1L6ZA

Crystal structure of murine ceacam1a[1,4]: a coronavirus receptor and cell adhesion molecule in the cea family
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
203
structure length
203
Chain Sequence
b'EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biliary glycoprotein C
publication title CRYSTAL STRUCTURE OF MURINE sCEACAM1a[1,4]: A CORONAVIRUS RECEPTOR IN THE CEA FAMILY
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 27
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6zA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l6zA02
5IROC 4X6FB 3P4OB 5C3LD 2LABA 4DUXA 3SDXA 5J3HC 5L2KB 3JXAA 3U0WH 4CVWA 3TA3D 1NJ9A 4YWGH 2XTLA 4OTXL 1IAKB 5GS1A 1MJ7H 3RA7L 3UYPA 3QWOB 2DIAA 5A2KH 3ULSA 4H8WH 4PRIE 4OGZA 4PJ8B 5BV7C 3MOBH 3SDCB 1HDMA 2H3NB 4AENA 5DF0A 2D31B 1CXKA 2NX5B 3JWDC 1JHTA 2EEAA 4H20L 1NBVL 4MYWB 5DQDL 5AG9A 5E8EA 1J86A 4O2FB 4ZO8A 3QIBD 2E9BA 4Z7VB 1IGTA 4XMKH 5CUSL 3ZDZF 1ADQA 4Y89A 2PF6A 2QQNL 1FPTL 1Z3GH 5F71A 3WN5C 3WXWL 4OQ1A 5CWSA 3ELAT 2AXGA 3MLZH 2E6PA 3RU8L 4YC2B 2COQA 1XR9B 3NPSB 1AP2A 3EYOB 1YMME 3WIIL 5KSBB 4JPKL 1T3FB 4N8CL 5ANMA 5DEGB 4H1LA 5LBSL 3VCLA 4UDTA 5FF6A 5EUOF 1DEEB 2OTUA 1IQWH 2HA1A 3TT3H 4Z5RA 1RUKL 4QHKI 1F11A 3P11L 5F7MC 3D18B 3D0LB 3U7YL 1N4XL 4KJWD 1EJOL 2BSED 5FV1L 3GJEA 4LCUB 2R23B 1K8DB 5GGRB 1G84A 4KZEL 5IESL 1H15A 4LSTL 1R5VA 1Y0LB 4YHLL 2IPKA 3OHXB 4P46C 3ARGD 3QNYA 4RZCB 1TPXC 5T3ZL 5EN2B 1U8IA 5IGXL 3PIQA 3X3FL 3MZGB 1MFBH 3MGTB 5IMLB 1E6OL 4Z7WE 4XCFH 2CR6A 1A3LL 2R1YA 3DVNA 1H8OA 1X5YA 4I3RH 5FA4A 4DOHB 5FHBL 3HE6B 3HTLX 4XAKD 4LPCA 1EK3A 3SQBA 5T33H 5AUMB 5I1HL 2J88H 1ZHBA 4RMUA 5KAQG 4BH7B 2QQQA 5DRWB 2H32H 1DSFH 4ZOBA 4U7MA 5HYJB 3SO3C 4M7LT 2X4QB 5K33A 2P49B 5HYQB 3D25B 3OKNB 5T1KA 4PREB 2GUOB 1X9QA 4CNIB 2Y07H 2L7JA 5F89A 2JJTA 4PJXE 2B2XL 4EXKA 4PJ5B 1A1NB 1I1AC 2OQJA 4OZFG 4PJDB 4UT9H 1SVCP 1A6ZA 3LEYL 4EN3D 1T0PB 2Z93A 4PD4K 4NRYA 4HXBH 5E2JA 2FX7H 4OKVA 32C2A 3MCKA 3LKRB 2QHLA 1MAKA 1SYSB 4IMKC 4LCWE 2YD8A 1AGDB 5KS9E 3EFDL 4RAUB 4NP4H 4K94C 3FB6A 1CFQB 2AEWA 4KK9D 4YBQC 1D5ZA 3BPLB 3QUZC 4QWWC 2XWBA 1YJDL 5I1GL 4PJEF 5T1DL 4P2QD 3RY6A 4XXDB 3GKZA 3LAFA 2R8SH 4DKEH 4P48A 3LZFH 4FQCH 1HILB 5ESAA 4Y19D 1OP3H 1RK0A 4HK0A 2YBRA 5DJ8B 4BYHA 5F8RC 1G6RA 4P3DA 1R3JA 3T2NH 1XT5A 4CGTA 3VFSA 4HHAA 5IW3A 1UB5B 3NA9L 3N9GH 4HX1B 5KOMC 2APFA 2IH3B 1MOEA 4FMFA 5DUPL 1MFEH 1ITCA 3DRQA 4WHTB 4MD0A 3UTSD 4EI6B 3L3OA 3STZA 2DD8L 1KG0B 4JHAH 3DBXA 2O5ZL 5A16A 5TE7H 5E2WL 4TULL 4NT6A 1IILE 4PJHA 4K3EL 3O6FB 1JHKL 4HCRH 1EZVX 1JN6B 4DEPB 3QIWB 1I8KB 5DJAA 3HMWH 3O6LL 1BFTA 3RWGA 2G5BB 2EDYA 2R0KL 1KB5L 3MRHA 4KI5F 2F8VA 1F6LL 4LHQB 4L3CA 5TGBA 3JTSA 2X7LA 2X9WA 2ZUTA 1OAYL 3U30C 1QFHA 5I16B 5ALCH 3TBWB 1DP0A 4S1RH 3HZVA 4RCAA 3IVKA 1NLBL 4U7SA 1DBAL 3MV8E 5GGQH 5JOEA 1EMTH 1RJLB 3U36B 1TJHH 5IJVA 4C56E 1S7VA 3FL7A 5ADPH 3RKDD 3GRWL 5GIRA 3GJFA 3V7MA 1U42A 5FUZH 2G9HA 2ZP0T 2JLLA 5CSGA 4I9WE 4KKBD 4A6YA 2HJFB 3WUWB 4XPHL 5D5ME 4RAHA 1EPFA 1UWXK 4JZJB 4EUPA 3HZYB 3VWKA 5JXAH 4K2UL 5DJDB 5DMJB 2W0FA 1RY7B 2UUDH 3RIFK 2B5IB 4UNTA 2QKIB 4NCDA 2DQUH 5C08D 1OM3H 3EKCA 4YAQB 3OGCB 1MPAH 4OGYH 3FO1A 2F74B 3BX7C 1YPZB 1N3NB 2XFXA 1FYTD 4YBHA 1OPGH 1HOCB 4EI5A 1BZ9B 1X5KA 3QI9C 5DMGD 1ZWIB 3RX8A 1CDUA 1UXSA 1GHFL 1I8LC 2XRAL 3WO3B 4OUUB 4ZAKC 6FABH 2IGFH 4GQ9H 2YPLA 1LEGB 3KAAA 4P4KD 2FIKB 3DECA 1CZ8L 1JGLH 4AM0A 3ZZ1A 5IVNA 2J8OA 4DGVL 2WZPD 2KQNA 4F15C 4PRPE 4MB4A 1GC1L 4QYOA 3OKMA 4FFYL 1CXIA 5DMKA 2VIRA 4E5XB 5MENB 5GRXG 2WBJC 2N4IA 3HR6A 2Q87A 1MI5D 1PKQE 1Q94A 1Q9KA 1IEAA 2YD5A 1ZTXH 5EPMA 4R7NB 1MREH 3SDDC 5KTEH 4L9LC 1FL5B 4K71B 4HZAA 3LS4H 4R96B 1NC2D 1BJ1J 5E03A 2IQ9L 3NN8A 3B8SA 1UQSB 2BCKB 3L95A 3QNZA 1NMBH 3Q2CA 1CGWA 1HYSC 2NZ9C 4DZ8B 3HZMB 3CDGB 5JR1L 4P9HL 5E6IA 3GMQA 1L6XA 2X6MA 1GXEA 4TUOB 1ZLWH 3QJHA 3H9HB 2B8OT 4XPGH 1U41A 4NKDA 4R0LC 2Y7QA 1TJIL 4ODHH 4DK3A 5F1KC 2W9DH 3D9AH 1U8MB 5I15L 3V6OC 1M6OA 3VFUB 1O0VA 5D2NA 3V0VA 4PJ9D 4WFGD 1HXYB 1S5IH 3BWUC 2P8MA 5CEYA 3JSSA 1JVKA 5EZOH 2A9MH 3BZEA 1VDGA 3ARFC 3HE7A 3KHQA 4H0IA 3GIZL 1YQVL 2EDOA 3QFJA 5HHNB 3QG6A 3UYRL 4LLVA 3U9PH 1KIRB 4QEGA 4OF6A 1GGIH 5IHUH 4KJQC 1T2QH 3I9GH 2ED8A 3ESVF 3CH1B 4K94H 2YWYA 4Q6IC 3BYTA 3KPRE 2XWJB 3RJDA 4AZ8A 3HG1A 1EEQA 3GMNB 2DMCA 3WNKA 3D3VA 5TF0A 3FT2B 4WNQB 4AL8H 2EYSB 4JY5H 1J9CT 4OF7A 4WUUD 4LIQH 3QCTH 1MUJB 5D70L 1UCTA 1JWSB 4UILL 1D5BA 4MJ6A 5ESQB 4ELMF 4IIQB 2FEEL 1ED3A 3B6SA 4TQEL 4TTDC 5L2KE 2QHRH 4N1HB 1IE5A 1IGIH 2FX9H 4HIHA 3CX5J 3MPCA 1I8IB 2V5RA 3OV6A 1IKNA 2H32A 1OF2B 5MP6L 4OF0A 2Y23A 4O58L 3VFOB 3T1FA 2FO4B 3RKPA 1IZJA 2OJZH 4TVPH 1NGZA 1I4FB 3QJFA 2NX5E 3IDUA 1N59B 1V8HA 4F33A 3U7AA 2VDLL 2BRQA 3RJQB 4HUWA 1PYWA 2EE6A 2VZUA 5IBLC 5LKNA 5FYKL 3PWVA 2C3XA 4AK1A 3FFCA 2ZUXA 5CP7A 5CHNB 2EEDA 5TDPA 4LVOC 4RDQG 3F58L 3OXSA 2XXMB 2YWZA 3QQ9D 3HFML 1I9JH 4APQB 2A83B 3ULVD 3C5ZA 4LSQH 3TYFA 4NJAH 1J1PH 5D72L 5KSBE 4NRXB 5KOVC 1QPPA 3QDGB 4AEEA 3PWPE 3P4LA 1MHPL 3QIUD 1F4YH 3P30H 4KJPC 1CE6A 1HEZA 2BMKA 3OB0K 3GHBH 2AJ3A 3TLRA 1I7TA 1YNTB 3NCJH 5KSAC 4O5LH 1MCLA 5E6YA 1WC7A 3C60A 5C0JB 5FO7B 1BM3H 3CZFB 1FCCA 1RMFL 2QL1A 2WANA 5E00A 1ZLSL 5JDJA 4Q9RL 5GRZA 5DC0A 3U83A 3O8XC 1JTOA 1OARL 2FGWH 5IMOA 1DUYA 3PL6C 3O9WA 4G6AD 2YZ1A 1GAFL 2BFVH 4EOWH 1FNGB 2QQKH 4B53A 3PDOB 2NY3B 1I9IL 1UM6H 3QH3B 4D2NA 1WEJL 4ZOEA 5B3NA 4HGKC 5E1AA 5I1DA 3KPMA 5ICXA 3GSNH 5K9KB 1QP1A 5M7QA 4KVCH 4LDLB 2B20A 1I8MA 1QSFD 1QLFA 4XVUD 4ZUSA 5DYOA 5F44A 3K1KC 1QSZA 4MNGA 1KCVL 2VAJA 3WJJC 5EZJB 4Y8AA 1IMHC 2X10A 3KLAA 4GG6A 4HCRA 1LP9B 3FB7A 1U6AH 4F2MB 3TWCH 1E27A 1QRNA 3WKMH 3DHJA 3DUSA 4P2OB 1NPUA 4Y2DC 2AJSL 4JN1L 3WSQL 5HYJE 5AZEH 3IJSB 3MRNB 4JFEA 3GEWB 2XZCH 2KUTA 4P23C 3LRHA 4LLUA 1QQDA 1RURH 5IROA 5IMKB 4JO3H 5GRVL 4OFYA 5TF1L 3FZUD 1HKFA 2DMBA 1XGPA 4PRID 2EIZB 4M7JH 3DMMD 4PJ5E 4X8JA 1E28B 4ORGB 4PJDE 4XCYB 4BFIB 2O26U 1UENA 4YGAB 1QBML 4OCNC 3PQYA 2EYTA 4NHCH 5GS0L 4X4YB 2VR9A 1A7OL 4NYLB 4O02L 1AGFB 3ZE1E 1KN2H 3C5JB 1YJDC 1HE7A 2AS5M 2HJLA 5LAXA 5TE4L 4F37K 3W9EB 4H5SB 5CJBA 5I1KH 5SV4A 3O3DA 4IRSB 5H37G 3TZVC 4OLYH 3IU4L 3B5GA 3G5ZA 4LOUC 3LD8C 1BVKB 1Q9LB 5CP3H 1XF3B 4MD5A 5L9DH 4NNPH 3WFBL 3H9ZA 5C0RL 2CR3A 3C6LD 1UH4A 4FFZH 1AKJD 3DIFA 4JLRB 4Q74A 5E94B 3KLHD 2MPAH 3CXDL 2BOBA 1FVDB 5EG6C 3BESR 3STLA 3O45A 3U9UA 4L4VB 1YEIH 5H94B 3RZCD 4TNWK 1YNLH 2AEQH 6CGTA 4OIIH 1KXTB 3PABA 4EDWH 3BO8A 4JKWA 2PYFB 3VG0H 4NZUH 4X6CF 4K3DH 4JR9H 4HWZB 3LMJH 5K59F 1LNUA 5DUML 1QKZH 3AREA 2ZUVA 4OCMC 3TNNA 4K7FA 3U0TA 2IC2A 3MUGA 1UC6A 4M1GH 4D0BB 1G1CA 2HT3C 4H0HB 3MA7B 4ZSOA 5LG1A 4B7LA 4CMHB 4HEME 1YEDA 4JJ5B 2C3GA 4M61A 3RIAK 4GKSA 2OJEB 4XX1G 1FRGL 5HGDA 3UTZA 4JDTL 2AVGA 3EDJA 3FQRA 1ETZA 1BECA 4OTXH 3EYUL 3X13B 3RA7H 2FNBA 5L7XL 3LSOB 4PGCA 4KVNL 3F62A 1LVEA 4IMLA 4NQVB 2ARWA 2FDBP 4KK5C 4HGWA 4Z7UA 4ZO6A 2QJDA 4LCCC 2FL5B 1ZANL 4MNHB 4HC1L 3BKJL 4H20H 1NBVH 1VFMA 5DQDH 4UT7L 3V5KA 3H7BA 4JRYD 5IB3B 4NO2A 4JVUA 3PHSA 5IWLC 4OD2B 2FWOA 3RBGA 15C8L 5CUSH 4U1SB 5KJRL 5DJ0A 5L88L 2QQNH 3W0WB 5ERWB 1FPTH 3WFHA 4KUZL 3WXWH 5D6DA 3OL2A 3BEWA 4DAGL 2YUWA 2QV2A 2ZPKL 3RU8H 1JPST 3TESA 4JRXA 3WIIH 4JPKH 2HAZA 3FO9A 2BNRA 2DIJA 5C0AA 4N8CH 4U6TA 4YHNB 4UUJB 4K8RC 1PQZB 3PXJA 2GAZB 3QXAB 2HH0H 5BOZG 1MAJA 5LBSH 4D0DB 4IMKA 3K3QA 1U91B 3BQUD 2WINA 1QVOB 5C0FB 4MJID 2VZ1A 2XA8L 3F7QA 4L8CA 1RUKH 1ZVSA 3HPJB 3P11H 3TVMB 2CIIB 3G5YA 1GC1C 1MCHA 3ROLA 3PWUA 4G9FA 3HRZA 2R29L 3U7YH 1N4XH 4M03A 1KN4L 2NY2C 1EJOH 1ZS8A 4G8EA 1PD6A 5EO9A 4RAVB 4KZEH 5IESH 4HZLB 4LSTH 1GPOL 5JOPE 4YHLH 3RWEB 3VW3L 5T3ZH 1PVHA 5IGXH 3UJTL 1FJ1B 3CFDB 2EDXA 3X3FH 1ZGLB 3PE9A 1UVQB 1E6OH 2VUYA 1A3LH 1YEJL 4GRWH 3WHE1 1M71A 2ADIB 5FHBH 1DN0A 3H9SD 4NQCA 5ITFA 1EHNA 1YEHL 4Q58C 5EUOA 5D1QB 4PJBF 3ZDXE 5I1HH 2XKUA 1EUUA 1NDGA 1AQDB 4R97C 2HRPL 3VFVB 4P9HC 1X4YA 5D1ZC 4J3OC 4X99A 2FJGB 3CDCA 2JJWA 2X4TA 3CLFL 5FUCE 3ULUL 4XNZB 3M17B 3GB7B 1NMAL 4MX7A 1DLHB 3MV8D 3KPSB 1S9KC 2B2XH 1KLUB 3LEYH 4C56D 1J05A 1ORQB 1GSMA 1FAIL 3QHZL 1P9MA 4GW4B 5DQJB 3NIGF 3LEXA 3I50L 3TF7C 4I9WD 4MNQA 5DJYA 4P59L 3OKOA 5D71L 1BBJB 5C09D 4J12A 5E5MA 5J11B 3P77A 3SJVE 3GFUA 3EFDH 3SO5A 2FSEB 2H45A 1UZ6F 4MWFA 5I1GH 1YJDH 1JK8B 5T1DH 5IVOA 2P5WB 1AGBB 2PYEB 3HC3L 1K9TA 2HTLC 2Q3AA 5IVXE 3QP3A 4HG4K 4UI2A 1JGEA 1INQA 1UA6L 2X4PB 3GSNA 1ONQB 4TNVK 5FUCC 2PTVA 4KRNA 5MERA 2BSRB 3UDWA 1S9WB 3QI9A 3CSGA 2W9EL 4OZGA 4WI9A 1NCNA 1NANI 3KYNB 3NA9H 4MA1C 2VO5A 5EOQL 3ROOA 4Y5XC 1FORL 5DUPH 4G8FB 5E1HB 1NEZG 4ZAKA 4CL7A 2DQIL 4WU7B 3OKLB 2DD8H 3KPLA 1FFRA 1T04B 3KJ4C 4FRWA 5E2WH 4TULH 1VADA 2I07B 5ISZA 4K3EH 5TPWL 3SDAC 3TIDB 1JHKH 5SWQA 3MC0A 3DX6A 3MRJB 1YC8A 3Q3GB 3SCMA 3IDYB 3IJHA 3PWLB 4LHUG 3GIVA 5EU4A 2R2EB 3BP7B 1Z9OA 3EYQD 4I0KA 3O6LH 4V1DE 3MRPA 4LGRB 1TITA 2WBJA 2R0KH 3NABL 1KB5H 3FQXB 1K4DA 2K7QA 3EJYD 4N0UA 3E1F1 1BFOB 4IS6A 5JXEA 1KJ2B 1OAYH 5C0BE 4Y1AB 3JV5A 1YUHA 4L9LA 2YPKB 3EHBC 1FSKC 1NLBH 3CD4A 4PV9B 4QHLB 1SY6L 1DBAH 4KDVA 1OGAB 4G6ML 2DQFB 4S0TD 5HHPB 3QDGE 4NKIL 1CICD 4MVBC 5I8EA 3FQNA 2DYPB 4BFBD 2VJXA 3GRWH 5CP3A 2FCBA 5I1LB 5CJ5A 4WDIA 1G9NL 4ZQKB 2IADB 1K5NB 3ULVF 3WS3B 2JJSC 3DROA 5SWSB 5HYEA 4JO1L 1MVUB 3V2AR 2IJ0C 4UIMA 2J5LB 1X4ZA 3L3GA 4QHKJ 4XPHH 1S9VA 4OD3L 2IPUG 4K2UH 5IM7B 1NGYA 4RNRA 2Z8VC 3VJ6A 2Z91B 4WW2C 3AM8A 3E6HB 3HUJB 2PUQT 3V6OA 3TBTA 3GDBA 3PWNA 3GMPB 3K8MA 4JM4L 5E2UL 3S96B 1U92B 3CU7A 5H2BA 1E4XI 3P0YL 1T22A 1FNAA 2YPVL 3ARFA 4K3JL 5JQ6L 3INUL 4HIJA 1XGUB 2IALA 1LHZA 1U8QA 2AW2A 4U1NB 4NNYB 2OK0L 2VDML 1AO7A 1GHFH 2XRAH 1BOYA 5JW5B 2UWEF 1BREA 1OD7A 2AXHA 3LN4B 1D6VL 3EOTL 1J0KA 3DXAE 1AGEA 1CZ8H 3ZKMD 2V7HA 1SEBA 2GITA 4DGVH 1NCAL 4X9BA 5D7SL 1ZE3C 1TFHA 1GC1H 3NIDF 4J8RA 1CFVL 1S9YB 4FFYH 3CH8A 5CZXD 4DGYL 4KHTL 4U6HA 2B1AL 5L2KD 2FECI 3DUUB 4NQEE 4ZPTB 1J0ZA 1JZ2A 2EO9A 5ACZA 2W0PA 5EBWB 4JZOA 2AEPL 1HZHL 2ENSA 5FKPA 2X44D 5A3ID 5GS0C 3PG2A 4PJ8D 5DWUL 4X6DA 3SDCD 3TYGL 3T77B 4MMXC 3KNBA 2G60L 2NX5D 3OJDA 4QRTB 5CZKA 1OTTC 5C6PB 3CX5K 1ZHKB 2BNUA 1D5IL 5BZDA 1NL0L 3HRPA 3TPUB 4GOSA 5FYJL 2X9YA 3UPCA 2IQ9H 4G8GB 2NY4C 3WL9A 4N8VB 3IU3A 1S8DB 1R24B 4YUEL 5IHZB 43C9B 4AEIL 4BSVB 4F57L 1A21A 4NN6B 5JR1H 3BN9C 4P9HH 4PY8I 3GHEL 1BVLB 4HXAL 1LEKA 1XGTA 2E8ZA 1TJIH 4AG4L 4LEOA 2PW1A 1G7PB 3LKQB 4F7TA 1S5HA 3F6LA 3REVB 1GRWA 5I15H 8FABB 1EBAA 2A74B 1JF1A 1NC4B 2FYYB 4N0CC 4NUJB 1NAML 1P1ZA 2Q7YA 3HPLA 1ZHLA 1R3LB 2VL4A 3GIZH 1YQVH 4P4RB 1B0GA 2EH7L 2PW2B 3UYRH 4I3SL 5KSAA 4R9HA 2CXGA 4DUVA 4DTGL 5DFVC 4Y4HB 4PB9L 3SKOA 1IC7H 4NSKB 2VLKB 1RIHL 4JFYB 1I85C 1U2CA 3GMOB 2A6JB 2VLRA 1I9RL 3BYYA 5DJZA 2W60B 1IT9L 1OY3B 4N9OB 3CFCL 3O8XA 2J3SA 3I3EA 3PL6A 2NW2A 3HE6D 1ZKAA 5D70H 5DEFA 4JG1L 1CG9A 4UILH 3DV6B 1KIUA 3TN0B 1A7NL 5CGMA 4TQEH 3VH8B 5CD5C 4M00A 3JVGC 4OUOA 1T66D 1DLFL 1WFUA 4GLRH 4X9IA 1WBYB 5FOJA 3WJJA 1D9KA 1LK2B 5HYJD 5MP6H 1AC6A 3UO1L 5IQ9A 4O58H 3RGVC 2RHEA 1HHHB 2EKSA 1UADC 1RAMA 2R0WL 2ZCKL 4KROC 1E0OB 1HSAA 2Q86A 4Y4FC 3W5MA 1FL3B 2NXZB 2VDLH 2WP3T 4JKPL 2QEJA 3WEXB 4PJ5D 4XCNA 4P23A 4LCYA 4OZ4A 5FYKH 3T0WA 4WI4A 5JHDA 3WDHA 4KGLA 3W0WE 2D0HA 3F58H 2QSCH 1UH3A 4LF3B 4PJXF 4PP1C 3OR7A 4JJHA 3HFMH 1B2WL 1MHCA 3UJJH 1U3ZA 3C2SA 5J7CC 3MRRA 4M3JA 2J7LA 2IPUK 4WI2A 5DA0B 5D72H 1YN6B 1M7DB 3O3BA 4WTZG 5CINL 5C8JB 4XC3L 5GHWL 1MHPH 2KZ1B 4HULB 2MMXA 2W38A 4QT5A 4NUGL 3IFNL 3QPXL 2VLJE 2OMNA 5KS9F 3GK8L 2ZNWA 4LKXB 1JFQL 4HKXB 3LKOB 4NBXB 3TZVA 4LMQI 4ZFOB 5IG7A 2ZWLT 1N5AB 2BY1A 1CDGA 1RMFH 1YDPB 1JPGB 5JW4Q 4NQDB 2K1MA 1ZLSH 4AIXA 3E8UH 5GISL 1OGTB 1B88A 3EYFB 4Q9RH 3QYCA 4E0RB 3QO1A 5HI4C 2JB6B 4L5FL 3UBXG 1OARH 4XZUA 5L0QB 3IXTB 4GXUM 1GAFH 1I3UA 2R2BA 4EBQL 4PJFB 1I9IH 4MHHG 5FEBA 1RZJL 1WEJH 5K9JL 2J12B 2VB5A 4PJGB 1Z2KA 2Q1EA 4CN6A 5GGSA 2X4UA 1KCVH 4XTRC 4I13B 4M6AA 3O6FD 4TYUA 2AGJL 4YHOL 5CEZE 5LGJA 5GRYA 2XG5A 1ZLVK 1K2DB 3QIWD 2ILLA 1MCQA 1W72B 5C3TA 1NFIB 3ULUC 2Q6WA 5EO0A 3PGCB 4BZ2L 2AJSH 3G08B 1KB5A 5HHMB 4JN1H 3WSQH 2RFXB 4HLZG 4I2XB 4QRSB 2WWMC 1MLCB 3LKNB 5TF1H 3U48A 2X70A 4PJCF 4G80B 1G7HB 4HAGA 2Z8SA 4DN4L 4NKOB 1GYAA 4KV5F 3D6GA 4U6VL 1FP5A 3MJ7B 3FTGB 1ND0A 4NGHL 1QBMH 2ICWB 3GRWA 3VXTB 3ARGA 1CDYA 2BVQB 5GS0H 1A7OH 4O02H 5HHVL 3CSBA 3ARZA 5TE4H 4D8PA 4MXQD 3MLTB 5I71B 2VISB 1BZ7B 1OAXL 4EJ1C 1QHOA 2E9JA 4YR6B 1SJEB 1XGYL 4JFOA 3IU4H 4WGWB 5E7FA 3BKCL 5E08H 1JGUL 1BX2A 3DVFA 5IWLA 4F7EB 2P5WE 3R4DA 2BP3A 3VWJC 1FVCB 3IDXL 4UQ2A 1WTLA 5D5MF 3WFBH 1F6AA 1CXLA 5C0RH 1DL7L 4ZODA 4ISVB 1YNKL 3T0AA 1A4JB 3KYKL 3AMKA 3VXMB 5HYFA 1RHHB 2XV6B 5HGGS 4PGEB 1XGRB 3BP6A 5BXFA 3CXDH 1KTDB 5D7LB 4CMMB 2XNAB 4KDTC 2EH8L 4MD4B 4CW1A 5D6CA 5DRZB 2B39A 4IJ3B 5FGBC 3T4YB 1S7SB 5DVLA 4NO0B 4QTHA 4OZHE 1X7QA 1CXEA 3H2WA 2X2YA 3HKFA 3WE6A 3WYRA 5DUMH 4ZXBB 5MEND 1BLNB 2C1PB 1PY9A 3QFDA 2IAMB 3QUKB 4RA0C 5D96C 4FZEL 3D85B 1OTUC 4NC0B 4R90L 1VKXA 4FA8A 1N8ZB 1J8KA 3BWAB 3GSUA 4GKZA 4WU5A 1JYNA 3V9FA 1P5VA 1UWXH 2JE8A 3AROA 3IRPX 1FRGH 4BSWB 5ID1B 4JDTH 1JRHI 2AQ3A 4QRQB 4Y1AE 3EYUH 1CFSB 4OZIB 5L7XH 3F12B 5BMFL 4JKKA 5JA9A 4Y19A 4KVNH 4GXUN 1J18A 1G9NC 4HJ0C 4XP1L 3IDIB 4Z6AT 2DL9A 3ESUF 1ZANH 4HC1H 3SY0B 5IW1A 5J57B 3T1WA 1FLRL 3BKJH 4M6NL 4UT7H 1WUNT 3ZT7A 1A2YA 4ONGH 4X7CC 5CGYC 5HHQA 2CDGB 1T7XA 4JGMA 15C8H 3UTSA 5KJRH 5GZOC 5L88H 5DTFA 4KUZH 4MDJA 4FXKB 5I74C 4DAGH 4FQ1L 2ZPKH 4OV5A 3HUJE 3DURB 3MSPA 2R2HA 4D9QD 1ZVHA 4CVXA 3T8XA 3IB4A 1JV5A 3V8OA 1A6AB 2MQ3A 3MO1A 3SKUD 3LPGA 4N9GA 3C2AL 4R2GB 3I75A 4ODUA 3ILPB 1BD2A 4RGNE 4U6XA 2VL5A 4LGSB 3VFNA 2XA8H 4TRPL 5LGKA 3CMOL 5B4MD 2R29H 3I85A 3WLBB 2QR0B 4KRPC 1KN4H 2VABA 2YK1L 1D3CA 1IC4L 4OZFH 1A6PA 1KPVB 2V17L 1GPOH 1D6EA 4MCYA 5HD8D 2FGZA 3V4UL 2RR3A 3VW3H 2X4OB 5C1MB 3UJTH 3B9DA 3DETC 3T4AA 4AIZB 4KKLC 4JFFB 4O51B 3G5XB 5FCSH 3O2VL 5HYSB 1YEJH 2C5DC 5DJXA 2CO6B 2APVA 4ZO7A 3FONA 1QA9A 4NDMB 4YFEA 1HYRC 4L3EB 4MCZB 4HKJB 3S4SB 1PFCA 1YEHH 4R4FL 5DZNA 3RL2A 3DX7B 1DE4A 1RUAL 2F5AL 3MA9L 3RDTC 3RTQB 3ZTJG 3CLEL 3EW3B 3IXAB 4GG8B 2HRPH 4F7MB 2ZG3A 2ZSWA 3V0WL 4NN7C 1P7QB 1JL8A 4RGNC 1FYTA 1H3GA 3SDAA 3HB3C 3F5WB 3OPZH 1D5XA 3T3ME 3DUHA 5DUBA 1ZA3A 3CLFH 3ULUH 4APQD 4MA7H 3VXNA 5EU6B 2D3VA 3QAZB 1NMAH 2VN4A 4Z7VF 5DHVH 5INCA 3W82A 4P4KA 2AABL 1JWUA 4I0PB 2NY5L 3SKMA 1SEQL 4PRBA 4XPAL 4X83A 4UNUA 4X6BB 3QDGD 5IFJB 3K74B 4QRPB 3TJHC 4Y5YC 3HNVH 1FAIH 1MCWM 3QHZH 3ZLQC 5JW4N 5E56A 1HQRA 1H5BB 2G2RB 2VAAB 3S88L 4P59H 5KSBF 5D71H 4PJBA 3PHQA 1UM5H 3BPOB 2YOCA 2V9QA 2E6QA 3RNQB 2YUXA 2JJSA 3FB5A 5CKAA 1DQJB 25C8L 3ARDB 3HC3H 5JORB 2VLKE 2HFFA 1NC2A 1YC7A 2AQ1A 5BO1L 2AEIT 4U1JA 1L4IA 3HAEG 2NY3D 2AQ2A 4WW2A 4U3CA 1RZ7L 1UA6H 2NQCA 2VUOA 1YEFL 1HH9B 5L8LB 4XGZB 4BQ8A 2LVCA 4CADA 4HJJL 3BPNB 3DVGA 4M5ZL 3HA0A 3L3DB 4P3CL 4KK6D 3SPVB 3PNWB 4P2YA 2W9EH 5FM4A 1KJVA 4ORZC 3SKNA 1QG3A 5EOQH 1M4KA 5E5RB 4A2MA 1FORH 2A6IA 2E7HA 2X4NB 4P2OD 4DFHA 2RCSL 3QQ3A 3ZKSD 2DQIH 4M3KB 1BOGA 5EC2B 3U2SA 4O2CB 4OBRA 4X7TB 4D3CH 5C0DB 5ETUA 4ZO9A 5FOBB 3S34L 5TPWH 4NO3A 1XF2B 1FZMB 3P3YA 4U0RB 4HWUA 3OB0H 2DQGL 1T5XB 3DV4B 1R5WA 3AXLB 4NZRL 4D0CA 3FO0L 2HFEB 4Z77B 4ZFFA 3X11B 3RAJL 1XCTB 4RA3A 3VGAB 4HKZA 4RWHA 3Q5YA 5SWZA 1AGCA 2SEBB 3VRLE 3AS0A 5C0GB 4FQ2L 3BXNA 1U3HC 4J4PD 4PJDF 3PJSB 4QHUB 1SY6H 5FO8A 4M93C 1G7MA 1YY8A 3K8LA 4IRSD 5HDQL 5F72S 4NKIH 2QADC 4F7PA 5HJ3A 1GZQB 3KPQA 3QDJB 2ITCA 4M7ZB 1G9NH 5DD6B 3TBSB 4JO1H 1CF8L 5HY9B 2X9XA 5I76B 4P5KB 4PGDB 5DS8B 4MAYB 2DIBA 4OD3H 3LN5B 2YRPA 3VI3E 3L5XL 1NLDL 2A73B 1HI6B 1RZJC 5DI8A 1EEYA 3LDBB 5FGCB 5HVGB 3NZ8A 3TO4C 4MS8D 4ZUTA 2ZOKA 2VOTA 3T0EB 2UV3A 4L4VD 1A9EB 2C26A 2CDFA 4JM4H 4N90E 5E2UH 1CFTB 2XXCB 1U8HA 1MHHA 4PBWD 4PJFE 4U0QB 3WLWD 2XPGB 5L2JA 3VXOB 5J6HA 2FJHB 3P0YH 3QT2A 4X9GA 2P4AB 2LVEA 3I02B 2YPVH 4K3JH 5JQ6H 1OWWA 5GS3A 5F9OL 2ZKHL 4YDLB 3BFOA 2OK0H 2VDMH 2R69L 4LLDA 4C4KT 3IDNA 3X12B 1BMGA 1OLLA 4NJ9L 1OQXA 5IB5A 1D6VH 3EOTH 4PRDB 4NCC2 1NCAH 3M1BB 4ETQA 5D7SH 2XKNB 3JTTA 2MFNA 1CFVH 4PJ7A 3QIUA 3GGWA 4DGYH 4KHTH 4WI6A 2B1AH 4WWKB 3BP5B 4S1QL 5I8KL 5FB8B 4E41A 1CQYA 4Q6YA 2GCYA 2YD3A 3IS1X 4GRMB 1IM3A 4I2XE 4LKCA 1FV1B 2AEPH 3MV9B 3EO1A 3UTOA 4ZPVA 1HZHH 4YJZL 3KYAA 3EYVB 2F53E 5DWUH 3TYGH 5DRNA 3S3SA 5BS0E 3JVGA 4RGMC 5DD0L 1LD9B 2G60H 2VXSL 5E8OA 5IMMA 1T1WB 4HC1A 5SX5K 3RWCB 1FE8L 4WFED 3MJ9L 5T1MB 5EOTA 4OFPA 2R9HD 1D5IH 1NL0H 5I1AA 1T5WA 4JHWL 5FYJH 3MRLA 1MFDL 1VGEL 3FCTA 3VE0B 4Y88A 1SJHA 4RQQB 4YUEH 1QNZL 1JUFB 4AEIH 2VZTA 4NPYA 4F57H 4I48A 2EC9T 3QXWA 3VRIB 3W0WD 4FABL 1WZKA 2ENYA 4JY4A 2NLJA 4R4BA 1WJ3A 2NY0C 3SDXB 1A0QL 2JJVA 3GHEH 4LPWA 4U1IA 2BRRL 4UTBL 5AYUL 4HXAH 4KKNA 1FZOB 5IKCB 4AG4H 1P4LA 1KF9B 5JO5A 1A6VL 2DWEB 5EIVA 3HCVB 3MNVA 4M8VA 4AENB 5IOPA 2AJXL 3VXME 1JHTB 1NAMH 3CSYA 5E8EB 4RFNB 3TVMD 4JREB 4PB0L 4DCQA 1KCLA 3LPFA 1YPZF 1J7VR 5D7LE 2H8PA 1O7SA 2EH7H 3DMMA 4I3SH 3RVVC 4DTGH 3RFZC 4OZFA 3VMPA 1TTFA 3QUYB 3G6AA 4PB9H 3IT8D 2FRGP 1RIHH 2I5YL 3O3AA 5ILTL 5I18L 3FKUS 1I9RH 2MQ0A 2NW3A 5C0CA 1G7JA 2F54E 3C09B 2CUMA 3ALPA 3CFCH 1XCQB 1VFAB 3HNTL 4BFEA 3VCLB 5FF6B 4JG1H 1RIUL 4X0KA 5FA3A 4RMTA 4Z5RB 1F4XL 2R15A 4FQIL 2ATPA 5CEZD 5D1QD 1A7NH 1PX3A 3ZE0E 1YMHA 1PEZA 4GW1B 4WVRA 3JBG7 1DLFH 1WAAA 5C0EB 1CXHA 3SEPA 4B41A 5GSRA 1IGCL 4OZIE 2DDQL 3GJEB 5D93C 3UO1H 1OAKH 3I84A 3U0PB 4XH2A 1H15B 2DKMA 4JFHE 3BW9A 1A22B 1FZKA 1R5VB 2IPKB 2BNQE 2R0WH 2ZCKH 1JF6A 3QNYB 2GHWB 3R8BB 3PIQB 5I8CA 5DHVA 3VXUA 3KPSD 2CLVA 5JW3L 3RVXD 3UZEA 2BERA 2VWEE 2EXWC 2R1YB 3QUXC 3MLPA 2M8XA 3DVNB 3NFSL 5CSZA 5FA4B 4CBPA 3QB7C 3RY4A 3ET9F 5SV3A 2IBGA 1UJ3C 4N5UA 2R2CA 4PFEA 5DJ2A 1F97A 5CJOL 1B2WH 3ARPA 2YA0A 5B38G 4HW6A 4JM2C 5HXMA 5D7JC 3LN9A 3MRQA 4HWBA 4XBGA 2CIKA 1JYWA 3RVWC 5CINH 4KQ3L 3WHXB 5I9QC 5F6HI 5GHWH 4K07A 4QLRA 4ZUUA 2P5WD 3IFNH 4NUGH 3IF1A 3QWRD 2PYED 3QPXH 2ARJB 4NHUB 4RMRA 1KJMB 3GK8H 1JFQH 5F89B 4NRZA 3ILQC 1MCWW 2OQJB 2RGSA 1F58L 3CFKA 2WUBL 3IFPA 3VWJA 5GISH 4QOKA 4YZFE 4GRLC 3FO2A 4JAMA 3D39E 4HUUA 2DLHA 1CT8A 1Q72L 4L5FH 3T65A 32C2B 1EAJA 3MCKB 4OLUL 1KENL 2PCPB 2MOVA 5ITBL 4EBQH 4JRYA 1RZJH 5D1XB 4EEEA 3MNWA 1EHAA 2J8UE 3FB6B 4O9HL 1TVBB 3JV6A 4UNVA 1L0YA 1YN7A 2VITA 2XWBB 4KDTA 4LLYA 2CSPA 2Z4QB 4PJAE 2Y06L 2OL3B 4L3EE 1NFDA 1F3RB 1FGVL 2AGJH 4YHOH 1GH7A 5ENWA 5FGBA 1T4KA 1F02I 2IBBA 3LV3B 3L5HA 3L3IA 3TPKA 5TDNB 4LSRL 3HMXA 2CLZA 4I4WA 4F9LC 3QZWG 4BK5A 2YBRB 4JQXC 4BZ2H 4HMDA 5HPOA 2CO7B 4FS0A 4I1NB 1J10A 1G6RB 3BQUA 4HF5L 2NY5C 4MJIA 3LKSB 1J1OL 4Y1AD 2OS7A 2P8PA 3RVUD 3VFSB 3RGHA 1AHWC 2YA1A 5EBMA 4WV1C 1U2HA 4HHAB 5JOFA 1SY6A 3QR2A 1OGAD 4LPUA 4DN4H 4FMKA 3CVHB 3DRQB 4U6VH 2EXYD 4UOW1 1KFAL 3DBXB 4NGHH 1KB9K 5A16B 2DYPD 4NT6B 1KIQA 4PJHB 3VFWB 4JB9L 2RJMA 5HHVH 5SWSD 1CD0A 4YH6A 4DKDC 1BF2A 3V6FA 2YSSA 5DJAB 5DSCA 1D5MA 1OAXH 3MRHB 2X4RA 4M43L 4Q7DA 3BKCH 1JGUH 2CRMA 3H9SA 5IEKA 1NGXA 4L3CB 1FZJB 3JTSB 2O5YL 4P0DA 5IF0A 1MRFL 3Q6FA 3ARBC 4X7EC 3IDXH 1TQBB 5F9WB 3KPPA 3KVQA 3NFNA 3HZVB 1DL7H 2R1WA 1YNKH 2LV4A 4JFQB 4PJCA 3KYKH 2VSCA 2PO6C 2O61B 3ZO0A 1S7VB 3VGHA 2A0LC 1CFBA 5HVHC 4X7DC 4WENB 3GJFB 3MLYL 4XMPL 1U8KA 3TBVB 2G9HB 2EH8H 4YHPB 4U33A 5E70A 3ZYOA 4A6YB 1Y6MR 3SGEI 3O6ML 3JWNC 3RUGA 2HG5A 4EUPB 5C0IB 2HFTA 1F5WA 4GAGL 1FO0A 1KT2B 2W0FB 1F4HA 1KCRL 2YN5A 4TN9A 2NCMA 3GSRA 1SYVA 2GW5A 3CXHJ 2H9GB 1LP9F 2FIRT 2J8HA 1X5LA 1VENA 5DZLA 5ESVA 1EFXD 2EE9A 1BJ1H 5BZWB 5C09A 3BPOC 3FO1B 4FZEH 3T0XA 3WXVL 4R90H 2XFXB 4XWOD 3V52L 4Z8FL 1O7VA 4EI5B 3BP4A 5HGAB 2I27N 3WIFB 1ES0A 5I19L 2WBWB 3CZJA 3EOBB 5E2VL 1UXSB 2JK5A 2DWDA 2EDNA 1MCRA 4LCIL 5CBEB 3VDAA 2YPLB 4PR5A 2NTFA 4G8GD 5BMFH 4AM0B 1ORSA 4XP1H 1AIFA 3RDTA 2BSTA 1MJ8L 1A7QL 3DTXB 5DHYA 5F96L 5JPMB 1F4WL 3O6KL 3AVEA 2CLRA 4QYOB 3OKMB 3P2TA 1FLRH 4M6NH 2PTUA 2VIRB 4YK4B 4LLMA 4ODXA 3MBEB 4MSWA 1F2QA 1Q94B 3OG6B 1IEAB 5EPMB 2H2SD 2P7TA 3QEUA 4JANA 5BJTB 4ODWA 4YDJB 4GBXB 1NC4D 1YEEL 1CE1L 4EDXA 1NAMA 4CU8A 5FGCE 1CLZL 4FQ1H 4YHZL 3L6FB 2L7UA 3OR6A 5HI3D 3T0EE 3MV01 3RWFA 2CQVA 4NFBA 1JPTL 3U4EB 4HT1L 2YMXL 4JFPA 3L95B 3C2AH 3QNZB 3H42L 3IDMA 1IM9B 5B21A 3BN3B 4Y4HD 2APTA 2VLKD 2NY1B 3WD5L 5E6IB 3GMQB 3QUML 4LSVL 4TRPH 2XN9B 3CMOH 1ZLWK 1DVFB 4LSDA 1Y18B 4PJIA 3V7AG 3PUCA 2Y7QB 4Y2OA 2YK1H 4CU6A 3OAZK 3CDYA 1CFNA 1M6OB 2YEZA 1IC4H 5DO2C 3RL1A 2V17H 2OR8A 2P42B 3FJTA 2P8MB 4QF1A 5CEYB 3BZEB 3TN0D 1KBGL 1DUZA 3HE7B 3IFOB 4XNXL 4JG0L 3FQUA 1JWMB 5D7IA 4W4NA 3O2VH 3IFLL 4HUXB 4LLVB 2ZUUA 5GZND 2GKIA 4HPOL 1A7RL 1J0HA 5FYLE 4XPTL 3V4VL 4LDOB 4NFDA 3VXSE 4R4FH 4X5LA 2C1OA 1RUAH 2F5AH 3MA9H 4HKBB 3CLEH 3I6LE 3QQ4B 2NXZD 1LO0L 3BIKA 2XY2A 1QSEE 3V0WH 3QRGL 3VXPB 1AXTL 2WV3A 1D5BB 4MJ6B 2FATL 4LAJH 4TUKL 3SDXE 2GJZA 1HWGB 3MUHL 4LQFL 1RZKC 2X1XR 2AABH 2FEDD 2NY5H 1SEQH 4XPAH 1EDQA 2H32B 4N0FA 4OFDA 5CD3B 1BHGA 3X14B 5BVPL 1U3HA 1NGZB 3QJFB 3AC0A 4YDKL 2EDTA 5I1EL 3S88H 1EERB 3U4BL 3H6JA 2DI8A 1PYWB 1LDPL 4NQDD 5C07A 3PWVB 2CMRL 2E6JA 2H3NA 1YA5A 4PY7A 1H9VA 5TDPB 2D31A 4DFIA 25C8H 2ZUQB 5EU7E 4OSUL 4GKNA 5TDOA 1TQCB 4N90D 3PHOA 2X42A 1QLEL 2EE2A 5BO1H 5H8DA 4O2FA 1C5DB 2E27L 2WLYA 3C5ZB 1RZ7H 4Z7VA 3TYFB 4MDIA 1YEFH 3TO4A 4XVJL 3MRDB 5ANME 1JF5A 1ERNA 4HJJH 3MX0A 4M5ZH 3P9MA 4XCFL 2BMKB 4QXTB 5AG8A 4P3CH 5BRZA 1XR9A 3MUY1 5F70A 5GS1C 5T1LA 4NQUA 1WC7B 1QBAA 4HEPG 4QRRA 4S2SB 5E00B 5DEGA 2VDQL 1XZ0A 2RCSH 5HHMD 1UACH 4XXCA 1DEEA 3MRIA 5F93C 4WO4C 3S34H 4BELD 2VKWA 1Q9OB 5IMOB 1DUYB 1S9XB 3O9WB 1MJJB 4JCMA 3E3QE 2XWTA 3WNOA 4JFZL 2DQGH 2Y6SC 5ICXB 4H88L 3N1GC 1HH6B 1I8MB 2NR6C 1F8TL 2P5EB 1QLFB 4NZRH 1DDHA 4LCUA 1H0DB 2XOTA 3FO0H 1K8DA 5DYOB 4MNGB 1BAFL 1XH3A 3RAJH 3OHXA 1JZ8A 5EN2A 4DWHA 2ERJC 3KLAB 4GG6B 4FQ2H 4LLAA 1C12A 1AXSB 1E27B 2PXYB 3DO7A 4JGUA 5HDQH 2QQLL 4J7RA 4JVWA 4GJTB 2WK2A 4JFEB 3LQMA 2IANA 3V95A 3FN9A 1QQDB 4ZFGL 3MLXL 1CF8H 4IRJC 3ZKNC 4IOIB 4BQ6A 1U8JB 1B6UA 1I1YA 1XGPB 4UDUB 3RNKA 1MCPH 5DRWA 4RWYL 3VXMD 3L5XH 1NLDH 3KS0H 1ZLVH 2X4QA 2Q8BL 5HYQA 3DYPA 3N1FC 4PREA 3E3QC 3PQYB 2GT9A 4L8DB 2FLRT 5BV7B 5D7LD 4P5TC 3SGDI 4DVBB 4V2BA 2HJLB 3O3DB 3LQZA 4XI5D 4NO0D 4XHJC 5F9OH 3QA3A 4RMWA 2R69H 4ZXBD 5EU3B 3R06B 1HSBA 1N64L 4NJ9H 1K4CA 5KG9B 2IAMD 1SYSA 2CDEB 4MB3A 2L4OA 4D9LL 1CU4L 3MRFA 3D85D 1TXKA 3WN5B 2FR4A 3QG7L 4RAUA 4UU9A 3L5WA 2H2PD 1A5FL 1KCSL 3X17A 1DQDL 4S1QH 5I8KH 3HC0A 4XXDA 5DQ9A 3IDJB 3O45B 1KXVC 1EO5A 1Y6NR 3VXRA 3PABB 2IPTL 1FDLL 3REWA 1EFQA 3A0OA 3BO8B 1YY9D 3TFKC 3R8QA 1PLGL 3RX7A 2BSSB 2MQCA 5DD0H 4ENED 2VXSH 1FE8H 5IW6B 3MJ9H 1LNUB 4IOFC 1TVDA 4P9ML 3TNNB 4OLEA 4K7FB 4PJHE 3U0TB 3MUGB 1TNNA 4JHWH 4KKCC 4P57A 5JDSA 1MFDH 1VGEH 2M1KA 4FTVA 4P46B 2IH3A 2EC9U 2YR3A 1QNZH 1TPXB 2R1XA 3EIFA 5A2FA 3CJJA 3O4LA 4FABH 4X5WB 4M61B 3TBYA 1A0QH 5DD5L 2BRRH 5HGDB 3QUXA 4UTBH 5AYUH 3NCCB 3O6FA 2DLEA 1ETZB 1FFPA 1YECL 2VDKL 3RWHB 1A6VH 1JN6A 1X5IA 1C16B 3KPTA 4XPFL 4CVUA 1W72L 1YMMB 4R2GD 4IMLB 5JTWA 4HGWB 4JM2A 2AJXH 5D7JA 4NBZB 4UV4L 3L3HB 3HUJF 2BVOB 5DHXB 2V2TA 3GO1L 3S35L 4ETYA 5J6GA 1ZMYA 5CCKL 3V5KB 4PB0H 3H7BB 3SO3B 5J9PB 4XRCA 4NO2B 5HHXL 5KVDL 2FWOB 3RBSA 4QCIA 1EGJL 4GQ9L 1IGJA 3U36A 3K80A 2AV7A 4OLZL 2IFFL 3KGRA 3K46A 5INDB 1HHJA 2I5YH 3Q5TA 4S1SL 1W0WA 5ILTH 1I1AB 5I18H 3BEWB 5BW7C 4JCLA 4JRXB 4JFFD 2BVYA 4TVSa 2HJFA 3FO9B 3WUWA 3OAYK 4XPBL 5JPNA 4JZJA 2VSDA 1M05B 4R3SB 3HNTH 4Z7WB 1P53A 4TSBL 5EIIB 1FNEA 1RIUH 3O2WL 4L3ED 2WINB 1EVTC 3VA2C 1F4XH 4FQIH 3VD3A 3RTQD 3MRCB 3ARBD 1URLA 4YAQA 3QUZB 1WICA 3PWUB 4G9FB 3HRZB 3W11D 3BEVA 2YPLE 3OAUL 2HJKB 1IGCH 4AEHL 5E6ZA 1ZS8B 1FHGA 4G8EB 1YPZA 5E8DL 1P7QD 1N3NA 3LHPH 2DDQH 5EO9B 5KSVB 1BZ9A 3W2DL 3NZHL 4NZTL 2DRUA 1ZWIA 3KJ6L 3LPWA 3FN3A 4POYA 4F9LA 4G8IB 5KANI 1YEGL 5EU6D 3O4OC 2DOCA 1PAMA 5JW3H 3GM0A 3I2CL 4I0PD 5CMAA 3UEZA 3VWKC 4J3WA 1M71B 2CXKA 3NFSH 5F3BA 4QRPD 3AB0C 1NSNL 5J13C 1AHWA 4NQCB 5CFHA 4KQ4L 4U1HB 3TO2A 5CJOH 5MENA 1S5IL 3B5HA 5EA0L 4R7NA 2NY7L 2A9ML 4LHUA 4ZNEA 4KQ3H 3EJZD 3VGDA 3P9LB 4LCWB 5CIPB 1PJ9A 4OCXL 1OHQA 3EBAA 2EICA 3MLUL 4X99B 3ARDD 1V7NL 4L4TA 4WEMB 2X4TB 1U58A 2ITDA 4YBLC 4HLZH 4R96A 4AH2A 4NO5B 2DLFL 2HKHH 4MX7B 2W59A 2W91A 3SOBL 1F58H 2WUBH 3TH4T 1AR1C 4UV7L 3U30B 3C8KB 1J05B 5D2NE 4GMSH 3WFCL 1GIGL 4G43B 1Q72H 1S7XA 2GK0A 4YDIL 7FABL 1T1XA 4OLUH 1KENH 1QFWI 4Y5VC 5HDLA 1MQKL 2PO6A 1DBJL 2VERN 3H9HA 3OKOB 5ITBH 3P77B 4X4MA 4DZBA 3QFJE 1I75A 4O9HH 1J0YA 1MCSA 3VFUA 2DMKA 4MWFB 1HXYA 2Y06H 1MQ8A 1GGUA 5E8PA 3ECBB 4PGBA 1FGVH 5CJXA 4LP5A 1PZ5B 4W4OC 4K23L 3MLVL 4LSRH 1EAPA 1Q38A 3HG1E 5MI0C 1W0YT 5C0ND 3GSNB 3ZSTA 5HHNA 4RFEB 3CXHK 3D3VE 1IL1B 1ZOXA 1UKTA 4H25B 4HF5H 3N1MC 5MERB 4NZJA 1F42A 1S78D 1J1OH 4ELKA 2AAVA 12E8L 1IAIL 3QI9B 4OZGB 4QGYA 3B2UC 3GMNA 3P9WB 3ROOB 4UBDD 5D2NC 2Z0BA 2ED7A 3FT2A 4WNQA 2EYSA 4ZAKB 3BT2L 2DICA 3KPLB 1EVUA 1KFAH 1MUJA 4K7PX 5GRWA 4FZ8L 3MYZA 1BJ8A 1JWSA 3QDJD 1VADB 2GY7B 3KHOA 3VGEA 4JB9H 1G0XA 4F15B 5SWQB 2BX5A 3DX6B 3IJHB 5I8OL 3GIVB 4FG6D 5FFLA 3GSWA 1P4IL 2BVPB 2O5XL 4MAYD 3BPCA 3MRPB 4JFDA 2WBJB 2NXYC 4M1CD 1FN4B 4N0UB 3FFCE 5HI5C 3VFOA 3TCXA 4WW1B 2O5YH 1RHFA 1I4FA 4IS6B 1MRFH 4KC3B 2MCPL 3SDDB 3T0ED 1MFCL 1DJSA 1N59A 4L9LB 1L7TL 5DVMA 3I6KA 1T1YA 3BDYL 5JIHA 2CUIA 3PGFL 5GQBA 2KKQA 5HGHA 4AYFA 2NPLX 1H3TA 1UM6L 5CHNA 2FH6A 3FQNB 2GJ6A 2CGRL 1DBML 2D2OA 3MLYH 3UYOD 4XMPH 3W9DA 1EHXA 2R4SL 1MWAB 4PJFF 4HFWA 4APQA 3DROB 2A83A 3EO0A 4UIMB 5KN5B 1XIWC 2N7AA 3O6MH 1T0NA 4PJGF 2QSQA 1IKNC 3LQAL 4NRXA 4GAGH 2NTSP 4PP2A 2A6DB 1LDSA 5C71A 5T3XL 1QOKA 4RNRB 4R0LB 3E6FA 3VJ6B 3HLAA 1KCRH 1CGXA 3GMMA 3LH2L 4WWKD 4MMZC 4PRPB 1MFAL 3TBTB 4BH8B 4UAOC 1MJUL 2GK2A 1TNMA 3MV9D 1TCRB 1AFVL 3WXVH 2OCFD 5ABDE 5H2BB 4BSJA 3U46A 3V52H 4Z8FH 5FYLD 4S1DD 3ARFB 4HIJB 4MA3A 1U8QB 5I19H 4YGVB 5E2VH 2HT2C 4MNGE 1AO7B 4LCIH 3I6GB 3OKKB 3J8F7 1FNGA 4JN2A 4GG6E 1AGEB 2GITB 5K9KA 1G7LA 1QRNE 3BD4A 1FAKT 4Q6IB 5I2IA 1MJ8H 1A7QH 5F96H 1F4WH 3BZFB 3O6KH 2DQTL 4J8RB 3S97C 3AS3A 3UZQA 1ROWA 4U6HB 4JFEE 4ZUVA 1AI1L 4M8QA 4U3XA 4KK8D 3IAGC 5ACZB 1LP9A 3C60C 4JZOB 3RVTD 3BMWA 1M7IA 1J11A 1MCEA 5FKPB 3MRBB 3TCLA 4X6DB 3VD7A 1YEEH 2GSGB 1E4KC 1CE1H 3KNBB 4U4BA 5CEXA 1MAML 3OJDB 1J88A 4OQTL 1CLZH 4Q2ZA 2BNUB 4YHZH 5IMKA 3PQYE 4FFZL 4FQXC 3MACL 1UKQA 3ZTJH 1JPTH 4FNLL 3WL9B 5F7LB 4HT1H 4Z7OF 2Y6SD 2YMXH 3IU3B 1NCDL 4TSCL 3H42H 1TDQA 4L8SC 2AERT 3QUYD 5FYKU 3DO3A 4OIIL 5IBUB 3WD5H 4CRPA 3QUMH 4LSVH 3C8DA 3FT3A 4PV8A 1NCBL 3GZKA 3KWWA 1LEKB 3ME0A 2EIEA 3C5JA 1L9MA 3PV6B 2HWZL 1FNHA 4OGXL 2GQHA 4J4PA 1S5HB 3OSKA 4LVOB 3W9EA 3KPRB 1CL7I 4FFWD 4P2CG 5GRJL 2I9TB 1JF1B 1XF5A 2EDFA 1TIUA 1P1ZB 1Q9LA 1QTYT 1KBGH 1XF3A 4W6XB 4XNXH 4JG0H 3SE4A 3HPLB 3QXDB 1IEBB 3AU1A 4YDVA 2A6KA 4LVHC 2LAAA 1B0GB 1MLBB 2VLMD 3AAZA 2D03L 3IFLH 4EZMA 1N0XL 5KSAB 2BXZA 4HPOH 1A7RH 3V4VH 4JLRA 1FIEA 4XPTH 5E94A 3ZE0F 1IEHA 2E7BA 1FVDA 2K7PA 2VLRB 4OZIF 4L4VA 5H94A 5DJZB 3UBXA 1LO0H 2ICEA 1K6QL 4WO4A 3O8XB 2MCG1 4ZSOE 3HAEH 4GRWB 3HI5L 3QRGH 5B3JE 3PL6B 1AXTH 1X44A 2AP2A 1F00I 3TT1L 2NW2B 4M9PA 1E4XL 2OXGA 4HWZA 1FFQA 2F15A 2FATH 4TUKH 4LQFH 4MXWL 1ZT1A 2C7UA 4Z7QE 4UB0L 3KDMB 2V9RA 4D0BA 2KDGA 2XG4A 2HMID 3NCYS 3BHBA 3K81A 5IQ9B 3H7LA 5BVPH 4Z7UE 5F7NC 3PWPB 4YDKH 2OJEA 1HSAB 4Y2DB 5I1EH 2HH0L 2FZ3B 4JDVA 5F6IC 3U4BH 3NBNA 3G6JA 4J3VA 1I7RA 3X13A 2FECL 3QRFM 1LDPH 4P23B 4OZ4B 2HT4C 2CMRH 4IRJA 2FL5A 5J12C 3AREC 4OSUH 4M1DL 4QHNB 1OSZA 3GSQB 1MHCB 1QLEH 1UM4L 4Z78A 2V2XB 5D1XD 4JRXE 2E27H 1SM3L 2HLAB 1X4XA 1NCWL 1ZT7A 1N5YL 2NYYD 3O3BB 2BNRE 4XVJH 5C0AE 4Y0GA 4Y16C 4TOYL 4U1SA 4P5TA 4QT5B 5IHBA 5F9JB 4MA8L 1Z9LA 5IFAL 3FAWA 3O2DL 3QPQD 4L3AA 4HLJA 3TZVB 5IG7B 4G9FE 5F8QC 1LO5A 3LD8B 4HS6A 1T21B 5D4QA 1PQZA 2VDQH 1P69B 1RIVL 2GSIB 4HUKB 3BGMA 3H8NA 3QXAA 5DR5L 4M48L 4D0DA 1U91A 3QO1B 4GS7C 4LIQE 1PSKL 5DVOA 1QVOA 5C0FA 1DANU 2D0FA 1CGSH 4XZUB 1AY1L 1F45A 3HPJA 1EEUA 3NFPA 3TVMA 3MLRL 2R2BB 4XC1L 4JFZH 1CN4A 1YZZA 1IBGL 4H88H 4Z95L 5C6TL 1F8TH 2ICES 4PLJC 3ARWA 3TNMA 4L29B 4RAVA 5GGSB 1BAFH 3C9NA 4M6ML 5D6DC 4KKAC 4NQCE 3RWEA 1DFBL 4M6OL 4TVPE 1WT5C 5EUOE 1G6VK 5ACLA 4GW5B 5HHOA 2YD9A 3EYSL 3DWTA 3JWOL 3DGGB 1A64A 2Q6WB 2QQLH 2YUVA 1EO8L 3L5IA 1KB5B 3QDMA 2EDRA 3OXRA 3VRJA 4R4ND 1X6LA 3WFDL 4BFGA 2F8XC 5D1QA 4ZFGH 2IG2L 3MLXH 3NCYP 1QPXA 5GRVK 4ZOCA 4N5EC 1JJUA 4POZD 1KGCE 1R3KB 1VGKA 3BRDA 1BFVL 1WIOA 1ZVYA 1WCBA 4RWYH 1WIPA 1HXMA 2Q8BH 5B39G 4OB5L 3BDXA 4CN1A 2XKSA 3T0VA 4WEBL 3GB7A 4MNQE 4LCCB 3KPSA 4D8PB 5H35B 1FFNA 1OP9A 4Y4KC 1KLUA 1A3QA 5FDWB 3RHWF 3FAXA 1DCLA 1BX2B 2F5BL 4P3WA 4WY7L 5M94B 4HIXL 5E9DA 2X1OA 1P5UA 3CFBB 1N64H 5DQJA 2D7OA 1F6AB 2VR5A 4D9LH 1CU4H 5J4MA 1G7IB 3QG7H 5BW7A 5ID0A 4EI5D 2ADJA 1BQHG 5BXFB 1A5FH 2P5WA 2C4FT 1KCSH 4IHOB 1DQDH 2PYEA 4PLOB 1ZT4A 1AH1A 1XR8A 1QHPA 2YPLD 5DFTA 4LLQB 4NM4L 4CW1B 1TTUA 5D6CB 3OKEA 2IH1B 4OZGE 4Q0XL 2IPTH 4NIKB 1FDLH 1WWAX 1PLGH 3N0PB 1ONQA 1P9MC 2NY2B 2XA3A 5DDHA 3S35X 2BSRA 2NNAB 2GTZA 4P9MH 3MBED 5ISZE 4NOBA 5D2LA 3KYNA 1OB1B 2DAVA 3S6CA 2DI7A 1VKXB 5LXGL 4JO2L 4JQVC 1DN2A 2HVJA 4GBXD 4GKZB 4QHMA 1T04A 4HAFA 4N0UE 3A67L 4NWTL 1NQBA 5DD5H 2HN7A 3V7AE 3TIDA 3P4MA 3EFFA 4OJFL 3MCLL 1YECH 2VDKH 4HG4J 3QEQA 4YHYC 2ATKA 2R2EA 4XPFH 1W72H 4PLKC 1OAUL 2A1WL 5A40E 5DK0A 5AD0B 2HTKD 3FQXA 1IM9D 2Q7NA 1HQ4A 4UV4H 3S5LB 1MHEA 4R97B 3GO1H 3S35H 2NY1D 4NQSA 1BFOA 5E6ID 3DRTB 3QUMA 2XN9D 2F9BT 3UDWC 1OTSD 5CCKH 1GZPA 1DVFD 2H41A 43CAA 1A2YB 5HHXH 5D1ZB 2W92A 5KVDH 4QHLA 3O11A 5HHQB 5F7HA 1OGAA 5FO9B 1EGJH 2DM2A 3CVHL 1H3PL 1VFUA 5HHPA 2AK4A 4OLZH 3MRMA 5DTFB 2IFFH 1S7RA 5FHAL 1QRKA 2APWA 2DJUA 4S1SH 1MCFA 2JIXA 4JQIL 5I1LA 4S10A 3JUZA 3HE7D 4OV5B 4OGAC 3SCMC 1K5NA 1JZ5A 3WS3A 5SWSA 3V6OE 2LAGB 3T8XB 3RRQA 1JV5B 2VLLA 1EV2E 3LIZL 3A6CL 4XPBH 4P2RA 3SGKA 1S7WB 2OXHA 3F8UB 4N9GB 4ODUB 4Y5VA 4TSBH 1BD2B 4OM0L 4PPTA 3O2WH 1HHGB 5JXEC 1ZXQA 3P0GB 2XYCA 5SX4I 1AO7E 2VE6A 3GMPA 1KOAA 3IRZA 3VA6A 2PETA 1U92A 3OAUH 4RRPG 3SE3A 2I9LA 4AEHH 1HIML 2OP4L 5E8DH 1SJXA 3HAEA 2ICCA 5CJQL 3B9KC 3W2DH 3NZHH 4NZTH 5AZ2L 3WUZA 2UVEA 3EDEA 4W4OA 1D6EB 2DN7A 1A02N 3KJ6H 4U1NA 5KBNC 1YYML 4NQXA 3S98A 3K2MC 3RI5F 4HS3B 5JW5A 3U79A 1YEGH 3K4ZA 3T4AB 1T6VN 8CGTA 1L9NA 1NBYA 3I2CH 1KLGA 4CJ1A 1DQML 4XP4L 2P47B 5DJXB 3FONB 1NSNH 1QA9B 3SDXF 4KI5C 4X6DE 2BC4A 3AM8C 3OAZH 1MNUL 2X41A 4KQ4H 1VERA 4MA1B 5DMYA 4KAQL 3ARYA 2D7NA 1DE4B 4Y5XB 5CKGA 5EBWA 4I18C 3KJ4B 5EA0H 2ZSWB 2NY7H 2EZ0C 2D4FA 3VI4E 4FFVD 3SDAB 3GMLB 5E0QA 3SJVB 4OCXH 4ZS6D 5JZ7D 4XBEL 3MLUH 3J7HA 1H3UA 1V7NH 1ZHKA 2HLFD 3NGBC 4R7DA 2HVKB 2DLFH 3OKYA 3EUUA 1IC7L 3CDFA 1JWUB 2UZXB 3C5ZD 5IVXB 2Y5EA 3CAFA 4KY1L 4G8GA 3SOBH 1D7FA 4PRBB 3GSXA 5DK3A 1R24A 4UV7H 5KW9L 1OSPL 4UINL 3T2OA 2YUZA 3WFCH 1GIGH 4XCCL 1FSKB 1MIEL 1CDCA 5E4EC 1ODAA 2R0ZL 1TCMA 4YDIH 7FABH 1JGDA 1BVLA 1MQKH 1DBJH 1S7TA 3C60D 1XEDA 2QBWA 2JCCA 3EOAA 3ZYIA 4X5XA 4RX4D 3G6DL 4X80L 3CX2A 3FB5B 4MQXD 2FYYA 1XIWA 1MCCA 3O9WD 2HFFB 5T3ZE 3CCHA 2VLRE 4U1JB 4K23H 3MLVH 1PX4A 3V5DA 4WW2B 3D2UB 3V6BR 2P5ED 4GRWE 1O5DT 5FM5O 3FOMA 4Y4HA 1MFNA 4CADB 3DVGB 4V1DB 2XTJC 5E24E 1EEZA 2FO1A 4JFYA 4LSPL 2BY0A 2P46B 3GMOA 3IYLW 4U1KA 12E8H 1IAIH 5EOCJ 5BVJA 1KJVB 3MJGX 3SKNB 5C0BB 2PXYD 3IAQA 2QSCL 5D7KD 3N1QC 3UJJL 2GEEA 1MSPA 3BT2H 2FBOJ 1KV3A 3U2SB 4FZ8H 4JFED 3KLSA 4JVPA 1QR1A 5IB1B 3MRGB 4NO3B 3VH8A 4AQOA 1MF2L 3BH9A 2NY6C 5I8OH 3KXFA 2EIBA 1P4IH 3BGFC 2O5XH 2YD6A 3UAJC 5J3HD 1FVEB 1R5WB 4WI5A 4C57C 1J5OL 4D0CB 2OTWB 4ZFFB 1HHHA 3L7EB 2UY7A 5JHDE 1T7WA 4KWUA 2MCPH 4HKZB 1QR4A 2M2DA 3PQYD 3ZDYE 4RSVA 3E8UL 5FKAA 5SWZB 1MFCH 1L7TH 1FL3A 1E4KA 3BXNB 3BDYH 3WEXA 5FO8B 4Z0BL 5FYJU 3PGFH 1N2RB 1G7MB 1YY8B 4FQXA 2DBLL 5IBTL 3FOLA 5EB9A 5HJ3B 1NGWA 2CGRH 1DBMH 2NY4B 2R4SH 4MQ7A 4LF3A 2ITCB 3G9VA 2D9QB 3GI9L 4L8SA 2OYPA 5DK2B 1AXIB 1HNGA 2HRLA 4QRUA 4QXUL 1MY7A 2EDLA 1I7UB 1R5IB 1R3HB 1Z0NA 1D9KC 3LQAH 5JLZB 4MQTB 3DXAB 5T3XH 1KC5L 5DI8B 1EEYB 2E8YA 3EDFA 3NZ8B 3GUTA 3LH2H 3W5NA 4KTYA 2OLDA 1MFAH 2ZOKB 1AD0A 5BQ7A 1MJUH 2CDFB 4HKXA 1AFVH 4ZFOA 1N5AA 4NQEB 1U8HB 1MHHB 2EDQA 3RWIA 5L2JB 4NQDA 4OD1L 1S7UA 1NBZA 4C83A 4HQQL 3JWOC 3AY4A 3B3IA 4LLDB 1Q0XL 2ICWI 4U2YA 1C08A 4YXHL 1SMOA 4WFFE 5IB5B 3KPOB 4PGZA 5F3HA 3VD5A 4P46D 5IK3A 4ETQB 4MXVE 4PJGA 5LJYH 2VDRL 2DQTH 5IP4A 3ZMRA 4PJ7B 3QXVA 3GGWB 4PJHF 1K3ZA 1AI1H 1INEL 4E41B 4PG9B 2GCYB 2XACC 1H3VA 2EYRB 1IM3B 2ESVA 5E08L 2YD2A 3B9EA 1L7IL 4RMVA 1W72A 1YMMD 3LKPA 2YC1A 1NANH 3G08A 5D9SA 2RFXA 1MAMH 5IMMB 4EIZC 4ONFL 4OQTH 2F58L 4YEEA 4QRSA 5I1AB 3MGOA 3MACH 2ZCLL 1T20A 4QY8B 3BZ4A 3RGVB 3MRLB 3QIBC 4FNLH 3FCTB 1J8HA 4ERSL 1G7HA 1NCDH 1SJHB 4KROB 4TSCH 3NCEB 1EGJA 1NUDA 4Y4FB 5KVEL 4NPYB 4PYGA 4O2EB 4JY4B 4R4BB 3VFPA 1I1AD 1NCBH 2BVQA 2FJFB 3CGTA 4JRXD 3KS0J 4LRIC 2HWZH 4OGXH 1MELA 5B38A 4KRLB 1NKOA 3ZYJA 2VISA 1OW0C 2CKBB 3MNVB 5GRJH 3QDAA 3ULVL 3VFMB 4XCEA 2OI9C 3CSYB 2H6PA 2WSKA 4KXZI 4QXWA 2VDOL 4YPJA 4YBQD 3QUZD 4QWWD 4A2LA 4Y16A 4G9FD 4KJWC 1BZQK 4M4RA 3MJ8A 2H8PB 4KJYA 4JEGB 2D03H 5HDBE 4HK3N 1AD9B 1N0XH 1F3DJ 1A4JA 4UIKL 5J1SC 4OZFB 1RHHA 1OVZA 3IETA 4LP4A 4WHCA 2MHAA 3ARGC 1JIBA 2X1PA 3O3AB 4NM8L 2E7MA 5JMRA 1SVZA 1U93B 1KTDA 2NW3B 5BV7L 1QFOA 5C0CB 4CMMA 4MD4A 1BIIA 1G7JB 1K6QH 4GFTB 3JWDL 4U1MA 4PRAB 3HI5H 3BAEL 5GGRY 1HCVA 3QSKB 4R26L 3TT1H 4ONGL 1S7SA 3T0BA 4NQCD 4X0KB 1E4XH 4TVPD 2ATPB 2V2WA 4YO0A 2EIDA 2C1PA 1YMHB 4MXWH 1T1ZA 4UB0H 4XNQA 1NDMA 4W6WB 4HIEB 1WT5A 4Y19E 1N8ZA 3QZWA 4LCWD 4XH2B 3L7FA 1ZA6B 3BW9B 1FZKB 3OAYH 3VD4A 4G7VL 3I3BA 5FAAA 5ID1A 4FOMA 4XP5L 1UYWL 4QRQA 5I8CB 3D1MC 5DHVB 4LEXL 3VXUB 5IIEA 3FFDA 2VLJB 3F12A 5E8NA 4EN3C 5IB4A 3IDIA 3QO0B 5IT2L 3UXFA 3TP4A 3BKML 3UTSE 2OSLB 1MEXL 3SY0A 5F7YC 4M1DH 3HI1B 1UM4H 2E9IA 1SM3H 3MRQB 4XBGB 2CIKB 1NCWH 1PZUB 1N5YH 1VEOA 4KK9C 3VU2A 2N1KA 4TOYH 2DJSA 1OAZL 1BD2E 5AEAA 4BM7A 2VH5L 3CSPA 4MA8H 5TFSL 4Y4KA 5IFAH 4OF3A 3O2DH 1EIBA 1KLFA 1K8IB 3RX5A 2WMPA 1V5JA 4NRZB 2APBA 2FX8L 4KPHL 3EOYG 2WAHA 1A6AA 2GYSA 1RIVH 3IFPB 3VWJB 1C7TA 2BHYA 5DR5H 4QOKB 3HZKB 4M48H 1H3XA 1X5HA 3MV7A 4HUUB 4Z76A 3ZE2E 1PSKH 1CT8B 2VQ1B 3U7WL 3T65B 4XVSL 3T2PA 2AJVL 2KL6A 1AY1H 2EC8A 2D7TL 3MLRH 4XC1H 1TZHB 3QI9D 3OPZL 1TZIB 3NPZB 2QR0A 3DX9A 1IBGH 4Z95H 4XHQA 5C6TH 3RPIA 4MA7L 4ZAKD 5JIKA 4L4JA 1AQKL 1KPVA 2VITB 4LLYB 1UJTA 4XB7A 4M6MH 3WIHL 5CLWA 4WCYL 1CTNA 1DFBH 4M6OH 1NFDB 3OMZA 1T4KB 3WBDA 3HNVL 3L3IB 3S9DB 4JFFA 1JCKA 3EYSH 4I4WB 2CLZB 3JWOH 1VACA 5I1JL 1DBBL 1EO8H 2WBJD 3WUWG 3RP1A 5FYKE 1FYTE 4PRHA 4HWBL 1RSFA 4NDMA 4MCZA 3V79C 3UPAA 5D96B 1UM5L 1M1SA 3WFDH 4F7CA 3SDDD 2IG2H 2Y25A 4JQVA 1VFBB 2CUHA 3H3PH 4GG8A 5JOFB 4F7MA 3FQTA 1KEGL 1BFVH 1UZ8A 1A6TA 3RKDC 4OB5H 1BBDH 4ONHB 3WO4C 1ITBB 1PY4A 3MROA 4UOJA 4WEBH 5EU6A 1HYSD 2NZ9D 4KKBC 1VFOA 4PJBE 3V6FB 2YSSB 5DSCB 4YNYA 4ZUWA 4AY0A 4DK6A 3MUJA 4OCWL 4X6BA 5IFJA 1XGQA 2X4RB 1QD0A 1REIA 5IVZB 4QRPA 4CJ0A 4MGXA 5IFHL 2CK2A 4WY7H 3ZHKA 2F5BH 1NGXB 4HFUL 5IEKB 4HIXH 2FD6L 4QGTA 5LQBL 5IF0B 4PRPD 3Q6FB 3R0MA 4OZHB 4YE4L 5DZOA 3KPPB 3UTQA 4D3CL 2Z31A 4PJEA 5DGRA 1EXUA 1T0MA 2G5RA 2R1WB 2EZ0D 1ACZA 5I74B 3RNQA 3ARFD 2C4FU 4JDZA 3LOWA 4P5MA 5DMGC 1Z9MA 3HMXL 3K8KA 1JI1A 1DQJA 4LQ1A 1AO7D 1U8KB 3ARDA 1IAMA 3L1OL 1RJYA 2VC2L 1A1MB 4P4KC 5AAMA 4NM4H 3C5SB 2X5PA 3NIGE 4KJQD 4Q0XH 1CGTA 4WI3A 3RUGB 1Y6KR 1AE6L 5ALBL 1HH9A 3G04B 4OCSL 1KELH 4G42A 5DGQA 1VEMA 3ZYZA 4XGZA 4KRPB 3DX8B 4R8WL 4DQOL 3WNNA 1UZ6E 3L3DA 4GG6F 4HUVA 4PTUA 1NCCL 1I9EA 1I1FB 4M62L 3B9KA 3PNWA 5KANG 4OCRL 4LU5L 2E7LC 5LXGH 4JO2H 1IAIM 4HJGB 2JJUA 4TTDD 1ES0B 1HHIA 1NUFA 3FMGL 3LEVL 4O2CA 1BQSA 5C0DA 5DVNA 3A67H 2JK5B 4NWTH 5FOBA 4OQTA 2X4SB 3MV11 2PTTA 4OJFH 3MCLH 4LNRA 1CDIA 4ZTPL 5SWZE 1XF2A 1FZMA 3V8CA 2ZSVA 4PR5B 2MWCA 3LB6C 4JRWA 1OAUH 2A1WH 2YRZA 3RDTB 2BSTB 3AXLA 5DHYB 4POUB 2W07A 2HFEA 4I18A 3X11A 1XCTA 5LCVL 5LGHL 4NN7B 5IBLD 4LLMB 1DTUA 4RGNB 4ODXB 1X5JA 3UTTA 2LTQC 2SEBA 3E2HC 2P7TB 4QHUA 3KPRD 3IKCB 4ODWB 3CVHH 4PJ9C 1H3PH 3A6OA 3T3PE 3MRKA 5ECJE 1BGXL 5FHAH 5KZCB 4MQSB 1NAMB 4X6EA 4GQPH 3QDJA 3MLWL 4JQIH 1FO0L 2D7PA 2J2ZA 3TBSA 1W0VA 3TIEA 3RWFB 4Y5YB 1I3RB 1CDBA 5I76A 2BOCA 4FN0A 4P5KA 4PGDA 4KJPD 3LIZH 2M26A 3A6CH 4W68A 4JO4L 5EUKA 4ZYKB 4MAYA 4DVRL 5KSAD 1EFXB 3IDMB 2IQAA 4OM0H 2A73A 4B50A 1HI6A 4WHYG 1MCKA 4LVEA 1KEML 5T3ZD 4NKMB 2VLRD 2VR4A 1TVHA 4HGMA 1A9EA 4Z9KB 4PJIB 2P44B 4HUMB 2YKLL 5GSVB 1J1XL 4LFHD 1HIMH 2OP4H 3O8XD 3ULVE 4J3TA 5CJQH 2XIDA 5I73C 3I02A 3PL6D 3RL1B 5AZ2H 4U1LA 3BSZL 4QF1B 3NOIA 2J6EA 1QLRA 1YYMH 4PJ7E 2EDDA 4FQPA 4YXLL 1MWAL 4E41E 5D7IB 3MR9A 1CTOA 1MCDA 4NKQB 1DQMH 4WHDA 4XP4H 5MEQB 3CNKA 1WF5A 2XKNA 3HS0B 2GJJA 2L0DA 1MNUH 1NMCC 3D69A 1RJZA 3PWPD 4KAQH 2C1OB 4I5BB 4Y2DD 1QBBA 2VYRE 5L6YL 4GRMA 4MHHI 2RQ8A 3MV9A 3BIKB 1KUMA 4P23D 1QFUL 4OFIA 1B4JL 3EYVA 1UB6A 1XF4A 4AIOA 5IEHB 4QO1A 4XBEH 1T1WA 4LVNC 3RWCA 5T1MA 1LE5A 2AXFB 1PW3A 2RBLA 3NIDE 2GJZB 4OCLC 3ULVC 4G6FB 3HC4L 1JMXA 3GSOA 4KY1H 4BKLA 1VHPA 3VE0A 4RQQA 4N0FB 1JUFA 5KW9H 1OSPH 4UINH 4G7YL 2GFBB 3QIUC 4OLXL 4XCCH 3VRIA 1MIEH 1U3HB 2R0ZH 5HGBA 4M93B 3O2DA 1FZOA 3TZVD 5IKCA 4PUBL 2QADB 2CK0L 4JPVL 4LOUD 2DWEA 4Z7WF 4F3FA 5C07B 3G6DH 3HCVA 4X80H 3OTTA 1EHLL 4PY7B 4GKNB 5EORL 4G6AC 5TDOB 3PHOB 1OAKL 1GGYA 4JHZA 1WBXB 2E9WA 4JZNB 2FBJL 4GAYB 5C0CE 4OAWB 4MDIB 3IDGA 3TO4B 4XVUC 1A1OB 3QUYA 4GUPA 5EBLB 3P9MB 3HI6L 1P4BL 2AJZB 4LSPH 4WFFD 4LL9A 5BRZB 1U95A 5T1LB 3P73B 4KGJA 1EA9C 1P6AB 1XCQA 4ZS7L 3RWJA 1WAAE 4QRRB 4RIRB 1T89C 2W9LA 3QULB 1RPQA 1VFAA 1XZ0B 4BQBA 4ELMA 2N7BA 5EBGA 3RWDB 3WFZA 5HSFA 3PWJB 5EFIB 4BZYA 4YHIA 3MRIB 5A1AA 2HT3D 1T83C 1QACA 3W39A 2Z92A 1NEUA 5DC4B 1B0RA 4GW1A 1MF2H 2XWTB 3ULUE 4FQLL 3FZUC 5ICZB 5C0EA 3BH8A 1EH9A 1RUQL 3DMMC 3VXUE 3TA3A 1J5OH 1DDHB 2IBZX 3U0PA 3WV0A 1MIML 2Z35B 1XH3B 1CI5A 3OJVC 1VB9A 3ARVA 5TQ0L 3L3JA 4LPVA 4HK3J 4KK5D 1FG9C 4X4XA 4RGMB 1C12B 5AWNL 3DO7B 4Z0BH 3MCG1 2DBLH 5IBTH 5F88A 4XNMB 3M45A 3QIBA 1JNHA 4GH7B 2BHUA 2IANB 3GI9H 4OIAA 3F7YB 4QXUH 1MCNA 3C6LC 1QBLL 3UPRA 1I1YB 4EQ3A 2NY0B 3RNKB 2ARJQ 4KUCD 2J4WL 4HMCA 3WHXA 3KLHC 4ZFZA 5GGUA 1UH2A 1KC5H 3OX8A 4KMTL 4LRIA 4QOKE 3WNMA 2J1KA 1A4KB 3U1SL 4K8RD 1OW0A 3F65A 4HIIB 2GT9B 2ARJA 4NHUA 3RZCC 4BA8A 1KJMA 1DQQA 1H8SA 2DF3A 4E42B 4JRYE 3ZT6A 4Q97A 4QKXB 4MZ3A 3N85L 4G6JL 4OD1H 3LQZB 3WCYA 4DUWA 1MCBA 4HQQH 3VG9C 3C6SB 5T5NF 1RI8A 2F53B 3QA3B 2KH2B 1OWRM 2NY2D 5FECA 1Q0XH 5BS0B 2JTDA 1HSBB 1ZEAL 2I60L 5K9OB 4OZGF 3QWQB 1NFDE 1K4CB 4YXHH 2PCPA 3JV0A 3MRFB 5D1XA 1LE9B 3AFLA 3VFGL 2FR4B 2VDNL 4ACPA 2VDRH 1TVBA 4UU9B 3L5WB 2Y36L 4FQHB 1QEWB 2Z4QA 2OL3A 2CD0A 2XQYG 3O0RL 1WZMA 2KPNA 1INEH 3HC0B 5DQ9B 4MJIE 5FCUL 4YIQA 5HTSA 5I0ZA 3LV3A 3VXRB 2Q8AL 5TDNA 1FFOB 3I3DA 2BDNL 1L7IH 3REWB 2VMFA 4KTEL 2MNUA 5J1AB 3OKDA 5TJWK 4ONFH 3BDBA 2F58H 4ZDHA 3LKSA 2ZCLH 5D93B 4BQCA 3QQNA 1P7HL 4P57B 5JDSB 5D1ZD 3MYJA 5KSUA 4ERSH 4FTVB 3IGAA 1HKLL 2R1XB 3CVHA 2GTWA 3PP3K 1MRDL 5KVEH 2YXMA 3O4LB 3TBYB 1Q9WA 3H9SE 3MREB 2WIIB 4EN3A 3QUXB 2VZVA 3VFWA 4AMKL 5JOPD 3GSVA 1FFPB 1EX0A 5C9JA 3JV4A 4XBPB 1J0IA 1UJ3B 3QNXA 1QO3A 1DQLL 3FT4A 2F54B 1WISA 1BD2D 2UYLA 4JM2B 4PJCE 3ULVH 3BQUC 5D7JB 2VNCA 2WW8A 2V2TB 1FZJA 4GKOA 4KV5E 1T7VA 2VDOH 5JW4M 5J6GB 1TENA 1KPRA 3EDKA 4N0YL 5I9QB 4XRCB 1DR9A 1UCBL 3Q1SL 3C8HA 4P2QA 1FH5L 4JFQA 4QCIB 2HTLD 3RUGE 3VDCA 4UIKH 1IGJB 1RZ8B 2O61A 2AV7B 1KB9J 1JTPA 5EO1A 1HHJB 1W0WB 4NM8H 3TBVA 4QNPE 2X1WL 4X9FA 4Z0XA 5BV7H 2BNQB 4U2ZA 4YHPA 4GRLB 5ICYB 4X6CA 3JWDH 3ES6B 5IB2A 5C09E 3BAEH 5JPNB 4CN4A 5C0IA 5B8CC 4R26H 1RUPL 1KT2A 1FNEB 2DLTA 1IAOA 5LVEA 4HD9A 2H9GA 4NN5C 1U8PA 1F3JA 1I7ZA 2VN7A 3BEVB 5GGTH 5BZWA 1AC0A 4NCC1 5FYJE 1B90A 4X6DF 5FYKD 2I26N 3SDAD 2A77L 5HGAA 3WIFA 3SJVD 1LEIA 1F13A 3V5HA 4AT6B 3EOBA 4G7VH 3WFEL 4K8RL 4XP5H 5CBEA 1UYWH 2XI9A 3VI4F 1LQSR 4LEXH 4N68A 5CMAB 3U6RB 2VXQL 5F3BB 4K7PY 5CZVL 5IT2H 3DTXA 2ZG1A 3BKMH 5JPMA 3L9RA 1AHWB 3EHBD 1NEZB 2YN3A 4WV1B 1MEXH 3GMRB 5F1IA 2X89D 4HDIB 3TO2B 3EJJX 2Q76B 5GRUL 4CVZB 3D39B 3MBEA 1SBSL 3UJIL 4MVBD 1JPFA 2YZ8A 4G6KL 4LHUB 5BJTA 4YDJA 3EGSA 5DJ6A 1KNOA 2J8UB 4GBXA 1U8LA 1OAZH 3QXUA 2VH5H 2V5TA 3K0WA 4L4TB 4J6RL 5TFSH 1WFTA 1U58B 2ITDB 3L6FA 3OQ3B 4AH2B 4RBPH 2ZOLA 4PJAB 4U31A 5EOCL 3ETBF 3H0TA 5IR1A 1RK1A 4KPHH 2FX8H 4PJIE 3U4EA 2ICWJ 3D2UD 2WWKO 1A3RL 3LB6D 5C08A 3ARBB 2YRLA 1WBZB 3MLSL 2P24B 2BY2A 1IM9A 4V1DD 1C1EL 1S7XB 3U7WH 2GK0B 1ZHNA 4XVSH 2AJVH 2EDWA 2XN9A 3O41A 1PG7L 2D7TH 1HN1A 1T1XB 1DVFA 2PO6B 3VFRA 3MJ6A 5I75C 1Y18A 3V6ZB 4GRWF 5C0BD 5HVHB 4U49A 5D7IE 1L6ZA 4DZBB 3FQWA 1RULL 1AQKH 2XQYK 5FK9B 3OJ2C 3WIHH 4EVNB 4BZ1L 4WCYH 1U0QA 5E8PB 4PGBB 3IFOA 1IC1A 1JZ3A 4HWEL 1JWMA 1EAPB 5L8KB 3EYQC 3F7VB 5C2UB 3U82B 1K85A 5I1JH 3O3EA 4HUXA 1DBBH 3EJYC 3NCMA 5I6XC 1MI5A 2DM3A 1MH5A 4HWBH 5IHLB 2DLIA 1MCOL 2FHBA 5GS0D 2F19L 5MEOB 2E7LA 5F9AC 5SWZD 4ELKB 3ALWA 4HKBA 4HV8A 3QQ4A 5A2LH 1OTTD 4OLVL 1JMZA 1KEGH 3ZDYF 3VXPA 2FHCA 2UY6A 5I66A 1CICC 4OBSA 2C3HA 4IEFB 3HR5B 3MNZB 2NY4D 4IDJL 4ESKA 3ZKXC 4U1GC 3BVNB 1C7SA 4J3UA 3GSWB 3BN9D 3B2VL 2IEPA 2UZIL 4HH9B 3BPCB 4OCWH 4K9EL 3P40A 3DXAD 4JFDB 4LGPB 2MKLC 5CD3A 4OT1L 5C07E 5IFHH 2ADGB 3X14A 4OI8A 2ZUSA 3QXTA 4HFUH 5DD3L 2FD6H 5LQBH 3NAAL 3CC5A 1UACL 4PJ9A 3BUYA 3SKJL 2Y5TA 4YE4H 4LLWB 3I6KB 1T1YB 4KZDL 4N0CD 5F7DB 2AKRB