SA 3ECSA 1IXYA 5ICEA 4UUAA 3EG9A 3NWPA 4NENA 5DTRA 4NBVA 5FBZA 2XUHA 4EVQA 2BMWA 4DV0B 1V16A 4G0WA 3GUHA 2JFBA 3BL6A 4Z9FA 4REQB 2FN8A 4UJ3A 4R2LA 4WCVA 2IV2X 1AC5A 1YASA 2VHUA 3P0JA 3W79A 2V6BA 1YOBA 3RBXA 2BDTA 3FE2A 2FG5A 3QVOA 1DXYA 3CUYA 4EF6A 3W3AA 2ZB7A 3RTGA 4ZU1X 2QG6A 4TTRA 3UOGA 1VLJA 3EA0A 1TQ4A 4PPGA 2UXCB 1ZXLA 3Q7EA 1GXSA 1ZOLA 3CRMA 4YRFA 2ZOSA 5DI3A 3M6IA 1T0HB 3PXXA 3JD4A 1KH1A 1YMUA 4Z0HO 1XU7A 2A9OA 3IOYA 1AUOA 2AN1A 5MFZA 3U16A 2CNLA 4ZGWA 3RYIB 3ETEA 2W37A 3FN4A 5AK4A 4Q82A 1NBEA 3ZZNA 1NTRA 4CI0B 1OBVA 3ESDA 2ECOA 2JAXA 3OU7A 3AW9A 3B1FA 3H11B 3OQNA 1VIMA 1OY1A 2O3UA 2X6TA 4WVLA 3WWDA 3NC1C 3LY8A 5AESA 5IC6A 1DVRA 3D7MA 1VZ2A 4KO2S 1USGA 4JBNA 4QAQA 4XCQA 4LN1A 3P9PA 1QMGA 1Z2DA 3V97A 1JZQA 3GU3A 4RVCA 1NQUA 3IS3A 5DBEX 3UHJA 4D44A 1RRGA 4KPGA 3S4YA 5BNWA 1IBKB 1ESDA 1GGMA 3V4OA 2IU4A 3DMYA 4MUMA 2AOXA 2ORED 3S2ZA 1TTTA 4ZCRA 4HI0E 2DWOA 2QKYA 4J0CA 4P6VF 3V4PB 5JBIA 4FNMA 4ARSA 5EC8A 1FP7A 2B6HA 3A1NA 3IESA 1TO6A 3WGMA 3ZKWB 4MPRA 3CGGA 3ZEIA 5AW2A 4EHAA 1YI0A 3G0OA 3PHIA 1QRDA 2YY7A 3CN7A 4MVYA 3MMSA 4YRCA 1D1TA 1F8GA 2PQ0A 3ZV6A 1GQQA 2JGFA 1MP0A 1OYYA 3IT1A 3KWFA 3LUJA 3QVXA 3DCNA 3TIGA 2X0JA 1G3IA 3RSOA 4ZHQF 2IKSA 4OCZA 2B1IA 3THWA 2I78A 5JJ5A 1Q2UA 1EWVA 1AQUA 1OI4A 1H2EA 3PEUA 1P9RA 2IT1A 3FX2A 1TE2A 1UKYA 1G6HA 1RQLA 4UHHA 2HHHB 4UEOA 3ZWQA 1DRWA 2D5AA 3T7JA 3PXGA 4KP7A 4X84A 1LLDA 3U4QA 4UHJA 1TM4E 3EVEA 4C14A 4L5JA 1Z35A 1LFAA 2RKWA 3UJ9A 5K0SA 4WINA 4EJ0A 2HT6A 5EG5A 1LF0A 2FW0A 2VHZA 1PWHA 1PE0A 5AHXA 2WHXA 4XW2A 1MW8X 3AETB 1FDOA 3M81A 2HM7A 5DF1A 3FMFA 2DSNA 4M49A 4C6HA 4QKQA 3HJAA 3I30X 2DU8A 3DHEA 1BW9A 2WD7A 4KMRA 4YAKA 1RJ9B 2W2LA 4XWAA 3DE2X 1MORA 5L7YA 3DDOA 3GFRA 1ZCBA 3LVBA 3MJSA 3PRYA 2QAIA 2VK1A 1FTYA 5H3HA 2AW5A 4QQKA 1NNUA 4YHBA 1N2IA 2OCBA 5BV2P 5HM6A 3HKBB 1VLLA 4GMKA 1XRRA 4I36A 4MX8A 3TAUA 1XVVA 1AMNA 4N1AA 4HX5A 1S2GA 4KFRA 4L5BA 1GTL1 5KVSA 1AHNA 1JFVA 3KAPA 4KOAA 4F60A 2RI1A 4O4IA 1MGOA 5J3JA 1FMLA 3MJTA 4DJTA 4CI9A 3RUPA 4YQFA 3G17A 4KR7A 5JPIA 1TVKA 4NPHA 4BP1A 4H0NA 4BUCA 5BWCA 1C81A 3EG9B 1Z0DA 3DE1X 2WAXA 3KHSA 4DAEA 2CDNA 3EPKA 2FXVA 1JSXA 1ZHHA 1LRLA 2J9FA 4BLWA 2QJFA 1JRLA 5KJ6A 1ZW6A 2PQ2A 2E37A 3NHLA 3CUVA 4PPNA 4BNKA 2WB2A 1Z28A 4I66A 2FW8A 3OD5A 3VMFA 1TB4A 2OYRA 4BO6A 2FG6C 3UO8B 4ZQCB 2PVCA 3FPSA 1ZWLA 1VBFA 4DY4A 2XBMA 5JS7A 3OFJA 2QTBA 3DEAA 2PGLA 3E2IA 4DSOA 3AY6A 4E2WA 4KXXA 4F5DA 2IXTA 3GWZA 4ZO7A 5D8DA 1A9QA 5DNAA 5EOVA 2XVAA 3VO9A 1HFEL 1J2YA 3KR9A 3GK3A 3QWHA 1KYVA 4N7BA 4OBXA 4QGFA 3LYAA 1MUUA 2C7BA 2ZSHA 2QL7A 3K0CA 4P53A 3PXUA 4XGNA 4WFJA 2YINC 3RFVA 2AD5A 4Y2SA 4BNMA 5KNBD 4AZ3A 3ST7A 2HAEA 5AW8A 3T3MB 4DLPA 1JPUA 2IEZA 2XEDA 2OXTA 1BS9A 4LISA 2YDXA 7MHTA 2XGGA 1MQ9A 5L3ZA 3LJKA 3CEMA 1RAHA 1MT0A 1QWSA 3WADA 5IT5A 4NF2A 3C4QA 4E51A 1YCHA 5MDHA 1KQ3A 4GXQA 4CM8B 2QE6A 4KWIA 2IU6A 4ZYTA 4BBJA 1S3FA 2M9MA 2P6PA 2W5UA 4FCTA 4UCQA 4C0WA 1AK9A 3AIMA 2AWOA 3PLNA 1CUIA 3JARA 1QKKA 5TEWA 3VPCA 1FVXA 1O6ZA 1QFMA 2HA0A 4R7GA 2XTJA 4R31A 1I1HA 1FZQA 4NZ9A 4JU8A 4C07A 1F5NA 2ZE8A 2BGIA 5ALVA 2H4FA 1JFTA 1E5XA 1XYYA 4Y8VA 4M86A 1T4CA 3H3FA 2ZK7A 3KELA 4HMQA 4QXRA 4ZI5A 1KO8A 4JHLA 4IIFA 5DCUA 3I0MA 4HBGA 2YDYA 1D4FA 1QQAA 3PD1A 4R3WA 1SVMA 4H9GA 3IR5A 3OPVA 3WLSA 1R0ZA 3R41A 3H3XA 1UJ6A 2EP7A 1P18A 1XZ8A 3U4QB 4IFBA 2WZBA 2R6JA 2XLCA 3RFXA 3VU0A 3HJNA 3HJUA 4IGIA 2F3TA 4BV3A 2Q1TA 4J0IA 2VO1A 4QTZA 2QZPA 3ZC3A 4LXIA 1KO1A 2JARA 4WXEA 4EW3A 2XWPA 3E7FA 3TR0A 1O08A 3PZRA 1UINA 3DW1X 5ALLA 3HVRA 5KYVA 3B89A 4WY5A 3W5BA 3D0QA 3H18A 5KDOA 4GGOA 1JLRA 4OP2A 4EITA 1T8WA 2R1VA 2PNJA 4CIXA 4MTLA 1Y48E 2F2TA 2ZUBA 3MRSA 3T7AA 1NP7A 4KMSA 4KN5A 1O6FA 5AW1A 3FLAA 5KZMB 1K5PA 2G5GX 3ZY3A 3KQUA 2QX8A 3E6AA 1VLVA 2IOFK 3JQBC 4AUNA 2OO7A 1W36C 4EBFA 5F3WB 3PFWO 4P7JA 3IMEA 3K73O 4O4IB 4TS3A 3LD9A 2GCGA 4X92A 1S2IA 2DR0A 1T4DA 1VB5A 2QENA 3FYDA 1OXTA 1ZO8A 1E9RA 2R751 3KLOA 4RIEA 2MYPA 5SYMA 2Z0MA 4GE3A 4DLVA 2C5LA 4RQBA 3I04A 3K7EA 3ELUA 3F4KA 4TN5A 3IQXA 1L0BA 5JMOA 1F4PA 1IXZA 4ND5A 3IBCA 4UKDA 4JOSA 3R7WA 1C50A 3BRQA 2XKKA 1OXSC 4K5QA 3WDMA 4OHCA 3EZ6A 4YALA 1L7NA 4H6VA 4ZOAA 4D1YA 5CVTA 4BVBA 1UFVA 2I6TA 4FMCF 4WLNA 3SZUA 4EA9A 1UH5A 5BNFA 2BR3A 1N6IA 4JN6B 3QMMA 4XVQA 4JB3A 4BFTA 1FYEA 4N3BA 3KZXA 1JTEA 3AB8A 5BSRA 2Q9AA 2ZB4A 4Y6SA 4B80A 1YI1A 5FHQA 1U11A 3MT0A 2BI8A 3QEOA 1PR9A 3QNUA 4R51A 5ITZA 1W35A 1O97C 1I3OA 3JRWA 6REQA 1M5RA 3KJGA 2WFZA 2C31A 4AZ3B 4O2RA 4OHPA 2P6OA 1YA4A 5B6JA 2COKA 1F4LA 2VDLB 1ODIA 2BUAA 4OGKA 3I34X 3ZHXA 4PLWA 1CW2B 2Q4OA 3DA8A 2ZYAA 3OTQA 3RSQA 3WLNA 5IN4A 4CWAA 3FFWA 1KE2A 1LC3A 2BCGY 2AMYA 3VR6A 1JG6A 1JLHA 1R2QA 1FP6A 4NU6A 2W22A 3T95A 5CA1B 1BGXT 4FMDB 1XMQB 3PRHA 5EKXA 1IHPA 2R2GA 1OU0A 2X3FA 3KPVA 1BEUB 3NPMA 2ZRHA 1JKJB 1OB2A 2IBSA 2CLMB 3GRAA 1UOQA 4RY8A 2E4WA 4WCFA 5EE0A 5EZQA 2C8KA 5EUBA 1H5NA 3DEJA 1VG1A 4IZOA 1JNXX 1X39A 2UZ1A 3QMWA 4MS3B 4PLZA 1A95A 3TVYA 1TEXA 4RDHA 1XTKA 2EJTA 2VF2A 2N75A 3M2TA 1MX3A 1NULA 1VTKA 1AKQA 4MYDA 1EFTA 1H2FA 2J4DA 2W4IA 3OZEA 3PNMA 4Q1DA 3W8DA 1KMMA 3SOPA 3NI2A 1CUFA 1EVLA 5M3BA 3HCEA 4LDZA 5A7HA 5A0VA 4DLBA 3Q4GA 1I94B 4D26A 4KAXA 2GT1A 5EIHA 3HZOA 2F1RA 2FWBA 4QU9A 5L40A 1RAEA 2Q0HA 3GUZA 2I4TA 4BTEA 3FPJA 5KDLA 2NU6A 2XBLA 5IKMA 1ECGA 3HCDA 4PSVA 2IX3A 3AF1A 1RKBA 2GOYA 1K6EA 3IIKA 1NZJA 2IOYA 2PUHA 5HUQA 3KO8A 1ISRA 4AS1A 1UBJS 4B31A 5JAHA 2CVQA 3AZQA 3TLKA 3VV2A 3CR8A 4MVJG 3DQZA 4KZPA 4GX5A 1ZR4A 4PONA 3ZHOA 2UKDA 1YB4A 1YE3A 3HEAA 2O2ZA 13PKA 2XUOA 2GYUA 4JXJA 3G0HA 1D4OA 1I4TD 1E8DA 3SXUB 3QE9Y 4FFBB 4BDSA 4BGDA 4LV6A 2YZNA 1ZSVA 3SF0A 2Z56A 4ABYA 3EGXB 1WQ1R 3GP3A 1AVTA 3OCCA 3GUCA 4WUVA 3MGGA 3NRJA 3RJTA 4DS3A 4LBZA 3RQIA 4YCAA 4AN4A 4EG4A 3SDZA 1QPZA 3ELDA 1E9DA 5DGCA 3IUBA 3BIFA 2QQEA 2Y0DA 4CODB 5JZMA 4OTZA 5DNUA 3WGTA 3PSHA 2Z4RA 2OFFA 4IIXA 1Q1BA 4B4KA 3Q8LA 3L1VA 1HT0A 3LP8A 4U1RA 2EOAA 1XLTC 3L1JA 2BI7A 1VE1A 1E8NA 1F5SA 1IH8A 2DFLA 4JLDA 3LF2A 3V8VA 3DOIA 2V74B 1JXQA 5C7LO 1K9VF 2IUSA 1ZSYA 2WHPB 3IDSA 4NJOA 2VDOB 5BUSA 3L8GA 4XCVA 4YT8A 3AM1A 3D6MA 3G0CA 5LLSA 1JVBA 5JZ9A 2OHJA 2C2YA 1RWNA 1SVNA 2GPSA 2WKSA 1E79D 1ZK4A 2CLIB 2Y1LA 1SH7A 4MVJA 1OLSB 4K6CA 3ES9A 2ZYHA 1NRJB 3WYAA 5GADl 2J6IA 1O57A 4L6AA 2E7ZA 4XB6B 2RCYA 1XZLA 4LXXA 1L3CA 2QSZA 4UMEA 2Q0XA 3BXEA 4IIDA 4Y2JA 3F97A 4L1KA 3R77A 2J3KA 5HCUA 2J0EA 2D59A 2IS2A 1UWLA 5DIFA 4UW9A 1JHAA 3R7FA 2ZAIA 3VZSA 3BXGA 3HHPA 5A7GA 3W5IA 4HQOA 2GH1A 4UHFA 5ITZB 2X40A 1TM1E 5JSZA 3H2ZA 1JZSA 6ABPA 1C1DA 4B44A 1YDWA 3OCXA 4KQJA 2ZM6B 4MUBA 4O4HA 4N7JA 2QD4A 3WMXA 1NBWB 3OURA 4GI2A 4ZC8A 2NU9B 5CCBA 5THKA 4M9UA 1O6BA 1FXWA 1SXQA 1S96A 2YVLA 1V4BA 1UPXA 3M5WA 2XDYA 2DFPA 3RFFA 1CUUA 1XRMA 3PEEA 4IMRA 4V2IA 2ZE6A 5IZCA 2ZYSA 3VJMA 1USIA 2PJRA 1XQ1A 3INGA 5FOXA 1DELA 3SZMA 1U81A 5KKAA 1XTUA 1AQ6A 1NFRA 5TF0A 2ACVA 2Y6VA 2V8BA 1FF9A 3L0PA 2XOKD 4WEQA 4Q47A 4ML3A 4MS1A 4BGUA 4I4TB 1CXZA 2UZ1B 4IPTA 3P52A 4QUEA 5AFSA 5KOJA 5AIAA 2IODA 1JDSA 3PQ7A 3IO3A 1SULA 1II9A 3TI7A 3PQ6A 4CDMA 1ZZGA 1WUKS 2Y05A 2OVBA 3EVAA 1ST3A 4ZT7A 3TX6A 3WQBA 4C3OB 5TS3A 3T5BA 3IPLA 3L9WA 4E94A 3K9GA 3L0SA 3NIBA 5CVDA 1O9BA 2BFWA 3TTSA 3DFZA 4QUBA 2AEJA 2FPRA 1GWNA 2WFLB 1KARA 1W0JA 4HZIA 5FI0B 5G41A 3TVTA 1L4EA 4PHFA 1LSOA 1SPXA 4MPDA 4E1BA 3ZOZA 4II7A 2YRXA 5I7WA 3RADC 5HIIA 2Y92A 2HREA 3AERA 4GR9A 4J7CA 3T34A 4RZ2A 3R9XB 4YRSA 1SVLA 2WA2A 1C9NA 3DMNA 4JWTA 4M2LA 5H80A 1C3JA 4L22A 3S1LA 4YT4A 2VBFA 1SXHA 3EHEA 2CYBA 2P1DA 4PHHA 2PX8A 4YJGB 2J87A 1JV2B 1L5HB 2CHUA 2JS7A 1PLKA 3W7BA 5AD1A 4XVUA 3X2EA 2P2SA 3CZQA 4FILA 1NBMA 3VOSA 2KYRA 1YHNA 4CF7A 5FBKA 5I7SA 1AHPA 1WSWA 2XQGA 2CLSA 2FZVA 3SC6A 2CCGA 5I3CA 4BAGA 2H4HA 5FL7A 1ARZA 3QOFA 1TM7E 2P3QA 3DZHA 3NRCA 5LZ8A 3TF5A 4IRMA 1JALA 1CP3A 4Q19A 1J00A 4C7KA 4GKJB 4N7RA 1ZISA 1OKKD 4B32A 3BTSA 3UUFA 2IHUA 1WMEA 4YQEA 4YCMA 1Z75A 1JFLA 3EMKA 1BDBA 3EIFA 5G2OA 2EP5A 1XEXB 5K2OA 2IH2A 4W7IA 2JRLA 4R8RA 4CKEA 3E5MA 1N3LA 4R1OA 5CRIA 3T5DA 2PZGA 5J59A 3ZQ6A 1KO4A 3HWX1 5ABPA 3B6EA 4OK5A 3IT2A 2AE1A 3SBXA 1ANKA 2CEAA 2GVNA 3R8FA 4QAJA 3SYNA 1EK1A 2G83A 5EKUA 3R74A 2HF9A 1TCCA 3C4JA 4ARIA 1ATZA 3ILYA 1X1RA 3QBDA 4M9RA 4BCCA 1DTSA 1QIIA 4FQ7A 5JUWA 1MIOA 3H0EA 5LZ5A 4D3ZA 1FU4A 5BURA 1AKRA 1X9HA 3AP3A 3TAXA 4GRAA 1TFUA 4IYRA 1ZRHA 4LY9A 4F0JA 3KUDA 5BY2A 4GOLD 3J81k 3ZNNA 5MFPA 3NOOA 2JKYA 2YV2A 5ALRA 5LD2B 2YMLA 3MILA 1ZCFA 1W5FA 4TQGA 4MRSA 4O5AA 4XR9A 4CCYB 1BN7A 2SICE 4IVPA 4YS6A 2Y6UA 1E61A 2IOQA 2VSNA 2XMZA 3GFVA 3A1VA 1IM8A 2V6IA 1CQWA 3K92A 1YFJA 3S2GA 2FPKA 1C1DB 3OX4A 3UWMA 2FDRA 2HRZA 3HL0A 1QZZA 3DDSA 3HCOA 4UM8B 3SQNA 3TMYA 2CSXA 4O4HB 5EE5B 5KTPA 5AK6A 5CBPA 1N2CA 4DV2B 1VBMA 2JD1A 2OCLA 3WWEA 5FEUA 1V43A 5CTAA 4WOJA 3CZPA 5G0TA 1GZ3A 2FPLA 4RQTA 1EE1A 2QR3A 4BMVA 2CT8A 1J39A 4W63A 4TV8B 3AU8A 1R6TA 2AEFA 3KKZA 1BH6A 3C7CB 3A6EA 2EVWX 2GBLC 2RI6A 3MHPA 3R7AA 1V1RB 5EWLA 3CF2A 2AMFA 3BWCA 2WLSA 1LA2A 3PUWA 2XB6A 3EZLA 3F6BX 2ILVA 3MWKA 4X41A 2OD9A 4JUCA 1DOAA 1M1YE 1Q16A 2F9MA 2NQ8A 2PAFA 2XQFA 3I0ZA 2VA8A 2X2PA 1R4NA 2ZREA 3ESYA 3QK7A 5JDIC 1QAQA 4BBZA 3I42A 4HQFA 4O4IF 3BHNA 1OOEA 2O2DA 1HDIA 1CWUA 1D7OA 1ZJYA 4KO1S 3R44A 3VPDA 5TXGA 2ZJ0A 2IYAA 3GUUA 4XQEA 3CF6R 4U7HA 4LJ7A 5TMPA 1XF1A 1LU9A 4O2LA 3BD6A 1R0CA 5GQSA 4ENVA 3LQRA 2V65A 5FBVB 4XRRA 2OCIA 3M8KA 3I2HA 3ZBUA 4DUGD 2XECA 4LXGA 3BULA 1BJRE 2FE4A 2FPUA 2OEPA 1GQYA 3TW0A 1I7LA 4BZQA 1U28C 4K9KA 5B4VA 5K8JB 2PUCA 1L4LA 3EDQA 3AEQA 5A05A 3VM6A 2XRZA 2G77B 2A67A 3MJRA 1OAAA 1WPXA 5TS2A 4ZRDA 1UOPA 4B6PA 4JLUA 2HI0A 1NLMA 1CNFA 5KYYA 4L85A 4JI3B 1IIRA 3DXXA 3PIRA 2XTNA 4V0ME 1PL0A 4FGSA 1XL0A 4X8MA 3D8SA 3RSZA 4LTDA 1GGNA 4HJRA 3L01A 5LIRA 3K5HA 4U7TB 1FFXA 3VR5D 4IH1A 1AKTA 3N2YA 4H3KB 1NUPA 3NM4A 1V4VA 4PY2A 2JK0A 2ZSIA 3P9IA 4XEHA 4FT4A 4YRJA 5BW6B 4INZA 1Q11A 4LYHA 4O3FA 4FYWA 1U3TA 1M2VA 1Q50A 1RJFA 4RENA 3I6ZA 3CVYA 1NU6A 3PDIB 1XNQB 1WNTA 1RC1A 3C5VA 3ELWA 4JB8A 4M99A 1WD5A 4Q4HA 3IAHA 4G5OA 4QQFA 3A2KA 3KQTA 5DN6D 1SC4A 5IPFA 2UUPA 2F43A 2HO4A 1LF5A 2C5BA 3IV7A 1VKNA 3OX3A 4FMDF 3RIMA 5CA1F 2G3YA 1ZCAA 2JF0A 5EJGA 2UYHA 3ICWA 3OQVA 2QTRA 2HGSA 4PCAA 1TUBA 5B2FA 3P45A 3PNQA 1RQRA 5JSQA 4M9ZA 4FFRA 3GG9A 3R4VA 3REQA 1E1DA 2QW0X 3JZDA 1B2LA 5AK5A 4NXMB 4R2JA 4MKFA 2PA3A 5CT9A 2PG3A 3KXLA 1JMYA 2WILA 2HUPA 2QWXA 3G82C 4LTMA 4M0DA 3JASA 4WLEA 8MHTA 1U9YA 3N39C 3FCEA 1H6CA 4JP1A 2ZR9A 5EJIA 3RI3A 3TO5A 2GFQA 1H1DA 5A6VA 1RWXA 4RD6A 5H4HA 4YLYA 1M72A 3GQBA 3QVJA 3GGOA 4B4WA 5JD4A 5KMGA 4ZYZA 4RK4A 1HNXB 5I7RA 4TOIA 1PJ3A 1AKNA 1RXEA 2HO5A 2VWQA 4JC0A 3NOVA 4V24A 3UWOA 2FN4A 2WW8A 1D9ZA 4PIVA 2VAMA 1IJBA 4HNTA 3QKWA 3A1UA 2CNWA 1NW6A 2I6GA 4GICA 3UFBA 2BEVA 4FP9A 1NJGA 2ZB2A 5SZJA 1JSCA 5FWYA 1ZAYA 5JFOA 4KR3A 2YHSA 4TYNA 2FEOA 2O8BB 2II6A 4QG3A 1XZBA 4DABA 5EIBD 1SOAA 3JQGB 2WBLC 3DF7A 4OMUA 3DM9B 4PZ0A 4U0KA 4X7PA 4YONB 2WWHA 3RAGA 2ZBEA 3Q2IA 3SEFA 4IMJB 2HCFA 1G3QA 1PW7A 4FC7A 1RR6A 2AFIE 1LK7A 1RAAA 1Q21A 3DL4A 5CPFA 5EWLB 3T4UA 2J5XA 4KXWA 2YNMD 2PMDA 1K08A 1LEHA 1N5LA 4NCKA 4RTOA 1ZMXA 2Z9BA 4WJZA 1RI4A 4TSFD 1S2OA 5F35A 2AN4A 2PY6A<