1L6MA

Neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
b'TSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title The Neutrophil Lipocalin NGAL is a Bacteriostatic Agent that Interferes with Siderophore-mediated Iron Acquisition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 41
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1l6mA00
3KFGA 4YDBA 3TGBA 1ADLA 1KOIA 1R0UA 5HZ8A 1MVGA 3O19A 5HA0A 2JU3A 3CWKA 4CK4A 2G7BA 1OPBA 1HMTA 4MVIA 5KICA 1T0VA 3HWFA 4ZHHA 1CBSA 2JU7A 4KIIA 3ELXA 1HMSA 1ERXA 4LZUA 3FELA 3VG7A 4RUNA 2AT3X 5F6BA 4ALBA 5IO7A 1GM6A 3G7XA 3FR2A 1EIOA 3P6DA 5L8IA 2FS7A 1JYDA 2JU8A 3DSZA 5HCEC 3CQRA 2RCTA 2NNDA 2WUTA 4AYHA 3BDRA 5H9LA 1A57A 1TOUA 1G7NA 1DZMA 2Q4NA 3WJEA 3Q6LA 4A60A 3P6FA 1JZUA 1BSOA 3BRNA 5H9AA 2CM9A 1IFBA 2DM5A 5HCCC 3BLGA 5D48A 1BBPA 1IKEA 1HBPA 2PY1A 1LIBA 2N93A 3OJYC 1A18A 4QGWA 2OFRX 1DF3A 1U17A 1MUPA 1BM5A 4ZGUA 3IFBA 4A8ZA 1HBQA 4WFVA 1ZNEA 2RQ0A 5AQ6A 4A1HA 3CR6A 5KHPA 1OEJA 2QO4A 1PBOA 4YBUA 3FA9A 2ANSA 3BU1A 2XKLA 4I3BA 4ORWA 1PEEA 3U0DA 1QABE 4ORUA 4N7DA 1N0SA 3U03A 1U0XA 4XMDA 5LJGA 1E02A 3I0AA 1KT7A 4ZJ0A 1YP6A 2QO6A 1GT3A 1VPRA 1NP4A 4YH0A 1GGLA 2RA6A 4IMNA 1O1VA 2WEXA 4MVKA 2GJ5A 3O22A 1I4UA 1E06A 3KFFA 2MJIA 5HZ5A 1LKEA 3JS1A 1TXLA 3WJDA 1SXUA 1KZXA 5HZ6A 1X89A 3B2KA 3TGCA 4ORYA 4ZHGA 1DZPA 1HMRA 5B29A 1NGLA 3AKNA 1L6MA 2R74A 1XCAA 1U18A 1O1UA 4TKHA 3BX7A 4Y0QA 5LJDA 5EPQA 5HTDA 3WJBA 4IAXA 4QZTA 1A2DA 1MX8A 1YIVA 4QAEA 1LPJA 2Q9SA 1ZNKA 1S7DA 4GH7A 1O8VA 2OFMX 1EALA 1S2PA 3FR4A 5HBSA 1NP1A 2AT8X 5K06A 5LJKA 3FW4A 3BY0A 3KQ0A 3ZUOA 4DQ3A 3C77X 2HYSA 3FA6A 1ALBA 2FRSA 4AZQA 3NX1A 1DZKA 1I04A 3CMPA 2FLJA 4AW8A 1KT4A 1QWDA 2ACOA 3PH6A 4TKJA 2FR2A 4XMFA 2LFOA 1OEEA 4WFUA 4I9RA 1CBIA 2JN3A 3ZQ3A 5KIDA 4AZNA 1KZWA 1KXOA 3U9PC 3GAQA 4R0BA 2CM4A 2P8GA 3NQ9A 1TOWA 1E00A 4TLJA 1BLRA 3FA7A 4QZUA 4HPAA 2AH7X 3STMX 1X8PA 2WQAE 3NQ3A 4YCHA 1LIEA 5LJHA 4AZPA 3STNA 4EDEA 4BVMA 2IFBA 3EM0A 4OS8A 5H8TA 4AZRA 1BJ7A 4NYQA 2HLVA 3TGAA 2X45A 4I9SA 4NLJA 4GNYA 5BVQA 2OVDA 5EDCA 1VYFA 5H9NA 1AB0A 4TNNA 1JJJA 3DTQA 2LBVA 1GX9A 1OEKA 4YMYA 3CBCA 3O2YA 3EBWA 2Q2PA 3APWA 2W2BA 1GX8A 2POAA 3UEVA 1BSQA 3NPOA 1OPAA 4QYPA 1G74A 1EUOA 2CBRA 4M6SA 5C0NA 3APXA 1FDQA 3FW5A 4Y0SA 2A3FX 3UEUA 4XMEA 4K19A 1FTPA 2K23A 1AVGI 4IB7A 4IB8A 1OBUA 3WVMA 5D47A 3PP6A 3F8AA 1X8NA 2CZUA 4LZVA 3T1DA 1KT3A 5F6ZA 4ZR2A 3NR3A 2HMBA 2HZRA 5LKEA 4ZH9A 3NP1A 3HWDA 2AKQA 3TZSA 4ORSA 3C76X 4A1YA 1GKAA 2QOSC 2FWVA 3L4RA 3BX8A 1JBHA 1SY2A 5BVTA 5LJBA 2WEWA 1DFVA 1KGLA 1KQXA 4ZHDA 1EW3A 2XSTA 1ML7A 3ELZA 2ACPX 2W2FA 1PM1X 1KQWA 3EBKA 1BRQA 1OBPA 5D4AA 1BSYA 1RLBE 1ZNLA 5EEDA 4QGVA 4LKTA 2AT0X 1BRPA 3D97A 3FIQA 5JR8A 3FR5A 1SXWA 1EPAA 4GETA 3S26A 5F1EA 3STKA 3EMMA 3NADA 1FEMA 4Y0PA 4BOEA 3BSZE 3FENA 1IKJA 4Y0RA 5IO6A 3VG5A 3CQNA 2FT9A 1SXXA 3B2JA 1QY2A 1EQDA 4XMCA 1LFOA 1QY0A 3MBTA 3PECA 1Z24A 3VG6A 4NYRA 1D3SA 4QYNA 4UU2A 1IFCA 1GXAA 1A3YA 5EDBA 3FA8A 4OS0A 1EIIA 2G78A 2L9CA 1KT6A 4HPCA 4OMWA 5BVSA 3PPTA 5HA1A 2WQ9A 1KT5A 2QM9A 3QKGA 2FTBA 2E4JA 4YGGA 3HWGA 3HK1A 3WBGA 3WXQA 1GT1A 1YWBA 2ASNX 1JYJA 1LIFA 1B4MA 1TW4A 2HNXA 4ARHA 2L68A 2WWPA 2LKKA 3APUA 3WJGA 4I3CA 4D6AA 2AT5X 3D95A 3K3LA 4QGXA 2A2GA 1X8UA 2WR6A 1P6PA 2MO5A 3IA8A 1YWCA 4AZMA 5FENA 3APVA 3BU9A 2CZTA 3KFHA 3KFIA 1LNMA 5HZ9A 4YCEA 1ICNA 3RZYA 3WJFA 1JJXA 5DG4A 1SA8A 1ZRYA 4NNTA 4LKPA 1DV9A 4ODDA 4NNSA 2NNEA 4EXZA 2R73A 3FEKA 5EEEA 1FENA 2A2UA 1T8VA 4DQ4A 2O62A 2AMMX 3P6EA 1SY1A 1YWAA 1ZNHA 1EPBA 2F73A 3CBSA 5D45A 5F7GA 3FMZA 1ZNGA 3PH5A 1UREA 4IMOA 4YFPA 2FS6A 2LBAA 3JSQA 4GKCA 3AKMA 1X8QA 4YGZA 1FE3A 4BQUA 5HAEA 1LICA 4IAWA 2MM3A 1D2UA 1OBQA 3F9DA 1PMPA 4HPDA 4GE1A 3PEDA 4ORXA 4HFOA 2X46A 1QFVA 5F58A 1G5WA 4ORRA 1BEBA 2NP1A 1DC9A 5HWZA 4WBKA 4GNWA 5L8NA 1S44A 1GT5A 1RBPA 2RD7C 1UZ2X 1ACDA 4YDAA 4YBPA 2OVEA 3D96A 4OMXA 4TKBA 3VG2A 2CBSA 1HQPA 1ZNDA 1QQSA 1B8EA 5LJCA 3WJCA 2JOZA 3P6CA 2Q2MA 4YKMA 2KT4B 1MX7A 3BS2A 1E5PA 4YFRA 1YP7A 5LJEA 2Q39A 3NX2A 4ES7A 1GKAB 4MVLA 1HN2A 1EXSA 2HZQA 3VG4A 1H91A 3C78X 3HWEA 5CE4A 1G85A 3P6GA 5LKFA 1GT4A 3B2HA 5HTEA 2OVAA 4XMHA 4ZHCA 4ZFXA 1LF7A 2GTFX 5H9KA 5HCDC 4ZCBA 4YFQA 1I05A 2A13A 4TJZA 4ZHFA 2GC9A 3MVFA 1B0OA 4GRJA 2AL0X 4NLIA 1DZJA 1SY3A 2EU7X 2RCQA 2A0AA 4YGHA 2FR3A 4O9SA 2L5PA 3TF6A 4EEJA 1BWYA 5B27A 1IW2A 4AZOA 4HPBA 4XMGA 4OS3A 3UEWA 1CRBA 1XKIA 5HZQA 4PSQA 5DPQA 3VG3A 3B2IA 4YKOA 1LIDA 3I17A 1CJ5A 5FFHA 3RSWA 1B56A 3FLLA 3P6HA 1FELA 5L8OA 1TVQA 2QO5A 4I3DA 4RUUA 5EZ2A 4IB9A 1QY1A 1I06A 1MDCA 1QFTA 2BLGA 4IBAA 3KZAA 4ALOA 1ERBA 3SAOA 2ALLX 3EYCA 3B2LA 3FEPA 2KTDA 2AT6X 1CBQA 1YUPA 2WSJA 2NNQA 4IB6A 2G79A 1ICMA 1YWDA 1JV4A 1SXYA 1QG5A 2W2AA 1X8OA 1AQBA 1CBRA 3UEXA 4ZH6A 4D6BA 1SY0A 2R56A 1IIUA 4N7CA 4EFGA 5IO5A 2OZQA 3ZUIA 4M7MA 1T68X 4UU3A 2K62A 1VYGA 4NP1A 2LB6A 5D8JA 1AELA 2YG2A 5FAZA 4TQ2A 1X71A 2L67A
chains in the Genus database with same CATH superfamily
2OY1O 3KFGA 1VWCB 4YDBA 1ADLA 1KOIA 1R0UA 4BBOA 1MVGA 5HZ8A 3TGBA 3O19A 5HA0A 2JW1A 2JU3A 2RTHB 3CWKA 3T2XA 1SWAA 1SWFA 2DJFA 4CK4A 2G7BA 1LCVA 1OPBA 1HMTA 4MVIA 5KICA 4EKVA 1T0VA 4ID2A 3HWFA 4ZHHA 3T6FA 5K67A 1CBSA 2JU7A 4KIIA 3ELXA 1NDJA 1HMSA 2F09A 1ERXA 2KTSA 2VDFA 4LZUA 1SRFA 4JNJA 2IZDB 1MM9A 3VGWA 3FELA 3VG7A 1KL5A 4RUNA 3S5XA 2AT3X 5F6BA 1K24A 4ALBA 3EC5A 5IO7A 4I60A 1GM6A 3G7XA 1RSUB 3FR2A 1UYNX 3JQOA 4GGZA 3WZOA 3X00A 1EIOA 4JO6A 3P6DA 4Y59A 5L8IA 2RTIB 2FS7A 2IZAA 4Z2OA 1JYDA 2JU8A 3DSZA 5HCEC 1LELA 3CQRA 3RY1A 2RCTA 1AVEA 2NNDA 2RTMA 2WUTA 2OFBA 4AYHA 2BS6A 4CPHA 3BDRA 5H9LA 1A57A 4O3ZA 1TOUA 3FIDA 1G7NA 1DZMA 3AUMO 2Q4NA 3WJEA 3Q6LA 4A60A 2IZHB 3NQKA 2QCBA 3P6FA 1BSOA 3VU1A 1JZUA 3BRNA 5H9AA 2CM9A 1IFBA 3D4RA 1N9YA 4MVEA 4GJSA 5CHKA 2VFBA 2DM5A 5HCCC 3BLGA 5D48A 1BBPA 1IKEA 1HBPA 2PY1A 1LIBA 2N93A 1VWFB 1A18A 3OJYC 4QGWA 2OFRX 1DF3A 1U17A 1MUPA 4KH8A 3EW1A 1BM5A 2G5LA 3IFBA 4A8ZA 4ZGUA 1HBQA 4WFVA 1ZNEA 2RQ0A 5AQ6A 4A1HA 1Y9TA 5F2BA 1RXJA 3CR6A 5KHPA 2OL6O 1OEJA 2QO4A 1PBOA 4CDCA 4YBUA 4BX7A 3FA9A 3ZW1A 2ANSA 3BU1A 2FGSA 2XKLA 4I3BA 2RTDB 4ORWA 5FQ8E 1PEEA 1QABE 3VHHA 3U0DA 3NBXX 4ORUA 4N7DA 1N0SA 3U03A 1U0XA 2JMBA 4XMDA 5LJGA 3SOTA 2GH7A 1E02A 3I0AA 4OKAA 3RE6A 3T6LA 1KT7A 4ZJ0A 3ZZVA 3ZUIA 1YP6A 2QO6A 1GT3A 1JJUA 1KL3A 1N4JA 1VPRA 2X4MA 1NP4A 4YH0A 1SWSA 4CDEA 1GGLA 4Z28A 2RA6A 1SWGA 4IMNA 1WBIA 1O1VA 2WEXA 4MVKA 2GJ5A 1Y55X 3O22A 1I4UA 4BX5B 1LDQA 1E06A 4NV7A 3KFFA 2MHDA 3VHIA 2MJIA 4O4SA 2IZIA 5HZ5A 1LKEA 3HOEA 1TXLA 3JS1A 2UZ2A 3WJDA 1SXUA 1KZXA 1OSPO 5HZ6A 1X89A 3B2KA 2RTKA 3P24A 3TGCA 4ORYA 2RTNB 3F6ZB 4ZHGA 1RAVA 1DZPA 1HMRA 5B29A 1NGLA 3AKNA 1L6MA 2R74A 5JD2A 1XCAA 4GDZA 1U18A 1O1UA 1HY2A 4TKHA 3BX7A 4Y0QA 5LJDA 4GDAA 1VWOB 5EPQA 2X32A 5HTDA 3WJBA 4IAXA 4QZTA 3CKGA 1A2DA 1NQNA 3RDMA 1MX8A 1YIVA 4QAEA 1VWGB 1LPJA 4FQBB 2Q9SA 1ZNKA 2OF9A 4B55A 4YVBA 1S7DA 2HKDA 4GH7A 4CSBA 1STPA 1O8VA 2OFMX 1JMZA 2X8FA 3RKGA 1SWTA 2OY8A 1S2PA 2RTGB 1EALA 3FR4A 5HBSA 1E2TA 1NP1A 2AT8X 5K06A 5LJKA 3FW4A 3BY0A 3KQ0A 3PQSA 1JMXA 3ZUOA 4DQ3A 4WHIA 2YMSA 2HYSA 3C77X 3FA6A 1ALBA 2FRSA 4AZQA 2DJGA 4BX6B 3CKFA 3NX1A 2OY5O 1DZKA 1I04A 1VWIB 3CMPA 3OD9A 1JQPA 2FLJA 1I9HA 1KT4A 1QWDA 2ACOA 2Y32A 4AW8A 1SLGB 4KCAA 3PH6A 4TKJA 2FR2A 4XMFA 2ZAGA 3WZPA 2FHNX 2LFOA 4IRWA 1OEEA 4WFUA 4I9RA 3RDSA 3S5VA 4ZHFA 1CBIA 2C1QA 2JN3A 3ZQ3A 5KIDA 4AZNA 2RTCB 1KZWA 1KXOA 3U9PC 3GAQA 4R0BA 4Z27A 2CM4A 2P8GA 3E3CA 3NQ9A 3SZJA 1TOWA 1E00A 4TLJA 1BLRA 3FA7A 4QZUA 1IJ8A 4HPAA 2AH7X 3STMX 4CV7A 1X8PA 2WQAE 3NQ3A 4YCHA 1LIEA 1SWEA 4FBVA 4U8UM 5LJHA 4AZPA 3MM0A 3RDUA 3STNA 4BVMA 4EDEA 1SMPI 3MX7A 1LCZA 2IFBA 3EM0A 4OS8A 5H8TA 4AZRA 1BJ7A 4NYQA 2HLVA 3TGAA 2FHLA 2X45A 4I9SA 1W6FA 4NLJA 4YBPA 4GNYA 1DF8A 5BVQA 4Z2PA 2OVDA 5EDCA 4FBRA 1VYFA 5H9NA 1AB0A 3WYPA 4BJ8A 4TNNA 1JJJA 2RTJA 3DTQA 2LBVA 1GX9A 4Z2VA 1OEKA 1VWDB 2BC3A 3ZI8A 4YMYA 3CBCA 3O2YA 3SLTA 3EBWA 5IXGA 2Q2PA 3APWA 5B2AO 1GX8A 2POAA 2W2BA 3UEVA 4NW4A 1BSQA 3NPOA 1OPAA 4QYPA 1G74A 1EUOA 2CBRA 4M6SA 3PK2A 4O4XA 4Z6JA 5C0NA 3APXA 1FDQA 3FW5A 4QRLA 4Y0SA 2A3FX 3UEUA 4XMEA 1SWBA 4K19A 1FTPA 1VWJB 1AVGI 2K23A 4IB7A 4IB8A 4O49A 4ON1A 1OBUA 3WVMA 5D47A 3PP6A 3F8AA 4MIRA 1X8NA 3UAQA 4BX7B 2CZUA 2X56A 3VE2A 1SREA 4LZVA 1KT3A 3T1DA 3ZW1B 5F6ZA 1SWJA 4ZR2A 3WYQA 3NR3A 1SRIA 2HMBA 2HZRA 5LKEA 4ZH9A 3NP1A 3HWDA 1SLFB 2AKQA 1VWRB 4ORSA 3TZSA 3C76X 1VWBB 2IZEB 1GKAA 2RN4A 4O4UA 4A1YA 2JGSA 2QOSC 2FWVA 3HTYA 3L4RA 3BX8A 1UYOX 2M4LA 2X8SA 1JBHA 1SY2A 2RTFB 5BVTA 2OF8A 5LJBA 2RTPB 2OYBO 1EI5A 1DFVA 2WEWA 1KQXA 4U8UO 2BT9A 3RDXA 4ZHDA 1KGLA 1EW3A 1VWNB 2XSTA 4MEEA 1ML7A 1GX3A 4ML7B 3ELZA 2ACPX 2W2FA 1PM1X 1KQWA 3EBKA 1BRQA 1OBPA 4GK9A 5D4AA 1BSYA 1RLBE 4O4OA 1HQQA 1ZNLA 5EEDA 1LCWA 2VFCA 5K68A 4BX6A 4QGVA 4LKTA 2AT0X 1BRPA 3D97A 4GD9A 5FQ6E 3SZHA 2LA7A 3FIQA 5JR8A 3FR5A 1SXWA 2RTAA 1EPAA 4GETA 3S26A 3QQ2A 1SWPA 3EMMA 3NADA 5F1EA 3STKA 3ZW0B 1FEMA 4C5PA 4Y0PA 4BOEA 3SZIA 3BSZE 3FENA 1IKJA 1VWEB 4U3QA 1HXLA 4Y0RA 5IO6A 3VG5A 4L1NA 3CQNA 3ZW2A 2FT9A 1SXXA 3B2JA 2Z4HA 1QY2A 5AEOA 1EQDA 4XMCA 2I5VO 3P02A 5B5FA 1LFOA 1WUBA 1QY0A 1RXKA 3MBTA 3PECA 1Z24A 4I6SA 3VG6A 3AEHA 3WOVA 1STRB 4NYRA 1D3SA 2PI3O 3LTWA 1IFCA 1GXAA 1A3YA 4QYNA 4UU2A 3FA8A 4OS0A 5EDBA 1MEPA 2G78A 2L9CA 1KT6A 3VPJE 1MOYA 1EIIA 4HPCA 4U8UN 1PTSA 4OMWA 5BVSA 3PPTA 5HA1A 2WQ9A 1N43A 4GGTA 1KT5A 2QM9A 3QKGA 2FTBA 2E4JA 4BGFA 1AELA 5BYPA 2KD2A 4YGGA 2IZGB 2C4IA 2X55A 4Y5DA 2IZFB 3HWGA 1VWLB 3HK1A 3WBGA 1GT1A 1YWBA 3RWXA 3WXQA 3WZNA 2Y3FA 2ASNX 1JYJA 1LIFA 1VWKB 2GTLM 1B4MA 1TW4A 2HNXA 4IABA 3WZQA 1PBYA 1RXHA 4ARHA 2L68A 2WWPA 4ES7A 2LKKA 3APUA 4HWMA 3WJGA 4I3CA 4D6AA 5IRWA 2AT5X 3D95A 3K3LA 2C1SA 4QGXA 2A2GA 1X8UA 2OFAA 2WR6A 2WPUA 2RTRB 3VHMA 1P6PA 2MO5A 3IA8A 1YWCA 4AZMA 5FENA 3APVA 3BU9A 2X8TA 2CZTA 3KFHA 4L3RA 3KFIA 2IZLB 1LNMA 4LQZA 4PJ2A 5HZ9A 4YCEA 1ICNA 3RZYA 1KL4A 3WJFA 1JJXA 5DG4A 1SA8A 5L3YA 1ZRYA 4NNTA 4LKPA 3Q34A 4INNA 1N7YA 1DV9A 4O3XB 4ODDA 5AJCA 4NNSA 2NNEA 4EXZA 3MG5A 4QNIA 2R73A 3FEKA 1SRGA 5EEEA 3T2WA 1FENA 2BSZA 3RE5A 2A2UA 1T8VA 2A5CA 4OEMA 4DQ4A 2O62A 3S60A 2AMMX 2MF6A 3P6EA 1SWUA 2ZSCA 1SRJA 1SY1A 1YWAA 1ZNHA 1EPBA 2F73A 2OL8O 3CBSA 5D45A 4GZVA 5F7GA 3FMZA 4CPHB 4DNEA 1ZNGA 3PH5A 1UREA 4IMOA 4YFPA 3RBYA 2FKGA 2FS6A 2LBAA 3JSQA 4GKCA 1VYOA 1SWHA 1X8QA 1FE3A 3AKMA 4YGZA 3RDOA 4BQUA 5HAEA 1LICA 1SWCA 3SLOA 4CPIA 4IAWA 2MM3A 1D2UA 1OBQA 3F9DA 4CDDA 1PMPA 2GTLO 4HPDA 4GE1A 5CYBA 1SRHA 3PEDA 4ORXA 1SWQA 4HFOA 2X46A 1QFVA 5F58A 1G5WA 4ORRA 1BEBA 3HPEA 2NP1A 1DC9A 5HWZA 4WBKA 2AF5A 2G8CO 4GNWA 1S44A 5L8NA 1Y53X 2UYWA 1GT5A 5AJBA 1RBPA 2RD7C 1UZ2X 1ACDA 2AVIA 1Y52X 3FDCA 2OVEA 3D96A 4YDAA 4OMXA 1VWAB 3VG2A 2CBSA 1HQPA 2QMIA 1W5RA 1ZNDA 4TKBA 1QQSA 1B8EA 5LJCA 3WJCA 2JOZA 3P6CA 1VWQB 3VE1A 2Q2MA 3PQUA 2MWHA 2KT4B 4YKMA 5B11O 1MX7A 4KC8A 1SWOA 2Z4IA 3BS2A 1E5PA 3OE3A 2IZKA 4GU8A 2OY7A 3LV4A 4YFRA 1YP7A 5LJEA 2Q39A 3NX2A 1W4TA 1Y0GA 1GKAB 4MVLA 1HN2A 1EXSA 2HZQA 3VG4A 5FQ7E 1N9MA 1H91A 2RTLA 3C78X 3HWEA 1G85A 3P6GA 5LKFA 1GT4A 4U46A 5CE4A 2QOMA 3N91A 2A8GA 1NBXA 2IZJA 1I78A 1SWNA 3KVNA 3B2HA 4ZGFA 5HTEA 2OVAA 4FGIB 2GTLN 3OBLA 2BS5A 4XMHA 4ZHCA 4ZFXA 5CSEA 1LF7A 2GTFX 3RY2A 5H9KA 5HCDC 4JGLA 4ZCBA 1AVDA 4YFQA 1I05A 2A13A 4TJZA 4KC7A 2OL7A 4CDFA 2GC9A 3EW2A 3MVFA 1B0OA 4GRJA 2AL0X 4MISA 4NLIA 5B10O 4BCSA 1DZJA 2IZCB 1SY3A 4GJVA 2EU7X 2RCQA 1STSB 2A0AA 3V8UA 1RSTB 4YGHA 1SWRA 4O3YA 2RTQB 2FR3A 4O9SA 1KFFA 2RTOB 2L5PA 3RDQA 3TF6A 4EEJA 1BWYA 5B27A 1IW2A 4JHQA 4AZOA 1VWHB 4HPBA 4XMGA 4GGRA 4OS3A 3UEWA 1CRBA 2OVSA 1XKIA 5HZQA 4BX5A 4PSQA 5DPQA 3VG3A 4CPEA 1SWKA 1VWPB 3B2IA 1LIDA 4YKOA 3I17A 1LDOA 3PDFA 2X34A 4QQ1A 1CJ5A 5FFHA 1HXZA 3RSWA 1SWDA 1B56A 3FLLA 3P6HA 1JIWI 1SLEB 1FELA 3SLJA 2CAMA 1TVQA 2QO5A 2RTEB 4I3DA 3ZW0A 1SWLA 5L8OA 4RUUA 5EZ2A 4I95A 4IB9A 1QY1A 4O3WA 1I06A 2I5ZO 1MDCA 1QFTA 2BLGA 4IBAA 3KZAA 4ALOA 1ERBA 1SLDB 2ALLX 4FBOA 3SAOA 3EYCA 2F01A 3B2LA 3FEPA 3FYFA 2KTDA 2AT6X 1CBQA 2IZBA 1YUPA 2WSJA 2NNQA 1MK5A 4IB6A 5B5GA 1VWMB 2G79A 1ICMA 1YWDA 4GUZA 2FKJA 1JV4A 1SXYA 1QG5A 4CPFA 2W2AA 1X8OA 1AQBA 1FJ1E 4KT5A 4OELA 5IRAA 1CBRA 3UEXA 4EQAC 2KW1A 5B3MO 1Y9LA 4ZH6A 4DCBA 3HOLA 4NV8A 4D6BA 1SY0A 2ZAIA 3ZWEA 3GE2A 2Y3EA 1LUQA 2R56A 1IIUA 4N7CA 4EFGA 5IRUA 1NQMA 2OZQA 5IO5A 2A5BA 4M7MA 1T68X 1K3BA 2K62A 1VYGA 3LHNA 2LB6A 4NP1A 4U9CA 4UU3A 2YG2A 3D9WA 5D8JA 5FAZA 3H3IA 4COTA 2BHVA 2RTBB 1NC9A 4TQ2A 1X71A 2L67A
chains in the Genus database with same CATH topology
3KFGA 4YDBA 3TGBA 1ADLA 1KOIA 1R0UA 5HZ8A 1MVGA 3O19A 5HA0A 2JW1A 2JU3A 3CWKA 4CK4A 2G7BA 1OPBA 1HMTA 4MVIA 5KICA 1T0VA 4ID2A 3HWFA 4ZHHA 1CBSA 2JU7A 4KIIA 3ELXA 1HMSA 2F09A 1ERXA 2KTSA 4LZUA 3FELA 3VG7A 4RUNA 3S5XA 2AT3X 5F6BA 4ALBA 5IO7A 1GM6A 3G7XA 3FR2A 3JQOA 1EIOA 3P6DA 5L8IA 2FS7A 1JYDA 2JU8A 3DSZA 5HCEC 3CQRA 2RCTA 2NNDA 2WUTA 4AYHA 2BS6A 3BDRA 5H9LA 1A57A 4O3ZA 1TOUA 1G7NA 1DZMA 2Q4NA 3WJEA 3Q6LA 4A60A 3NQKA 3P6FA 1JZUA 1BSOA 3VU1A 3BRNA 5H9AA 2CM9A 1IFBA 3D4RA 4MVEA 2DM5A 5HCCC 3BLGA 5D48A 1BBPA 1IKEA 1HBPA 2PY1A 1LIBA 2N93A 3OJYC 1A18A 4QGWA 2OFRX 1DF3A 1U17A 1MUPA 4KH8A 1BM5A 4ZGUA 3IFBA 4A8ZA 1HBQA 4WFVA 1ZNEA 2RQ0A 5AQ6A 4A1HA 1Y9TA 3CR6A 5KHPA 1OEJA 2QO4A 1PBOA 4YBUA 3FA9A 3ZW1A 2ANSA 3BU1A 2XKLA 4I3BA 4ORWA 5FQ8E 1PEEA 3U0DA 1QABE 3NBXX 4ORUA 4N7DA 1N0SA 3U03A 1U0XA 2JMBA 4XMDA 5LJGA 3SOTA 1E02A 3I0AA 1KT7A 4ZJ0A 3ZZVA 1YP6A 2QO6A 1GT3A 1VPRA 1NP4A 4YH0A 1GGLA 2RA6A 4IMNA 1O1VA 2WEXA 4MVKA 2GJ5A 3O22A 1I4UA 1E06A 3KFFA 2MHDA 2MJIA 4O4SA 5HZ5A 1LKEA 3HOEA 1TXLA 3JS1A 3WJDA 1SXUA 1KZXA 5HZ6A 1X89A 3B2KA 3P24A 3TGCA 4ORYA 4ZHGA 3F6ZB 1DZPA 1HMRA 5B29A 1NGLA 3AKNA 1L6MA 2R74A 1XCAA 4GDZA 1U18A 1O1UA 4TKHA 3BX7A 4Y0QA 5LJDA 5EPQA 5HTDA 3WJBA 4IAXA 4QZTA 1A2DA 1MX8A 1YIVA 4QAEA 4FQBB 1LPJA 2Q9SA 1ZNKA 1S7DA 4GH7A 4CSBA 1O8VA 2OFMX 2X8FA 3RKGA 1EALA 1S2PA 3FR4A 5HBSA 1NP1A 2AT8X 5K06A 5LJKA 3FW4A 3BY0A 3KQ0A 3PQSA 3ZUOA 4DQ3A 4WHIA 2YMSA 2HYSA 3C77X 3FA6A 1ALBA 2FRSA 4AZQA 3NX1A 1DZKA 1I04A 3OD9A 3CMPA 2FLJA 4AW8A 1KT4A 1QWDA 2ACOA 4KCAA 3PH6A 4TKJA 2FR2A 4XMFA 2ZAGA 2LFOA 1OEEA 4WFUA 4I9RA 3S5VA 1CBIA 2JN3A 3ZQ3A 5KIDA 4AZNA 1KZWA 1KXOA 3U9PC 3GAQA 4R0BA 2CM4A 2P8GA 3E3CA 3NQ9A 1TOWA 1E00A 4TLJA 1BLRA 3FA7A 4QZUA 4HPAA 2AH7X 3STMX 4CV7A 1X8PA 2WQAE 3NQ3A 4YCHA 1LIEA 4FBVA 4U8UM 5LJHA 4AZPA 3STNA 4EDEA 4BVMA 1SMPI 3MX7A 2IFBA 3EM0A 4OS8A 5H8TA 4AZRA 1BJ7A 4NYQA 2HLVA 3TGAA 2X45A 4I9SA 4NLJA 4GNYA 5BVQA 2OVDA 5EDCA 4FBRA 1VYFA 5H9NA 1AB0A 4TNNA 1JJJA 3DTQA 2LBVA 1GX9A 1OEKA 3ZI8A 4YMYA 3CBCA 3O2YA 3EBWA 2Q2PA 3APWA 1GX8A 2POAA 2W2BA 3UEVA 4NW4A 1BSQA 3NPOA 1OPAA 4QYPA 1G74A 1EUOA 2CBRA 4M6SA 5C0NA 4O4XA 3APXA 1FDQA 3FW5A 4QRLA 4Y0SA 2A3FX 3UEUA 4XMEA 4K19A 1FTPA 2K23A 1AVGI 4O49A 4IB7A 4IB8A 4ON1A 1OBUA 3WVMA 5D47A 3PP6A 3F8AA 4MIRA 1X8NA 3UAQA 2CZUA 3VE2A 4LZVA 3T1DA 1KT3A 3ZW1B 5F6ZA 4ZR2A 3NR3A 2HMBA 2HZRA 5LKEA 4ZH9A 3NP1A 3HWDA 2AKQA 3TZSA 4ORSA 3C76X 4A1YA 2RN4A 1GKAA 4O4UA 2QOSC 2FWVA 3HTYA 3L4RA 3BX8A 2M4LA 1JBHA 2X8SA 1SY2A 5BVTA 5LJBA 1EI5A 1DFVA 2WEWA 1KQXA 4U8UO 2BT9A 4ZHDA 1KGLA 1EW3A 2XSTA 1ML7A 4ML7B 3ELZA 2ACPX 2W2FA 1PM1X 1KQWA 3EBKA 1BRQA 1OBPA 4GK9A 5D4AA 1BSYA 1RLBE 4O4OA 1ZNLA 5EEDA 4QGVA 4LKTA 2AT0X 1BRPA 3D97A 5FQ6E 2LA7A 3FIQA 5JR8A 3FR5A 1SXWA 1EPAA 4GETA 3S26A 5F1EA 3STKA 3EMMA 3NADA 3ZW0B 1FEMA 4Y0PA 4BOEA 3BSZE 3FENA 1IKJA 4U3QA 4Y0RA 5IO6A 3VG5A 4L1NA 3CQNA 3ZW2A 2FT9A 1SXXA 3B2JA 2Z4HA 1QY2A 5AEOA 1EQDA 4XMCA 3P02A 1LFOA 1QY0A 3MBTA 3PECA 1Z24A 4I6SA 3VG6A 3WOVA 4NYRA 1D3SA 4QYNA 4UU2A 1IFCA 1GXAA 1A3YA 5EDBA 3VPJE 3FA8A 4OS0A 1EIIA 2G78A 2L9CA 1KT6A 4HPCA 4U8UN 4OMWA 5BVSA 3PPTA 5HA1A 2WQ9A 1KT5A 2QM9A 3QKGA 2FTBA 2E4JA 5BYPA 2KD2A 4YGGA 3HWGA 3HK1A 3WBGA 3WXQA 1GT1A 1YWBA 3RWXA 2ASNX 1JYJA 1LIFA 2GTLM 1B4MA 1TW4A 2HNXA 4IABA 4ARHA 2L68A 2WWPA 2LKKA 3APUA 4HWMA 3WJGA 4I3CA 4D6AA 2AT5X 3D95A 3K3LA 4QGXA 2A2GA 1X8UA 2WR6A 1P6PA 2MO5A 3IA8A 1YWCA 4AZMA 5FENA 3APVA 3BU9A 2X8TA 2CZTA 3KFHA 4L3RA 3KFIA 1LNMA 4LQZA 4PJ2A 5HZ9A 4YCEA 1ICNA 3RZYA 3WJFA 1JJXA 5DG4A 1SA8A 1ZRYA 4NNTA 4LKPA 4INNA 1DV9A 4O3XB 4ODDA 5AJCA 4NNSA 2NNEA 4EXZA 4QNIA 2R73A 3FEKA 5EEEA 1FENA 2A2UA 1T8VA 4DQ4A 2O62A 3S60A 2AMMX 3P6EA 1SY1A 1YWAA 1ZNHA 1EPBA 2F73A 3CBSA 5D45A 4GZVA 5F7GA 3FMZA 1ZNGA 3PH5A 1UREA 4IMOA 4YFPA 3RBYA 2FS6A 2LBAA 3JSQA 4GKCA 3AKMA 1X8QA 4YGZA 1FE3A 4BQUA 5HAEA 1LICA 4IAWA 2MM3A 1D2UA 1OBQA 3F9DA 1PMPA 2GTLO 4HPDA 4GE1A 5CYBA 3PEDA 4ORXA 4HFOA 2X46A 1QFVA 5F58A 1G5WA 4ORRA 1BEBA 2NP1A 1DC9A 5HWZA 4WBKA 4GNWA 5L8NA 1S44A 1GT5A 5AJBA 1RBPA 2RD7C 1UZ2X 1ACDA 4YDAA 4YBPA 2OVEA 3D96A 4OMXA 4TKBA 3VG2A 2CBSA 1HQPA 2QMIA 1ZNDA 1QQSA 1B8EA 5LJCA 3WJCA 2JOZA 3P6CA 3VE1A 2Q2MA 3PQUA 2MWHA 2KT4B 4YKMA 1MX7A 4KC8A 2Z4IA 3BS2A 1E5PA 3OE3A 4GU8A 3LV4A 4YFRA 1YP7A 5LJEA 2Q39A 3NX2A 4ES7A 1GKAB 4MVLA 1HN2A 1EXSA 2HZQA 3VG4A 5FQ7E 1H91A 3C78X 3HWEA 5CE4A 1G85A 3P6GA 5LKFA 1GT4A 3N91A 3B2HA 4ZGFA 5HTEA 2OVAA 4FGIB 2GTLN 3OBLA 2BS5A 4XMHA 4ZHCA 4ZFXA 1LF7A 2GTFX 5H9KA 5HCDC 4JGLA 4ZCBA 4YFQA 1I05A 2A13A 4TJZA 4KC7A 4ZHFA 2GC9A 4MISA 3MVFA 1B0OA 4GRJA 2AL0X 4NLIA 1DZJA 1SY3A 2EU7X 2RCQA 2A0AA 3V8UA 4YGHA 4O3YA 2FR3A 4O9SA 2L5PA 3TF6A 4EEJA 1BWYA 5B27A 1IW2A 4AZOA 4HPBA 4XMGA 4OS3A 3UEWA 1CRBA 2OVSA 1XKIA 5HZQA 4PSQA 5DPQA 3VG3A 3B2IA 4YKOA 1LIDA 3I17A 1CJ5A 4QQ1A 5FFHA 3RSWA 1B56A 3FLLA 3P6HA 1JIWI 1FELA 3ZW0A 5L8OA 1TVQA 2QO5A 4I3DA 4RUUA 5EZ2A 4I95A 4IB9A 1QY1A 4O3WA 1I06A 1MDCA 1QFTA 2BLGA 4IBAA 3KZAA 4ALOA 1ERBA 4FBOA 2ALLX 3SAOA 3EYCA 3B2LA 3FEPA 3FYFA 2KTDA 2AT6X 1CBQA 1YUPA 2WSJA 2NNQA 4IB6A 2G79A 1ICMA 1YWDA 1JV4A 1SXYA 1QG5A 2W2AA 1X8OA 1AQBA 4KT5A 1CBRA 3UEXA 4EQAC 2KW1A 1Y9LA 4ZH6A 3HOLA 4D6BA 1SY0A 2ZAIA 3ZWEA 3GE2A 2R56A 1IIUA 4N7CA 4EFGA 5IO5A 2OZQA 3ZUIA 4M7MA 1T68X 4UU3A 2K62A 1VYGA 3LHNA 2LB6A 4NP1A 4U9CA 5D8JA 2YG2A 4COTA 1AELA 5FAZA 3H3IA 2BHVA 4TQ2A 1X71A 2L67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFG A;  4YDB A;  3TGB A;  1ADL A;  1KOI A;  1R0U A;  5HZ8 A;  1MVG A;  3O19 A;  5HA0 A;  2JU3 A;  3CWK A;  4CK4 A;  2G7B A;  1OPB A;  1HMT A;  4MVI A;  5KIC A;  1T0V A;  3HWF A;  4ZHH A;  1CBS A;  2JU7 A;  4KII A;  3ELX A;  1HMS A;  1ERX A;  4LZU A;  3FEL A;  3VG7 A;  4RUN A;  2AT3 X;  5F6B A;  4ALB A;  5IO7 A;  1GM6 A;  3G7X A;  3FR2 A;  1EIO A;  3P6D A;  5L8I A;  2FS7 A;  1JYD A;  2JU8 A;  3DSZ A;  5HCE C;  3CQR A;  2RCT A;  2NND A;  2WUT A;  4AYH A;  3BDR A;  5H9L A;  1A57 A;  1TOU A;  1G7N A;  1DZM A;  2Q4N A;  3WJE A;  3Q6L A;  4A60 A;  3P6F A;  1JZU A;  1BSO A;  3BRN A;  5H9A A;  2CM9 A;  1IFB A;  2DM5 A;  5HCC C;  3BLG A;  5D48 A;  1BBP A;  1IKE A;  1HBP A;  2PY1 A;  1LIB A;  2N93 A;  3OJY C;  1A18 A;  4QGW A;  2OFR X;  1DF3 A;  1U17 A;  1MUP A;  1BM5 A;  4ZGU A;  3IFB A;  4A8Z A;  1HBQ A;  4WFV A;  1ZNE A;  2RQ0 A;  5AQ6 A;  4A1H A;  3CR6 A;  5KHP A;  1OEJ A;  2QO4 A;  1PBO A;  4YBU A;  3FA9 A;  2ANS A;  3BU1 A;  2XKL A;  4I3B A;  4ORW A;  1PEE A;  3U0D A;  1QAB E;  4ORU A;  4N7D A;  1N0S A;  3U03 A;  1U0X A;  4XMD A;  5LJG A;  1E02 A;  3I0A A;  1KT7 A;  4ZJ0 A;  1YP6 A;  2QO6 A;  1GT3 A;  1VPR A;  1NP4 A;  4YH0 A;  1GGL A;  2RA6 A;  4IMN A;  1O1V A;  2WEX A;  4MVK A;  2GJ5 A;  3O22 A;  1I4U A;  1E06 A;  3KFF A;  2MJI A;  5HZ5 A;  1LKE A;  3JS1 A;  1TXL A;  3WJD A;  1SXU A;  1KZX A;  5HZ6 A;  1X89 A;  3B2K A;  3TGC A;  4ORY A;  4ZHG A;  1DZP A;  1HMR A;  5B29 A;  1NGL A;  3AKN A;  1L6M A;  2R74 A;  1XCA A;  1U18 A;  1O1U A;  4TKH A;  3BX7 A;  4Y0Q A;  5LJD A;  5EPQ A;  5HTD A;  3WJB A;  4IAX A;  4QZT A;  1A2D A;  1MX8 A;  1YIV A;  4QAE A;  1LPJ A;  2Q9S A;  1ZNK A;  1S7D A;  4GH7 A;  1O8V A;  2OFM X;  1EAL A;  1S2P A;  3FR4 A;  5HBS A;  1NP1 A;  2AT8 X;  5K06 A;  5LJK A;  3FW4 A;  3BY0 A;  3KQ0 A;  3ZUO A;  4DQ3 A;  3C77 X;  2HYS A;  3FA6 A;  1ALB A;  2FRS A;  4AZQ A;  3NX1 A;  1DZK A;  1I04 A;  3CMP A;  2FLJ A;  4AW8 A;  1KT4 A;  1QWD A;  2ACO A;  3PH6 A;  4TKJ A;  2FR2 A;  4XMF A;  2LFO A;  1OEE A;  4WFU A;  4I9R A;  1CBI A;  2JN3 A;  3ZQ3 A;  5KID A;  4AZN A;  1KZW A;  1KXO A;  3U9P C;  3GAQ A;  4R0B A;  2CM4 A;  2P8G A;  3NQ9 A;  1TOW A;  1E00 A;  4TLJ A;  1BLR A;  3FA7 A;  4QZU A;  4HPA A;  2AH7 X;  3STM X;  1X8P A;  2WQA E;  3NQ3 A;  4YCH A;  1LIE A;  5LJH A;  4AZP A;  3STN A;  4EDE A;  4BVM A;  2IFB A;  3EM0 A;  4OS8 A;  5H8T A;  4AZR A;  1BJ7 A;  4NYQ A;  2HLV A;  3TGA A;  2X45 A;  4I9S A;  4NLJ A;  4GNY A;  5BVQ A;  2OVD A;  5EDC A;  1VYF A;  5H9N A;  1AB0 A;  4TNN A;  1JJJ A;  3DTQ A;  2LBV A;  1GX9 A;  1OEK A;  4YMY A;  3CBC A;  3O2Y A;  3EBW A;  2Q2P A;  3APW A;  2W2B A;  1GX8 A;  2POA A;  3UEV A;  1BSQ A;  3NPO A;  1OPA A;  4QYP A;  1G74 A;  1EUO A;  2CBR A;  4M6S A;  5C0N A;  3APX A;  1FDQ A;  3FW5 A;  4Y0S A;  2A3F X;  3UEU A;  4XME A;  4K19 A;  1FTP A;  2K23 A;  1AVG I;  4IB7 A;  4IB8 A;  1OBU A;  3WVM A;  5D47 A;  3PP6 A;  3F8A A;  1X8N A;  2CZU A;  4LZV A;  3T1D A;  1KT3 A;  5F6Z A;  4ZR2 A;  3NR3 A;  2HMB A;  2HZR A;  5LKE A;  4ZH9 A;  3NP1 A;  3HWD A;  2AKQ A;  3TZS A;  4ORS A;  3C76 X;  4A1Y A;  1GKA A;  2QOS C;  2FWV A;  3L4R A;  3BX8 A;  1JBH A;  1SY2 A;  5BVT A;  5LJB A;  2WEW A;  1DFV A;  1KGL A;  1KQX A;  4ZHD A;  1EW3 A;  2XST A;  1ML7 A;  3ELZ A;  2ACP X;  2W2F A;  1PM1 X;  1KQW A;  3EBK A;  1BRQ A;  1OBP A;  5D4A A;  1BSY A;  1RLB E;  1ZNL A;  5EED A;  4QGV A;  4LKT A;  2AT0 X;  1BRP A;  3D97 A;  3FIQ A;  5JR8 A;  3FR5 A;  1SXW A;  1EPA A;  4GET A;  3S26 A;  5F1E A;  3STK A;  3EMM A;  3NAD A;  1FEM A;  4Y0P A;  4BOE A;  3BSZ E;  3FEN A;  1IKJ A;  4Y0R A;  5IO6 A;  3VG5 A;  3CQN A;  2FT9 A;  1SXX A;  3B2J A;  1QY2 A;  1EQD A;  4XMC A;  1LFO A;  1QY0 A;  3MBT A;  3PEC A;  1Z24 A;  3VG6 A;  4NYR A;  1D3S A;  4QYN A;  4UU2 A;  1IFC A;  1GXA A;  1A3Y A;  5EDB A;  3FA8 A;  4OS0 A;  1EII A;  2G78 A;  2L9C A;  1KT6 A;  4HPC A;  4OMW A;  5BVS A;  3PPT A;  5HA1 A;  2WQ9 A;  1KT5 A;  2QM9 A;  3QKG A;  2FTB A;  2E4J A;  4YGG A;  3HWG A;  3HK1 A;  3WBG A;  3WXQ A;  1GT1 A;  1YWB A;  2ASN X;  1JYJ A;  1LIF A;  1B4M A;  1TW4 A;  2HNX A;  4ARH A;  2L68 A;  2WWP A;  2LKK A;  3APU A;  3WJG A;  4I3C A;  4D6A A;  2AT5 X;  3D95 A;  3K3L A;  4QGX A;  2A2G A;  1X8U A;  2WR6 A;  1P6P A;  2MO5 A;  3IA8 A;  1YWC A;  4AZM A;  5FEN A;  3APV A;  3BU9 A;  2CZT A;  3KFH A;  3KFI A;  1LNM A;  5HZ9 A;  4YCE A;  1ICN A;  3RZY A;  3WJF A;  1JJX A;  5DG4 A;  1SA8 A;  1ZRY A;  4NNT A;  4LKP A;  1DV9 A;  4ODD A;  4NNS A;  2NNE A;  4EXZ A;  2R73 A;  3FEK A;  5EEE A;  1FEN A;  2A2U A;  1T8V A;  4DQ4 A;  2O62 A;  2AMM X;  3P6E A;  1SY1 A;  1YWA A;  1ZNH A;  1EPB A;  2F73 A;  3CBS A;  5D45 A;  5F7G A;  3FMZ A;  1ZNG A;  3PH5 A;  1URE A;  4IMO A;  4YFP A;  2FS6 A;  2LBA A;  3JSQ A;  4GKC A;  3AKM A;  1X8Q A;  4YGZ A;  1FE3 A;  4BQU A;  5HAE A;  1LIC A;  4IAW A;  2MM3 A;  1D2U A;  1OBQ A;  3F9D A;  1PMP A;  4HPD A;  4GE1 A;  3PED A;  4ORX A;  4HFO A;  2X46 A;  1QFV A;  5F58 A;  1G5W A;  4ORR A;  1BEB A;  2NP1 A;  1DC9 A;  5HWZ A;  4WBK A;  4GNW A;  5L8N A;  1S44 A;  1GT5 A;  1RBP A;  2RD7 C;  1UZ2 X;  1ACD A;  4YDA A;  4YBP A;  2OVE A;  3D96 A;  4OMX A;  4TKB A;  3VG2 A;  2CBS A;  1HQP A;  1ZND A;  1QQS A;  1B8E A;  5LJC A;  3WJC A;  2JOZ A;  3P6C A;  2Q2M A;  4YKM A;  2KT4 B;  1MX7 A;  3BS2 A;  1E5P A;  4YFR A;  1YP7 A;  5LJE A;  2Q39 A;  3NX2 A;  4ES7 A;  1GKA B;  4MVL A;  1HN2 A;  1EXS A;  2HZQ A;  3VG4 A;  1H91 A;  3C78 X;  3HWE A;  5CE4 A;  1G85 A;  3P6G A;  5LKF A;  1GT4 A;  3B2H A;  5HTE A;  2OVA A;  4XMH A;  4ZHC A;  4ZFX A;  1LF7 A;  2GTF X;  5H9K A;  5HCD C;  4ZCB A;  4YFQ A;  1I05 A;  2A13 A;  4TJZ A;  4ZHF A;  2GC9 A;  3MVF A;  1B0O A;  4GRJ A;  2AL0 X;  4NLI A;  1DZJ A;  1SY3 A;  2EU7 X;  2RCQ A;  2A0A A;  4YGH A;  2FR3 A;  4O9S A;  2L5P A;  3TF6 A;  4EEJ A;  1BWY A;  5B27 A;  1IW2 A;  4AZO A;  4HPB A;  4XMG A;  4OS3 A;  3UEW A;  1CRB A;  1XKI A;  5HZQ A;  4PSQ A;  5DPQ A;  3VG3 A;  3B2I A;  4YKO A;  1LID A;  3I17 A;  1CJ5 A;  5FFH A;  3RSW A;  1B56 A;  3FLL A;  3P6H A;  1FEL A;  5L8O A;  1TVQ A;  2QO5 A;  4I3D A;  4RUU A;  5EZ2 A;  4IB9 A;  1QY1 A;  1I06 A;  1MDC A;  1QFT A;  2BLG A;  4IBA A;  3KZA A;  4ALO A;  1ERB A;  3SAO A;  2ALL X;  3EYC A;  3B2L A;  3FEP A;  2KTD A;  2AT6 X;  1CBQ A;  1YUP A;  2WSJ A;  2NNQ A;  4IB6 A;  2G79 A;  1ICM A;  1YWD A;  1JV4 A;  1SXY A;  1QG5 A;  2W2A A;  1X8O A;  1AQB A;  1CBR A;  3UEX A;  4ZH6 A;  4D6B A;  1SY0 A;  2R56 A;  1IIU A;  4N7C A;  4EFG A;  5IO5 A;  2OZQ A;  3ZUI A;  4M7M A;  1T68 X;  4UU3 A;  2K62 A;  1VYG A;  4NP1 A;  2LB6 A;  5D8J A;  1AEL A;  2YG2 A;  5FAZ A;  4TQ2 A;  1X71 A;  2L67 A; 
#chains in the Genus database with same CATH topology
 2OY1 O;  3KFG A;  1VWC B;  4YDB A;  1ADL A;  1KOI A;  1R0U A;  4BBO A;  1MVG A;  5HZ8 A;  3TGB A;  3O19 A;  5HA0 A;  2JW1 A;  2JU3 A;  2RTH B;  3CWK A;  3T2X A;  1SWA A;  1SWF A;  2DJF A;  4CK4 A;  2G7B A;  1LCV A;  1OPB A;  1HMT A;  4MVI A;  5KIC A;  4EKV A;  1T0V A;  4ID2 A;  3HWF A;  4ZHH A;  3T6F A;  5K67 A;  1CBS A;  2JU7 A;  4KII A;  3ELX A;  1NDJ A;  1HMS A;  2F09 A;  1ERX A;  2KTS A;  2VDF A;  4LZU A;  1SRF A;  4JNJ A;  2IZD B;  1MM9 A;  3VGW A;  3FEL A;  3VG7 A;  1KL5 A;  4RUN A;  3S5X A;  2AT3 X;  5F6B A;  1K24 A;  4ALB A;  3EC5 A;  5IO7 A;  4I60 A;  1GM6 A;  3G7X A;  1RSU B;  3FR2 A;  1UYN X;  3JQO A;  4GGZ A;  3WZO A;  3X00 A;  1EIO A;  4JO6 A;  3P6D A;  4Y59 A;  5L8I A;  2RTI B;  2FS7 A;  2IZA A;  4Z2O A;  1JYD A;  2JU8 A;  3DSZ A;  5HCE C;  1LEL A;  3CQR A;  3RY1 A;  2RCT A;  1AVE A;  2NND A;  2RTM A;  2WUT A;  2OFB A;  4AYH A;  2BS6 A;  4CPH A;  3BDR A;  5H9L A;  1A57 A;  4O3Z A;  1TOU A;  3FID A;  1G7N A;  1DZM A;  3AUM O;  2Q4N A;  3WJE A;  3Q6L A;  4A60 A;  2IZH B;  3NQK A;  2QCB A;  3P6F A;  1BSO A;  3VU1 A;  1JZU A;  3BRN A;  5H9A A;  2CM9 A;  1IFB A;  3D4R A;  1N9Y A;  4MVE A;  4GJS A;  5CHK A;  2VFB A;  2DM5 A;  5HCC C;  3BLG A;  5D48 A;  1BBP A;  1IKE A;  1HBP A;  2PY1 A;  1LIB A;  2N93 A;  1VWF B;  1A18 A;  3OJY C;  4QGW A;  2OFR X;  1DF3 A;  1U17 A;  1MUP A;  4KH8 A;  3EW1 A;  1BM5 A;  2G5L A;  3IFB A;  4A8Z A;  4ZGU A;  1HBQ A;  4WFV A;  1ZNE A;  2RQ0 A;  5AQ6 A;  4A1H A;  1Y9T A;  5F2B A;  1RXJ A;  3CR6 A;  5KHP A;  2OL6 O;  1OEJ A;  2QO4 A;  1PBO A;  4CDC A;  4YBU A;  4BX7 A;  3FA9 A;  3ZW1 A;  2ANS A;  3BU1 A;  2FGS A;  2XKL A;  4I3B A;  2RTD B;  4ORW A;  5FQ8 E;  1PEE A;  1QAB E;  3VHH A;  3U0D A;  3NBX X;  4ORU A;  4N7D A;  1N0S A;  3U03 A;  1U0X A;  2JMB A;  4XMD A;  5LJG A;  3SOT A;  2GH7 A;  1E02 A;  3I0A A;  4OKA A;  3RE6 A;  3T6L A;  1KT7 A;  4ZJ0 A;  3ZZV A;  3ZUI A;  1YP6 A;  2QO6 A;  1GT3 A;  1JJU A;  1KL3 A;  1N4J A;  1VPR A;  2X4M A;  1NP4 A;  4YH0 A;  1SWS A;  4CDE A;  1GGL A;  4Z28 A;  2RA6 A;  1SWG A;  4IMN A;  1WBI A;  1O1V A;  2WEX A;  4MVK A;  2GJ5 A;  1Y55 X;  3O22 A;  1I4U A;  4BX5 B;  1LDQ A;  1E06 A;  4NV7 A;  3KFF A;  2MHD A;  3VHI A;  2MJI A;  4O4S A;  2IZI A;  5HZ5 A;  1LKE A;  3HOE A;  1TXL A;  3JS1 A;  2UZ2 A;  3WJD A;  1SXU A;  1KZX A;  1OSP O;  5HZ6 A;  1X89 A;  3B2K A;  2RTK A;  3P24 A;  3TGC A;  4ORY A;  2RTN B;  3F6Z B;  4ZHG A;  1RAV A;  1DZP A;  1HMR A;  5B29 A;  1NGL A;  3AKN A;  1L6M A;  2R74 A;  5JD2 A;  1XCA A;  4GDZ A;  1U18 A;  1O1U A;  1HY2 A;  4TKH A;  3BX7 A;  4Y0Q A;  5LJD A;  4GDA A;  1VWO B;  5EPQ A;  2X32 A;  5HTD A;  3WJB A;  4IAX A;  4QZT A;  3CKG A;  1A2D A;  1NQN A;  3RDM A;  1MX8 A;  1YIV A;  4QAE A;  1VWG B;  1LPJ A;  4FQB B;  2Q9S A;  1ZNK A;  2OF9 A;  4B55 A;  4YVB A;  1S7D A;  2HKD A;  4GH7 A;  4CSB A;  1STP A;  1O8V A;  2OFM X;  1JMZ A;  2X8F A;  3RKG A;  1SWT A;  2OY8 A;  1S2P A;  2RTG B;  1EAL A;  3FR4 A;  5HBS A;  1E2T A;  1NP1 A;  2AT8 X;  5K06 A;  5LJK A;  3FW4 A;  3BY0 A;  3KQ0 A;  3PQS A;  1JMX A;  3ZUO A;  4DQ3 A;  4WHI A;  2YMS A;  2HYS A;  3C77 X;  3FA6 A;  1ALB A;  2FRS A;  4AZQ A;  2DJG A;  4BX6 B;  3CKF A;  3NX1 A;  2OY5 O;  1DZK A;  1I04 A;  1VWI B;  3CMP A;  3OD9 A;  1JQP A;  2FLJ A;  1I9H A;  1KT4 A;  1QWD A;  2ACO A;  2Y32 A;  4AW8 A;  1SLG B;  4KCA A;  3PH6 A;  4TKJ A;  2FR2 A;  4XMF A;  2ZAG A;  3WZP A;  2FHN X;  2LFO A;  4IRW A;  1OEE A;  4WFU A;  4I9R A;  3RDS A;  3S5V A;  4ZHF A;  1CBI A;  2C1Q A;  2JN3 A;  3ZQ3 A;  5KID A;  4AZN A;  2RTC B;  1KZW A;  1KXO A;  3U9P C;  3GAQ A;  4R0B A;  4Z27 A;  2CM4 A;  2P8G A;  3E3C A;  3NQ9 A;  3SZJ A;  1TOW A;  1E00 A;  4TLJ A;  1BLR A;  3FA7 A;  4QZU A;  1IJ8 A;  4HPA A;  2AH7 X;  3STM X;  4CV7 A;  1X8P A;  2WQA E;  3NQ3 A;  4YCH A;  1LIE A;  1SWE A;  4FBV A;  4U8U M;  5LJH A;  4AZP A;  3MM0 A;  3RDU A;  3STN A;  4BVM A;  4EDE A;  1SMP I;  3MX7 A;  1LCZ A;  2IFB A;  3EM0 A;  4OS8 A;  5H8T A;  4AZR A;  1BJ7 A;  4NYQ A;  2HLV A;  3TGA A;  2FHL A;  2X45 A;  4I9S A;  1W6F A;  4NLJ A;  4YBP A;  4GNY A;  1DF8 A;  5BVQ A;  4Z2P A;  2OVD A;  5EDC A;  4FBR A;  1VYF A;  5H9N A;  1AB0 A;  3WYP A;  4BJ8 A;  4TNN A;  1JJJ A;  2RTJ A;  3DTQ A;  2LBV A;  1GX9 A;  4Z2V A;  1OEK A;  1VWD B;  2BC3 A;  3ZI8 A;  4YMY A;  3CBC A;  3O2Y A;  3SLT A;  3EBW A;  5IXG A;  2Q2P A;  3APW A;  5B2A O;  1GX8 A;  2POA A;  2W2B A;  3UEV A;  4NW4 A;  1BSQ A;  3NPO A;  1OPA A;  4QYP A;  1G74 A;  1EUO A;  2CBR A;  4M6S A;  3PK2 A;  4O4X A;  4Z6J A;  5C0N A;  3APX A;  1FDQ A;  3FW5 A;  4QRL A;  4Y0S A;  2A3F X;  3UEU A;  4XME A;  1SWB A;  4K19 A;  1FTP A;  1VWJ B;  1AVG I;  2K23 A;  4IB7 A;  4IB8 A;  4O49 A;  4ON1 A;  1OBU A;  3WVM A;  5D47 A;  3PP6 A;  3F8A A;  4MIR A;  1X8N A;  3UAQ A;  4BX7 B;  2CZU A;  2X56 A;  3VE2 A;  1SRE A;  4LZV A;  1KT3 A;  3T1D A;  3ZW1 B;  5F6Z A;  1SWJ A;  4ZR2 A;  3WYQ A;  3NR3 A;  1SRI A;  2HMB A;  2HZR A;  5LKE A;  4ZH9 A;  3NP1 A;  3HWD A;  1SLF B;  2AKQ A;  1VWR B;  4ORS A;  3TZS A;  3C76 X;  1VWB B;  2IZE B;  1GKA A;  2RN4 A;  4O4U A;  4A1Y A;  2JGS A;  2QOS C;  2FWV A;  3HTY A;  3L4R A;  3BX8 A;  1UYO X;  2M4L A;  2X8S A;  1JBH A;  1SY2 A;  2RTF B;  5BVT A;  2OF8 A;  5LJB A;  2RTP B;  2OYB O;  1EI5 A;  1DFV A;  2WEW A;  1KQX A;  4U8U O;  2BT9 A;  3RDX A;  4ZHD A;  1KGL A;  1EW3 A;  1VWN B;  2XST A;  4MEE A;  1ML7 A;  1GX3 A;  4ML7 B;  3ELZ A;  2ACP X;  2W2F A;  1PM1 X;  1KQW A;  3EBK A;  1BRQ A;  1OBP A;  4GK9 A;  5D4A A;  1BSY A;  1RLB E;  4O4O A;  1HQQ A;  1ZNL A;  5EED A;  1LCW A;  2VFC A;  5K68 A;  4BX6 A;  4QGV A;  4LKT A;  2AT0 X;  1BRP A;  3D97 A;  4GD9 A;  5FQ6 E;  3SZH A;  2LA7 A;  3FIQ A;  5JR8 A;  3FR5 A;  1SXW A;  2RTA A;  1EPA A;  4GET A;  3S26 A;  3QQ2 A;  1SWP A;  3EMM A;  3NAD A;  5F1E A;  3STK A;  3ZW0 B;  1FEM A;  4C5P A;  4Y0P A;  4BOE A;  3SZI A;  3BSZ E;  3FEN A;  1IKJ A;  1VWE B;  4U3Q A;  1HXL A;  4Y0R A;  5IO6 A;  3VG5 A;  4L1N A;  3CQN A;  3ZW2 A;  2FT9 A;  1SXX A;  3B2J A;  2Z4H A;  1QY2 A;  5AEO A;  1EQD A;  4XMC A;  2I5V O;  3P02 A;  5B5F A;  1LFO A;  1WUB A;  1QY0 A;  1RXK A;  3MBT A;  3PEC A;  1Z24 A;  4I6S A;  3VG6 A;  3AEH A;  3WOV A;  1STR B;  4NYR A;  1D3S A;  2PI3 O;  3LTW A;  1IFC A;  1GXA A;  1A3Y A;  4QYN A;  4UU2 A;  3FA8 A;  4OS0 A;  5EDB A;  1MEP A;  2G78 A;  2L9C A;  1KT6 A;  3VPJ E;  1MOY A;  1EII A;  4HPC A;  4U8U N;  1PTS A;  4OMW A;  5BVS A;  3PPT A;  5HA1 A;  2WQ9 A;  1N43 A;  4GGT A;  1KT5 A;  2QM9 A;  3QKG A;  2FTB A;  2E4J A;  4BGF A;  1AEL A;  5BYP A;  2KD2 A;  4YGG A;  2IZG B;  2C4I A;  2X55 A;  4Y5D A;  2IZF B;  3HWG A;  1VWL B;  3HK1 A;  3WBG A;  1GT1 A;  1YWB A;  3RWX A;  3WXQ A;  3WZN A;  2Y3F A;  2ASN X;  1JYJ A;  1LIF A;  1VWK B;  2GTL M;  1B4M A;  1TW4 A;  2HNX A;  4IAB A;  3WZQ A;  1PBY A;  1RXH A;  4ARH A;  2L68 A;  2WWP A;  4ES7 A;  2LKK A;  3APU A;  4HWM A;  3WJG A;  4I3C A;  4D6A A;  5IRW A;  2AT5 X;  3D95 A;  3K3L A;  2C1S A;  4QGX A;  2A2G A;  1X8U A;  2OFA A;  2WR6 A;  2WPU A;  2RTR B;  3VHM A;  1P6P A;  2MO5 A;  3IA8 A;  1YWC A;  4AZM A;  5FEN A;  3APV A;  3BU9 A;  2X8T A;  2CZT A;  3KFH A;  4L3R A;  3KFI A;  2IZL B;  1LNM A;  4LQZ A;  4PJ2 A;  5HZ9 A;  4YCE A;  1ICN A;  3RZY A;  1KL4 A;  3WJF A;  1JJX A;  5DG4 A;  1SA8 A;  5L3Y A;  1ZRY A;  4NNT A;  4LKP A;  3Q34 A;  4INN A;  1N7Y A;  1DV9 A;  4O3X B;  4ODD A;  5AJC A;  4NNS A;  2NNE A;  4EXZ A;  3MG5 A;  4QNI A;  2R73 A;  3FEK A;  1SRG A;  5EEE A;  3T2W A;  1FEN A;  2BSZ A;  3RE5 A;  2A2U A;  1T8V A;  2A5C A;  4OEM A;  4DQ4 A;  2O62 A;  3S60 A;  2AMM X;  2MF6 A;  3P6E A;  1SWU A;  2ZSC A;  1SRJ A;  1SY1 A;  1YWA A;  1ZNH A;  1EPB A;  2F73 A;  2OL8 O;  3CBS A;  5D45 A;  4GZV A;  5F7G A;  3FMZ A;  4CPH B;  4DNE A;  1ZNG A;  3PH5 A;  1URE A;  4IMO A;  4YFP A;  3RBY A;  2FKG A;  2FS6 A;  2LBA A;  3JSQ A;  4GKC A;  1VYO A;  1SWH A;  1X8Q A;  1FE3 A;  3AKM A;  4YGZ A;  3RDO A;  4BQU A;  5HAE A;  1LIC A;  1SWC A;  3SLO A;  4CPI A;  4IAW A;  2MM3 A;  1D2U A;  1OBQ A;  3F9D A;  4CDD A;  1PMP A;  2GTL O;  4HPD A;  4GE1 A;  5CYB A;  1SRH A;  3PED A;  4ORX A;  1SWQ A;  4HFO A;  2X46 A;  1QFV A;  5F58 A;  1G5W A;  4ORR A;  1BEB A;  3HPE A;  2NP1 A;  1DC9 A;  5HWZ A;  4WBK A;  2AF5 A;  2G8C O;  4GNW A;  1S44 A;  5L8N A;  1Y53 X;  2UYW A;  1GT5 A;  5AJB A;  1RBP A;  2RD7 C;  1UZ2 X;  1ACD A;  2AVI A;  1Y52 X;  3FDC A;  2OVE A;  3D96 A;  4YDA A;  4OMX A;  1VWA B;  3VG2 A;  2CBS A;  1HQP A;  2QMI A;  1W5R A;  1ZND A;  4TKB A;  1QQS A;  1B8E A;  5LJC A;  3WJC A;  2JOZ A;  3P6C A;  1VWQ B;  3VE1 A;  2Q2M A;  3PQU A;  2MWH A;  2KT4 B;  4YKM A;  5B11 O;  1MX7 A;  4KC8 A;  1SWO A;  2Z4I A;  3BS2 A;  1E5P A;  3OE3 A;  2IZK A;  4GU8 A;  2OY7 A;  3LV4 A;  4YFR A;  1YP7 A;  5LJE A;  2Q39 A;  3NX2 A;  1W4T A;  1Y0G A;  1GKA B;  4MVL A;  1HN2 A;  1EXS A;  2HZQ A;  3VG4 A;  5FQ7 E;  1N9M A;  1H91 A;  2RTL A;  3C78 X;  3HWE A;  1G85 A;  3P6G A;  5LKF A;  1GT4 A;  4U46 A;  5CE4 A;  2QOM A;  3N91 A;  2A8G A;  1NBX A;  2IZJ A;  1I78 A;  1SWN A;  3KVN A;  3B2H A;  4ZGF A;  5HTE A;  2OVA A;  4FGI B;  2GTL N;  3OBL A;  2BS5 A;  4XMH A;  4ZHC A;  4ZFX A;  5CSE A;  1LF7 A;  2GTF X;  3RY2 A;  5H9K A;  5HCD C;  4JGL A;  4ZCB A;  1AVD A;  4YFQ A;  1I05 A;  2A13 A;  4TJZ A;  4KC7 A;  2OL7 A;  4CDF A;  2GC9 A;  3EW2 A;  3MVF A;  1B0O A;  4GRJ A;  2AL0 X;  4MIS A;  4NLI A;  5B10 O;  4BCS A;  1DZJ A;  2IZC B;  1SY3 A;  4GJV A;  2EU7 X;  2RCQ A;  1STS B;  2A0A A;  3V8U A;  1RST B;  4YGH A;  1SWR A;  4O3Y A;  2RTQ B;  2FR3 A;  4O9S A;  1KFF A;  2RTO B;  2L5P A;  3RDQ A;  3TF6 A;  4EEJ A;  1BWY A;  5B27 A;  1IW2 A;  4JHQ A;  4AZO A;  1VWH B;  4HPB A;  4XMG A;  4GGR A;  4OS3 A;  3UEW A;  1CRB A;  2OVS A;  1XKI A;  5HZQ A;  4BX5 A;  4PSQ A;  5DPQ A;  3VG3 A;  4CPE A;  1SWK A;  1VWP B;  3B2I A;  1LID A;  4YKO A;  3I17 A;  1LDO A;  3PDF A;  2X34 A;  4QQ1 A;  1CJ5 A;  5FFH A;  1HXZ A;  3RSW A;  1SWD A;  1B56 A;  3FLL A;  3P6H A;  1JIW I;  1SLE B;  1FEL A;  3SLJ A;  2CAM A;  1TVQ A;  2QO5 A;  2RTE B;  4I3D A;  3ZW0 A;  1SWL A;  5L8O A;  4RUU A;  5EZ2 A;  4I95 A;  4IB9 A;  1QY1 A;  4O3W A;  1I06 A;  2I5Z O;  1MDC A;  1QFT A;  2BLG A;  4IBA A;  3KZA A;  4ALO A;  1ERB A;  1SLD B;  2ALL X;  4FBO A;  3SAO A;  3EYC A;  2F01 A;  3B2L A;  3FEP A;  3FYF A;  2KTD A;  2AT6 X;  1CBQ A;  2IZB A;  1YUP A;  2WSJ A;  2NNQ A;  1MK5 A;  4IB6 A;  5B5G A;  1VWM B;  2G79 A;  1ICM A;  1YWD A;  4GUZ A;  2FKJ A;  1JV4 A;  1SXY A;  1QG5 A;  4CPF A;  2W2A A;  1X8O A;  1AQB A;  1FJ1 E;  4KT5 A;  4OEL A;  5IRA A;  1CBR A;  3UEX A;  4EQA C;  2KW1 A;  5B3M O;  1Y9L A;  4ZH6 A;  4DCB A;  3HOL A;  4NV8 A;  4D6B A;  1SY0 A;  2ZAI A;  3ZWE A;  3GE2 A;  2Y3E A;  1LUQ A;  2R56 A;  1IIU A;  4N7C A;  4EFG A;  5IRU A;  1NQM A;  2OZQ A;  5IO5 A;  2A5B A;  4M7M A;  1T68 X;  1K3B A;  2K62 A;  1VYG A;  3LHN A;  2LB6 A;  4NP1 A;  4U9C A;  4UU3 A;  2YG2 A;  3D9W A;  5D8J A;  5FAZ A;  3H3I A;  4COT A;  2BHV A;  2RTB B;  1NC9 A;  4TQ2 A;  1X71 A;  2L67 A; 
#chains in the Genus database with same CATH homology
 3KFG A;  4YDB A;  3TGB A;  1ADL A;  1KOI A;  1R0U A;  5HZ8 A;  1MVG A;  3O19 A;  5HA0 A;  2JW1 A;  2JU3 A;  3CWK A;  4CK4 A;  2G7B A;  1OPB A;  1HMT A;  4MVI A;  5KIC A;  1T0V A;  4ID2 A;  3HWF A;  4ZHH A;  1CBS A;  2JU7 A;  4KII A;  3ELX A;  1HMS A;  2F09 A;  1ERX A;  2KTS A;  4LZU A;  3FEL A;  3VG7 A;  4RUN A;  3S5X A;  2AT3 X;  5F6B A;  4ALB A;  5IO7 A;  1GM6 A;  3G7X A;  3FR2 A;  3JQO A;  1EIO A;  3P6D A;  5L8I A;  2FS7 A;  1JYD A;  2JU8 A;  3DSZ A;  5HCE C;  3CQR A;  2RCT A;  2NND A;  2WUT A;  4AYH A;  2BS6 A;  3BDR A;  5H9L A;  1A57 A;  4O3Z A;  1TOU A;  1G7N A;  1DZM A;  2Q4N A;  3WJE A;  3Q6L A;  4A60 A;  3NQK A;  3P6F A;  1JZU A;  1BSO A;  3VU1 A;  3BRN A;  5H9A A;  2CM9 A;  1IFB A;  3D4R A;  4MVE A;  2DM5 A;  5HCC C;  3BLG A;  5D48 A;  1BBP A;  1IKE A;  1HBP A;  2PY1 A;  1LIB A;  2N93 A;  3OJY C;  1A18 A;  4QGW A;  2OFR X;  1DF3 A;  1U17 A;  1MUP A;  4KH8 A;  1BM5 A;  4ZGU A;  3IFB A;  4A8Z A;  1HBQ A;  4WFV A;  1ZNE A;  2RQ0 A;  5AQ6 A;  4A1H A;  1Y9T A;  3CR6 A;  5KHP A;  1OEJ A;  2QO4 A;  1PBO A;  4YBU A;  3FA9 A;  3ZW1 A;  2ANS A;  3BU1 A;  2XKL A;  4I3B A;  4ORW A;  5FQ8 E;  1PEE A;  3U0D A;  1QAB E;  3NBX X;  4ORU A;  4N7D A;  1N0S A;  3U03 A;  1U0X A;  2JMB A;  4XMD A;  5LJG A;  3SOT A;  1E02 A;  3I0A A;  1KT7 A;  4ZJ0 A;  3ZZV A;  1YP6 A;  2QO6 A;  1GT3 A;  1VPR A;  1NP4 A;  4YH0 A;  1GGL A;  2RA6 A;  4IMN A;  1O1V A;  2WEX A;  4MVK A;  2GJ5 A;  3O22 A;  1I4U A;  1E06 A;  3KFF A;  2MHD A;  2MJI A;  4O4S A;  5HZ5 A;  1LKE A;  3HOE A;  1TXL A;  3JS1 A;  3WJD A;  1SXU A;  1KZX A;  5HZ6 A;  1X89 A;  3B2K A;  3P24 A;  3TGC A;  4ORY A;  4ZHG A;  3F6Z B;  1DZP A;  1HMR A;  5B29 A;  1NGL A;  3AKN A;  1L6M A;  2R74 A;  1XCA A;  4GDZ A;  1U18 A;  1O1U A;  4TKH A;  3BX7 A;  4Y0Q A;  5LJD A;  5EPQ A;  5HTD A;  3WJB A;  4IAX A;  4QZT A;  1A2D A;  1MX8 A;  1YIV A;  4QAE A;  4FQB B;  1LPJ A;  2Q9S A;  1ZNK A;  1S7D A;  4GH7 A;  4CSB A;  1O8V A;  2OFM X;  2X8F A;  3RKG A;  1EAL A;  1S2P A;  3FR4 A;  5HBS A;  1NP1 A;  2AT8 X;  5K06 A;  5LJK A;  3FW4 A;  3BY0 A;  3KQ0 A;  3PQS A;  3ZUO A;  4DQ3 A;  4WHI A;  2YMS A;  2HYS A;  3C77 X;  3FA6 A;  1ALB A;  2FRS A;  4AZQ A;  3NX1 A;  1DZK A;  1I04 A;  3OD9 A;  3CMP A;  2FLJ A;  4AW8 A;  1KT4 A;  1QWD A;  2ACO A;  4KCA A;  3PH6 A;  4TKJ A;  2FR2 A;  4XMF A;  2ZAG A;  2LFO A;  1OEE A;  4WFU A;  4I9R A;  3S5V A;  1CBI A;  2JN3 A;  3ZQ3 A;  5KID A;  4AZN A;  1KZW A;  1KXO A;  3U9P C;  3GAQ A;  4R0B A;  2CM4 A;  2P8G A;  3E3C A;  3NQ9 A;  1TOW A;  1E00 A;  4TLJ A;  1BLR A;  3FA7 A;  4QZU A;  4HPA A;  2AH7 X;  3STM X;  4CV7 A;  1X8P A;  2WQA E;  3NQ3 A;  4YCH A;  1LIE A;  4FBV A;  4U8U M;  5LJH A;  4AZP A;  3STN A;  4EDE A;  4BVM A;  1SMP I;  3MX7 A;  2IFB A;  3EM0 A;  4OS8 A;  5H8T A;  4AZR A;  1BJ7 A;  4NYQ A;  2HLV A;  3TGA A;  2X45 A;  4I9S A;  4NLJ A;  4GNY A;  5BVQ A;  2OVD A;  5EDC A;  4FBR A;  1VYF A;  5H9N A;  1AB0 A;  4TNN A;  1JJJ A;  3DTQ A;  2LBV A;  1GX9 A;  1OEK A;  3ZI8 A;  4YMY A;  3CBC A;  3O2Y A;  3EBW A;  2Q2P A;  3APW A;  1GX8 A;  2POA A;  2W2B A;  3UEV A;  4NW4 A;  1BSQ A;  3NPO A;  1OPA A;  4QYP A;  1G74 A;  1EUO A;  2CBR A;  4M6S A;  5C0N A;  4O4X A;  3APX A;  1FDQ A;  3FW5 A;  4QRL A;  4Y0S A;  2A3F X;  3UEU A;  4XME A;  4K19 A;  1FTP A;  2K23 A;  1AVG I;  4O49 A;  4IB7 A;  4IB8 A;  4ON1 A;  1OBU A;  3WVM A;  5D47 A;  3PP6 A;  3F8A A;  4MIR A;  1X8N A;  3UAQ A;  2CZU A;  3VE2 A;  4LZV A;  3T1D A;  1KT3 A;  3ZW1 B;  5F6Z A;  4ZR2 A;  3NR3 A;  2HMB A;  2HZR A;  5LKE A;  4ZH9 A;  3NP1 A;  3HWD A;  2AKQ A;  3TZS A;  4ORS A;  3C76 X;  4A1Y A;  2RN4 A;  1GKA A;  4O4U A;  2QOS C;  2FWV A;  3HTY A;  3L4R A;  3BX8 A;  2M4L A;  1JBH A;  2X8S A;  1SY2 A;  5BVT A;  5LJB A;  1EI5 A;  1DFV A;  2WEW A;  1KQX A;  4U8U O;  2BT9 A;  4ZHD A;  1KGL A;  1EW3 A;  2XST A;  1ML7 A;  4ML7 B;  3ELZ A;  2ACP X;  2W2F A;  1PM1 X;  1KQW A;  3EBK A;  1BRQ A;  1OBP A;  4GK9 A;  5D4A A;  1BSY A;  1RLB E;  4O4O A;  1ZNL A;  5EED A;  4QGV A;  4LKT A;  2AT0 X;  1BRP A;  3D97 A;  5FQ6 E;  2LA7 A;  3FIQ A;  5JR8 A;  3FR5 A;  1SXW A;  1EPA A;  4GET A;  3S26 A;  5F1E A;  3STK A;  3EMM A;  3NAD A;  3ZW0 B;  1FEM A;  4Y0P A;  4BOE A;  3BSZ E;  3FEN A;  1IKJ A;  4U3Q A;  4Y0R A;  5IO6 A;  3VG5 A;  4L1N A;  3CQN A;  3ZW2 A;  2FT9 A;  1SXX A;  3B2J A;  2Z4H A;  1QY2 A;  5AEO A;  1EQD A;  4XMC A;  3P02 A;  1LFO A;  1QY0 A;  3MBT A;  3PEC A;  1Z24 A;  4I6S A;  3VG6 A;  3WOV A;  4NYR A;  1D3S A;  4QYN A;  4UU2 A;  1IFC A;  1GXA A;  1A3Y A;  5EDB A;  3VPJ E;  3FA8 A;  4OS0 A;  1EII A;  2G78 A;  2L9C A;  1KT6 A;  4HPC A;  4U8U N;  4OMW A;  5BVS A;  3PPT A;  5HA1 A;  2WQ9 A;  1KT5 A;  2QM9 A;  3QKG A;  2FTB A;  2E4J A;  5BYP A;  2KD2 A;  4YGG A;  3HWG A;  3HK1 A;  3WBG A;  3WXQ A;  1GT1 A;  1YWB A;  3RWX A;  2ASN X;  1JYJ A;  1LIF A;  2GTL M;  1B4M A;  1TW4 A;  2HNX A;  4IAB A;  4ARH A;  2L68 A;  2WWP A;  2LKK A;  3APU A;  4HWM A;  3WJG A;  4I3C A;  4D6A A;  2AT5 X;  3D95 A;  3K3L A;  4QGX A;  2A2G A;  1X8U A;  2WR6 A;  1P6P A;  2MO5 A;  3IA8 A;  1YWC A;  4AZM A;  5FEN A;  3APV A;  3BU9 A;  2X8T A;  2CZT A;  3KFH A;  4L3R A;  3KFI A;  1LNM A;  4LQZ A;  4PJ2 A;  5HZ9 A;  4YCE A;  1ICN A;  3RZY A;  3WJF A;  1JJX A;  5DG4 A;  1SA8 A;  1ZRY A;  4NNT A;  4LKP A;  4INN A;  1DV9 A;  4O3X B;  4ODD A;  5AJC A;  4NNS A;  2NNE A;  4EXZ A;  4QNI A;  2R73 A;  3FEK A;  5EEE A;  1FEN A;  2A2U A;  1T8V A;  4DQ4 A;  2O62 A;  3S60 A;  2AMM X;  3P6E A;  1SY1 A;  1YWA A;  1ZNH A;  1EPB A;  2F73 A;  3CBS A;  5D45 A;  4GZV A;  5F7G A;  3FMZ A;  1ZNG A;  3PH5 A;  1URE A;  4IMO A;  4YFP A;  3RBY A;  2FS6 A;  2LBA A;  3JSQ A;  4GKC A;  3AKM A;  1X8Q A;  4YGZ A;  1FE3 A;  4BQU A;  5HAE A;  1LIC A;  4IAW A;  2MM3 A;  1D2U A;  1OBQ A;  3F9D A;  1PMP A;  2GTL O;  4HPD A;  4GE1 A;  5CYB A;  3PED A;  4ORX A;  4HFO A;  2X46 A;  1QFV A;  5F58 A;  1G5W A;  4ORR A;  1BEB A;  2NP1 A;  1DC9 A;  5HWZ A;  4WBK A;  4GNW A;  5L8N A;  1S44 A;  1GT5 A;  5AJB A;  1RBP A;  2RD7 C;  1UZ2 X;  1ACD A;  4YDA A;  4YBP A;  2OVE A;  3D96 A;  4OMX A;  4TKB A;  3VG2 A;  2CBS A;  1HQP A;  2QMI A;  1ZND A;  1QQS A;  1B8E A;  5LJC A;  3WJC A;  2JOZ A;  3P6C A;  3VE1 A;  2Q2M A;  3PQU A;  2MWH A;  2KT4 B;  4YKM A;  1MX7 A;  4KC8 A;  2Z4I A;  3BS2 A;  1E5P A;  3OE3 A;  4GU8 A;  3LV4 A;  4YFR A;  1YP7 A;  5LJE A;  2Q39 A;  3NX2 A;  4ES7 A;  1GKA B;  4MVL A;  1HN2 A;  1EXS A;  2HZQ A;  3VG4 A;  5FQ7 E;  1H91 A;  3C78 X;  3HWE A;  5CE4 A;  1G85 A;  3P6G A;  5LKF A;  1GT4 A;  3N91 A;  3B2H A;  4ZGF A;  5HTE A;  2OVA A;  4FGI B;  2GTL N;  3OBL A;  2BS5 A;  4XMH A;  4ZHC A;  4ZFX A;  1LF7 A;  2GTF X;  5H9K A;  5HCD C;  4JGL A;  4ZCB A;  4YFQ A;  1I05 A;  2A13 A;  4TJZ A;  4KC7 A;  4ZHF A;  2GC9 A;  4MIS A;  3MVF A;  1B0O A;  4GRJ A;  2AL0 X;  4NLI A;  1DZJ A;  1SY3 A;  2EU7 X;  2RCQ A;  2A0A A;  3V8U A;  4YGH A;  4O3Y A;  2FR3 A;  4O9S A;  2L5P A;  3TF6 A;  4EEJ A;  1BWY A;  5B27 A;  1IW2 A;  4AZO A;  4HPB A;  4XMG A;  4OS3 A;  3UEW A;  1CRB A;  2OVS A;  1XKI A;  5HZQ A;  4PSQ A;  5DPQ A;  3VG3 A;  3B2I A;  4YKO A;  1LID A;  3I17 A;  1CJ5 A;  4QQ1 A;  5FFH A;  3RSW A;  1B56 A;  3FLL A;  3P6H A;  1JIW I;  1FEL A;  3ZW0 A;  5L8O A;  1TVQ A;  2QO5 A;  4I3D A;  4RUU A;  5EZ2 A;  4I95 A;  4IB9 A;  1QY1 A;  4O3W A;  1I06 A;  1MDC A;  1QFT A;  2BLG A;  4IBA A;  3KZA A;  4ALO A;  1ERB A;  4FBO A;  2ALL X;  3SAO A;  3EYC A;  3B2L A;  3FEP A;  3FYF A;  2KTD A;  2AT6 X;  1CBQ A;  1YUP A;  2WSJ A;  2NNQ A;  4IB6 A;  2G79 A;  1ICM A;  1YWD A;  1JV4 A;  1SXY A;  1QG5 A;  2W2A A;  1X8O A;  1AQB A;  4KT5 A;  1CBR A;  3UEX A;  4EQA C;  2KW1 A;  1Y9L A;  4ZH6 A;  3HOL A;  4D6B A;  1SY0 A;  2ZAI A;  3ZWE A;  3GE2 A;  2R56 A;  1IIU A;  4N7C A;  4EFG A;  5IO5 A;  2OZQ A;  3ZUI A;  4M7M A;  1T68 X;  4UU3 A;  2K62 A;  1VYG A;  3LHN A;  2LB6 A;  4NP1 A;  4U9C A;  5D8J A;  2YG2 A;  4COT A;  1AEL A;  5FAZ A;  3H3I A;  2BHV A;  4TQ2 A;  1X71 A;  2L67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...