1L7YA

Solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
MSGGTAATTAGSKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGVGVNPAQPAGNIFLKHGSELRLIPRDRVGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN ZK652.3
publication title NMR structure of conserved eukaryotic protein ZK652.3 from C. elegans: a ubiquitin-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l7yA00
4NNJB 2KFKB 1OTRB 3RZWC 3X23A 1VD2A 4IUMB 2CHWA 4TKNA 4ZRJA 2V1YA 2YLMA 3ZKJC 2O2VB 3OLMD 4FHJA 2KXJA 1R4NI 3UF8A 4BKTA 2MQJA 2LXCA 2ZJDA 4W9FA 3WAOA 1G6JA 5DCNA 1LM8B 3N32A 3HK0A 5EDSA 2JVCA 2LGXA 4DBGA 1UD7A 4B6WA 3PRMB 1NI2A 2ASQA 2BYFA 2D3GA 4MEMA 3U30A 4LDTB 1YQBA 2ZZPB 2I1KA 4F1SA 3OJ3A 5D2MB 1WZ0A 3Q3FA 1GJZA 2BPSA 5JH5C 1WR6E 1Q0WB 2FIDA 2KJ6A 2KMAA 5DPRA 4E71A 3DPDA 3H7PB 2DYMA 2MP2A 2L76A 3AULA 2JRHA 2IBIB 2HJ8A 4EOYA 4WQOB 2MBQA 2KFJA 2G45B 4DWFA 3IVFA 3VHTC 3QHTA 3WANA 1RLFA 4LCDE 2KHWB 3ZUNA 1V9JA 2DHZA 4W9DA 3JW0X 1K8RB 1WF9A 3ZLZA 2KNBA 3RT3B 3QA8A 5JHBA 3ZNZB 2MWSB 4II3B 3CMMB 2IYDB 2KX3A 5CHWA 2ZNVC 1RAXA 4NAWB 3TCAA 4PYUA 2CS4A 1WM2A 2GBNA 2JY6A 1ZKHA 3RZFA 3CSTA 3ZDTA 3H9DA 1XQQA 3QX1A 2WYQA 2PEAA 5KHQA 2MSED 5CTRC 2G4SA 2KTRB 2KWUB 2KWVB 4K1RB 3DBHI 4HJKA 5G55A 4PS8A 3V62A 3R66C 2MX2A 3KW5B 2L0FA 4KIKB 3D32A 3QARA 2GBKA 1OQYA 4DHZE 4NY0A 4MJSB 4M0WB 4PS7A 5CX3A 3WAMA 2GBJA 5C1ZA 1GC7A 3T8MA 4HCPB 2BGFA 5E6OA 1WIAA 2LI5A 3JYUA 4K7UA 4A3OA 1UBIA 3NY5A 3QWZB 1YX6B 2A4ZA 4MH0E 2J0KA 1IYFA 4RMAA 2NR2A 4DDID 2N4FA 4XX5A 1Q5WB 2IZVB 2NVUI 1SGHA 3QIJA 4FJZA 1U4AA 5BO4B 2PJHA 5CHFA 5E6NA 4KV2A 3V6EB 2N1WA 4HVBA 1MG8A 3BINA 3EHVA 1GUAB 3VH3B 4WJNA 2D2QA 1UH6A 4TQ0A 4WJPA 2WDTB 4AP4C 2D10A 4ZYNA 4CYEA 4DHJB 3ZNID 1S3SG 1YIWA 2K39A 2LRWA 4HK2A 4G0NB 1WX8A 4TQ1A 2FNJB 1RRBA 1WE6A 3KYDD 4IM0A 4P7IA 3ZO5B 1WXSA 1WXVA 2KN5A 3VTVA 2N1VA 1WGDA 3VTUA 2AWTA 1E7UA 1J19A 4ASWC 3R7RA 5DPSA 4WJQA 3GZNI 3W1SA 2C7HA 3PLUA 3UINB 3VDZA 3M3JA 4M8MA 2LXAA 1YJ1A 3WA0A 1WE7A 3A9JB 2IO2B 4RM8A 2KLGA 4FN2A 2K6DB 2RGFA 2L3ZA 4FJYA 2XK5B 2G3QB 5AZGA 2Z59B 2MBBB 3PTFC 1C1YB 3JSVB 4G11A 2RSUA 5D6JB 4KVGB 2PPHA 3L10B 3AI5A 4K81A 4W9CA 4GOCA 4N9F4 1V5OA 4B9KA 2LUEA 4II2B 2EMTA 1WGHA 2KLCA 3B08A 1KM7A 2REXA 4FA6A 4KDLB 4NJ6A 4BVUC 1WXMA 1J0GA 2WWZA 2JT4B 3U8ZA 2MLBA 1BT0A 2VRRB 3HHMA 1E5WA 2CR5A 3L54A 2NS5A 2GOWA 4GDLA 4IWQA 3ZTCA 2KQ7A 1TBEA 2EKEC 4NQKE 2C7MB 2RPQA 3R3MA 4TV3A 2C9WB 3M63B 2KDEB 4AOFA 2WX0A 3UIOB 3SD5A 2K8BA 2LWPA 3P2BA 1WJ4A 1YX5B 1P1AA 3TMPB 4LDTD 3IFWB 4WAAA 4X57B 1TTNA 1WY8A 2MBEA 1V80A 2D07B 2ZEQA 2JZZA 4EZKA 4WWOA 4FADA 3PS6A 3ZNHB 2LGDA 4FHKA 2M8SA 3L13A 1EF5A 2GBRA 4ANXA 2IO0B 4ICVA 4PYZA 2KFKA 3V61A 3ENEA 2L7RA 2FAZA 3TBLD 1WXAA 3DCGA 2J0MA 4ANWA 2BYEA 2ZNVB 3ZW3A 3SDLC 2O2VA 1OEYA 2FUHB 2IY1B 4PS3A 1OEYJ 1H4RA 2FCQA 3ML9A 3ZRFA 3PT2B 3QAQA 3WIMA 1D3ZA 2N9PC 1YD8U 1J8CA 1OGWA 1AARA 3A4RA 1TZ1A 2IY0B 3EC8A 3RCZA 3BY4B 2OJRA 4MGIE 2KKCA 4AWJA 3RYTA 2Z0DB 3ZTDA 2L0TA 4ICUA 2KO3A 3PSEB 1E7VA 2XBBC 3T9LA 2KC2A 1IPGA 4W9HA 4ZRKA 2AL3A 3OJ4B 3U7DA 2KWCA 4GU2A 3H7PA 2O6VB 2UYZB 3PREA 3NZUA 3UIPB 3JVZX 1SE9A 1WJNA 2ZCBA 1I42A 5AZFA 1WFYA 2DZJA 3OAWA 3PRPB 5D94A 1UGMA 2K6QA 3N3KB 2M0XA 3DVGY 2JF5A 1KLVA 2FCMA 1QZEA 2LGYA 2HTHA 2KX0A 4M8NA 1P98A 3CSFA 4GDKB 3RD2A 1V81A 2HE7A 4KZCA 2WX1A 2BF8B 4HDOA 1UBQA 1UZXB 1V49A 4IWOA 4EEWA 4CO7A 1EUVB 4EUTA 4E74A 2LVQA 2EMSA 3ECIA 1R4MI 2AL6A 2K25A 4KSKC 3NS8A 4AUQC 2JXXA 2K8CA 4K7WA 3DDCB 2JWZA 3Q3JA 1E8WA 2NPTB 2MRPA 4NAWA 4ZRIA 3QCAA 1LQBA 2R2QA 3L16A 4J6IA 2IO3B 2KDFB 3K9OB 2ZPNA 2FCNA 3O65B 1ZW7A 2KTFA 4RM9A 4W9EA 3A1QB 1CMXB 1WR1A 3GOEA 4BBNC 4DXAB 2PE9A 2KTRA 3UQBA 3DBLI 5E6PA 3UQAA 5GMVA 2NBWB 3APDA 3TL5A 2OOBB 3IHPC 3PPAA 2L05A 1WM3A 1EO6A 3W1YA 4DHJD 4KIKA 3W1SC 3ZDMC 5JZEB 1Z2MA 4BKSD 3PRZA 4MJSA 1E8XA 1XD3B 2DYBA 2KDIA 3VAWA 1PQSA 1X1MA 3APCA 3KVFB 1TGZB 4JLCA 5LXIB 1V6EA 3DBSA 3IG3A 4E3CA 5AEKB 2BYVE 2ZPYA 3NOBA 2CU1A 4WJOA 3M95A 4AJYB 2N7EA 4JGHB 3HM3A 4HLEA 4DHZB 1WYWB 3HM6X 1HE8A 2JZ3B 4GSWA 4NQLB 4MDKE 1Z5SB 3DBRI 4IWPA 3DQVA 4MSMB 2QHOA 1E8YA 1I35A 2L8JA 2LRUA 2MA9B 4HWIB 4W9IA 1WJ6A 1NBFC 2LASA 4G3XB 2GBMA 3KYCD 1A5RA 2Y5BB 4IC7B 1KJTA 3KUZA 2CHZA 4ANVA 3KUDB 4EKUA 4IW0A 4LJOB 1T0YA 3DVNU 4I6LB 1WI0A 2B3AA 1UELA 2LVOA 3V6CB 4MM3A 4W9JA 2JUOA 2MP2B 2DAFA 3PV1A 3VQIA 4BKSA 3LJ3A 2LJ5A 1WX7A 3I3TB 5C23A 2JRIB 5D7GA 4XC2A 3HIZA 4WWPA 3L08A 5LXHA 1XT9B 4FLHA 4LJPB 4A3PA 4MGYE 3ML8A 5J18A 1Q1OA 3A9JA 3AU4A 4IM3A 2N9EB 2DZKA 4DK5A 1C3TA 4BKGA 1WGRA 2XK5A 2ZCCA 4HPMB 3QQ8B 3RULA 4DDGD 5KHOA 5J17A 2V4LA 3JSVA 3QJZA 4GN1A 2JPHA 4BBNF 2XEWA 2LZ6A 2HD5B 4F8CB 5G2NA 4URKA 1ISNA 3SU8X 1WRDB 4KSLC 4EFOA 2GMIC 2NBUA 1FXTB 4MGKE 2K1FA 2CHXA 4I6PA 5CHVC 2W9NA 3VUXA 5L83A 4CHKA 4KZ0A 1JRUA 4YL8A 3V60A 3EFUA 4IG7B 5TR5A 3ONSA 3KH0A 1WMHB 4W9GA 4ANUA 5HKHA 4MSQB 4GGQA 4GIVA 2KK8A 3B1LX 2YVCA 5JHAA 2G4DB 4XZ4A 2KC1A 2MBOA 2MW5A 3PVLA 1S1QB 1M94A 5FR6A 2CKHB 1IP9A 3AU5A 3LDZE 1L7YA 2BWFA 4HCNB 4NJ7A 2KDBA 1F9JA 2L00B 3AXCA 1LFDA 2LD9A 3KUCB 3NHEB 4JL9A 1L2NA 2N9XA 3PZDA 1V5TA 1WZ3A 3MHSD 2NBVB 5LLIA 3R7QA 2AEHA 3DVGX 2Z0EB 5AZHA 3ZVVA 2O6VD 1WX9A 2ZVOA 5DPTA 2DX5B 1WJUA 3ZRCA 1P9DU 4GXBA 2RR9A 1WGYA 2AYOB 2R2OA 1RFAA 4G50A 3MTNB 2KANA 4BFRA 2DAJA 3VUWA 3S2AA 1GG3A 2DZIA 1WH3A 3B0AA 3ZNGC 1LXDA 2V3SA 3C0RB 2M4NA 1WMHA 2MBHA 4FULA 2ZVNA 4W9KA 3SHQA 4AJWA 4BOSC 2KMCA 2M1MA 2BKRB 4HDQA 3A4SC 4KDIC 4IM2A 2MCNB 2C7NB 5L95C 4HPLB 3MJWA 2DYOA 3IBEA 3VUYA 3WALA 2D11A 3VXWA 2J0JA 1GC6A 2PE6B 3ZIMA 1V86A 3A9KB 4EZJA 3DOWA 3VH4B 2O6VA 3PGEA 4A20A 1E8ZA 1ZGUB 4I6NB 3VTWA 2KVRA 3TJPA 4ZDVA 1V2YA 2KJRA 4GB9A 1NDDA 3NZSA 4JQWC 3QC8B 3APFA 2BKFA 2FCSA 1VCBA 4TUUA 1H8CA 3H6NA 4OVVA 5IAAC 4GDKA 2LVPA 3PLVA 5J2RA 2DENB 3N30A 1P0RA 4BOZB 1GNUA 2A5UA 2KJHB 2M17A 2NCNA 3CF6E 3L17A 3H1UA 2K8HA 3RUIB 4FBJB 4F7ZA 1WGGA 3K9PB 4GDLB 3EECA 2RD0A 2C5LC 2KD0A 2N7DA 2NPTA 4WWNA 2KZRA 4MGZE 2C60A 3VFKA 3DVNV 4EZLA 3A33B 4HXDA 1E90A 4OVUA 1EF1A 2DZMA 1SIFA 3PHWB 4JIOU 2IO1B 4MELA 2I1JA 2BWES 3A1QA 3L0WB 3WAPA 2KOXA 3A9KA 3M62B 3VVWB 2KQSA 2J7QB 4K7SA 3UGBB 1P3QU 4W9LA 4NPNA 3TIXA 3X0WA 2FIFA 1KOTA 3ALBA 4B95A 3H7SA 3PHXB 5DPWA 4GMVA 2UWQA 3QK0A 5IA7A 1Y8RC 4FJVB
chains in the Genus database with same CATH superfamily
1OTRB 1GOZA 1L6VA 2KXJA 1R4NI 2BB5A 4BKTA 2INCC 2ZJDA 1G6JA 3IT6B 1QOGA 4R3DA 3N32A 3NVYA 4OZCA 5EDSA 2JVCA 1FEHA 4DBGA 4B6WA 1NI2A 2ASQA 2WXOA 2G9HD 3U30A 3ZJUA 4LDTB 2ZZPB 2WP9B 3OJ3A 3Q3FA 2LFIA 1WR6E 5DPRA 3AE9B 4OZBA 1FIQA 1IGCA 2DYMA 3PZ8A 4WQOB 4DWFA 3VHTC 1MHHE 1RLFA 4LCDE 2BQQA 4W9DA 1V8CA 1K8RB 5JHBA 2KX3A 2VH1A 3TCAA 3Q3MC 1HZ5A 1T3QA 4OW0A 2JY6A 1XLOA 2WYQA 2QMTA 5KHQA 3MFGA 2G4SA 2NTTA 2KWUB 3DBHI 3R66C 2MX2A 2BS3B 4MACA 1OQYA 1STEA 3AV8A 4MJSB 3AM9A 3WAMA 5C1ZA 5HI1A 2IGDA 3GP7A 1QQRA 2J0KA 4RMAA 1AYFA 1ACCA 4FJZA 1U4AA 2GRIA 1PDXA 4RNAA 1YJJA 4WURA 2D2QA 4XDDA 2D10A 1YIWA 2WQYB 3ZO5B 1WXSA 2PVOD 4IDIA 2N1VA 1WGDA 1J19A 1FRDA 4WJQA 1SE2A 2BS2B 3PLUA 4M8MA 1JW9D 1WE7A 4C7YA 2IO2B 4FN2A 2W82A 2Y5PA 3Q14C 4K81A 3RMKC 2LUEA 1XLPA 3GS2A 3AEDB 2RDHA 1XCQL 4LNIA 3N1YC 4BVUC 5HHDG 5EE0A 3U8ZA 2MLBA 1E5WA 2CR5A 3Q8AA 2N9KA 1T6BX 1XO3A 1SB3C 2RDBC 1J7AA 4TV3A 2KDEB 1WJ4A 1I4XA 1P1AA 3IFWB 4WAAA 3GE8C 4FHKA 2GBRA 3P4RB 4HPPA 2KFKA 3TEWA 3ENEA 2X8XX 3TBLD 1WXAA 4ANWA 2BYEA 3AEAB 2E3TA 2KDMA 1JCKB 3P63A 3PT2B 1D3ZA 2WDRB 4YT0B 2JZPA 1AARA 1YMHE 3BY4B 4MGIE 4AWJA 3RYTA 2MJDA 1VLBA 2LHDA 3PSEB 3T9LA 3HVZA 3OJ4B 1SIJA 3DWGC 3BWUD 1I7HA 3PREA 1Q10A 3Q8EA 5AZFA 1WFYA 1DOYA 1F1HA 3ZGZA 2M0XA 2Y5CA 1AWDA 3PO0A 2HTHA 2KX0A 4NJCA 1WGKA 2CJNA 2W55A 4HDOA 4CO7A 1R4MI 1N6ZA 4KSKC 5BMHA 2K8CA 2RPVA 4NAWA 4ZRIA 1B9RA 1LQBA 1TKYA 4IKGA 2M19A 2R2QA 4J6IA 2IO3B 4W9EA 2FCNA 4RM9A 1F52A 1OFFA 1FCCC 3UQBA 3APDA 4DHJD 1SXTA 1EO6A 3W1SC 3ZDMC 1KTKA 4C80A 1RWSA 2MHJA 1XD3B 2KDIA 3VAWA 1PQSA 1VZ7A 2N0SB 2BYVE 3NOBA 4AJYB 5EE3A 1LO5D 3I9V1 5HG2A 3DHGC 4HKZE 1E7PB 3U2SC 1XCTL 3BIID 1RFKA 2MA9B 1ZP0B 2D3BA 1TT5B 1MI0A 3KYCD 1GAQB 4RCOA 3KUZA 4S0RA 5D3IB 4IW0A 4C4VB 2WLBA 4KGRA 1WI0A 2B3AA 2WXRA 2MP2B 3PV1A 3VQIA 3DWMA 3LJ3A 4A6QA 5D7GA 1MVKA 5LXHA 4FLHA 4KX6B 3A9JA 2WHIA 4IM3A 1R4NB 1C3TA 4HPMB 4EE2A 4N6EB 3JSVA 2VZKD 3QJZA 1JWBD 4NAMA 4BBNF 2LZ6A 2HD5B 2BW2A 4F8CB 2RMMA 5G2NA 3SU8X 2WU2B 4KSLC 2NBUA 1FXTB 4I6PA 2W9NA 3EFUA 4WAFA 3NRZA 1K51A 4GGQA 2KK8A 2YVCA 5JHAA 4XZ4A 3AU5A 3LDZE 2BWFA 4NJ7A 2L00B 3RNBC 3IXSA 2LD9A 1WZ3A 3BYTB 2NBVB 3R7QA 5DPTA 3AE4B 1N5XA 2WDVB 4BFRA 3AEEB 4HKQA 1E9MA 1JRPA 1WH3A 2QJLA 1WMHA 4HRSA 2MCNB 5L95C 4HPLB 3MJWA 2DYOA 2PTLA 3AE1B 4LK0M 5C2TB 2PE6B 3A9KB 4LNOA 1BMLC 3VH4B 2O6VA 3VTWA 3TJPA 4ZDVA 1V2YA 2KJRA 3N20C 4PT5A 1I4HA 4IOIE 2FCSA 4HROA 2K3UA 4GDKA 3PLVA 5J2RA 1EM7A 3NJTA 1ESFA 4F7ZA 3K9PB 4GDLB 2K9XA 4ZRPA 2KZRA 2C60A 4BZAA 2DZMA 3IT4B 3B2GA 2IO1B 2INDC 2I1JA 2PMVA 5BMIA 2KOXA 4OZAA 1SSNA 2J7QB 1SJHD 2KQSA 2M56B 4K7SA 4NPNA 1L6UA 2FIFA 1KOTA 3H7SA 3CWIA 1SBBB 3P1MA 1N63A 3X23A 1EU3A 2CHWA 4TKNA 2V1YA 2KN4A 2YLMA 2O2VB 1HZ6A 3Q8BA 4FHJA 2PVGC 2EKIA 2LXCA 2BT6A 4W9FA 2D3CA 3RNGC 4P1BC 4RGNA 3HRDD 1YNTE 3LXFA 4F1SA 2GI9A 5D2MB 5IO9A 1GJZA 1MHXA 2BPSA 5JH5C 2KJ6A 2GB1A 3H7PB 2L76A 3AULA 1Y56A 2IBIB 4EOYA 4L1BA 2JYEA 4KKJA 1JMLA 2QEJC 1TS5A 1C76A 4C7ZA 2DHZA 2LGSA 3NVZA 2KNBA 3QA8A 1YQ4B 3ZJTA 1WWTA 2IYDB 1AW7A 5BYRA 1RYJA 2ZNVC 2MJEA 1K53A 2LEKA 3CSTA 1XLNA 3QX1A 5H92C 4K1RB 3W5UB 4PS8A 3L4PA 1ZXIA 3KW5B 4A9AA 4ZRQA 4DHZE 4NY0A 4YSYB 1WIAA 1K52A 2LI5A 3JYUA 4K7UA 1CJEA 1UBIA 4WQMA 4A3OA 2A4ZA 1FNVA 3KWVA 2NR2A 3O13A 2N4FA 4XX5A 1Q5WB 2IZVB 2INPE 1UWXA 3KWLA 1EU4A 1TIFA 5E6NA 2L52A 4KV2A 1JQ4A 3V6EB 1WXQA 4HVBA 1D5ZC 3BINA 3EHVA 1GUAB 3VH3B 3PZ7A 2WDTB 3ZXVA 4CYEA 1L0XB 4HK2A 1CK1A 4TQ1A 4G0NB 4IM0A 1WSPA 3Q6BA 1WXVA 2KN5A 3VTVA 2AWTA 2IGHA 5DPSA 3GZNI 3W1SA 3VDZA 3UINB 2LGIA 3WA0A 4RM8A 2Q5WD 3MP9A 2Z59B 5AZGA 1C1YB 3BVMA 4G11A 2DBYA 2ICIA 1QOBA 4JE3B 3ZYYX 4W9CA 4P1CC 2WDQB 4N9F4 1GB4A 2KLCA 2REXA 3V05A 1L5PA 2JT4B 4JPSA 3HHMA 3L54A 2SAKA 2GOWA 4A90A 4FXCA 2C7MB 3N9YC 3UIOB 2K8BA 2LWPA 1SE4A 4DXGA 4LDTD 4LTUA 3U7ZA 2JWUA 2MBEA 1BXTA 2JZZA 2KVZA 1CQVA 2PW9A 3ZNHB 3L13A 2AQ2B 3V61A 3DCGA 2J0MA 3SDLC 1OEYA 3E56A 2FUHB 3AMZA 2N9PC 2CU3A 1OGWA 4MT5A 4BAXA 3A4RA 1D6EC 1YQ3B 4QAYA 3RCZA 5G5GA 1D5MC 2Z0DB 1TS4A 3N1ZC 1E7VA 2KC2A 4GU2A 3NZUA 3JVZX 4B0EA 2ZCBA 1WJNA 2INNE 4LLGM 1UGMA 1KLVA 1FMAD 2LGYA 2PKOA 1KLUD 1P98A 1I4PA 2I2YA 1V81A 2VH2A 2WX1A 2BF8B 4EEWA 4E74A 2LVQA 2K25A 3RNAC 3NS8A 1C4CA 4YWGG 4K7WA 1J7CA 1TKEA 4US9A 3Q3JA 1E8WA 2NPTB 2MRPA 3SEBA 3LB8C 1FRRA 3K9OB 3O65B 2KTFA 4XDCA 3A1QB 1ET9A 3KQ4A 3TSSA 2KTRA 2J53A 3DBLI 2NBWB 3TL5A 3IHPC 2L05A 1QKZA 2QILA 4KIKA 5IOIA 4RGTA 4M0WA 1KH0A 2L32A 1TGZB 1V6EA 4E3CA 3W2DA 2JQRB 3HM3A 1ZDXA 4M00A 2SEBD 4OHJA 1HE8A 1DGJA 4MDKE 3EA6A 3DBRB 4IWPA 3DQVA 1I35A 3AE3B 1T5XD 2LRUA 4W9IA 1WJ6A 3FILA 4G3XB 1A5RA 3E9SA 4EKUA 4LJOB 1PGAA 4RF0A 3V6CB 4MM3A 2JUOA 1DOIA 4O1NA 1IUEA 2V4IB 2LJ5A 5C23A 4A3PA 4MGYE 2Z8LA 3AU4A 3Q69A 1WGRA 2XK5A 2WNMA 5J17A 2V4LA 2JPHA 3NVVA 2XEWA 2WXIA 5IKCM 1L4ZB 2K1FA 1UGJA 1ENFA 5G5HA 4CHKA 4AS1A 4KZ0A 4YL8A 2NMQA 4JWSC 4IG7B 2J4XA 1I4RA 3LYYA 1IBXA 2MW5A 2HTME 1QT9A 4HCNB 1LFDA 3KLSX 3NHEB 4PK1A 1FXAA 4JL9A 3I5JC 3FAHA 1C9FA 5LLIA 5BMGA 2WGSA 2DX5B 4GXBA 1F2RC 1L4DB 1WGYA 1ROEA 1MJDA 2R2OA 4XWTA 3ABVB 4ITKA 3W9CB 3SFDB 3S2AA 3ZNGC 3AE7B 1XLQA 1LXDA 5D3DA 3AE2B 2M4NA 2MBHA 3SHQA 2L1AA 3AE6B 2KMCA 2BKRB 1YJIA 3A4SC 1HTQA 5EE1A 3MHZA 3WALA 1E6EB 1TJEA 5FKAC 1SEBD 4J3OD 3ZIMA 1N5WA 1V86A 4JWUC 4EZJA 2KT7A 3MC0B 3R2TA 3PGEA 1E8ZA 1ZGUB 4I6NB 2BTEA 4GB9A 1NDDA 3APFA 4OVVA 5IAAC 1P0RA 1GNUA 2KJHB 1QOAA 3H1UA 3I57A 5EE9A 2WXFA 2C5LC 1JWAD 4YXDB 4MGZE 3DVNV 1D4BA 1XF5L 4OVUA 3NVWA 3MJ5A 3PHWB 1SJED 4JIOU 2V3PA 2HDEA 1M4VA 3L0WB 3WAPA 3A9KA 3VVWB 3UGBB 3X0WA 3TIXA 3PHXB 5DPWA 2MJ3A 5IA7A 4NNJB 2KFKB 4KKIA 3ZJVA 4ZRJA 1T0RC 1C79A 1V1PA 2DLBA 3U52E 3AN1A 4RFBA 3WAOA 4M01A 3TEXA 2IGGA 3HK0A 2LGXA 1UD7A 3PRMB 4A55A 2J52A 4MEMA 1WZ0A 2FIDA 1EWYC 3DPDA 2JRHA 2HJ8A 2KFJA 2G45B 3ETRA 3QHTA 2ON8A 3U4EG 1ZOYB 1JWSD 1F2RI 2KHWB 2MH7A 3ZUNA 1I4GA 1FCLA 3JW0X 1WF9A 1ZE3D 3RNEC 3P4QB 3RT3B 1XXGA 2BBCA 4NAWB 2FUG1 2ZW1A 3ZDTA 3H9DA 3DBHB 4HJKA 3ZQ4A 2WS3B 3QARA 2GBKA 2GBJA 2BGFA 1J7BA 1YOVB 2JU6X 4MH0E 4CQNA 3VRAB 1ZDVA 3T3NA 1SGHA 4L23A 2PJHA 1VRAB 1QOFA 1MG8A 5FR3A 1MPEA 2X38A 2FBWB 4WJPA 2K0PA 3ZNID 5BO4B 2YEPB 1WX8A 2FNJB 1WE6A 3KYDD 2K5PA 4P7IA 2J42A 3BVGA 1V1OA 1E7UA 1PGXA 4ASWC 3R7RA 1ET6A 2LXAA 1YJ1A 3A9JB 1T0SC 3OWEB 4FJYA 3WCQA 2KMMA 3PTFC 3JSVB 2PPHA 1XEEA 2BB6A 2W3RA 3W5VB 4B9KA 4II2B 1N62A 3RI7C 1KM7A 4KDLB 2QSDA 4NJ6A 1WXMA 1YN4A 1J0GA 2NS5A 3B9JA 2KQ7A 1TBEA 2EKEC 2RPQA 2L83A 2IDYA 3M63B 1HEZE 4AOFA 3SD5A 4USAA 3Q2AC 3NS1A 3TMPB 5BYSA 3CIRB 1TTNA 2D07B 2ZEQA 4EZKA 4WWOA 4FADA 3PS6A 2LGDA 1EF5A 4ANXA 2IO0B 4PYZA 2FAZA 1ZPSA 1NYRA 2IY1B 1OEYJ 1H4RA 2WXLA 3ML9A 3ZRFA 4YTPB 1YN5A 4ZHPA 3BVZA 3Q3OC 3AEBB 2IY0B 4K3BA 3EC8A 4ZHOA 1GPXA 2KAJA 4ICUA 2KO3A 1AN8A 4W9HA 3U7DA 2KWCA 2O6VB 2UYZB 3UIPB 1I42A 3OAWA 4B0MA 2LMCA 3N3KB 3DVGY 2JF5A 1QZEA 3URYA 1VJKA 1NEKB 4GDKB 3RD2A 5IN7A 2HE7A 4KZCA 1V49A 4IWOA 3C8YA 2EMSA 1R4MB 3AH7A 2AL6A 4AUQC 4D2KA 1PGBA 3DDCB 4US8A 3R2IA 1HTOA 1SF0A 2KDFB 1P7FA 4BBNC 1OQQA 3GOEA 5LNK1 3I63C 2PE9A 5GMVA 3PPAA 4L2YA 3W1YA 1WM3A 2HJ1A 5JZEB 4BKSD 4LNFA 4MJSA 2DYBA 3FKYA 4JLCA 4DQOC 3FC4A 2TSSA 5AEKB 4WJOA 3M95A 4HLEA 4JGHB 3P42A 3VR8B 2WXQA 4OVZA 4YTMB 5I4DA 1KRHA 4GSWA 2Y3AA 1I4QA 3AE5B 2UU7A 4ARIA 1E8YA 2L8JA 1NBFC 2LASA 2D5GA 2GBMA 3IAS1 2K22A 2Y5BB 2LJIA 1KJTA 2CHZA 1T0YA 3DVNU 1LGRA 4I6LB 2I38A 2H88B 3RPFC 1WX7A 3IAM1 2JRIB 4XC2A 4WWPA 1HA5A 5J18A 1Q1OA 5AUIA 1VZ8A 3BYYB 3DHHC 2DZKA 4YSZB 4BKGA 4DDGD 2ZCCA 3QQ8B 1NENB 2WXGA 4URKA 1RM6C 1WRDB 2ACZB 4EFOA 2GMIC 5GXGB 1QILA 2CHXA 5CHVC 2WXNA 3VUXA 5L83A 1JRUA 3RNCC 5TR5A 3ONSA 1TZOA 4GIVA 2G4DB 2KC1A 5FR6A 2WU5B 1L7YA 3NG0A 2KDBA 1IGDA 3AXCA 4Q2JA 3SFEB 1C78A 2N9XA 3PZDA 3MHSD 2AEHA 2Z0EB 1WX9A 2FE8A 1P9DU 1WRIA 1KF6B 4P16A 3MTNB 2KANA 2XN9C 2DAJA 3VUWA 1GG3A 1JWUD 3SR6A 2DZIA 5HFYA 3B0AA 2V3NA 4N58A 2V3SA 4W9KA 4HDQA 4IM2A 2C7NB 3VUYA 3IBEA 4XYCA 2D11A 3VXWA 3AB5A 2J0JA 1GC6A 1JROA 2D3AA 3VRBB 1N61A 2KACA 1ZUD2 3Q3NC 5IP4D 4A20A 4YSXB 2JXTA 4JQWC 3NZSA 1T0QC 2ZW0A 1HQRD 1PUTA 1VCBA 1FPYA 1H8CA 3H6NA 3DHIC 3AECB 2DENB 3N30A 4BOZB 3L17A 1TYGB 2R61A 2A5UA 2H89B 1WGGA 3EECA 2BYTA 4HXDA 1E90A 1SIFA 1P7EA 3BK1A 1NI3A 4C56C 1P3QU 4A8XC 1UF0A 2EELA 3ALBA 4B95A 4GMVA 3ZXRA 1BUIC 4FJVB 1C4PA 3RZWC 4ACFA 1VD2A 4IUMB 3UI3A 3ZKJC 3OLMD 3UF8A 2MQJA 1K50A 2OHFA 4HJGE 5DCNA 4RH6A 1UNSA 1LM8B 1KLGD 2NTSA 5FK9C 3RFZB 2BYFA 2D3GA 1YQBA 2I1KA 1D5XC 4C4VA 1Q0WB 1VR9A 4E71A 2KMAA 2MP2A 3Q8FA 2MBQA 4TMAB 3TUOA 3IVFA 2LUMA 1FNWA 3WANA 1OQRA 1V9JA 2CJOA 3ZLZA 3P4PB 3C19A 2QIEB 1TY2A 2MWSB 3ZNZB 2AX5A 4II3B 3CMMB 5CHWA 3AEGB 1RAXA 4PYUA 2CS4A 1WM2A 1MG4A 2GBNA 5TSSA 1ZKHA 3RZFA 2IPKD 4GLSC 1XQQA 4XE0A 2PEAA 5H8YE 2MSED 5CTRC 2KTRB 5G55A 2KWVB 4WIPA 3V62A 1C77A 1PFDA 2L0FA 4KIKB 3D32A 3EUB2 2QDFA 1CZPA 4M0WB 4PS7A 5CX3A 1GC7A 3T8MA 4HCPB 5E6OA 3NY5A 3QWZB 1YX6B 1IYFA 3B2FA 5BYQA 4DDID 3VR9B 2NVUI 3BK2A 3QIJA 5CHFA 2LHEA 2N1WA 3NZ3A 3FILB 4WJNA 1UH6A 4TQ0A 2RDGA 1NYQA 4AP4C 4ZYNA 4DHJB 1S3SG 1V97A 2K39A 2LRWA 4WH4A 4MM3B 1RRBA 5E6JA 3VTUA 3GZNB 3OG5A 2C7HA 1FM0D 4RF1A 3M3JA 1VDVA 2KLGA 5T8IA 2K6DB 2RGFA 2L3ZA 3Q8CA 2XK5B 2G3QB 2MBBB 2OEDA 2RSUA 5D6JB 4KVGB 1JALA 1A70A 3AI5A 3L10B 1WYGA 1UUPA 4GOCA 1V5OA 2EMTA 1WGHA 1F0ZA 1EWCA 3B08A 4FA6A 3NUHB 2KQ4X 2WWZA 2QC8A 1BT0A 2VRRB 3BZDB 4GDLA 4IWQA 3ZTCA 4NQKE 3GB1A 1IBXB 3R3MA 2C9WB 4JX1C 2JSVX 2WX0A 2PIAA 3P2BA 3GE3C 1YX5B 2VZKB 4S17A 2PLPA 4X57B 1WY8A 1V80A 1N60A 2WXPA 2N9LA 1JWMD 4C00A 3RNFC 2M8SA 4ICVA 2L7RA 2ZNVB 3ZW3A 1E10A 1VZ6A 1FXIA 2O2VA 4RGMA 4PS3A 2FCQA 3HUIA 3TEZA 3QAQA 3WIMA 2V0GA 2YEPF 1YD8U 1J8CA 2WXHA 4N59A 1TZ1A 4KGSA 2KWDA 2OJRA 4M02A 2KKCA 3ZTDA 2L0TA 4ZYSA 2XBBC 1IPGA 4ZRKA 2AL3A 1SE3A 1B1ZA 3H7PA 1SE9A 1HXYD 2DZJA 3PRPB 5D94A 3V3XA 4TSSA 2K6QA 2FCMA 2KYWA 4M8NA 1TS3A 3CSFA 1UBQA 1UZXB 1EUVB 4EUTA 2W3SA 1MFWA 3ECIA 2GLSA 2JXXA 2JWZA 4UDUC 3QCAA 3L16A 1QLBB 2ZPNA 1ZW7A 3HVDA 1CMXB 1R7SA 1WR1A 4DXAB 1L0VB 3DBLB 3UQAA 5E6PA 1TS2A 4YTNB 2OOBB 2IJ0A 3EGRA 1Z2MA 3PRZA 1E8XA 1X1MA 4P6VF 3APCA 3KVFB 5LXIB 1QF6A 3DBSA 2G1EA 3IG3A 1V1PB 2ZPYA 2CU1A 2N7EA 4DHZB 1WYWB 3HM6X 4NQLB 2JZ3B 3J9CA 1FNUA 1Z5SB 3DBRI 4MSMB 2QHOA 4HWIB 2DNFA 5JXVA 4IC7B 2E6XA 3KUDB 4ANVA 2WXMA 4H2AA 1UELA 2LVOA 4W9JA 2DAFA 4BKSA 4RGOS 4ARCA 3I3TB 4XGAB 3HIZA 3L08A 1XT9B 4LJPB 3ML8A 2N7JA 2N9EB 2WXJA 4DK5A 3RULA 4KGTA 5KHOA 4GN1A 3R8BA 2XNAC 1ISNA 2B76B 1ZXHA 3MC8A 4MGKE 1E0ZA 5MPOA 1KFYB 3N1XC 4MH8A 3V60A 1GB1A 5HKHA 1TKGA 1WMHB 3KH0A 4W9GA 4ANUA 4MSQB 3B1LX 3AE8B 2MBOA 3PVLA 1S1QB 1M94A 2CKHB 1IP9A 2BS4B 1PYWD 1F9JA 4HEA1 4LNNA 3KUCB 3AEFB 1L2NA 1V5TA 3ZVVA 3DVGX 5AZHA 3P4SB 1NVID 2O6VD 2ZVOA 1WJUA 2JX5A 3ZRCA 2RR9A 2AYOB 1RFAA 4G50A 2AQ3B 3RN9C 3H8HA 4LNKA 4ZOHC 2ONQA 3C0RB 1FO4A 4AJWA 4FULA 2ZVNA 4BOSC 2M1MA 4WWMA 4KDIC 2W54A 1DYQA 4AQ7A 4XWWA 1F77A 3TEYA 5AUKA 3DOWA 2KVRA 1DOXA 1UWMA 3QC8B 1C4AA 5C3JB 2BKFA 2QCZA 1FFUA 2JYTA 3T3OA 4TUUA 2M0AA 3EFCA 2V9HA 2WXKA 2OJWA 2LVPA 4NZLB 2DWQA 2M17A 1FFVA 2NCNA 3CF6E 2K8HA 3RUIB 4FBJB 4DXFA 2AQ1B 2BVCA 2RD0A 1L0YB 2KD0A 2N7DA 4K3CA 2NPTA 4WWNA 3VFKA 4EZLA 3A33B 1EF1A 4MELA 2BWES 3A1QA 4REZA 3M62B 1FD6A 2MEKA 4W9LA 2UWQA 3MC9A 3QK0A 1YN3A 1TY0A 1Y8RC
chains in the Genus database with same CATH topology
4NNJB 2KFKB 1OTRB 3RZWC 3X23A 1VD2A 4IUMB 2CHWA 4TKNA 4ZRJA 2V1YA 2YLMA 3ZKJC 2O2VB 3OLMD 4FHJA 2KXJA 1R4NI 3UF8A 4BKTA 2MQJA 2LXCA 2ZJDA 4W9FA 3WAOA 1G6JA 5DCNA 1LM8B 3N32A 3HK0A 5EDSA 2JVCA 2LGXA 4DBGA 1UD7A 4B6WA 3PRMB 1NI2A 2ASQA 2BYFA 2D3GA 4MEMA 3U30A 4LDTB 1YQBA 2ZZPB 2I1KA 4F1SA 3OJ3A 5D2MB 1WZ0A 3Q3FA 1GJZA 2BPSA 5JH5C 1WR6E 1Q0WB 2FIDA 2KJ6A 2KMAA 5DPRA 4E71A 3DPDA 3H7PB 2DYMA 2MP2A 2L76A 3AULA 2JRHA 2IBIB 2HJ8A 4EOYA 4WQOB 2MBQA 2KFJA 2G45B 4DWFA 3IVFA 3VHTC 3QHTA 3WANA 1RLFA 4LCDE 2KHWB 3ZUNA 1V9JA 2DHZA 4W9DA 3JW0X 1K8RB 1WF9A 3ZLZA 2KNBA 3RT3B 3QA8A 5JHBA 3ZNZB 2MWSB 4II3B 3CMMB 2IYDB 2KX3A 5CHWA 2ZNVC 1RAXA 4NAWB 3TCAA 4PYUA 2CS4A 1WM2A 2GBNA 2JY6A 1ZKHA 3RZFA 3CSTA 3ZDTA 3H9DA 1XQQA 3QX1A 2WYQA 2PEAA 5KHQA 2MSED 5CTRC 2G4SA 2KTRB 2KWUB 2KWVB 4K1RB 3DBHI 4HJKA 5G55A 4PS8A 3V62A 3R66C 2MX2A 3KW5B 2L0FA 4KIKB 3D32A 3QARA 2GBKA 1OQYA 4DHZE 4NY0A 4MJSB 4M0WB 4PS7A 5CX3A 3WAMA 2GBJA 5C1ZA 1GC7A 3T8MA 4HCPB 2BGFA 5E6OA 1WIAA 2LI5A 3JYUA 4K7UA 4A3OA 1UBIA 3NY5A 3QWZB 1YX6B 2A4ZA 4MH0E 2J0KA 1IYFA 4RMAA 2NR2A 4DDID 2N4FA 4XX5A 1Q5WB 2IZVB 2NVUI 1SGHA 3QIJA 4FJZA 1U4AA 5BO4B 2PJHA 5CHFA 5E6NA 4KV2A 3V6EB 2N1WA 4HVBA 1MG8A 3BINA 3EHVA 1GUAB 3VH3B 4WJNA 2D2QA 1UH6A 4TQ0A 4WJPA 2WDTB 4AP4C 2D10A 4ZYNA 4CYEA 4DHJB 3ZNID 1S3SG 1YIWA 2K39A 2LRWA 4HK2A 4G0NB 1WX8A 4TQ1A 2FNJB 1RRBA 1WE6A 3KYDD 4IM0A 4P7IA 3ZO5B 1WXSA 1WXVA 2KN5A 3VTVA 2N1VA 1WGDA 3VTUA 2AWTA 1E7UA 1J19A 4ASWC 3R7RA 5DPSA 4WJQA 3GZNI 3W1SA 2C7HA 3PLUA 3UINB 3VDZA 3M3JA 4M8MA 2LXAA 1YJ1A 3WA0A 1WE7A 3A9JB 2IO2B 4RM8A 2KLGA 4FN2A 2K6DB 2RGFA 2L3ZA 4FJYA 2XK5B 2G3QB 5AZGA 2Z59B 2MBBB 3PTFC 1C1YB 3JSVB 4G11A 2RSUA 5D6JB 4KVGB 2PPHA 3L10B 3AI5A 4K81A 4W9CA 4GOCA 4N9F4 1V5OA 4B9KA 2LUEA 4II2B 2EMTA 1WGHA 2KLCA 3B08A 1KM7A 2REXA 4FA6A 4KDLB 4NJ6A 4BVUC 1WXMA 1J0GA 2WWZA 2JT4B 3U8ZA 2MLBA 1BT0A 2VRRB 3HHMA 1E5WA 2CR5A 3L54A 2NS5A 2GOWA 4GDLA 4IWQA 3ZTCA 2KQ7A 1TBEA 2EKEC 4NQKE 2C7MB 2RPQA 3R3MA 4TV3A 2C9WB 3M63B 2KDEB 4AOFA 2WX0A 3UIOB 3SD5A 2K8BA 2LWPA 3P2BA 1WJ4A 1YX5B 1P1AA 3TMPB 4LDTD 3IFWB 4WAAA 4X57B 1TTNA 1WY8A 2MBEA 1V80A 2D07B 2ZEQA 2JZZA 4EZKA 4WWOA 4FADA 3PS6A 3ZNHB 2LGDA 4FHKA 2M8SA 3L13A 1EF5A 2GBRA 4ANXA 2IO0B 4ICVA 4PYZA 2KFKA 3V61A 3ENEA 2L7RA 2FAZA 3TBLD 1WXAA 3DCGA 2J0MA 4ANWA 2BYEA 2ZNVB 3ZW3A 3SDLC 2O2VA 1OEYA 2FUHB 2IY1B 4PS3A 1OEYJ 1H4RA 2FCQA 3ML9A 3ZRFA 3PT2B 3QAQA 3WIMA 1D3ZA 2N9PC 1YD8U 1J8CA 1OGWA 1AARA 3A4RA 1TZ1A 2IY0B 3EC8A 3RCZA 3BY4B 2OJRA 4MGIE 2KKCA 4AWJA 3RYTA 2Z0DB 3ZTDA 2L0TA 4ICUA 2KO3A 3PSEB 1E7VA 2XBBC 3T9LA 2KC2A 1IPGA 4W9HA 4ZRKA 2AL3A 3OJ4B 3U7DA 2KWCA 4GU2A 3H7PA 2O6VB 2UYZB 3PREA 3NZUA 3UIPB 3JVZX 1SE9A 1WJNA 2ZCBA 1I42A 5AZFA 1WFYA 2DZJA 3OAWA 3PRPB 5D94A 1UGMA 2K6QA 3N3KB 2M0XA 3DVGY 2JF5A 1KLVA 2FCMA 1QZEA 2LGYA 2HTHA 2KX0A 4M8NA 1P98A 3CSFA 4GDKB 3RD2A 1V81A 2HE7A 4KZCA 2WX1A 2BF8B 4HDOA 1UBQA 1UZXB 1V49A 4IWOA 4EEWA 4CO7A 1EUVB 4EUTA 4E74A 2LVQA 2EMSA 3ECIA 1R4MI 2AL6A 2K25A 4KSKC 3NS8A 4AUQC 2JXXA 2K8CA 4K7WA 3DDCB 2JWZA 3Q3JA 1E8WA 2NPTB 2MRPA 4NAWA 4ZRIA 3QCAA 1LQBA 2R2QA 3L16A 4J6IA 2IO3B 2KDFB 3K9OB 2ZPNA 2FCNA 3O65B 1ZW7A 2KTFA 4RM9A 4W9EA 3A1QB 1CMXB 1WR1A 3GOEA 4BBNC 4DXAB 2PE9A 2KTRA 3UQBA 3DBLI 5E6PA 3UQAA 5GMVA 2NBWB 3APDA 3TL5A 2OOBB 3IHPC 3PPAA 2L05A 1WM3A 1EO6A 3W1YA 4DHJD 4KIKA 3W1SC 3ZDMC 5JZEB 1Z2MA 4BKSD 3PRZA 4MJSA 1E8XA 1XD3B 2DYBA 2KDIA 3VAWA 1PQSA 1X1MA 3APCA 3KVFB 1TGZB 4JLCA 5LXIB 1V6EA 3DBSA 3IG3A 4E3CA 5AEKB 2BYVE 2ZPYA 3NOBA 2CU1A 4WJOA 3M95A 4AJYB 2N7EA 4JGHB 3HM3A 4HLEA 4DHZB 1WYWB 3HM6X 1HE8A 2JZ3B 4GSWA 4NQLB 4MDKE 1Z5SB 3DBRI 4IWPA 3DQVA 4MSMB 2QHOA 1E8YA 1I35A 2L8JA 2LRUA 2MA9B 4HWIB 4W9IA 1WJ6A 1NBFC 2LASA 4G3XB 2GBMA 3KYCD 1A5RA 2Y5BB 4IC7B 1KJTA 3KUZA 2CHZA 4ANVA 3KUDB 4EKUA 4IW0A 4LJOB 1T0YA 3DVNU 4I6LB 1WI0A 2B3AA 1UELA 2LVOA 3V6CB 4MM3A 4W9JA 2JUOA 2MP2B 2DAFA 3PV1A 3VQIA 4BKSA 3LJ3A 2LJ5A 1WX7A 3I3TB 5C23A 2JRIB 5D7GA 4XC2A 3HIZA 4WWPA 3L08A 5LXHA 1XT9B 4FLHA 4LJPB 4A3PA 4MGYE 3ML8A 5J18A 1Q1OA 3A9JA 3AU4A 4IM3A 2N9EB 2DZKA 4DK5A 1C3TA 4BKGA 1WGRA 2XK5A 2ZCCA 4HPMB 3QQ8B 3RULA 4DDGD 5KHOA 5J17A 2V4LA 3JSVA 3QJZA 4GN1A 2JPHA 4BBNF 2XEWA 2LZ6A 2HD5B 4F8CB 5G2NA 4URKA 1ISNA 3SU8X 1WRDB 4KSLC 4EFOA 2GMIC 2NBUA 1FXTB 4MGKE 2K1FA 2CHXA 4I6PA 5CHVC 2W9NA 3VUXA 5L83A 4CHKA 4KZ0A 1JRUA 4YL8A 3V60A 3EFUA 4IG7B 5TR5A 3ONSA 3KH0A 1WMHB 4W9GA 4ANUA 5HKHA 4MSQB 4GGQA 4GIVA 2KK8A 3B1LX 2YVCA 5JHAA 2G4DB 4XZ4A 2KC1A 2MBOA 2MW5A 3PVLA 1S1QB 1M94A 5FR6A 2CKHB 1IP9A 3AU5A 3LDZE 1L7YA 2BWFA 4HCNB 4NJ7A 2KDBA 1F9JA 2L00B 3AXCA 1LFDA 2LD9A 3KUCB 3NHEB 4JL9A 1L2NA 2N9XA 3PZDA 1V5TA 1WZ3A 3MHSD 2NBVB 5LLIA 3R7QA 2AEHA 3DVGX 2Z0EB 5AZHA 3ZVVA 2O6VD 1WX9A 2ZVOA 5DPTA 2DX5B 1WJUA 3ZRCA 1P9DU 4GXBA 2RR9A 1WGYA 2AYOB 2R2OA 1RFAA 4G50A 3MTNB 2KANA 4BFRA 2DAJA 3VUWA 3S2AA 1GG3A 2DZIA 1WH3A 3B0AA 3ZNGC 1LXDA 2V3SA 3C0RB 2M4NA 1WMHA 2MBHA 4FULA 2ZVNA 4W9KA 3SHQA 4AJWA 4BOSC 2KMCA 2M1MA 2BKRB 4HDQA 3A4SC 4KDIC 4IM2A 2MCNB 2C7NB 5L95C 4HPLB 3MJWA 2DYOA 3IBEA 3VUYA 3WALA 2D11A 3VXWA 2J0JA 1GC6A 2PE6B 3ZIMA 1V86A 3A9KB 4EZJA 3DOWA 3VH4B 2O6VA 3PGEA 4A20A 1E8ZA 1ZGUB 4I6NB 3VTWA 2KVRA 3TJPA 4ZDVA 1V2YA 2KJRA 4GB9A 1NDDA 3NZSA 4JQWC 3QC8B 3APFA 2BKFA 2FCSA 1VCBA 4TUUA 1H8CA 3H6NA 4OVVA 5IAAC 4GDKA 2LVPA 3PLVA 5J2RA 2DENB 3N30A 1P0RA 4BOZB 1GNUA 2A5UA 2KJHB 2M17A 2NCNA 3CF6E 3L17A 3H1UA 2K8HA 3RUIB 4FBJB 4F7ZA 1WGGA 3K9PB 4GDLB 3EECA 2RD0A 2C5LC 2KD0A 2N7DA 2NPTA 4WWNA 2KZRA 4MGZE 2C60A 3VFKA 3DVNV 4EZLA 3A33B 4HXDA 1E90A 4OVUA 1EF1A 2DZMA 1SIFA 3PHWB 4JIOU 2IO1B 4MELA 2I1JA 2BWES 3A1QA 3L0WB 3WAPA 2KOXA 3A9KA 3M62B 3VVWB 2KQSA 2J7QB 4K7SA 3UGBB 1P3QU 4W9LA 4NPNA 3TIXA 3X0WA 2FIFA 1KOTA 3ALBA 4B95A 3H7SA 3PHXB 5DPWA 4GMVA 2UWQA 3QK0A 5IA7A 1Y8RC 4FJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNJ B;  2KFK B;  1OTR B;  3RZW C;  3X23 A;  1VD2 A;  4IUM B;  2CHW A;  4TKN A;  4ZRJ A;  2V1Y A;  2YLM A;  3ZKJ C;  2O2V B;  3OLM D;  4FHJ A;  2KXJ A;  1R4N I;  3UF8 A;  4BKT A;  2MQJ A;  2LXC A;  2ZJD A;  4W9F A;  3WAO A;  1G6J A;  5DCN A;  1LM8 B;  3N32 A;  3HK0 A;  5EDS A;  2JVC A;  2LGX A;  4DBG A;  1UD7 A;  4B6W A;  3PRM B;  1NI2 A;  2ASQ A;  2BYF A;  2D3G A;  4MEM A;  3U30 A;  4LDT B;  1YQB A;  2ZZP B;  2I1K A;  4F1S A;  3OJ3 A;  5D2M B;  1WZ0 A;  3Q3F A;  1GJZ A;  2BPS A;  5JH5 C;  1WR6 E;  1Q0W B;  2FID A;  2KJ6 A;  2KMA A;  5DPR A;  4E71 A;  3DPD A;  3H7P B;  2DYM A;  2MP2 A;  2L76 A;  3AUL A;  2JRH A;  2IBI B;  2HJ8 A;  4EOY A;  4WQO B;  2MBQ A;  2KFJ A;  2G45 B;  4DWF A;  3IVF A;  3VHT C;  3QHT A;  3WAN A;  1RLF A;  4LCD E;  2KHW B;  3ZUN A;  1V9J A;  2DHZ A;  4W9D A;  3JW0 X;  1K8R B;  1WF9 A;  3ZLZ A;  2KNB A;  3RT3 B;  3QA8 A;  5JHB A;  3ZNZ B;  2MWS B;  4II3 B;  3CMM B;  2IYD B;  2KX3 A;  5CHW A;  2ZNV C;  1RAX A;  4NAW B;  3TCA A;  4PYU A;  2CS4 A;  1WM2 A;  2GBN A;  2JY6 A;  1ZKH A;  3RZF A;  3CST A;  3ZDT A;  3H9D A;  1XQQ A;  3QX1 A;  2WYQ A;  2PEA A;  5KHQ A;  2MSE D;  5CTR C;  2G4S A;  2KTR B;  2KWU B;  2KWV B;  4K1R B;  3DBH I;  4HJK A;  5G55 A;  4PS8 A;  3V62 A;  3R66 C;  2MX2 A;  3KW5 B;  2L0F A;  4KIK B;  3D32 A;  3QAR A;  2GBK A;  1OQY A;  4DHZ E;  4NY0 A;  4MJS B;  4M0W B;  4PS7 A;  5CX3 A;  3WAM A;  2GBJ A;  5C1Z A;  1GC7 A;  3T8M A;  4HCP B;  2BGF A;  5E6O A;  1WIA A;  2LI5 A;  3JYU A;  4K7U A;  4A3O A;  1UBI A;  3NY5 A;  3QWZ B;  1YX6 B;  2A4Z A;  4MH0 E;  2J0K A;  1IYF A;  4RMA A;  2NR2 A;  4DDI D;  2N4F A;  4XX5 A;  1Q5W B;  2IZV B;  2NVU I;  1SGH A;  3QIJ A;  4FJZ A;  1U4A A;  5BO4 B;  2PJH A;  5CHF A;  5E6N A;  4KV2 A;  3V6E B;  2N1W A;  4HVB A;  1MG8 A;  3BIN A;  3EHV A;  1GUA B;  3VH3 B;  4WJN A;  2D2Q A;  1UH6 A;  4TQ0 A;  4WJP A;  2WDT B;  4AP4 C;  2D10 A;  4ZYN A;  4CYE A;  4DHJ B;  3ZNI D;  1S3S G;  1YIW A;  2K39 A;  2LRW A;  4HK2 A;  4G0N B;  1WX8 A;  4TQ1 A;  2FNJ B;  1RRB A;  1WE6 A;  3KYD D;  4IM0 A;  4P7I A;  3ZO5 B;  1WXS A;  1WXV A;  2KN5 A;  3VTV A;  2N1V A;  1WGD A;  3VTU A;  2AWT A;  1E7U A;  1J19 A;  4ASW C;  3R7R A;  5DPS A;  4WJQ A;  3GZN I;  3W1S A;  2C7H A;  3PLU A;  3UIN B;  3VDZ A;  3M3J A;  4M8M A;  2LXA A;  1YJ1 A;  3WA0 A;  1WE7 A;  3A9J B;  2IO2 B;  4RM8 A;  2KLG A;  4FN2 A;  2K6D B;  2RGF A;  2L3Z A;  4FJY A;  2XK5 B;  2G3Q B;  5AZG A;  2Z59 B;  2MBB B;  3PTF C;  1C1Y B;  3JSV B;  4G11 A;  2RSU A;  5D6J B;  4KVG B;  2PPH A;  3L10 B;  3AI5 A;  4K81 A;  4W9C A;  4GOC A;  4N9F 4;  1V5O A;  4B9K A;  2LUE A;  4II2 B;  2EMT A;  1WGH A;  2KLC A;  3B08 A;  1KM7 A;  2REX A;  4FA6 A;  4KDL B;  4NJ6 A;  4BVU C;  1WXM A;  1J0G A;  2WWZ A;  2JT4 B;  3U8Z A;  2MLB A;  1BT0 A;  2VRR B;  3HHM A;  1E5W A;  2CR5 A;  3L54 A;  2NS5 A;  2GOW A;  4GDL A;  4IWQ A;  3ZTC A;  2KQ7 A;  1TBE A;  2EKE C;  4NQK E;  2C7M B;  2RPQ A;  3R3M A;  4TV3 A;  2C9W B;  3M63 B;  2KDE B;  4AOF A;  2WX0 A;  3UIO B;  3SD5 A;  2K8B A;  2LWP A;  3P2B A;  1WJ4 A;  1YX5 B;  1P1A A;  3TMP B;  4LDT D;  3IFW B;  4WAA A;  4X57 B;  1TTN A;  1WY8 A;  2MBE A;  1V80 A;  2D07 B;  2ZEQ A;  2JZZ A;  4EZK A;  4WWO A;  4FAD A;  3PS6 A;  3ZNH B;  2LGD A;  4FHK A;  2M8S A;  3L13 A;  1EF5 A;  2GBR A;  4ANX A;  2IO0 B;  4ICV A;  4PYZ A;  2KFK A;  3V61 A;  3ENE A;  2L7R A;  2FAZ A;  3TBL D;  1WXA A;  3DCG A;  2J0M A;  4ANW A;  2BYE A;  2ZNV B;  3ZW3 A;  3SDL C;  2O2V A;  1OEY A;  2FUH B;  2IY1 B;  4PS3 A;  1OEY J;  1H4R A;  2FCQ A;  3ML9 A;  3ZRF A;  3PT2 B;  3QAQ A;  3WIM A;  1D3Z A;  2N9P C;  1YD8 U;  1J8C A;  1OGW A;  1AAR A;  3A4R A;  1TZ1 A;  2IY0 B;  3EC8 A;  3RCZ A;  3BY4 B;  2OJR A;  4MGI E;  2KKC A;  4AWJ A;  3RYT A;  2Z0D B;  3ZTD A;  2L0T A;  4ICU A;  2KO3 A;  3PSE B;  1E7V A;  2XBB C;  3T9L A;  2KC2 A;  1IPG A;  4W9H A;  4ZRK A;  2AL3 A;  3OJ4 B;  3U7D A;  2KWC A;  4GU2 A;  3H7P A;  2O6V B;  2UYZ B;  3PRE A;  3NZU A;  3UIP B;  3JVZ X;  1SE9 A;  1WJN A;  2ZCB A;  1I42 A;  5AZF A;  1WFY A;  2DZJ A;  3OAW A;  3PRP B;  5D94 A;  1UGM A;  2K6Q A;  3N3K B;  2M0X A;  3DVG Y;  2JF5 A;  1KLV A;  2FCM A;  1QZE A;  2LGY A;  2HTH A;  2KX0 A;  4M8N A;  1P98 A;  3CSF A;  4GDK B;  3RD2 A;  1V81 A;  2HE7 A;  4KZC A;  2WX1 A;  2BF8 B;  4HDO A;  1UBQ A;  1UZX B;  1V49 A;  4IWO A;  4EEW A;  4CO7 A;  1EUV B;  4EUT A;  4E74 A;  2LVQ A;  2EMS A;  3ECI A;  1R4M I;  2AL6 A;  2K25 A;  4KSK C;  3NS8 A;  4AUQ C;  2JXX A;  2K8C A;  4K7W A;  3DDC B;  2JWZ A;  3Q3J A;  1E8W A;  2NPT B;  2MRP A;  4NAW A;  4ZRI A;  3QCA A;  1LQB A;  2R2Q A;  3L16 A;  4J6I A;  2IO3 B;  2KDF B;  3K9O B;  2ZPN A;  2FCN A;  3O65 B;  1ZW7 A;  2KTF A;  4RM9 A;  4W9E A;  3A1Q B;  1CMX B;  1WR1 A;  3GOE A;  4BBN C;  4DXA B;  2PE9 A;  2KTR A;  3UQB A;  3DBL I;  5E6P A;  3UQA A;  5GMV A;  2NBW B;  3APD A;  3TL5 A;  2OOB B;  3IHP C;  3PPA A;  2L05 A;  1WM3 A;  1EO6 A;  3W1Y A;  4DHJ D;  4KIK A;  3W1S C;  3ZDM C;  5JZE B;  1Z2M A;  4BKS D;  3PRZ A;  4MJS A;  1E8X A;  1XD3 B;  2DYB A;  2KDI A;  3VAW A;  1PQS A;  1X1M A;  3APC A;  3KVF B;  1TGZ B;  4JLC A;  5LXI B;  1V6E A;  3DBS A;  3IG3 A;  4E3C A;  5AEK B;  2BYV E;  2ZPY A;  3NOB A;  2CU1 A;  4WJO A;  3M95 A;  4AJY B;  2N7E A;  4JGH B;  3HM3 A;  4HLE A;  4DHZ B;  1WYW B;  3HM6 X;  1HE8 A;  2JZ3 B;  4GSW A;  4NQL B;  4MDK E;  1Z5S B;  3DBR I;  4IWP A;  3DQV A;  4MSM B;  2QHO A;  1E8Y A;  1I35 A;  2L8J A;  2LRU A;  2MA9 B;  4HWI B;  4W9I A;  1WJ6 A;  1NBF C;  2LAS A;  4G3X B;  2GBM A;  3KYC D;  1A5R A;  2Y5B B;  4IC7 B;  1KJT A;  3KUZ A;  2CHZ A;  4ANV A;  3KUD B;  4EKU A;  4IW0 A;  4LJO B;  1T0Y A;  3DVN U;  4I6L B;  1WI0 A;  2B3A A;  1UEL A;  2LVO A;  3V6C B;  4MM3 A;  4W9J A;  2JUO A;  2MP2 B;  2DAF A;  3PV1 A;  3VQI A;  4BKS A;  3LJ3 A;  2LJ5 A;  1WX7 A;  3I3T B;  5C23 A;  2JRI B;  5D7G A;  4XC2 A;  3HIZ A;  4WWP A;  3L08 A;  5LXH A;  1XT9 B;  4FLH A;  4LJP B;  4A3P A;  4MGY E;  3ML8 A;  5J18 A;  1Q1O A;  3A9J A;  3AU4 A;  4IM3 A;  2N9E B;  2DZK A;  4DK5 A;  1C3T A;  4BKG A;  1WGR A;  2XK5 A;  2ZCC A;  4HPM B;  3QQ8 B;  3RUL A;  4DDG D;  5KHO A;  5J17 A;  2V4L A;  3JSV A;  3QJZ A;  4GN1 A;  2JPH A;  4BBN F;  2XEW A;  2LZ6 A;  2HD5 B;  4F8C B;  5G2N A;  4URK A;  1ISN A;  3SU8 X;  1WRD B;  4KSL C;  4EFO A;  2GMI C;  2NBU A;  1FXT B;  4MGK E;  2K1F A;  2CHX A;  4I6P A;  5CHV C;  2W9N A;  3VUX A;  5L83 A;  4CHK A;  4KZ0 A;  1JRU A;  4YL8 A;  3V60 A;  3EFU A;  4IG7 B;  5TR5 A;  3ONS A;  3KH0 A;  1WMH B;  4W9G A;  4ANU A;  5HKH A;  4MSQ B;  4GGQ A;  4GIV A;  2KK8 A;  3B1L X;  2YVC A;  5JHA A;  2G4D B;  4XZ4 A;  2KC1 A;  2MBO A;  2MW5 A;  3PVL A;  1S1Q B;  1M94 A;  5FR6 A;  2CKH B;  1IP9 A;  3AU5 A;  3LDZ E;  1L7Y A;  2BWF A;  4HCN B;  4NJ7 A;  2KDB A;  1F9J A;  2L00 B;  3AXC A;  1LFD A;  2LD9 A;  3KUC B;  3NHE B;  4JL9 A;  1L2N A;  2N9X A;  3PZD A;  1V5T A;  1WZ3 A;  3MHS D;  2NBV B;  5LLI A;  3R7Q A;  2AEH A;  3DVG X;  2Z0E B;  5AZH A;  3ZVV A;  2O6V D;  1WX9 A;  2ZVO A;  5DPT A;  2DX5 B;  1WJU A;  3ZRC A;  1P9D U;  4GXB A;  2RR9 A;  1WGY A;  2AYO B;  2R2O A;  1RFA A;  4G50 A;  3MTN B;  2KAN A;  4BFR A;  2DAJ A;  3VUW A;  3S2A A;  1GG3 A;  2DZI A;  1WH3 A;  3B0A A;  3ZNG C;  1LXD A;  2V3S A;  3C0R B;  2M4N A;  1WMH A;  2MBH A;  4FUL A;  2ZVN A;  4W9K A;  3SHQ A;  4AJW A;  4BOS C;  2KMC A;  2M1M A;  2BKR B;  4HDQ A;  3A4S C;  4KDI C;  4IM2 A;  2MCN B;  2C7N B;  5L95 C;  4HPL B;  3MJW A;  2DYO A;  3IBE A;  3VUY A;  3WAL A;  2D11 A;  3VXW A;  2J0J A;  1GC6 A;  2PE6 B;  3ZIM A;  1V86 A;  3A9K B;  4EZJ A;  3DOW A;  3VH4 B;  2O6V A;  3PGE A;  4A20 A;  1E8Z A;  1ZGU B;  4I6N B;  3VTW A;  2KVR A;  3TJP A;  4ZDV A;  1V2Y A;  2KJR A;  4GB9 A;  1NDD A;  3NZS A;  4JQW C;  3QC8 B;  3APF A;  2BKF A;  2FCS A;  1VCB A;  4TUU A;  1H8C A;  3H6N A;  4OVV A;  5IAA C;  4GDK A;  2LVP A;  3PLV A;  5J2R A;  2DEN B;  3N30 A;  1P0R A;  4BOZ B;  1GNU A;  2A5U A;  2KJH B;  2M17 A;  2NCN A;  3CF6 E;  3L17 A;  3H1U A;  2K8H A;  3RUI B;  4FBJ B;  4F7Z A;  1WGG A;  3K9P B;  4GDL B;  3EEC A;  2RD0 A;  2C5L C;  2KD0 A;  2N7D A;  2NPT A;  4WWN A;  2KZR A;  4MGZ E;  2C60 A;  3VFK A;  3DVN V;  4EZL A;  3A33 B;  4HXD A;  1E90 A;  4OVU A;  1EF1 A;  2DZM A;  1SIF A;  3PHW B;  4JIO U;  2IO1 B;  4MEL A;  2I1J A;  2BWE S;  3A1Q A;  3L0W B;  3WAP A;  2KOX A;  3A9K A;  3M62 B;  3VVW B;  2KQS A;  2J7Q B;  4K7S A;  3UGB B;  1P3Q U;  4W9L A;  4NPN A;  3TIX A;  3X0W A;  2FIF A;  1KOT A;  3ALB A;  4B95 A;  3H7S A;  3PHX B;  5DPW A;  4GMV A;  2UWQ A;  3QK0 A;  5IA7 A;  1Y8R C;  4FJV B; 
#chains in the Genus database with same CATH topology
 1OTR B;  1GOZ A;  1L6V A;  2KXJ A;  1R4N I;  2BB5 A;  4BKT A;  2INC C;  2ZJD A;  1G6J A;  3IT6 B;  1QOG A;  4R3D A;  3N32 A;  3NVY A;  4OZC A;  5EDS A;  2JVC A;  1FEH A;  4DBG A;  4B6W A;  1NI2 A;  2ASQ A;  2WXO A;  2G9H D;  3U30 A;  3ZJU A;  4LDT B;  2ZZP B;  2WP9 B;  3OJ3 A;  3Q3F A;  2LFI A;  1WR6 E;  5DPR A;  3AE9 B;  4OZB A;  1FIQ A;  1IGC A;  2DYM A;  3PZ8 A;  4WQO B;  4DWF A;  3VHT C;  1MHH E;  1RLF A;  4LCD E;  2BQQ A;  4W9D A;  1V8C A;  1K8R B;  5JHB A;  2KX3 A;  2VH1 A;  3TCA A;  3Q3M C;  1HZ5 A;  1T3Q A;  4OW0 A;  2JY6 A;  1XLO A;  2WYQ A;  2QMT A;  5KHQ A;  3MFG A;  2G4S A;  2NTT A;  2KWU B;  3DBH I;  3R66 C;  2MX2 A;  2BS3 B;  4MAC A;  1OQY A;  1STE A;  3AV8 A;  4MJS B;  3AM9 A;  3WAM A;  5C1Z A;  5HI1 A;  2IGD A;  3GP7 A;  1QQR A;  2J0K A;  4RMA A;  1AYF A;  1ACC A;  4FJZ A;  1U4A A;  2GRI A;  1PDX A;  4RNA A;  1YJJ A;  4WUR A;  2D2Q A;  4XDD A;  2D10 A;  1YIW A;  2WQY B;  3ZO5 B;  1WXS A;  2PVO D;  4IDI A;  2N1V A;  1WGD A;  1J19 A;  1FRD A;  4WJQ A;  1SE2 A;  2BS2 B;  3PLU A;  4M8M A;  1JW9 D;  1WE7 A;  4C7Y A;  2IO2 B;  4FN2 A;  2W82 A;  2Y5P A;  3Q14 C;  4K81 A;  3RMK C;  2LUE A;  1XLP A;  3GS2 A;  3AED B;  2RDH A;  1XCQ L;  4LNI A;  3N1Y C;  4BVU C;  5HHD G;  5EE0 A;  3U8Z A;  2MLB A;  1E5W A;  2CR5 A;  3Q8A A;  2N9K A;  1T6B X;  1XO3 A;  1SB3 C;  2RDB C;  1J7A A;  4TV3 A;  2KDE B;  1WJ4 A;  1I4X A;  1P1A A;  3IFW B;  4WAA A;  3GE8 C;  4FHK A;  2GBR A;  3P4R B;  4HPP A;  2KFK A;  3TEW A;  3ENE A;  2X8X X;  3TBL D;  1WXA A;  4ANW A;  2BYE A;  3AEA B;  2E3T A;  2KDM A;  1JCK B;  3P63 A;  3PT2 B;  1D3Z A;  2WDR B;  4YT0 B;  2JZP A;  1AAR A;  1YMH E;  3BY4 B;  4MGI E;  4AWJ A;  3RYT A;  2MJD A;  1VLB A;  2LHD A;  3PSE B;  3T9L A;  3HVZ A;  3OJ4 B;  1SIJ A;  3DWG C;  3BWU D;  1I7H A;  3PRE A;  1Q10 A;  3Q8E A;  5AZF A;  1WFY A;  1DOY A;  1F1H A;  3ZGZ A;  2M0X A;  2Y5C A;  1AWD A;  3PO0 A;  2HTH A;  2KX0 A;  4NJC A;  1WGK A;  2CJN A;  2W55 A;  4HDO A;  4CO7 A;  1R4M I;  1N6Z A;  4KSK C;  5BMH A;  2K8C A;  2RPV A;  4NAW A;  4ZRI A;  1B9R A;  1LQB A;  1TKY A;  4IKG A;  2M19 A;  2R2Q A;  4J6I A;  2IO3 B;  4W9E A;  2FCN A;  4RM9 A;  1F52 A;  1OFF A;  1FCC C;  3UQB A;  3APD A;  4DHJ D;  1SXT A;  1EO6 A;  3W1S C;  3ZDM C;  1KTK A;  4C80 A;  1RWS A;  2MHJ A;  1XD3 B;  2KDI A;  3VAW A;  1PQS A;  1VZ7 A;  2N0S B;  2BYV E;  3NOB A;  4AJY B;  5EE3 A;  1LO5 D;  3I9V 1;  5HG2 A;  3DHG C;  4HKZ E;  1E7P B;  3U2S C;  1XCT L;  3BII D;  1RFK A;  2MA9 B;  1ZP0 B;  2D3B A;  1TT5 B;  1MI0 A;  3KYC D;  1GAQ B;  4RCO A;  3KUZ A;  4S0R A;  5D3I B;  4IW0 A;  4C4V B;  2WLB A;  4KGR A;  1WI0 A;  2B3A A;  2WXR A;  2MP2 B;  3PV1 A;  3VQI A;  3DWM A;  3LJ3 A;  4A6Q A;  5D7G A;  1MVK A;  5LXH A;  4FLH A;  4KX6 B;  3A9J A;  2WHI A;  4IM3 A;  1R4N B;  1C3T A;  4HPM B;  4EE2 A;  4N6E B;  3JSV A;  2VZK D;  3QJZ A;  1JWB D;  4NAM A;  4BBN F;  2LZ6 A;  2HD5 B;  2BW2 A;  4F8C B;  2RMM A;  5G2N A;  3SU8 X;  2WU2 B;  4KSL C;  2NBU A;  1FXT B;  4I6P A;  2W9N A;  3EFU A;  4WAF A;  3NRZ A;  1K51 A;  4GGQ A;  2KK8 A;  2YVC A;  5JHA A;  4XZ4 A;  3AU5 A;  3LDZ E;  2BWF A;  4NJ7 A;  2L00 B;  3RNB C;  3IXS A;  2LD9 A;  1WZ3 A;  3BYT B;  2NBV B;  3R7Q A;  5DPT A;  3AE4 B;  1N5X A;  2WDV B;  4BFR A;  3AEE B;  4HKQ A;  1E9M A;  1JRP A;  1WH3 A;  2QJL A;  1WMH A;  4HRS A;  2MCN B;  5L95 C;  4HPL B;  3MJW A;  2DYO A;  2PTL A;  3AE1 B;  4LK0 M;  5C2T B;  2PE6 B;  3A9K B;  4LNO A;  1BML C;  3VH4 B;  2O6V A;  3VTW A;  3TJP A;  4ZDV A;  1V2Y A;  2KJR A;  3N20 C;  4PT5 A;  1I4H A;  4IOI E;  2FCS A;  4HRO A;  2K3U A;  4GDK A;  3PLV A;  5J2R A;  1EM7 A;  3NJT A;  1ESF A;  4F7Z A;  3K9P B;  4GDL B;  2K9X A;  4ZRP A;  2KZR A;  2C60 A;  4BZA A;  2DZM A;  3IT4 B;  3B2G A;  2IO1 B;  2IND C;  2I1J A;  2PMV A;  5BMI A;  2KOX A;  4OZA A;  1SSN A;  2J7Q B;  1SJH D;  2KQS A;  2M56 B;  4K7S A;  4NPN A;  1L6U A;  2FIF A;  1KOT A;  3H7S A;  3CWI A;  1SBB B;  3P1M A;  1N63 A;  3X23 A;  1EU3 A;  2CHW A;  4TKN A;  2V1Y A;  2KN4 A;  2YLM A;  2O2V B;  1HZ6 A;  3Q8B A;  4FHJ A;  2PVG C;  2EKI A;  2LXC A;  2BT6 A;  4W9F A;  2D3C A;  3RNG C;  4P1B C;  4RGN A;  3HRD D;  1YNT E;  3LXF A;  4F1S A;  2GI9 A;  5D2M B;  5IO9 A;  1GJZ A;  1MHX A;  2BPS A;  5JH5 C;  2KJ6 A;  2GB1 A;  3H7P B;  2L76 A;  3AUL A;  1Y56 A;  2IBI B;  4EOY A;  4L1B A;  2JYE A;  4KKJ A;  1JML A;  2QEJ C;  1TS5 A;  1C76 A;  4C7Z A;  2DHZ A;  2LGS A;  3NVZ A;  2KNB A;  3QA8 A;  1YQ4 B;  3ZJT A;  1WWT A;  2IYD B;  1AW7 A;  5BYR A;  1RYJ A;  2ZNV C;  2MJE A;  1K53 A;  2LEK A;  3CST A;  1XLN A;  3QX1 A;  5H92 C;  4K1R B;  3W5U B;  4PS8 A;  3L4P A;  1ZXI A;  3KW5 B;  4A9A A;  4ZRQ A;  4DHZ E;  4NY0 A;  4YSY B;  1WIA A;  1K52 A;  2LI5 A;  3JYU A;  4K7U A;  1CJE A;  1UBI A;  4WQM A;  4A3O A;  2A4Z A;  1FNV A;  3KWV A;  2NR2 A;  3O13 A;  2N4F A;  4XX5 A;  1Q5W B;  2IZV B;  2INP E;  1UWX A;  3KWL A;  1EU4 A;  1TIF A;  5E6N A;  2L52 A;  4KV2 A;  1JQ4 A;  3V6E B;  1WXQ A;  4HVB A;  1D5Z C;  3BIN A;  3EHV A;  1GUA B;  3VH3 B;  3PZ7 A;  2WDT B;  3ZXV A;  4CYE A;  1L0X B;  4HK2 A;  1CK1 A;  4TQ1 A;  4G0N B;  4IM0 A;  1WSP A;  3Q6B A;  1WXV A;  2KN5 A;  3VTV A;  2AWT A;  2IGH A;  5DPS A;  3GZN I;  3W1S A;  3VDZ A;  3UIN B;  2LGI A;  3WA0 A;  4RM8 A;  2Q5W D;  3MP9 A;  2Z59 B;  5AZG A;  1C1Y B;  3BVM A;  4G11 A;  2DBY A;  2ICI A;  1QOB A;  4JE3 B;  3ZYY X;  4W9C A;  4P1C C;  2WDQ B;  4N9F 4;  1GB4 A;  2KLC A;  2REX A;  3V05 A;  1L5P A;  2JT4 B;  4JPS A;  3HHM A;  3L54 A;  2SAK A;  2GOW A;  4A90 A;  4FXC A;  2C7M B;  3N9Y C;  3UIO B;  2K8B A;  2LWP A;  1SE4 A;  4DXG A;  4LDT D;  4LTU A;  3U7Z A;  2JWU A;  2MBE A;  1BXT A;  2JZZ A;  2KVZ A;  1CQV A;  2PW9 A;  3ZNH B;  3L13 A;  2AQ2 B;  3V61 A;  3DCG A;  2J0M A;  3SDL C;  1OEY A;  3E56 A;  2FUH B;  3AMZ A;  2N9P C;  2CU3 A;  1OGW A;  4MT5 A;  4BAX A;  3A4R A;  1D6E C;  1YQ3 B;  4QAY A;  3RCZ A;  5G5G A;  1D5M C;  2Z0D B;  1TS4 A;  3N1Z C;  1E7V A;  2KC2 A;  4GU2 A;  3NZU A;  3JVZ X;  4B0E A;  2ZCB A;  1WJN A;  2INN E;  4LLG M;  1UGM A;  1KLV A;  1FMA D;  2LGY A;  2PKO A;  1KLU D;  1P98 A;  1I4P A;  2I2Y A;  1V81 A;  2VH2 A;  2WX1 A;  2BF8 B;  4EEW A;  4E74 A;  2LVQ A;  2K25 A;  3RNA C;  3NS8 A;  1C4C A;  4YWG G;  4K7W A;  1J7C A;  1TKE A;  4US9 A;  3Q3J A;  1E8W A;  2NPT B;  2MRP A;  3SEB A;  3LB8 C;  1FRR A;  3K9O B;  3O65 B;  2KTF A;  4XDC A;  3A1Q B;  1ET9 A;  3KQ4 A;  3TSS A;  2KTR A;  2J53 A;  3DBL I;  2NBW B;  3TL5 A;  3IHP C;  2L05 A;  1QKZ A;  2QIL A;  4KIK A;  5IOI A;  4RGT A;  4M0W A;  1KH0 A;  2L32 A;  1TGZ B;  1V6E A;  4E3C A;  3W2D A;  2JQR B;  3HM3 A;  1ZDX A;  4M00 A;  2SEB D;  4OHJ A;  1HE8 A;  1DGJ A;  4MDK E;  3EA6 A;  3DBR B;  4IWP A;  3DQV A;  1I35 A;  3AE3 B;  1T5X D;  2LRU A;  4W9I A;  1WJ6 A;  3FIL A;  4G3X B;  1A5R A;  3E9S A;  4EKU A;  4LJO B;  1PGA A;  4RF0 A;  3V6C B;  4MM3 A;  2JUO A;  1DOI A;  4O1N A;  1IUE A;  2V4I B;  2LJ5 A;  5C23 A;  4A3P A;  4MGY E;  2Z8L A;  3AU4 A;  3Q69 A;  1WGR A;  2XK5 A;  2WNM A;  5J17 A;  2V4L A;  2JPH A;  3NVV A;  2XEW A;  2WXI A;  5IKC M;  1L4Z B;  2K1F A;  1UGJ A;  1ENF A;  5G5H A;  4CHK A;  4AS1 A;  4KZ0 A;  4YL8 A;  2NMQ A;  4JWS C;  4IG7 B;  2J4X A;  1I4R A;  3LYY A;  1IBX A;  2MW5 A;  2HTM E;  1QT9 A;  4HCN B;  1LFD A;  3KLS X;  3NHE B;  4PK1 A;  1FXA A;  4JL9 A;  3I5J C;  3FAH A;  1C9F A;  5LLI A;  5BMG A;  2WGS A;  2DX5 B;  4GXB A;  1F2R C;  1L4D B;  1WGY A;  1ROE A;  1MJD A;  2R2O A;  4XWT A;  3ABV B;  4ITK A;  3W9C B;  3SFD B;  3S2A A;  3ZNG C;  3AE7 B;  1XLQ A;  1LXD A;  5D3D A;  3AE2 B;  2M4N A;  2MBH A;  3SHQ A;  2L1A A;  3AE6 B;  2KMC A;  2BKR B;  1YJI A;  3A4S C;  1HTQ A;  5EE1 A;  3MHZ A;  3WAL A;  1E6E B;  1TJE A;  5FKA C;  1SEB D;  4J3O D;  3ZIM A;  1N5W A;  1V86 A;  4JWU C;  4EZJ A;  2KT7 A;  3MC0 B;  3R2T A;  3PGE A;  1E8Z A;  1ZGU B;  4I6N B;  2BTE A;  4GB9 A;  1NDD A;  3APF A;  4OVV A;  5IAA C;  1P0R A;  1GNU A;  2KJH B;  1QOA A;  3H1U A;  3I57 A;  5EE9 A;  2WXF A;  2C5L C;  1JWA D;  4YXD B;  4MGZ E;  3DVN V;  1D4B A;  1XF5 L;  4OVU A;  3NVW A;  3MJ5 A;  3PHW B;  1SJE D;  4JIO U;  2V3P A;  2HDE A;  1M4V A;  3L0W B;  3WAP A;  3A9K A;  3VVW B;  3UGB B;  3X0W A;  3TIX A;  3PHX B;  5DPW A;  2MJ3 A;  5IA7 A;  4NNJ B;  2KFK B;  4KKI A;  3ZJV A;  4ZRJ A;  1T0R C;  1C79 A;  1V1P A;  2DLB A;  3U52 E;  3AN1 A;  4RFB A;  3WAO A;  4M01 A;  3TEX A;  2IGG A;  3HK0 A;  2LGX A;  1UD7 A;  3PRM B;  4A55 A;  2J52 A;  4MEM A;  1WZ0 A;  2FID A;  1EWY C;  3DPD A;  2JRH A;  2HJ8 A;  2KFJ A;  2G45 B;  3ETR A;  3QHT A;  2ON8 A;  3U4E G;  1ZOY B;  1JWS D;  1F2R I;  2KHW B;  2MH7 A;  3ZUN A;  1I4G A;  1FCL A;  3JW0 X;  1WF9 A;  1ZE3 D;  3RNE C;  3P4Q B;  3RT3 B;  1XXG A;  2BBC A;  4NAW B;  2FUG 1;  2ZW1 A;  3ZDT A;  3H9D A;  3DBH B;  4HJK A;  3ZQ4 A;  2WS3 B;  3QAR A;  2GBK A;  2GBJ A;  2BGF A;  1J7B A;  1YOV B;  2JU6 X;  4MH0 E;  4CQN A;  3VRA B;  1ZDV A;  3T3N A;  1SGH A;  4L23 A;  2PJH A;  1VRA B;  1QOF A;  1MG8 A;  5FR3 A;  1MPE A;  2X38 A;  2FBW B;  4WJP A;  2K0P A;  3ZNI D;  5BO4 B;  2YEP B;  1WX8 A;  2FNJ B;  1WE6 A;  3KYD D;  2K5P A;  4P7I A;  2J42 A;  3BVG A;  1V1O A;  1E7U A;  1PGX A;  4ASW C;  3R7R A;  1ET6 A;  2LXA A;  1YJ1 A;  3A9J B;  1T0S C;  3OWE B;  4FJY A;  3WCQ A;  2KMM A;  3PTF C;  3JSV B;  2PPH A;  1XEE A;  2BB6 A;  2W3R A;  3W5V B;  4B9K A;  4II2 B;  1N62 A;  3RI7 C;  1KM7 A;  4KDL B;  2QSD A;  4NJ6 A;  1WXM A;  1YN4 A;  1J0G A;  2NS5 A;  3B9J A;  2KQ7 A;  1TBE A;  2EKE C;  2RPQ A;  2L83 A;  2IDY A;  3M63 B;  1HEZ E;  4AOF A;  3SD5 A;  4USA A;  3Q2A C;  3NS1 A;  3TMP B;  5BYS A;  3CIR B;  1TTN A;  2D07 B;  2ZEQ A;  4EZK A;  4WWO A;  4FAD A;  3PS6 A;  2LGD A;  1EF5 A;  4ANX A;  2IO0 B;  4PYZ A;  2FAZ A;  1ZPS A;  1NYR A;  2IY1 B;  1OEY J;  1H4R A;  2WXL A;  3ML9 A;  3ZRF A;  4YTP B;  1YN5 A;  4ZHP A;  3BVZ A;  3Q3O C;  3AEB B;  2IY0 B;  4K3B A;  3EC8 A;  4ZHO A;  1GPX A;  2KAJ A;  4ICU A;  2KO3 A;  1AN8 A;  4W9H A;  3U7D A;  2KWC A;  2O6V B;  2UYZ B;  3UIP B;  1I42 A;  3OAW A;  4B0M A;  2LMC A;  3N3K B;  3DVG Y;  2JF5 A;  1QZE A;  3URY A;  1VJK A;  1NEK B;  4GDK B;  3RD2 A;  5IN7 A;  2HE7 A;  4KZC A;  1V49 A;  4IWO A;  3C8Y A;  2EMS A;  1R4M B;  3AH7 A;  2AL6 A;  4AUQ C;  4D2K A;  1PGB A;  3DDC B;  4US8 A;  3R2I A;  1HTO A;  1SF0 A;  2KDF B;  1P7F A;  4BBN C;  1OQQ A;  3GOE A;  5LNK 1;  3I63 C;  2PE9 A;  5GMV A;  3PPA A;  4L2Y A;  3W1Y A;  1WM3 A;  2HJ1 A;  5JZE B;  4BKS D;  4LNF A;  4MJS A;  2DYB A;  3FKY A;  4JLC A;  4DQO C;  3FC4 A;  2TSS A;  5AEK B;  4WJO A;  3M95 A;  4HLE A;  4JGH B;  3P42 A;  3VR8 B;  2WXQ A;  4OVZ A;  4YTM B;  5I4D A;  1KRH A;  4GSW A;  2Y3A A;  1I4Q A;  3AE5 B;  2UU7 A;  4ARI A;  1E8Y A;  2L8J A;  1NBF C;  2LAS A;  2D5G A;  2GBM A;  3IAS 1;  2K22 A;  2Y5B B;  2LJI A;  1KJT A;  2CHZ A;  1T0Y A;  3DVN U;  1LGR A;  4I6L B;  2I38 A;  2H88 B;  3RPF C;  1WX7 A;  3IAM 1;  2JRI B;  4XC2 A;  4WWP A;  1HA5 A;  5J18 A;  1Q1O A;  5AUI A;  1VZ8 A;  3BYY B;  3DHH C;  2DZK A;  4YSZ B;  4BKG A;  4DDG D;  2ZCC A;  3QQ8 B;  1NEN B;  2WXG A;  4URK A;  1RM6 C;  1WRD B;  2ACZ B;  4EFO A;  2GMI C;  5GXG B;  1QIL A;  2CHX A;  5CHV C;  2WXN A;  3VUX A;  5L83 A;  1JRU A;  3RNC C;  5TR5 A;  3ONS A;  1TZO A;  4GIV A;  2G4D B;  2KC1 A;  5FR6 A;  2WU5 B;  1L7Y A;  3NG0 A;  2KDB A;  1IGD A;  3AXC A;  4Q2J A;  3SFE B;  1C78 A;  2N9X A;  3PZD A;  3MHS D;  2AEH A;  2Z0E B;  1WX9 A;  2FE8 A;  1P9D U;  1WRI A;  1KF6 B;  4P16 A;  3MTN B;  2KAN A;  2XN9 C;  2DAJ A;  3VUW A;  1GG3 A;  1JWU D;  3SR6 A;  2DZI A;  5HFY A;  3B0A A;  2V3N A;  4N58 A;  2V3S A;  4W9K A;  4HDQ A;  4IM2 A;  2C7N B;  3VUY A;  3IBE A;  4XYC A;  2D11 A;  3VXW A;  3AB5 A;  2J0J A;  1GC6 A;  1JRO A;  2D3A A;  3VRB B;  1N61 A;  2KAC A;  1ZUD 2;  3Q3N C;  5IP4 D;  4A20 A;  4YSX B;  2JXT A;  4JQW C;  3NZS A;  1T0Q C;  2ZW0 A;  1HQR D;  1PUT A;  1VCB A;  1FPY A;  1H8C A;  3H6N A;  3DHI C;  3AEC B;  2DEN B;  3N30 A;  4BOZ B;  3L17 A;  1TYG B;  2R61 A;  2A5U A;  2H89 B;  1WGG A;  3EEC A;  2BYT A;  4HXD A;  1E90 A;  1SIF A;  1P7E A;  3BK1 A;  1NI3 A;  4C56 C;  1P3Q U;  4A8X C;  1UF0 A;  2EEL A;  3ALB A;  4B95 A;  4GMV A;  3ZXR A;  1BUI C;  4FJV B;  1C4P A;  3RZW C;  4ACF A;  1VD2 A;  4IUM B;  3UI3 A;  3ZKJ C;  3OLM D;  3UF8 A;  2MQJ A;  1K50 A;  2OHF A;  4HJG E;  5DCN A;  4RH6 A;  1UNS A;  1LM8 B;  1KLG D;  2NTS A;  5FK9 C;  3RFZ B;  2BYF A;  2D3G A;  1YQB A;  2I1K A;  1D5X C;  4C4V A;  1Q0W B;  1VR9 A;  4E71 A;  2KMA A;  2MP2 A;  3Q8F A;  2MBQ A;  4TMA B;  3TUO A;  3IVF A;  2LUM A;  1FNW A;  3WAN A;  1OQR A;  1V9J A;  2CJO A;  3ZLZ A;  3P4P B;  3C19 A;  2QIE B;  1TY2 A;  2MWS B;  3ZNZ B;  2AX5 A;  4II3 B;  3CMM B;  5CHW A;  3AEG B;  1RAX A;  4PYU A;  2CS4 A;  1WM2 A;  1MG4 A;  2GBN A;  5TSS A;  1ZKH A;  3RZF A;  2IPK D;  4GLS C;  1XQQ A;  4XE0 A;  2PEA A;  5H8Y E;  2MSE D;  5CTR C;  2KTR B;  5G55 A;  2KWV B;  4WIP A;  3V62 A;  1C77 A;  1PFD A;  2L0F A;  4KIK B;  3D32 A;  3EUB 2;  2QDF A;  1CZP A;  4M0W B;  4PS7 A;  5CX3 A;  1GC7 A;  3T8M A;  4HCP B;  5E6O A;  3NY5 A;  3QWZ B;  1YX6 B;  1IYF A;  3B2F A;  5BYQ A;  4DDI D;  3VR9 B;  2NVU I;  3BK2 A;  3QIJ A;  5CHF A;  2LHE A;  2N1W A;  3NZ3 A;  3FIL B;  4WJN A;  1UH6 A;  4TQ0 A;  2RDG A;  1NYQ A;  4AP4 C;  4ZYN A;  4DHJ B;  1S3S G;  1V97 A;  2K39 A;  2LRW A;  4WH4 A;  4MM3 B;  1RRB A;  5E6J A;  3VTU A;  3GZN B;  3OG5 A;  2C7H A;  1FM0 D;  4RF1 A;  3M3J A;  1VDV A;  2KLG A;  5T8I A;  2K6D B;  2RGF A;  2L3Z A;  3Q8C A;  2XK5 B;  2G3Q B;  2MBB B;  2OED A;  2RSU A;  5D6J B;  4KVG B;  1JAL A;  1A70 A;  3AI5 A;  3L10 B;  1WYG A;  1UUP A;  4GOC A;  1V5O A;  2EMT A;  1WGH A;  1F0Z A;  1EWC A;  3B08 A;  4FA6 A;  3NUH B;  2KQ4 X;  2WWZ A;  2QC8 A;  1BT0 A;  2VRR B;  3BZD B;  4GDL A;  4IWQ A;  3ZTC A;  4NQK E;  3GB1 A;  1IBX B;  3R3M A;  2C9W B;  4JX1 C;  2JSV X;  2WX0 A;  2PIA A;  3P2B A;  3GE3 C;  1YX5 B;  2VZK B;  4S17 A;  2PLP A;  4X57 B;  1WY8 A;  1V80 A;  1N60 A;  2WXP A;  2N9L A;  1JWM D;  4C00 A;  3RNF C;  2M8S A;  4ICV A;  2L7R A;  2ZNV B;  3ZW3 A;  1E10 A;  1VZ6 A;  1FXI A;  2O2V A;  4RGM A;  4PS3 A;  2FCQ A;  3HUI A;  3TEZ A;  3QAQ A;  3WIM A;  2V0G A;  2YEP F;  1YD8 U;  1J8C A;  2WXH A;  4N59 A;  1TZ1 A;  4KGS A;  2KWD A;  2OJR A;  4M02 A;  2KKC A;  3ZTD A;  2L0T A;  4ZYS A;  2XBB C;  1IPG A;  4ZRK A;  2AL3 A;  1SE3 A;  1B1Z A;  3H7P A;  1SE9 A;  1HXY D;  2DZJ A;  3PRP B;  5D94 A;  3V3X A;  4TSS A;  2K6Q A;  2FCM A;  2KYW A;  4M8N A;  1TS3 A;  3CSF A;  1UBQ A;  1UZX B;  1EUV B;  4EUT A;  2W3S A;  1MFW A;  3ECI A;  2GLS A;  2JXX A;  2JWZ A;  4UDU C;  3QCA A;  3L16 A;  1QLB B;  2ZPN A;  1ZW7 A;  3HVD A;  1CMX B;  1R7S A;  1WR1 A;  4DXA B;  1L0V B;  3DBL B;  3UQA A;  5E6P A;  1TS2 A;  4YTN B;  2OOB B;  2IJ0 A;  3EGR A;  1Z2M A;  3PRZ A;  1E8X A;  1X1M A;  4P6V F;  3APC A;  3KVF B;  5LXI B;  1QF6 A;  3DBS A;  2G1E A;  3IG3 A;  1V1P B;  2ZPY A;  2CU1 A;  2N7E A;  4DHZ B;  1WYW B;  3HM6 X;  4NQL B;  2JZ3 B;  3J9C A;  1FNU A;  1Z5S B;  3DBR I;  4MSM B;  2QHO A;  4HWI B;  2DNF A;  5JXV A;  4IC7 B;  2E6X A;  3KUD B;  4ANV A;  2WXM A;  4H2A A;  1UEL A;  2LVO A;  4W9J A;  2DAF A;  4BKS A;  4RGO S;  4ARC A;  3I3T B;  4XGA B;  3HIZ A;  3L08 A;  1XT9 B;  4LJP B;  3ML8 A;  2N7J A;  2N9E B;  2WXJ A;  4DK5 A;  3RUL A;  4KGT A;  5KHO A;  4GN1 A;  3R8B A;  2XNA C;  1ISN A;  2B76 B;  1ZXH A;  3MC8 A;  4MGK E;  1E0Z A;  5MPO A;  1KFY B;  3N1X C;  4MH8 A;  3V60 A;  1GB1 A;  5HKH A;  1TKG A;  1WMH B;  3KH0 A;  4W9G A;  4ANU A;  4MSQ B;  3B1L X;  3AE8 B;  2MBO A;  3PVL A;  1S1Q B;  1M94 A;  2CKH B;  1IP9 A;  2BS4 B;  1PYW D;  1F9J A;  4HEA 1;  4LNN A;  3KUC B;  3AEF B;  1L2N A;  1V5T A;  3ZVV A;  3DVG X;  5AZH A;  3P4S B;  1NVI D;  2O6V D;  2ZVO A;  1WJU A;  2JX5 A;  3ZRC A;  2RR9 A;  2AYO B;  1RFA A;  4G50 A;  2AQ3 B;  3RN9 C;  3H8H A;  4LNK A;  4ZOH C;  2ONQ A;  3C0R B;  1FO4 A;  4AJW A;  4FUL A;  2ZVN A;  4BOS C;  2M1M A;  4WWM A;  4KDI C;  2W54 A;  1DYQ A;  4AQ7 A;  4XWW A;  1F77 A;  3TEY A;  5AUK A;  3DOW A;  2KVR A;  1DOX A;  1UWM A;  3QC8 B;  1C4A A;  5C3J B;  2BKF A;  2QCZ A;  1FFU A;  2JYT A;  3T3O A;  4TUU A;  2M0A A;  3EFC A;  2V9H A;  2WXK A;  2OJW A;  2LVP A;  4NZL B;  2DWQ A;  2M17 A;  1FFV A;  2NCN A;  3CF6 E;  2K8H A;  3RUI B;  4FBJ B;  4DXF A;  2AQ1 B;  2BVC A;  2RD0 A;  1L0Y B;  2KD0 A;  2N7D A;  4K3C A;  2NPT A;  4WWN A;  3VFK A;  4EZL A;  3A33 B;  1EF1 A;  4MEL A;  2BWE S;  3A1Q A;  4REZ A;  3M62 B;  1FD6 A;  2MEK A;  4W9L A;  2UWQ A;  3MC9 A;  3QK0 A;  1YN3 A;  1TY0 A;  1Y8R C; 
#chains in the Genus database with same CATH homology
 4NNJ B;  2KFK B;  1OTR B;  3RZW C;  3X23 A;  1VD2 A;  4IUM B;  2CHW A;  4TKN A;  4ZRJ A;  2V1Y A;  2YLM A;  3ZKJ C;  2O2V B;  3OLM D;  4FHJ A;  2KXJ A;  1R4N I;  3UF8 A;  4BKT A;  2MQJ A;  2LXC A;  2ZJD A;  4W9F A;  3WAO A;  1G6J A;  5DCN A;  1LM8 B;  3N32 A;  3HK0 A;  5EDS A;  2JVC A;  2LGX A;  4DBG A;  1UD7 A;  4B6W A;  3PRM B;  1NI2 A;  2ASQ A;  2BYF A;  2D3G A;  4MEM A;  3U30 A;  4LDT B;  1YQB A;  2ZZP B;  2I1K A;  4F1S A;  3OJ3 A;  5D2M B;  1WZ0 A;  3Q3F A;  1GJZ A;  2BPS A;  5JH5 C;  1WR6 E;  1Q0W B;  2FID A;  2KJ6 A;  2KMA A;  5DPR A;  4E71 A;  3DPD A;  3H7P B;  2DYM A;  2MP2 A;  2L76 A;  3AUL A;  2JRH A;  2IBI B;  2HJ8 A;  4EOY A;  4WQO B;  2MBQ A;  2KFJ A;  2G45 B;  4DWF A;  3IVF A;  3VHT C;  3QHT A;  3WAN A;  1RLF A;  4LCD E;  2KHW B;  3ZUN A;  1V9J A;  2DHZ A;  4W9D A;  3JW0 X;  1K8R B;  1WF9 A;  3ZLZ A;  2KNB A;  3RT3 B;  3QA8 A;  5JHB A;  3ZNZ B;  2MWS B;  4II3 B;  3CMM B;  2IYD B;  2KX3 A;  5CHW A;  2ZNV C;  1RAX A;  4NAW B;  3TCA A;  4PYU A;  2CS4 A;  1WM2 A;  2GBN A;  2JY6 A;  1ZKH A;  3RZF A;  3CST A;  3ZDT A;  3H9D A;  1XQQ A;  3QX1 A;  2WYQ A;  2PEA A;  5KHQ A;  2MSE D;  5CTR C;  2G4S A;  2KTR B;  2KWU B;  2KWV B;  4K1R B;  3DBH I;  4HJK A;  5G55 A;  4PS8 A;  3V62 A;  3R66 C;  2MX2 A;  3KW5 B;  2L0F A;  4KIK B;  3D32 A;  3QAR A;  2GBK A;  1OQY A;  4DHZ E;  4NY0 A;  4MJS B;  4M0W B;  4PS7 A;  5CX3 A;  3WAM A;  2GBJ A;  5C1Z A;  1GC7 A;  3T8M A;  4HCP B;  2BGF A;  5E6O A;  1WIA A;  2LI5 A;  3JYU A;  4K7U A;  4A3O A;  1UBI A;  3NY5 A;  3QWZ B;  1YX6 B;  2A4Z A;  4MH0 E;  2J0K A;  1IYF A;  4RMA A;  2NR2 A;  4DDI D;  2N4F A;  4XX5 A;  1Q5W B;  2IZV B;  2NVU I;  1SGH A;  3QIJ A;  4FJZ A;  1U4A A;  5BO4 B;  2PJH A;  5CHF A;  5E6N A;  4KV2 A;  3V6E B;  2N1W A;  4HVB A;  1MG8 A;  3BIN A;  3EHV A;  1GUA B;  3VH3 B;  4WJN A;  2D2Q A;  1UH6 A;  4TQ0 A;  4WJP A;  2WDT B;  4AP4 C;  2D10 A;  4ZYN A;  4CYE A;  4DHJ B;  3ZNI D;  1S3S G;  1YIW A;  2K39 A;  2LRW A;  4HK2 A;  4G0N B;  1WX8 A;  4TQ1 A;  2FNJ B;  1RRB A;  1WE6 A;  3KYD D;  4IM0 A;  4P7I A;  3ZO5 B;  1WXS A;  1WXV A;  2KN5 A;  3VTV A;  2N1V A;  1WGD A;  3VTU A;  2AWT A;  1E7U A;  1J19 A;  4ASW C;  3R7R A;  5DPS A;  4WJQ A;  3GZN I;  3W1S A;  2C7H A;  3PLU A;  3UIN B;  3VDZ A;  3M3J A;  4M8M A;  2LXA A;  1YJ1 A;  3WA0 A;  1WE7 A;  3A9J B;  2IO2 B;  4RM8 A;  2KLG A;  4FN2 A;  2K6D B;  2RGF A;  2L3Z A;  4FJY A;  2XK5 B;  2G3Q B;  5AZG A;  2Z59 B;  2MBB B;  3PTF C;  1C1Y B;  3JSV B;  4G11 A;  2RSU A;  5D6J B;  4KVG B;  2PPH A;  3L10 B;  3AI5 A;  4K81 A;  4W9C A;  4GOC A;  4N9F 4;  1V5O A;  4B9K A;  2LUE A;  4II2 B;  2EMT A;  1WGH A;  2KLC A;  3B08 A;  1KM7 A;  2REX A;  4FA6 A;  4KDL B;  4NJ6 A;  4BVU C;  1WXM A;  1J0G A;  2WWZ A;  2JT4 B;  3U8Z A;  2MLB A;  1BT0 A;  2VRR B;  3HHM A;  1E5W A;  2CR5 A;  3L54 A;  2NS5 A;  2GOW A;  4GDL A;  4IWQ A;  3ZTC A;  2KQ7 A;  1TBE A;  2EKE C;  4NQK E;  2C7M B;  2RPQ A;  3R3M A;  4TV3 A;  2C9W B;  3M63 B;  2KDE B;  4AOF A;  2WX0 A;  3UIO B;  3SD5 A;  2K8B A;  2LWP A;  3P2B A;  1WJ4 A;  1YX5 B;  1P1A A;  3TMP B;  4LDT D;  3IFW B;  4WAA A;  4X57 B;  1TTN A;  1WY8 A;  2MBE A;  1V80 A;  2D07 B;  2ZEQ A;  2JZZ A;  4EZK A;  4WWO A;  4FAD A;  3PS6 A;  3ZNH B;  2LGD A;  4FHK A;  2M8S A;  3L13 A;  1EF5 A;  2GBR A;  4ANX A;  2IO0 B;  4ICV A;  4PYZ A;  2KFK A;  3V61 A;  3ENE A;  2L7R A;  2FAZ A;  3TBL D;  1WXA A;  3DCG A;  2J0M A;  4ANW A;  2BYE A;  2ZNV B;  3ZW3 A;  3SDL C;  2O2V A;  1OEY A;  2FUH B;  2IY1 B;  4PS3 A;  1OEY J;  1H4R A;  2FCQ A;  3ML9 A;  3ZRF A;  3PT2 B;  3QAQ A;  3WIM A;  1D3Z A;  2N9P C;  1YD8 U;  1J8C A;  1OGW A;  1AAR A;  3A4R A;  1TZ1 A;  2IY0 B;  3EC8 A;  3RCZ A;  3BY4 B;  2OJR A;  4MGI E;  2KKC A;  4AWJ A;  3RYT A;  2Z0D B;  3ZTD A;  2L0T A;  4ICU A;  2KO3 A;  3PSE B;  1E7V A;  2XBB C;  3T9L A;  2KC2 A;  1IPG A;  4W9H A;  4ZRK A;  2AL3 A;  3OJ4 B;  3U7D A;  2KWC A;  4GU2 A;  3H7P A;  2O6V B;  2UYZ B;  3PRE A;  3NZU A;  3UIP B;  3JVZ X;  1SE9 A;  1WJN A;  2ZCB A;  1I42 A;  5AZF A;  1WFY A;  2DZJ A;  3OAW A;  3PRP B;  5D94 A;  1UGM A;  2K6Q A;  3N3K B;  2M0X A;  3DVG Y;  2JF5 A;  1KLV A;  2FCM A;  1QZE A;  2LGY A;  2HTH A;  2KX0 A;  4M8N A;  1P98 A;  3CSF A;  4GDK B;  3RD2 A;  1V81 A;  2HE7 A;  4KZC A;  2WX1 A;  2BF8 B;  4HDO A;  1UBQ A;  1UZX B;  1V49 A;  4IWO A;  4EEW A;  4CO7 A;  1EUV B;  4EUT A;  4E74 A;  2LVQ A;  2EMS A;  3ECI A;  1R4M I;  2AL6 A;  2K25 A;  4KSK C;  3NS8 A;  4AUQ C;  2JXX A;  2K8C A;  4K7W A;  3DDC B;  2JWZ A;  3Q3J A;  1E8W A;  2NPT B;  2MRP A;  4NAW A;  4ZRI A;  3QCA A;  1LQB A;  2R2Q A;  3L16 A;  4J6I A;  2IO3 B;  2KDF B;  3K9O B;  2ZPN A;  2FCN A;  3O65 B;  1ZW7 A;  2KTF A;  4RM9 A;  4W9E A;  3A1Q B;  1CMX B;  1WR1 A;  3GOE A;  4BBN C;  4DXA B;  2PE9 A;  2KTR A;  3UQB A;  3DBL I;  5E6P A;  3UQA A;  5GMV A;  2NBW B;  3APD A;  3TL5 A;  2OOB B;  3IHP C;  3PPA A;  2L05 A;  1WM3 A;  1EO6 A;  3W1Y A;  4DHJ D;  4KIK A;  3W1S C;  3ZDM C;  5JZE B;  1Z2M A;  4BKS D;  3PRZ A;  4MJS A;  1E8X A;  1XD3 B;  2DYB A;  2KDI A;  3VAW A;  1PQS A;  1X1M A;  3APC A;  3KVF B;  1TGZ B;  4JLC A;  5LXI B;  1V6E A;  3DBS A;  3IG3 A;  4E3C A;  5AEK B;  2BYV E;  2ZPY A;  3NOB A;  2CU1 A;  4WJO A;  3M95 A;  4AJY B;  2N7E A;  4JGH B;  3HM3 A;  4HLE A;  4DHZ B;  1WYW B;  3HM6 X;  1HE8 A;  2JZ3 B;  4GSW A;  4NQL B;  4MDK E;  1Z5S B;  3DBR I;  4IWP A;  3DQV A;  4MSM B;  2QHO A;  1E8Y A;  1I35 A;  2L8J A;  2LRU A;  2MA9 B;  4HWI B;  4W9I A;  1WJ6 A;  1NBF C;  2LAS A;  4G3X B;  2GBM A;  3KYC D;  1A5R A;  2Y5B B;  4IC7 B;  1KJT A;  3KUZ A;  2CHZ A;  4ANV A;  3KUD B;  4EKU A;  4IW0 A;  4LJO B;  1T0Y A;  3DVN U;  4I6L B;  1WI0 A;  2B3A A;  1UEL A;  2LVO A;  3V6C B;  4MM3 A;  4W9J A;  2JUO A;  2MP2 B;  2DAF A;  3PV1 A;  3VQI A;  4BKS A;  3LJ3 A;  2LJ5 A;  1WX7 A;  3I3T B;  5C23 A;  2JRI B;  5D7G A;  4XC2 A;  3HIZ A;  4WWP A;  3L08 A;  5LXH A;  1XT9 B;  4FLH A;  4LJP B;  4A3P A;  4MGY E;  3ML8 A;  5J18 A;  1Q1O A;  3A9J A;  3AU4 A;  4IM3 A;  2N9E B;  2DZK A;  4DK5 A;  1C3T A;  4BKG A;  1WGR A;  2XK5 A;  2ZCC A;  4HPM B;  3QQ8 B;  3RUL A;  4DDG D;  5KHO A;  5J17 A;  2V4L A;  3JSV A;  3QJZ A;  4GN1 A;  2JPH A;  4BBN F;  2XEW A;  2LZ6 A;  2HD5 B;  4F8C B;  5G2N A;  4URK A;  1ISN A;  3SU8 X;  1WRD B;  4KSL C;  4EFO A;  2GMI C;  2NBU A;  1FXT B;  4MGK E;  2K1F A;  2CHX A;  4I6P A;  5CHV C;  2W9N A;  3VUX A;  5L83 A;  4CHK A;  4KZ0 A;  1JRU A;  4YL8 A;  3V60 A;  3EFU A;  4IG7 B;  5TR5 A;  3ONS A;  3KH0 A;  1WMH B;  4W9G A;  4ANU A;  5HKH A;  4MSQ B;  4GGQ A;  4GIV A;  2KK8 A;  3B1L X;  2YVC A;  5JHA A;  2G4D B;  4XZ4 A;  2KC1 A;  2MBO A;  2MW5 A;  3PVL A;  1S1Q B;  1M94 A;  5FR6 A;  2CKH B;  1IP9 A;  3AU5 A;  3LDZ E;  1L7Y A;  2BWF A;  4HCN B;  4NJ7 A;  2KDB A;  1F9J A;  2L00 B;  3AXC A;  1LFD A;  2LD9 A;  3KUC B;  3NHE B;  4JL9 A;  1L2N A;  2N9X A;  3PZD A;  1V5T A;  1WZ3 A;  3MHS D;  2NBV B;  5LLI A;  3R7Q A;  2AEH A;  3DVG X;  2Z0E B;  5AZH A;  3ZVV A;  2O6V D;  1WX9 A;  2ZVO A;  5DPT A;  2DX5 B;  1WJU A;  3ZRC A;  1P9D U;  4GXB A;  2RR9 A;  1WGY A;  2AYO B;  2R2O A;  1RFA A;  4G50 A;  3MTN B;  2KAN A;  4BFR A;  2DAJ A;  3VUW A;  3S2A A;  1GG3 A;  2DZI A;  1WH3 A;  3B0A A;  3ZNG C;  1LXD A;  2V3S A;  3C0R B;  2M4N A;  1WMH A;  2MBH A;  4FUL A;  2ZVN A;  4W9K A;  3SHQ A;  4AJW A;  4BOS C;  2KMC A;  2M1M A;  2BKR B;  4HDQ A;  3A4S C;  4KDI C;  4IM2 A;  2MCN B;  2C7N B;  5L95 C;  4HPL B;  3MJW A;  2DYO A;  3IBE A;  3VUY A;  3WAL A;  2D11 A;  3VXW A;  2J0J A;  1GC6 A;  2PE6 B;  3ZIM A;  1V86 A;  3A9K B;  4EZJ A;  3DOW A;  3VH4 B;  2O6V A;  3PGE A;  4A20 A;  1E8Z A;  1ZGU B;  4I6N B;  3VTW A;  2KVR A;  3TJP A;  4ZDV A;  1V2Y A;  2KJR A;  4GB9 A;  1NDD A;  3NZS A;  4JQW C;  3QC8 B;  3APF A;  2BKF A;  2FCS A;  1VCB A;  4TUU A;  1H8C A;  3H6N A;  4OVV A;  5IAA C;  4GDK A;  2LVP A;  3PLV A;  5J2R A;  2DEN B;  3N30 A;  1P0R A;  4BOZ B;  1GNU A;  2A5U A;  2KJH B;  2M17 A;  2NCN A;  3CF6 E;  3L17 A;  3H1U A;  2K8H A;  3RUI B;  4FBJ B;  4F7Z A;  1WGG A;  3K9P B;  4GDL B;  3EEC A;  2RD0 A;  2C5L C;  2KD0 A;  2N7D A;  2NPT A;  4WWN A;  2KZR A;  4MGZ E;  2C60 A;  3VFK A;  3DVN V;  4EZL A;  3A33 B;  4HXD A;  1E90 A;  4OVU A;  1EF1 A;  2DZM A;  1SIF A;  3PHW B;  4JIO U;  2IO1 B;  4MEL A;  2I1J A;  2BWE S;  3A1Q A;  3L0W B;  3WAP A;  2KOX A;  3A9K A;  3M62 B;  3VVW B;  2KQS A;  2J7Q B;  4K7S A;  3UGB B;  1P3Q U;  4W9L A;  4NPN A;  3TIX A;  3X0W A;  2FIF A;  1KOT A;  3ALB A;  4B95 A;  3H7S A;  3PHX B;  5DPW A;  4GMV A;  2UWQ A;  3QK0 A;  5IA7 A;  1Y8R C;  4FJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...