1L7YA

Solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
MSGGTAATTAGSKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGVGVNPAQPAGNIFLKHGSELRLIPRDRVGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of conserved eukaryotic protein ZK652.3 from C. elegans: a ubiquitin-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN ZK652.3
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l7yA00
3WAPA 4MSQB 2DYMA 4K7SA 4W9EA 1WXVA 2KXJA 1EF5A 3LDZE 3R66C 3IFWB 1V2YA 1ZGUB 2MP2A 4W9GA 4ZRKA 2PE9A 3OJ3A 1WXSA 2CKHB 3H9DA 1TTNA 1Q5WB 1E7UA 4JL9A 5CX3A 2ZVNA 2B3AA 2UYZB 4W9DA 2KTRA 4IC7B 4DWFA 3QAQA 5D7GA 3VUYA 1OQYA 4LDTD 3QHTA 2IO1B 2XK5B 1IPGA 2OJRA 5DPRA 3VTWA 5KHQA 1C3TA 3IVFA 1Z2MA 3BINA 4F1SA 4KDLB 2AWTA 4MSMB 2O2VA 3PVLA 4MM3A 3KVFB 3JVZX 3HIZA 4IWOA 2IY1B 3JSVA 3NY5A 3RZWC 2LVOA 2RPQA 2D11A 3QWZB 5AZHA 1WXAA 2YVCA 3V6CB 2J7QB 1ZKHA 4GB9A 2HJ8A 4CYEA 3QJZA 3RCZA 3ZW3A 1H8CA 1XQQA 1A5RA 1SE9A 2KDIA 2KO3A 3PZDA 5LXIB 5DCNA 2BGFA 3VDZA 1WGGA 2BYVE 2W9NA 4HPLB 2WX1A 2FCNA 5CHWA 2G3QB 3DQVA 4IWQA 4FA6A 2EKEC 2GBKA 3DBLI 2FAZA 4EEWA 1V81A 3VH3B 4EKUA 1L2NA 3B0AA 4GIVA 1OTRB 4W9CA 2WX0A 1F9JA 2BWES 3NHEB 2FIFA 1LXDA 5L83A 2RSUA 4E74A 3C0RB 3ONSA 3DCGA 4HCNB 5D2MB 2KZRA 1T0YA 5DPTA 2RD0A 3AXCA 4JGHB 5FR6A 3PV1A 2MCNB 1UBQA 4PS7A 3VHTC 2BWFA 3PT2B 1YX6B 1RFAA 1WMHA 2LGDA 1V5TA 2JRHA 3A9KA 1VD2A 2RR9A 4WJQA 4ZRIA 3ZNHB 3M62B 5HKHA 2N1VA 3WANA 4I6PA 1YD8U 2NCNA 4FBJB 2KC2A 2KKCA 1C1YB 1BT0A 3U7DA 3IHPC 3Q3FA 1WIAA 3A9KB 2KOXA 3EFUA 3K9OB 1WYWB 4IWPA 4RM9A 3TMPB 1E8XA 1WY8A 2BYEA 2QHOA 4MJSA 2FIDA 2WDTB 4IG7B 3KYDD 1NDDA 2KD0A 2I1JA 2KMCA 4TV3A 3ZNGC 4IM2A 2KHWB 4E3CA 2ZPNA 5CHFA 4ANUA 1K8RB 2L76A 1OEYJ 2KDEB 5JZEB 1E8WA 4GSWA 4MDKE 1UELA 3PGEA 4FULA 4N9F4 4PYUA 4WWNA 2IO0B 1NBFC 4MEMA 5GMVA 2JXXA 4GOCA 2C7NB 1GNUA 1FXTB 1WE6A 4GDKB 3DVNV 4NAWB 3SD5A 4A3OA 2MLBA 4K81A 3U8ZA 2MBOA 3M63B 3HM3A 4EZLA 3IBEA 2Z0DB 2O6VD 3N32A 3ZUNA 4BKGA 4CO7A 5J2RA 4EZKA 1KJTA 3HK0A 5C23A 4HVBA 4DBGA 4GU2A 1GJZA 1WRDB 3A9JB 3MJWA 5D94A 1AARA 4KSKC 3A9JA 2LGYA 4LDTB 2GOWA 2ZVOA 4ANWA 2MSED 2BF8B 3DVGY 4EFOA 1L7YA 2ZPYA 4W9LA 3RYTA 4B9KA 2A4ZA 2JZZA 3DVNU 4NAWA 4ANXA 2LUEA 3OLMD 2KTRB 3ENEA 3RULA 4AWJA 4LJPB 2D10A 3A4RA 3JYUA 2C60A 4DHZE 2LJ5A 4B6WA 2MWSB 5DPSA 5JHBA 4F8CB 3VFKA 4EOYA 3PREA 2KLCA 4GN1A 2EMSA 4BFRA 2KLGA 1WFYA 5DPWA 2ZJDA 2CHZA 3UIOB 2MBHA 2R2QA 1GUAB 5J17A 2KN5A 4GMVA 1LQBA 3VUXA 3VH4B 4I6NB 4AJWA 3ZNZB 3PRPB 2GMIC 4MGYE 4DHZB 3L17A 3ZDTA 2JPHA 1P1AA 2L00B 4ZDVA 1CMXB 1XD3B 4WQOB 3JW0X 4KZ0A 4E71A 1ISNA 4P7IA 1P9DU 1WJNA 3PLUA 2AEHA 1WF9A 2A5UA 2ZCCA 3QX1A 4AJYB 3SDLC 4EUTA 2N4FA 2DAFA 2N1WA 1PQSA 3PLVA 3TL5A 1WE7A 4BKSA 2KVRA 1H4RA 2PJHA 4AUQC 2KJ6A 1WM3A 4ZYNA 3SU8X 3MTNB 1WM2A 2VRRB 3DBRI 2D07B 2LD9A 2NPTB 4URKA 3APDA 1M94A 2MBQA 1WH3A 2ZNVC 3DBHI 4GDLA 2O6VA 5BO4B 3R3MA 2KTFA 1P0RA 4RM8A 3S2AA 3Q3JA 2NBVB 2FCMA 3PTFC 2GBRA 2M0XA 3D32A 3LJ3A 4NQLB 3A33B 1WX9A 4F7ZA 2N7EA 4FHJA 4K7WA 2C9WB 1UD7A 4NJ6A 2L05A 3WA0A 4WJOA 5CTRC 4TQ0A 2KQSA 5G2NA 3VTVA 2BKRB 2LASA 3UQAA 2DZJA 4GDKA 3QQ8B 3VTUA 1LM8B 2DHZA 2KWCA 1V5OA 3PHXB 4PYZA 4LCDE 4WJNA 1WJ6A 3KH0A 4I6LB 5LXHA 4XC2A 2CHXA 1Y8RC 4WWOA 3UF8A 2L8JA 3ZRCA 2HD5B 4HLEA 4HWIB 4AP4C 4XZ4A 1V9JA 4WWPA 3RD2A 3EC8A 1J8CA 4FJVB 2EMTA 1UBIA 2MA9B 2DZKA 1YIWA 1WJ4A 3EECA 3JSVB 2IZVB 2L0TA 1NI2A 1UZXB 3H6NA 3A4SC 4HXDA 1HE8A 2O2VB 3R7RA 3OJ4B 2GBJA 2K39A 4IUMB 1R4NI 2O6VB 1KM7A 2K25A 4II3B 2DYBA 1LFDA 4IM3A 4MH0E 1I35A 2XK5A 4G50A 2NPTA 4MJSB 3VQIA 1E90A 4MGZE 1OGWA 4G0NB 4HK2A 1WR1A 2K8HA 3PRMB 1WGHA 1WXMA 4BBNC 2CR5A 4DDGD 4HDQA 4K7UA 2PE6B 1JRUA 2KMAA 3KUZA 1WJUA 3HM6X 1G6JA 1V86A 2JRIB 2K8BA 4NPNA 3H1UA 4BKSD 2ZNVB 3T8MA 1J19A 1R4MI 5E6OA 3ZTCA 2KC1A 3WALA 3L54A 3GOEA 4G3XB 2KANA 2DX5B 3CSTA 1WMHB 2N7DA 3PHWB 5LLIA 4ZRJA 2LZ6A 2NVUI 4HCPB 2D2QA 4J6IA 5G55A 2JF5A 2NBWB 3PS6A 2KQ7A 2MBBB 3W1SA 2IBIB 4KDIC 2M4NA 3K9PB 4KIKA 2ZCBA 2IYDB 3L0WB 2GBMA 4KZCA 2LWPA 3VXWA 1X1MA 1WZ3A 3PPAA 4DK5A 1TBEA 4FJYA 5EDSA 1IYFA 4OVVA 1Q1OA 2K8CA 4NY0A 3VUWA 1WI0A 2YLMA 3HHMA 3KUCB 2KDFB 3M95A 1OEYA 2LI5A 2NS5A 2KWVB 3AU5A 3ML9A 5AZFA 2IO3B 2PPHA 4PS8A 3KUDB 2LXCA 2K6QA 3N3KB 3R7QA 2DZIA 2NBUA 1YQBA 5KHOA 1MG8A 3EHVA 1D3ZA 2WWZA 1WGYA 2JVCA 1KLVA 3V62A 3TIXA 4II2B 3H7PB 4M8NA 2K6DB 5AEKB 1EF1A 2R2OA 1UH6A 4LJOB 3ZVVA 3P2BA 2BKFA 2RGFA 3CF6E 3DVGX 2KX0A 2AL6A 2DENB 2FNJB 1TGZB 2JZ3B 4XX5A 3X23A 2LVPA 4A20A 2J0MA 5AZGA 2HTHA 3NZUA 3UINB 2JT4B 3QARA 1YJ1A 5IAAC 2N9XA 2REXA 1GG3A 1RLFA 4G11A 2G45B 2AL3A 3AI5A 4PS3A 5E6PA 3ZRFA 1WGDA 3I3TB 2MW5A 5TR5A 3VAWA 3UQBA 3ECIA 1GC7A 2C5LC 2J0KA 3NOBA 4IW0A 3ALBA 3X0WA 4BOSC 2BPSA 2M8SA 1WZ0A 4NJ7A 2C7MB 4FJZA 4FLHA 3DBSA 1UGMA 2C7HA 2DYOA 3ZDMC 3KW5B 2N9EB 3NZSA 3L13A 3WAMA 2PEAA 4KIKB 1WX8A 2GBNA 1E8YA 1QZEA 2BYFA 2KDBA 4A3PA 2IY0B 2FCSA 2NR2A 3IG3A 2WYQA 2LRUA 3A1QB 2FUHB 2KNBA 2M1MA 1WGRA 1RRBA 3CMMB 3RZFA 3B08A 2N9PC 3CSFA 1ZW7A 2M17A 4JQWC 4W9JA 3TJPA 3AU4A 1E7VA 4BOZB 4BVUC 1SIFA 2ZEQA 2AYOB 3T9LA 2KK8A 4CHKA 1E8ZA 2Y5BB 3PSEB 4JLCA 5CHVC 4AOFA 2L3ZA 1EO6A 3DPDA 4DDID 1E5WA 4KV2A 4FADA 2JUOA 4FN2A 2LVQA 4YL8A 1V80A 1KOTA 4W9HA 4RMAA 4KVGB 3RT3B 2L0FA 3BY4B 4NNJB 3OAWA 3L16A 5JHAA 5J18A 2KFJA 3UIPB 3L10B 2Z0EB 2KJHB 3UGBB 2LRWA 3DOWA 1SGHA 4ICUA 1S1QB 2DAJA 2KJRA 4EZJA 3QA8A 3L08A 3V61A 2V3SA 4DHJB 4JIOU 3WIMA 3QIJA 2J0JA 4ANVA 4DHJD 3O65B 4IM0A 3W1SC 4TUUA 3TCAA 3V60A 2CHWA 2XEWA 4GXBA 2D3GA 4HJKA 1V6EA 1YX5B 2HE7A 2MRPA 4TQ1A 5E6NA 5IA7A 4HDOA 2UWQA 4GGQA 4NQKE 3ZO5B 2G4SA 3WAOA 2CS4A 5JH5C 1Q0WB 2LGXA 3QC8B 1V49A 4MELA 3DDCB 4MGKE 4WAAA 4BBNF 5L95C 1WX7A 3QCAA 2I1KA 2Z59B 1IP9A 4W9KA 3TBLD 4DXAB 3QK0A 3KYCD 3V6EB 1Z5SB 1P98A 2DZMA 3H7PA 3MHSD 2G4DB 4WJPA 4X57B 3ZLZA 1EUVB 4HPMB 3ML8A 3N30A 2V4LA 1I42A 4GDLB 2V1YA 4ASWC 3M3JA 2IO2B 2OOBB 3W1YA 4B95A 4MGIE 2KX3A 3SHQA 4W9FA 3B1LX 3PRZA 2ASQA 4W9IA 2MBEA 1U4AA 2ZZPB 3NS8A 3H7SA 3APFA 2FCQA 1GC6A 3RUIB 4OVUA 1P3QU 4K1RB 2K1FA 2MP2B 4TKNA 3GZNI 3APCA 4M0WB 5C1ZA 2JY6A 4FHKA 2JWZA 3ZKJC 3ZNID 2L7RA 2MQJA 1VCBA 1J0GA 4BKTA 2LXAA 2KFKA 1WR6E 3A1QA 2CU1A 2MX2A 5D6JB 4M8MA 3ZIMA 2XBBC 1XT9B 3ZTDA 3VVWB 3AULA 1TZ1A 3U30A 1S3SG 4KSLC 1RAXA 2KWUB 4ICVA 2KFKB
chains in the Genus database with same CATH superfamily
4K7SA 3H8HA 1WXVA 2PIAA 1MHHE 3IFWB 3J9CA 2M19A 2PE9A 3OJ3A 1WXSA 1TTNA 1Q5WB 3SEBA 3TSSA 2KTRA 3AEDB 4DWFA 1OQYA 3IVFA 1UF0A 3BINA 4F1SA 2AWTA 3P4QB 1B1ZA 2LVOA 4TSSA 5H8YE 3R8BA 2LGSA 4GB9A 1FCLA 1PGXA 4CYEA 1HZ5A 2AQ1B 2BGFA 5DCNA 1WGGA 4HPLB 1VZ8A 2G3QB 1T0SC 2M56B 1L2NA 4RNAA 2D5GA 2BWES 3NHEB 4WWMA 2RSUA 2WGSA 2KZRA 2W3RA 1UWMA 1T0YA 4XWTA 2WU5B 3AXCA 4XE0A 2MCNB 1V97A 1EWYC 1IGCA 2BWFA 4WJQA 1RFAA 2RR9A 4YSZB 5HKHA 1SEBD 2WXFA 2KKCA 1BT0A 3U7DA 3Q3FA 1WIAA 3HVZA 1WYWB 1ACCA 1RYJA 2FIDA 2WDTB 3KYDD 4L2YA 4AS1A 3FILB 2CU3A 3AEAB 4E3CA 4IM2A 1OEYJ 3EUB2 3ZXVA 2J4XA 4MDKE 3BVMA 4FULA 4PYUA 5GMVA 2JXXA 2C7NB 4GDKB 3Q2AC 3AEEB 3DWGC 2GI9A 2Z0DB 2O6VD 4CO7A 2TSSA 4K3BA 1VR9A 1UGJA 4A90A 4KSKC 3NJTA 2GOWA 1FEHA 2MSED 2BF8B 2HJ1A 3DVGY 5AUKA 3C19A 2JZZA 3DVNU 3RULA 4AWJA 2FBWB 3JYUA 2C60A 4C80A 2MWSB 4F8CB 3VFKA 1LGRA 4O1NA 2KLCA 4XDDA 2WDRB 5DPWA 2BBCA 2MBHA 1QOBA 4JWSC 2R2QA 2KN5A 4GMVA 3E9SA 2MEKA 3ZDTA 2JPHA 2L00B 1N60A 1NVID 1CMXB 4KKJA 3JW0X 4KZ0A 3QX1A 4WAFA 1XLPA 2KT7A 1PQSA 1NYRA 4BKSA 1E0ZA 5IN7A 1H4RA 2Y5PA 3BWUD 2WNMA 4XDCA 2E6XA 2NPTB 4YWGG 1M94A 3BK1A 4YXDB 4NJCA 1MG4A 4HJGE 3R3MA 2QSDA 2WXMA 4S17A 1F1HA 2GBRA 5C2TB 3LJ3A 1FFUA 3N1YC 3A33B 1WX9A 4F7ZA 3EGRA 2WDVB 4WJOA 2PVGC 1FFVA 5BMGA 2LASA 5FKAC 3UQAA 2DHZA 2KWCA 4LCDE 1WJ6A 2CHXA 2L8JA 2KQ4X 1M4VA 4AP4C 3RD2A 3EC8A 4FJVB 2EMTA 1UBIA 2MA9B 3IXSA 2L0TA 2WP9B 2O2VB 3R2TA 2K39A 1R4NI 1KLGD 4IM3A 2XK5A 4MJSB 3VQIA 1E90A 1QOGA 1OGWA 4RH6A 3PRMB 2K8HA 1T3QA 2L1AA 1I4RA 3NVZA 1F2RI 3P63A 2ONQA 4MT5A 2K8BA 1D5XC 1JALA 2JRIB 1R4MI 5E6OA 2N7JA 2KC1A 1OFFA 5LLIA 3AECB 4J6IA 1E7PB 3AE5B 2KQ7A 1TKEA 2L32A 3W1SA 1ZXIA 3IAM1 1KTKA 2IBIB 4KDIC 3K9PB 4AQ7A 1WGKA 3GE3C 1AW7A 4ZRQA 2D3AA 3P4RB 3RNGC 5T8IA 2IYDB 1X1MA 4DK5A 1TBEA 4OVVA 1Q1OA 1WI0A 3M95A 2V3PA 4NAMA 3ML9A 5AZFA 1KH0A 4PS8A 2KN4A 3GP7A 2DZIA 2INPE 5HI1A 3P2BA 3DVGX 2FNJB 3X23A 2LVPA 3VR8B 1WXQA 2MJDA 3NZUA 3U4EG 4ZYSA 4G11A 1UWXA 1YJIA 1STEA 1EM7A 3UQBA 3AMZA 1GC7A 2WS3B 1V1OA 4DXFA 2DYOA 3KW5B 3W5UB 4L23A 4K3CA 2KDBA 4A3PA 3IG3A 3A1QB 1CK1A 5D3IB 2LFIA 1DGJA 1E7VA 2ZEQA 2AYOB 2WXHA 2GRIA 3T9LA 4CHKA 4JLCA 2L3ZA 3DPDA 1E5WA 2JYEA 4YL8A 3GB1A 1SJHD 1P7EA 1V80A 4W9HA 3RT3B 2L0FA 3UIPB 3L10B 3P1MA 2Z0EB 4DHJB 1DOYA 5BYSA 1FPYA 2J0JA 4DHJD 4IM0A 3W1SC 2JWUA 3RNAC 3TCAA 4A6QA 2J42A 4A8XC 2CHWA 4P6VF 1V6EA 1YX5B 2INCC 3WAOA 2CS4A 1Q0WB 4MELA 3DDCB 3MJ5A 1WX7A 3AE9B 3AE6B 3MHSD 4RGOS 2MH7A 3ZLZA 4HPMB 2V4LA 2PVOD 3KLSX 3RNBC 1HA5A 4B95A 3W2DA 1TKYA 1C9FA 1QQRA 5BMHA 4W9IA 1U4AA 1V1PA 1QKZA 3APFA 3NVWA 3AB5A 1P3QU 2GB1A 1BUIC 2V4IB 4M0WB 5C1ZA 3ZKJC 4BKTA 2KFKA 3A1QA 1WR6E 4N59A 4M8MA 2XBBC 1XT9B 1S3SG 1D4BA 2IPKD 2EKIA 2WXOA 2DYMA 4OZBA 5EE3A 1VRAB 1EF5A 1XXGA 2WU2B 3LDZE 3R66C 4M02A 3NVVA 1FRDA 1E7UA 2ZVNA 4W9DA 3AE1B 1IBXA 2RDGA 4NZLB 1Z2MA 1JWSD 4MM3A 3DBLB 3HIZA 1WYGA 2MHJA 3RZWC 1K50A 3P4SB 1WXAA 2YVCA 1T0QC 1TY2A 2J7QB 3QJZA 3PZDA 3VDZA 2BYVE 2HDEA 2W9NA 2WX1A 1I4PA 4RCOA 4IWQA 4FA6A 2GBKA 2FAZA 4EEWA 3VH3B 5C3JB 5G5HA 5H92C 1TS4A 4B0MA 5L83A 4E74A 3C0RB 3DCGA 3HUIA 4YTNB 5FK9C 5D2MB 2KACA 3U52E 1VLBA 1JQ4A 1CZPA 3VHTC 2LGDA 1V5TA 1VD2A 4ZHOA 4I6PA 2NCNA 3EFCA 4FBJB 2KC2A 4PT5A 3IHPC 4RM9A 1N6ZA 3TUOA 1RFKA 1WY8A 2BYEA 2QHOA 4MJSA 2I1JA 2KHWB 4IKGA 2OJWA 4LNIA 1YQ4B 1K8RB 1I4XA 2KDEB 2WXKA 4WWNA 2IO0B 5IO9A 2KMMA 4GOCA 1JCKB 1XLQA 3VRBB 1FXTB 1WE6A 1FXAA 4A3OA 3AEBB 1WRIA 4EZLA 3ZUNA 5J2RA 2UU7A 4KGRA 1GJZA 4CQNA 1AARA 3Q6BA 3A9JA 2LGYA 2ZVOA 2LGIA 4ANWA 5E6JA 4W9LA 4OW0A 4NAWA 4B0EA 1LO5D 3A4RA 2LJ5A 2PLPA 1KLUD 1V8CA 1FNWA 5DPSA 3N20C 4EOYA 1C77A 2EMSA 4HKZE 1I4QA 1WFYA 3LYYA 1GUAB 1ZPSA 2FE8A 3VRAB 4DHZB 1Y56A 1XD3B 4E71A 3PLUA 2AEHA 1WF9A 2ZCCA 3SDLC 2G9HD 1TS5A 2K9XA 1WE7A 1TKGA 1V1PB 2KVRA 2JZPA 2QIEB 2KDMA 2BTEA 1FM0D 1WM2A 1XLOA 2K0PA 4URKA 3APDA 1K53A 1C4PA 3Q3JA 1AWDA 2NBVB 2FCMA 3Q8FA 4NQLB 2OEDA 2WXLA 2DNFA 2N7EA 4K7WA 4PK1A 2L05A 3BK2A 2KQSA 2W3SA 4GDKA 3QQ8B 1LM8B 3KH0A 4I6LB 3UF8A 1Y8RC 2DBYA 4WWOA 3ZRCA 1YN5A 4HWIB 1GB1A 4M00A 1J8CA 1YIWA 4UDUC 3JSVB 1QOAA 2IZVB 4C7YA 3H6NA 1HE8A 3R7RA 4JE3B 2NMQA 4MH0E 5IP4D 2NTSA 3I57A 4G0NB 1WXMA 4BBNC 2CR5A 4HDQA 3AE8B 3V3XA 3KUZA 4NPNA 4LNFA 2ZNVB 3T8MA 3WALA 5AUIA 2KANA 3CSTA 2N7DA 2EELA 1PGAA 2LZ6A 4HCPB 2D2QA 2NBWB 1N61A 2MBBB 2V3NA 2PTLA 2H89B 2M4NA 4ARCA 1ZE3D 3U7ZA 2GBMA 3VXWA 4FJYA 3Q8CA 1JW9D 4YTPB 3KUCB 2KDFB 3AU5A 2PPHA 3N3KB 3R7QA 3IAS1 1JWUD 1OQRA 1D3ZA 1KLVA 4D2KA 3N1ZC 4II2B 3H7PB 2K6DB 1Q10A 1UH6A 4LJOB 3CF6E 2KX0A 1FMAD 1KF6B 4XX5A 1L0YB 2HTHA 4US9A 3W5VB 3ZJVA 3UINB 3QARA 2N9XA 2ON8A 3BZDB 1RLFA 3AI5A 1WSPA 2JXTA 3I3TB 2MW5A 3VAWA 1SE4A 2C5LC 2I38A 4BOSC 3X0WA 4TMAB 1VZ7A 3FKYA 4FJZA 2AX5A 2C7HA 3ZDMC 1BMLC 3L13A 2GBNA 2YEPB 1E8YA 3KQ4A 3SR6A 2LRUA 2FUHB 3CMMB 3TJPA 3AU4A 1OQQA 3MC0B 4BOZB 1SIFA 3PSEB 5CHVC 4AOFA 4N58A 4DDID 3PZ8A 4REZA 3URYA 2JUOA 1FIQA 1UUPA 4KVGB 1XCQL 3OAWA 3L16A 5JHAA 5J18A 4WURA 1R4NB 3MFGA 1XEEA 1ZXHA 1SGHA 4ICUA 1S1QB 3L08A 2DWQA 3QIJA 4ANVA 1ENFA 4GXBA 2VZKB 2W54A 5E6NA 4P16A 4TQ1A 2Y5CA 5JH5C 1DYQA 3QCAA 2Z59B 3RI7C 4W9KA 3TBLD 1WWTA 3BIID 3MC9A 3V6EB 2W82A 2WHIA 3H7PA 2AQ2B 3RPFC 1EUVB 3N30A 3PZ7A 1I42A 4WH4A 1IBXB 4ASWC 3C8YA 4HROA 2OOBB 3W1YA 3DBHB 2KWDA 4RGMA 2HTME 3NS8A 3B2FA 2FCQA 3T3OA 1FD6A 4MACA 4TKNA 4HPPA 2JY6A 4BZAA 2JWZA 3ZNID 3T3NA 2MQJA 2ICIA 1L6UA 2LMCA 1YQ3B 1ZOYB 2MX2A 1JRPA 3I5JC 3AULA 3U30A 1SE3A 2KFKB 2XNAC 2JU6X 4MSQB 4W9EA 1MFWA 2L52A 1V2YA 1XLNA 4W9GA 4XYCA 1NEKB 2CKHB 1SF0A 3BYYB 4JL9A 5CX3A 1MPEA 1QILA 1FO4A 2CJOA 3VUYA 2IO1B 4ITKA 1IPGA 2OJRA 3VTWA 1C4CA 4KDLB 4MSMB 3PVLA 4IWOA 2IY1B 3JSVA 3NY5A 2RPQA 2D11A 5AZHA 1SXTA 3V6CB 1ZKHA 2HJ8A 3ZYYX 3RCZA 1PFDA 3ZW3A 2OHFA 1H8CA 2L83A 1A5RA 1SE9A 5LXIB 2EKEC 3B0AA 4GIVA 2BVCA 2WX0A 1HTOA 4P1BC 2FIFA 2VZKD 4KX6B 2V9HA 2QCZA 5FR6A 4JGHB 4LNNA 3PV1A 1UBQA 4PS7A 4LTUA 4GLSC 5HG2A 3PT2B 1YX6B 1WMHA 1NYQA 4ZRIA 1EU3A 3AE3B 1TY0A 1CJEA 3U2SC 3BVGA 3TEXA 3ZGZA 1YD8U 1C1YB 2INDC 2KOXA 3EFUA 3RNCC 1E8XA 1VZ6A 1VDVA 2SEBD 1NDDA 3Q3OC 3Q8EA 1SSNA 1N5XA 1F52A 2KMCA 1TT5B 3OG5A 2ZPNA 5CHFA 4ANUA 1KRHA 2L76A 3RN9C 4YSXB 5JZEB 1E8WA 1YMHE 3E56A 3Q3MC 4N9F4 1HZ6A 1NBFC 3DVNV 4NAWB 2MLBA 2W55A 4K81A 2MBOA 2X38A 2WXGA 3HK0A 3LB8C 4DBGA 3A9JB 1FNVA 2MJ3A 2QMTA 1KFYB 4LDTB 3W9CB 5I4DA 2IJ0A 4EFOA 1L7YA 3RYTA 4ANXA 2KTRB 2M0AA 3ENEA 4LJPB 2D10A 2IDYA 1GB4A 4DHZE 2E3TA 4B6WA 4LLGM 5JHBA 5EE1A 3ABVB 3PREA 3B2GA 4BFRA 1D6EC 1YN3A 3AV8A 1QF6A 1T5XD 2ZJDA 5IKCM 3UIOB 5J17A 3VH4B 4I6NB 3ZNZB 3PRPB 4MGYE 4ZDVA 3L17A 5FR3A 1P1AA 3Q8BA 1IGDA 4WQOB 4P7IA 1WJNA 2A5UA 1XF5L 4EUTA 2DAFA 2N1WA 3NVYA 2JSVX 2VH1A 1WM3A 3MTNB 1N63A 1NENB 4GDLA 1UNSA 2ZNVC 3DBHI 2KTFA 1P0RA 4RM8A 3S2AA 4IDIA 1MI0A 1GOZA 2M0XA 1MVKA 2BB6A 4FHJA 4J3OD 3DWMA 2C9WB 1P7FA 2D3CA 4TQ0A 5G2NA 2NTTA 3VTUA 3R2IA 3OWEB 5LXHA 4XC2A 5JXVA 3SFEB 4HLEA 4XZ4A 1V9JA 4KGTA 2DLBA 1DOIA 1F77A 3TEWA 1TS3A 1WJ4A 3EECA 2RDBC 1NI2A 4MM3B 3A4SC 4HXDA 3CWIA 2K25A 1B9RA 1I4HA 2DYBA 1I35A 1YJJA 2NPTA 4HK2A 1WR1A 1WGHA 4K7UA 2PE6B 1TJEA 3HM6X 1V86A 2JYTA 4N6EB 2GLSA 3GOEA 4G3XB 2FUG1 4ZRJA 2NVUI 2JF5A 4Q2JA 1PDXA 4A55A 4EE2A 4KIKA 1MJDA 1L0VB 4KZCA 2LWPA 2K3UA 1WZ3A 2K8CA 4M0WA 1BXTA 1AN8A 3HHMA 1OEYA 2LI5A 2KWVB 1PGBA 3WCQA 3KUDB 2NBUA 1AYFA 1YQBA 1ZDVA 2XN9C 1MG8A 2WWZA 1WGYA 1E6EB 3V62A 5AEKB 1EF1A 5LNK1 3ZVVA 2BKFA 2RGFA 3AH7A 3P42A 3IT6B 4ACFA 4A20A 3NUHB 2J0MA 5MPOA 4YSYB 1ZUD2 3KWVA 2LJIA 1YN4A 4PS3A 3AN1A 3ZRFA 1T0RC 5TR5A 3NOBA 3ALBA 2BPSA 2M8SA 1WZ0A 1MHXA 2BS3B 4FLHA 1R7SA 2C7MB 1XO3A 3DBSA 1UGMA 3MHZA 4BAXA 3WAMA 2JQRB 2BYFA 2N9KA 2FCSA 2WYQA 1TS2A 2KNBA 2IGGA 2M1MA 3NS1A 3AE7B 3CIRB 3B08A 1ZW7A 3HRDD 4W9JA 2IGDA 4H2AA 2KK8A 1E8ZA 4KV2A 4FADA 1FRRA 4FN2A 2LVQA 3IT4B 3V05A 3NRZA 3Q3NC 1L4DB 4RMAA 2V0GA 3ETRA 4NNJB 4OZCA 1SIJA 1SE2A 2BYTA 2KJHB 5BYQA 2LRWA 2RDHA 3NG0A 3GZNB 3QA8A 3V61A 1JROA 5IOIA 1PUTA 2JX5A 2XEWA 2D3GA 3P4PB 4HJKA 4GGQA 4NQKE 2LGXA 1SB3C 1V49A 1R4MB 2I1KA 1IP9A 3KYCD 2DZMA 1QLBB 3ML8A 2V1YA 1ET9A 2IO2B 4MGIE 2KX3A 4LK0M 3SHQA 2BQQA 3B1LX 3B9JA 2ZZPB 3NZ3A 1F2RC 1GC6A 3RUIB 4OVUA 1SBBB 3GZNI 5G5GA 1F0ZA 3MP9A 3AM9A 4HKQA 2QC8A 3ZIMA 2CU1A 3ZTDA 2Y3AA 4OVZA 3VVWB 3UI3A 1TZ1A 2WDQB 4KSLC 2D3BA 2KWUB 4ICVA 3WAPA 1I7HA 2KXJA 1ZGUB 2MP2A 4ZRKA 2N0SB 3DHHC 3H9DA 2BB5A 2B3AA 2UYZB 1A70A 2LEKA 4IC7B 3QAQA 5D7GA 2J53A 4LDTD 3QHTA 3RNFC 2XK5B 5DPRA 5KHQA 1C3TA 2LHEA 2O2VA 3KVFB 3JVZX 2WXJA 3QWZB 2WXNA 2QDFA 3AEGB 3RFZB 2WXPA 1XQQA 2KDIA 2KO3A 5CHWA 2FCNA 3DQVA 3DBLI 1V81A 2CJNA 4EKUA 1OTRB 4W9CA 1F9JA 2KVZA 1LXDA 3ONSA 4HCNB 3ZQ4A 3N9YC 1RM6C 5DPTA 3RMKC 2RD0A 3TEZA 3EA6A 1HQRD 2Q5WD 3LXFA 1C79A 2JRHA 3AEFB 3A9KA 3ZNHB 3AE2B 3M62B 1DOXA 4RGTA 2N1VA 3WANA 1FXIA 2MJEA 4WQMA 4S0RA 1K52A 3Q14C 3A9KB 3K9OB 3TMPB 4IWPA 3DHIC 4IG7B 2RPVA 3RNEC 1L5PA 4RF0A 1YOVB 2KD0A 3I63C 5GXGB 3ZJTA 4TV3A 3ZNGC 2K5PA 1HXYD 4US8A 4GSWA 1JWMD 4KGSA 2I2YA 1UELA 3PGEA 3SFDB 4MEMA 1TYGB 1GNUA 2SAKA 3SD5A 1ZDXA 1K51A 3U8ZA 3M63B 3HM3A 4YT0B 3IBEA 3N32A 4BKGA 4EZKA 1KJTA 3Q69A 5C23A 1ZP0B 4HVBA 4GU2A 1WRDB 3MJWA 5D94A 3GE8C 1J7CA 4M01A 5EE0A 2ZPYA 1E9MA 4B9KA 2A4ZA 2LUEA 3OLMD 4C56C 2N9LA 1JWBD 1HEZE 1XCTL 4ARIA 2KAJA 1QT9A 4GN1A 4RGNA 3FAHA 2KLGA 2CHZA 4LNOA 1GPXA 4OHJA 1EU4A 3FILA 2QEJC 1LQBA 3VUXA 4AJWA 2GMIC 2ZW1A 4HEA1 5BYRA 1ET6A 4USAA 1C4AA 1ISNA 3TEYA 1P9DU 4AJYB 2N4FA 2PW9A 3PLVA 5HHDG 3TL5A 4XGAB 2PJHA 4AUQC 1RWSA 2KJ6A 4ZYNA 3SU8X 2VRRB 3DBRI 2D07B 2LD9A 2INNE 2BS2B 4C4VA 2MBQA 1WH3A 3BVZA 2O6VA 5BO4B 2LHDA 1VJKA 3PTFC 3N1XC 3D32A 4RFBA 3HVDA 1UD7A 3DHGC 4NJ6A 3WA0A 4XWWA 4P1CC 2WXIA 5CTRC 3VTVA 2BKRB 2DZJA 4A9AA 1V5OA 3PHXB 4PYZA 4WJNA 1YNTE 2ACZB 2HD5B 4WWPA 2DZKA 2WLBA 1UZXB 3OJ4B 2GBJA 4IUMB 1L6VA 2O6VB 3DBRB 1KM7A 4II3B 1LFDA 4C4VB 4G50A 4ZHPA 4MGZE 3Q8AA 4DDGD 2H88B 1JRUA 2KMAA 1WJUA 1G6JA 3FC4A 3H1UA 4BKSD 1J19A 1C76A 3ZTCA 1ESFA 3L54A 1D5MC 2DX5B 1WMHB 3PHWB 3ZJUA 5G55A 2PMVA 2IGHA 3PS6A 1N5WA 2ZCBA 3L0WB 3PO0A 3L4PA 1TZOA 3PPAA 4FXCA 5EDSA 1IYFA 2AQ3B 4NY0A 3VUWA 2YLMA 5HFYA 2NS5A 2IO3B 2LXCA 1ROEA 2K6QA 2ZW0A 4OZAA 5KHOA 3EHVA 2WXQA 2Z8LA 2JVCA 4YTMB 4L1BA 3TIXA 3ZXRA 4M8NA 2K22A 2R2OA 2AL6A 2DENB 1TGZB 2JZ3B 1J7AA 1SJED 2WQYB 5AZGA 3I9V1 4DXGA 4JX1C 2JT4B 5IAAC 1YJ1A 1JWAD 1L0XB 2REXA 1GG3A 2X8XX 2G45B 2AL3A 4IOIE 5E6PA 1FNUA 1NI3A 1WGDA 1D5ZC 4IW0A 3ECIA 2QJLA 2J0KA 2PKOA 4DQOC 2KYWA 4NJ7A 1TIFA 2N9EB 3NZSA 5EE9A 2B76B 2PEAA 4KIKB 1WX8A 1QZEA 2G1EA 2IY0B 2NR2A 3BYTB 1WGRA 1RRBA 4ZRPA 3RZFA 2N9PC 3CSFA 3VR9B 2M17A 4JQWC 2YEPF 1CQVA 4RF1A 4BVUC 4JWUC 2Y5BB 2WXRA 2J52A 1EO6A 1EWCA 1E10A 2BS4B 1KOTA 2RMMA 3BY4B 4R3DA 2KFJA 2R61A 1JMLA 1T6BX 3UGBB 4ZOHC 3DOWA 2KJRA 2DAJA 4EZJA 2V3SA 4JIOU 3WIMA 2BW2A 1L4ZB 3GS2A 3O65B 4QAYA 4TUUA 4KKIA 3V60A 1FCCC 1C78A 2MRPA 2HE7A 5IA7A 4HDOA 2UWQA 3ZO5B 2G4SA 4MGKE 3QC8B 1GAQB 4BBNF 5L95C 4WAAA 1HTQA 1QOFA 2BT6A 4C7ZA 1I4GA 4DXAB 3QK0A 3KWLA 1Z5SB 1P98A 4WIPA 4MH8A 2G4DB 4WJPA 4X57B 2VH2A 4GDLB 1PYWD 3M3JA 1N62A 2QILA 4JPSA 2LUMA 4W9FA 3PRZA 2ASQA 2MBEA 3H7SA 3AE4B 4K1RB 2K1FA 2MP2B 3APCA 1J7BA 5TSSA 3O13A 4FHKA 2L7RA 1VCBA 1J0GA 2LXAA 4HRSA 3MC8A 1IUEA 5D6JB 5D3DA 4C00A 4LNKA 1RAXA 5BMIA
chains in the Genus database with same CATH topology
3WAPA 4MSQB 2DYMA 4K7SA 4W9EA 1WXVA 2KXJA 1EF5A 3LDZE 3R66C 3IFWB 1V2YA 1ZGUB 2MP2A 4W9GA 4ZRKA 2PE9A 3OJ3A 1WXSA 2CKHB 3H9DA 1TTNA 1Q5WB 1E7UA 4JL9A 5CX3A 2ZVNA 2B3AA 2UYZB 4W9DA 2KTRA 4IC7B 4DWFA 3QAQA 5D7GA 3VUYA 1OQYA 4LDTD 3QHTA 2IO1B 2XK5B 1IPGA 2OJRA 5DPRA 3VTWA 5KHQA 1C3TA 3IVFA 1Z2MA 3BINA 4F1SA 4KDLB 2AWTA 4MSMB 2O2VA 3PVLA 4MM3A 3KVFB 3JVZX 3HIZA 4IWOA 2IY1B 3JSVA 3NY5A 3RZWC 2LVOA 2RPQA 2D11A 3QWZB 5AZHA 1WXAA 2YVCA 3V6CB 2J7QB 1ZKHA 4GB9A 2HJ8A 4CYEA 3QJZA 3RCZA 3ZW3A 1H8CA 1XQQA 1A5RA 1SE9A 2KDIA 2KO3A 3PZDA 5LXIB 5DCNA 2BGFA 3VDZA 1WGGA 2BYVE 2W9NA 4HPLB 2WX1A 2FCNA 5CHWA 2G3QB 3DQVA 4IWQA 4FA6A 2EKEC 2GBKA 3DBLI 2FAZA 4EEWA 1V81A 3VH3B 4EKUA 1L2NA 3B0AA 4GIVA 1OTRB 4W9CA 2WX0A 1F9JA 2BWES 3NHEB 2FIFA 1LXDA 5L83A 2RSUA 4E74A 3C0RB 3ONSA 3DCGA 4HCNB 5D2MB 2KZRA 1T0YA 5DPTA 2RD0A 3AXCA 4JGHB 5FR6A 3PV1A 2MCNB 1UBQA 4PS7A 3VHTC 2BWFA 3PT2B 1YX6B 1RFAA 1WMHA 2LGDA 1V5TA 2JRHA 3A9KA 1VD2A 2RR9A 4WJQA 4ZRIA 3ZNHB 3M62B 5HKHA 2N1VA 3WANA 4I6PA 1YD8U 2NCNA 4FBJB 2KC2A 2KKCA 1C1YB 1BT0A 3U7DA 3IHPC 3Q3FA 1WIAA 3A9KB 2KOXA 3EFUA 3K9OB 1WYWB 4IWPA 4RM9A 3TMPB 1E8XA 1WY8A 2BYEA 2QHOA 4MJSA 2FIDA 2WDTB 4IG7B 3KYDD 1NDDA 2KD0A 2I1JA 2KMCA 4TV3A 3ZNGC 4IM2A 2KHWB 4E3CA 2ZPNA 5CHFA 4ANUA 1K8RB 2L76A 1OEYJ 2KDEB 5JZEB 1E8WA 4GSWA 4MDKE 1UELA 3PGEA 4FULA 4N9F4 4PYUA 4WWNA 2IO0B 1NBFC 4MEMA 5GMVA 2JXXA 4GOCA 2C7NB 1GNUA 1FXTB 1WE6A 4GDKB 3DVNV 4NAWB 3SD5A 4A3OA 2MLBA 4K81A 3U8ZA 2MBOA 3M63B 3HM3A 4EZLA 3IBEA 2Z0DB 2O6VD 3N32A 3ZUNA 4BKGA 4CO7A 5J2RA 4EZKA 1KJTA 3HK0A 5C23A 4HVBA 4DBGA 4GU2A 1GJZA 1WRDB 3A9JB 3MJWA 5D94A 1AARA 4KSKC 3A9JA 2LGYA 4LDTB 2GOWA 2ZVOA 4ANWA 2MSED 2BF8B 3DVGY 4EFOA 1L7YA 2ZPYA 4W9LA 3RYTA 4B9KA 2A4ZA 2JZZA 3DVNU 4NAWA 4ANXA 2LUEA 3OLMD 2KTRB 3ENEA 3RULA 4AWJA 4LJPB 2D10A 3A4RA 3JYUA 2C60A 4DHZE 2LJ5A 4B6WA 2MWSB 5DPSA 5JHBA 4F8CB 3VFKA 4EOYA 3PREA 2KLCA 4GN1A 2EMSA 4BFRA 2KLGA 1WFYA 5DPWA 2ZJDA 2CHZA 3UIOB 2MBHA 2R2QA 1GUAB 5J17A 2KN5A 4GMVA 1LQBA 3VUXA 3VH4B 4I6NB 4AJWA 3ZNZB 3PRPB 2GMIC 4MGYE 4DHZB 3L17A 3ZDTA 2JPHA 1P1AA 2L00B 4ZDVA 1CMXB 1XD3B 4WQOB 3JW0X 4KZ0A 4E71A 1ISNA 4P7IA 1P9DU 1WJNA 3PLUA 2AEHA 1WF9A 2A5UA 2ZCCA 3QX1A 4AJYB 3SDLC 4EUTA 2N4FA 2DAFA 2N1WA 1PQSA 3PLVA 3TL5A 1WE7A 4BKSA 2KVRA 1H4RA 2PJHA 4AUQC 2KJ6A 1WM3A 4ZYNA 3SU8X 3MTNB 1WM2A 2VRRB 3DBRI 2D07B 2LD9A 2NPTB 4URKA 3APDA 1M94A 2MBQA 1WH3A 2ZNVC 3DBHI 4GDLA 2O6VA 5BO4B 3R3MA 2KTFA 1P0RA 4RM8A 3S2AA 3Q3JA 2NBVB 2FCMA 3PTFC 2GBRA 2M0XA 3D32A 3LJ3A 4NQLB 3A33B 1WX9A 4F7ZA 2N7EA 4FHJA 4K7WA 2C9WB 1UD7A 4NJ6A 2L05A 3WA0A 4WJOA 5CTRC 4TQ0A 2KQSA 5G2NA 3VTVA 2BKRB 2LASA 3UQAA 2DZJA 4GDKA 3QQ8B 3VTUA 1LM8B 2DHZA 2KWCA 1V5OA 3PHXB 4PYZA 4LCDE 4WJNA 1WJ6A 3KH0A 4I6LB 5LXHA 4XC2A 2CHXA 1Y8RC 4WWOA 3UF8A 2L8JA 3ZRCA 2HD5B 4HLEA 4HWIB 4AP4C 4XZ4A 1V9JA 4WWPA 3RD2A 3EC8A 1J8CA 4FJVB 2EMTA 1UBIA 2MA9B 2DZKA 1YIWA 1WJ4A 3EECA 3JSVB 2IZVB 2L0TA 1NI2A 1UZXB 3H6NA 3A4SC 4HXDA 1HE8A 2O2VB 3R7RA 3OJ4B 2GBJA 2K39A 4IUMB 1R4NI 2O6VB 1KM7A 2K25A 4II3B 2DYBA 1LFDA 4IM3A 4MH0E 1I35A 2XK5A 4G50A 2NPTA 4MJSB 3VQIA 1E90A 4MGZE 1OGWA 4G0NB 4HK2A 1WR1A 2K8HA 3PRMB 1WGHA 1WXMA 4BBNC 2CR5A 4DDGD 4HDQA 4K7UA 2PE6B 1JRUA 2KMAA 3KUZA 1WJUA 3HM6X 1G6JA 1V86A 2JRIB 2K8BA 4NPNA 3H1UA 4BKSD 2ZNVB 3T8MA 1J19A 1R4MI 5E6OA 3ZTCA 2KC1A 3WALA 3L54A 3GOEA 4G3XB 2KANA 2DX5B 3CSTA 1WMHB 2N7DA 3PHWB 5LLIA 4ZRJA 2LZ6A 2NVUI 4HCPB 2D2QA 4J6IA 5G55A 2JF5A 2NBWB 3PS6A 2KQ7A 2MBBB 3W1SA 2IBIB 4KDIC 2M4NA 3K9PB 4KIKA 2ZCBA 2IYDB 3L0WB 2GBMA 4KZCA 2LWPA 3VXWA 1X1MA 1WZ3A 3PPAA 4DK5A 1TBEA 4FJYA 5EDSA 1IYFA 4OVVA 1Q1OA 2K8CA 4NY0A 3VUWA 1WI0A 2YLMA 3HHMA 3KUCB 2KDFB 3M95A 1OEYA 2LI5A 2NS5A 2KWVB 3AU5A 3ML9A 5AZFA 2IO3B 2PPHA 4PS8A 3KUDB 2LXCA 2K6QA 3N3KB 3R7QA 2DZIA 2NBUA 1YQBA 5KHOA 1MG8A 3EHVA 1D3ZA 2WWZA 1WGYA 2JVCA 1KLVA 3V62A 3TIXA 4II2B 3H7PB 4M8NA 2K6DB 5AEKB 1EF1A 2R2OA 1UH6A 4LJOB 3ZVVA 3P2BA 2BKFA 2RGFA 3CF6E 3DVGX 2KX0A 2AL6A 2DENB 2FNJB 1TGZB 2JZ3B 4XX5A 3X23A 2LVPA 4A20A 2J0MA 5AZGA 2HTHA 3NZUA 3UINB 2JT4B 3QARA 1YJ1A 5IAAC 2N9XA 2REXA 1GG3A 1RLFA 4G11A 2G45B 2AL3A 3AI5A 4PS3A 5E6PA 3ZRFA 1WGDA 3I3TB 2MW5A 5TR5A 3VAWA 3UQBA 3ECIA 1GC7A 2C5LC 2J0KA 3NOBA 4IW0A 3ALBA 3X0WA 4BOSC 2BPSA 2M8SA 1WZ0A 4NJ7A 2C7MB 4FJZA 4FLHA 3DBSA 1UGMA 2C7HA 2DYOA 3ZDMC 3KW5B 2N9EB 3NZSA 3L13A 3WAMA 2PEAA 4KIKB 1WX8A 2GBNA 1E8YA 1QZEA 2BYFA 2KDBA 4A3PA 2IY0B 2FCSA 2NR2A 3IG3A 2WYQA 2LRUA 3A1QB 2FUHB 2KNBA 2M1MA 1WGRA 1RRBA 3CMMB 3RZFA 3B08A 2N9PC 3CSFA 1ZW7A 2M17A 4JQWC 4W9JA 3TJPA 3AU4A 1E7VA 4BOZB 4BVUC 1SIFA 2ZEQA 2AYOB 3T9LA 2KK8A 4CHKA 1E8ZA 2Y5BB 3PSEB 4JLCA 5CHVC 4AOFA 2L3ZA 1EO6A 3DPDA 4DDID 1E5WA 4KV2A 4FADA 2JUOA 4FN2A 2LVQA 4YL8A 1V80A 1KOTA 4W9HA 4RMAA 4KVGB 3RT3B 2L0FA 3BY4B 4NNJB 3OAWA 3L16A 5JHAA 5J18A 2KFJA 3UIPB 3L10B 2Z0EB 2KJHB 3UGBB 2LRWA 3DOWA 1SGHA 4ICUA 1S1QB 2DAJA 2KJRA 4EZJA 3QA8A 3L08A 3V61A 2V3SA 4DHJB 4JIOU 3WIMA 3QIJA 2J0JA 4ANVA 4DHJD 3O65B 4IM0A 3W1SC 4TUUA 3TCAA 3V60A 2CHWA 2XEWA 4GXBA 2D3GA 4HJKA 1V6EA 1YX5B 2HE7A 2MRPA 4TQ1A 5E6NA 5IA7A 4HDOA 2UWQA 4GGQA 4NQKE 3ZO5B 2G4SA 3WAOA 2CS4A 5JH5C 1Q0WB 2LGXA 3QC8B 1V49A 4MELA 3DDCB 4MGKE 4WAAA 4BBNF 5L95C 1WX7A 3QCAA 2I1KA 2Z59B 1IP9A 4W9KA 3TBLD 4DXAB 3QK0A 3KYCD 3V6EB 1Z5SB 1P98A 2DZMA 3H7PA 3MHSD 2G4DB 4WJPA 4X57B 3ZLZA 1EUVB 4HPMB 3ML8A 3N30A 2V4LA 1I42A 4GDLB 2V1YA 4ASWC 3M3JA 2IO2B 2OOBB 3W1YA 4B95A 4MGIE 2KX3A 3SHQA 4W9FA 3B1LX 3PRZA 2ASQA 4W9IA 2MBEA 1U4AA 2ZZPB 3NS8A 3H7SA 3APFA 2FCQA 1GC6A 3RUIB 4OVUA 1P3QU 4K1RB 2K1FA 2MP2B 4TKNA 3GZNI 3APCA 4M0WB 5C1ZA 2JY6A 4FHKA 2JWZA 3ZKJC 3ZNID 2L7RA 2MQJA 1VCBA 1J0GA 4BKTA 2LXAA 2KFKA 1WR6E 3A1QA 2CU1A 2MX2A 5D6JB 4M8MA 3ZIMA 2XBBC 1XT9B 3ZTDA 3VVWB 3AULA 1TZ1A 3U30A 1S3SG 4KSLC 1RAXA 2KWUB 4ICVA 2KFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAP A;  4MSQ B;  2DYM A;  4K7S A;  4W9E A;  1WXV A;  2KXJ A;  1EF5 A;  3LDZ E;  3R66 C;  3IFW B;  1V2Y A;  1ZGU B;  2MP2 A;  4W9G A;  4ZRK A;  2PE9 A;  3OJ3 A;  1WXS A;  2CKH B;  3H9D A;  1TTN A;  1Q5W B;  1E7U A;  4JL9 A;  5CX3 A;  2ZVN A;  2B3A A;  2UYZ B;  4W9D A;  2KTR A;  4IC7 B;  4DWF A;  3QAQ A;  5D7G A;  3VUY A;  1OQY A;  4LDT D;  3QHT A;  2IO1 B;  2XK5 B;  1IPG A;  2OJR A;  5DPR A;  3VTW A;  5KHQ A;  1C3T A;  3IVF A;  1Z2M A;  3BIN A;  4F1S A;  4KDL B;  2AWT A;  4MSM B;  2O2V A;  3PVL A;  4MM3 A;  3KVF B;  3JVZ X;  3HIZ A;  4IWO A;  2IY1 B;  3JSV A;  3NY5 A;  3RZW C;  2LVO A;  2RPQ A;  2D11 A;  3QWZ B;  5AZH A;  1WXA A;  2YVC A;  3V6C B;  2J7Q B;  1ZKH A;  4GB9 A;  2HJ8 A;  4CYE A;  3QJZ A;  3RCZ A;  3ZW3 A;  1H8C A;  1XQQ A;  1A5R A;  1SE9 A;  2KDI A;  2KO3 A;  3PZD A;  5LXI B;  5DCN A;  2BGF A;  3VDZ A;  1WGG A;  2BYV E;  2W9N A;  4HPL B;  2WX1 A;  2FCN A;  5CHW A;  2G3Q B;  3DQV A;  4IWQ A;  4FA6 A;  2EKE C;  2GBK A;  3DBL I;  2FAZ A;  4EEW A;  1V81 A;  3VH3 B;  4EKU A;  1L2N A;  3B0A A;  4GIV A;  1OTR B;  4W9C A;  2WX0 A;  1F9J A;  2BWE S;  3NHE B;  2FIF A;  1LXD A;  5L83 A;  2RSU A;  4E74 A;  3C0R B;  3ONS A;  3DCG A;  4HCN B;  5D2M B;  2KZR A;  1T0Y A;  5DPT A;  2RD0 A;  3AXC A;  4JGH B;  5FR6 A;  3PV1 A;  2MCN B;  1UBQ A;  4PS7 A;  3VHT C;  2BWF A;  3PT2 B;  1YX6 B;  1RFA A;  1WMH A;  2LGD A;  1V5T A;  2JRH A;  3A9K A;  1VD2 A;  2RR9 A;  4WJQ A;  4ZRI A;  3ZNH B;  3M62 B;  5HKH A;  2N1V A;  3WAN A;  4I6P A;  1YD8 U;  2NCN A;  4FBJ B;  2KC2 A;  2KKC A;  1C1Y B;  1BT0 A;  3U7D A;  3IHP C;  3Q3F A;  1WIA A;  3A9K B;  2KOX A;  3EFU A;  3K9O B;  1WYW B;  4IWP A;  4RM9 A;  3TMP B;  1E8X A;  1WY8 A;  2BYE A;  2QHO A;  4MJS A;  2FID A;  2WDT B;  4IG7 B;  3KYD D;  1NDD A;  2KD0 A;  2I1J A;  2KMC A;  4TV3 A;  3ZNG C;  4IM2 A;  2KHW B;  4E3C A;  2ZPN A;  5CHF A;  4ANU A;  1K8R B;  2L76 A;  1OEY J;  2KDE B;  5JZE B;  1E8W A;  4GSW A;  4MDK E;  1UEL A;  3PGE A;  4FUL A;  4N9F 4;  4PYU A;  4WWN A;  2IO0 B;  1NBF C;  4MEM A;  5GMV A;  2JXX A;  4GOC A;  2C7N B;  1GNU A;  1FXT B;  1WE6 A;  4GDK B;  3DVN V;  4NAW B;  3SD5 A;  4A3O A;  2MLB A;  4K81 A;  3U8Z A;  2MBO A;  3M63 B;  3HM3 A;  4EZL A;  3IBE A;  2Z0D B;  2O6V D;  3N32 A;  3ZUN A;  4BKG A;  4CO7 A;  5J2R A;  4EZK A;  1KJT A;  3HK0 A;  5C23 A;  4HVB A;  4DBG A;  4GU2 A;  1GJZ A;  1WRD B;  3A9J B;  3MJW A;  5D94 A;  1AAR A;  4KSK C;  3A9J A;  2LGY A;  4LDT B;  2GOW A;  2ZVO A;  4ANW A;  2MSE D;  2BF8 B;  3DVG Y;  4EFO A;  1L7Y A;  2ZPY A;  4W9L A;  3RYT A;  4B9K A;  2A4Z A;  2JZZ A;  3DVN U;  4NAW A;  4ANX A;  2LUE A;  3OLM D;  2KTR B;  3ENE A;  3RUL A;  4AWJ A;  4LJP B;  2D10 A;  3A4R A;  3JYU A;  2C60 A;  4DHZ E;  2LJ5 A;  4B6W A;  2MWS B;  5DPS A;  5JHB A;  4F8C B;  3VFK A;  4EOY A;  3PRE A;  2KLC A;  4GN1 A;  2EMS A;  4BFR A;  2KLG A;  1WFY A;  5DPW A;  2ZJD A;  2CHZ A;  3UIO B;  2MBH A;  2R2Q A;  1GUA B;  5J17 A;  2KN5 A;  4GMV A;  1LQB A;  3VUX A;  3VH4 B;  4I6N B;  4AJW A;  3ZNZ B;  3PRP B;  2GMI C;  4MGY E;  4DHZ B;  3L17 A;  3ZDT A;  2JPH A;  1P1A A;  2L00 B;  4ZDV A;  1CMX B;  1XD3 B;  4WQO B;  3JW0 X;  4KZ0 A;  4E71 A;  1ISN A;  4P7I A;  1P9D U;  1WJN A;  3PLU A;  2AEH A;  1WF9 A;  2A5U A;  2ZCC A;  3QX1 A;  4AJY B;  3SDL C;  4EUT A;  2N4F A;  2DAF A;  2N1W A;  1PQS A;  3PLV A;  3TL5 A;  1WE7 A;  4BKS A;  2KVR A;  1H4R A;  2PJH A;  4AUQ C;  2KJ6 A;  1WM3 A;  4ZYN A;  3SU8 X;  3MTN B;  1WM2 A;  2VRR B;  3DBR I;  2D07 B;  2LD9 A;  2NPT B;  4URK A;  3APD A;  1M94 A;  2MBQ A;  1WH3 A;  2ZNV C;  3DBH I;  4GDL A;  2O6V A;  5BO4 B;  3R3M A;  2KTF A;  1P0R A;  4RM8 A;  3S2A A;  3Q3J A;  2NBV B;  2FCM A;  3PTF C;  2GBR A;  2M0X A;  3D32 A;  3LJ3 A;  4NQL B;  3A33 B;  1WX9 A;  4F7Z A;  2N7E A;  4FHJ A;  4K7W A;  2C9W B;  1UD7 A;  4NJ6 A;  2L05 A;  3WA0 A;  4WJO A;  5CTR C;  4TQ0 A;  2KQS A;  5G2N A;  3VTV A;  2BKR B;  2LAS A;  3UQA A;  2DZJ A;  4GDK A;  3QQ8 B;  3VTU A;  1LM8 B;  2DHZ A;  2KWC A;  1V5O A;  3PHX B;  4PYZ A;  4LCD E;  4WJN A;  1WJ6 A;  3KH0 A;  4I6L B;  5LXH A;  4XC2 A;  2CHX A;  1Y8R C;  4WWO A;  3UF8 A;  2L8J A;  3ZRC A;  2HD5 B;  4HLE A;  4HWI B;  4AP4 C;  4XZ4 A;  1V9J A;  4WWP A;  3RD2 A;  3EC8 A;  1J8C A;  4FJV B;  2EMT A;  1UBI A;  2MA9 B;  2DZK A;  1YIW A;  1WJ4 A;  3EEC A;  3JSV B;  2IZV B;  2L0T A;  1NI2 A;  1UZX B;  3H6N A;  3A4S C;  4HXD A;  1HE8 A;  2O2V B;  3R7R A;  3OJ4 B;  2GBJ A;  2K39 A;  4IUM B;  1R4N I;  2O6V B;  1KM7 A;  2K25 A;  4II3 B;  2DYB A;  1LFD A;  4IM3 A;  4MH0 E;  1I35 A;  2XK5 A;  4G50 A;  2NPT A;  4MJS B;  3VQI A;  1E90 A;  4MGZ E;  1OGW A;  4G0N B;  4HK2 A;  1WR1 A;  2K8H A;  3PRM B;  1WGH A;  1WXM A;  4BBN C;  2CR5 A;  4DDG D;  4HDQ A;  4K7U A;  2PE6 B;  1JRU A;  2KMA A;  3KUZ A;  1WJU A;  3HM6 X;  1G6J A;  1V86 A;  2JRI B;  2K8B A;  4NPN A;  3H1U A;  4BKS D;  2ZNV B;  3T8M A;  1J19 A;  1R4M I;  5E6O A;  3ZTC A;  2KC1 A;  3WAL A;  3L54 A;  3GOE A;  4G3X B;  2KAN A;  2DX5 B;  3CST A;  1WMH B;  2N7D A;  3PHW B;  5LLI A;  4ZRJ A;  2LZ6 A;  2NVU I;  4HCP B;  2D2Q A;  4J6I A;  5G55 A;  2JF5 A;  2NBW B;  3PS6 A;  2KQ7 A;  2MBB B;  3W1S A;  2IBI B;  4KDI C;  2M4N A;  3K9P B;  4KIK A;  2ZCB A;  2IYD B;  3L0W B;  2GBM A;  4KZC A;  2LWP A;  3VXW A;  1X1M A;  1WZ3 A;  3PPA A;  4DK5 A;  1TBE A;  4FJY A;  5EDS A;  1IYF A;  4OVV A;  1Q1O A;  2K8C A;  4NY0 A;  3VUW A;  1WI0 A;  2YLM A;  3HHM A;  3KUC B;  2KDF B;  3M95 A;  1OEY A;  2LI5 A;  2NS5 A;  2KWV B;  3AU5 A;  3ML9 A;  5AZF A;  2IO3 B;  2PPH A;  4PS8 A;  3KUD B;  2LXC A;  2K6Q A;  3N3K B;  3R7Q A;  2DZI A;  2NBU A;  1YQB A;  5KHO A;  1MG8 A;  3EHV A;  1D3Z A;  2WWZ A;  1WGY A;  2JVC A;  1KLV A;  3V62 A;  3TIX A;  4II2 B;  3H7P B;  4M8N A;  2K6D B;  5AEK B;  1EF1 A;  2R2O A;  1UH6 A;  4LJO B;  3ZVV A;  3P2B A;  2BKF A;  2RGF A;  3CF6 E;  3DVG X;  2KX0 A;  2AL6 A;  2DEN B;  2FNJ B;  1TGZ B;  2JZ3 B;  4XX5 A;  3X23 A;  2LVP A;  4A20 A;  2J0M A;  5AZG A;  2HTH A;  3NZU A;  3UIN B;  2JT4 B;  3QAR A;  1YJ1 A;  5IAA C;  2N9X A;  2REX A;  1GG3 A;  1RLF A;  4G11 A;  2G45 B;  2AL3 A;  3AI5 A;  4PS3 A;  5E6P A;  3ZRF A;  1WGD A;  3I3T B;  2MW5 A;  5TR5 A;  3VAW A;  3UQB A;  3ECI A;  1GC7 A;  2C5L C;  2J0K A;  3NOB A;  4IW0 A;  3ALB A;  3X0W A;  4BOS C;  2BPS A;  2M8S A;  1WZ0 A;  4NJ7 A;  2C7M B;  4FJZ A;  4FLH A;  3DBS A;  1UGM A;  2C7H A;  2DYO A;  3ZDM C;  3KW5 B;  2N9E B;  3NZS A;  3L13 A;  3WAM A;  2PEA A;  4KIK B;  1WX8 A;  2GBN A;  1E8Y A;  1QZE A;  2BYF A;  2KDB A;  4A3P A;  2IY0 B;  2FCS A;  2NR2 A;  3IG3 A;  2WYQ A;  2LRU A;  3A1Q B;  2FUH B;  2KNB A;  2M1M A;  1WGR A;  1RRB A;  3CMM B;  3RZF A;  3B08 A;  2N9P C;  3CSF A;  1ZW7 A;  2M17 A;  4JQW C;  4W9J A;  3TJP A;  3AU4 A;  1E7V A;  4BOZ B;  4BVU C;  1SIF A;  2ZEQ A;  2AYO B;  3T9L A;  2KK8 A;  4CHK A;  1E8Z A;  2Y5B B;  3PSE B;  4JLC A;  5CHV C;  4AOF A;  2L3Z A;  1EO6 A;  3DPD A;  4DDI D;  1E5W A;  4KV2 A;  4FAD A;  2JUO A;  4FN2 A;  2LVQ A;  4YL8 A;  1V80 A;  1KOT A;  4W9H A;  4RMA A;  4KVG B;  3RT3 B;  2L0F A;  3BY4 B;  4NNJ B;  3OAW A;  3L16 A;  5JHA A;  5J18 A;  2KFJ A;  3UIP B;  3L10 B;  2Z0E B;  2KJH B;  3UGB B;  2LRW A;  3DOW A;  1SGH A;  4ICU A;  1S1Q B;  2DAJ A;  2KJR A;  4EZJ A;  3QA8 A;  3L08 A;  3V61 A;  2V3S A;  4DHJ B;  4JIO U;  3WIM A;  3QIJ A;  2J0J A;  4ANV A;  4DHJ D;  3O65 B;  4IM0 A;  3W1S C;  4TUU A;  3TCA A;  3V60 A;  2CHW A;  2XEW A;  4GXB A;  2D3G A;  4HJK A;  1V6E A;  1YX5 B;  2HE7 A;  2MRP A;  4TQ1 A;  5E6N A;  5IA7 A;  4HDO A;  2UWQ A;  4GGQ A;  4NQK E;  3ZO5 B;  2G4S A;  3WAO A;  2CS4 A;  5JH5 C;  1Q0W B;  2LGX A;  3QC8 B;  1V49 A;  4MEL A;  3DDC B;  4MGK E;  4WAA A;  4BBN F;  5L95 C;  1WX7 A;  3QCA A;  2I1K A;  2Z59 B;  1IP9 A;  4W9K A;  3TBL D;  4DXA B;  3QK0 A;  3KYC D;  3V6E B;  1Z5S B;  1P98 A;  2DZM A;  3H7P A;  3MHS D;  2G4D B;  4WJP A;  4X57 B;  3ZLZ A;  1EUV B;  4HPM B;  3ML8 A;  3N30 A;  2V4L A;  1I42 A;  4GDL B;  2V1Y A;  4ASW C;  3M3J A;  2IO2 B;  2OOB B;  3W1Y A;  4B95 A;  4MGI E;  2KX3 A;  3SHQ A;  4W9F A;  3B1L X;  3PRZ A;  2ASQ A;  4W9I A;  2MBE A;  1U4A A;  2ZZP B;  3NS8 A;  3H7S A;  3APF A;  2FCQ A;  1GC6 A;  3RUI B;  4OVU A;  1P3Q U;  4K1R B;  2K1F A;  2MP2 B;  4TKN A;  3GZN I;  3APC A;  4M0W B;  5C1Z A;  2JY6 A;  4FHK A;  2JWZ A;  3ZKJ C;  3ZNI D;  2L7R A;  2MQJ A;  1VCB A;  1J0G A;  4BKT A;  2LXA A;  2KFK A;  1WR6 E;  3A1Q A;  2CU1 A;  2MX2 A;  5D6J B;  4M8M A;  3ZIM A;  2XBB C;  1XT9 B;  3ZTD A;  3VVW B;  3AUL A;  1TZ1 A;  3U30 A;  1S3S G;  4KSL C;  1RAX A;  2KWU B;  4ICV A;  2KFK B; 
#chains in the Genus database with same CATH topology
 4K7S A;  3H8H A;  1WXV A;  2PIA A;  1MHH E;  3IFW B;  3J9C A;  2M19 A;  2PE9 A;  3OJ3 A;  1WXS A;  1TTN A;  1Q5W B;  3SEB A;  3TSS A;  2KTR A;  3AED B;  4DWF A;  1OQY A;  3IVF A;  1UF0 A;  3BIN A;  4F1S A;  2AWT A;  3P4Q B;  1B1Z A;  2LVO A;  4TSS A;  5H8Y E;  3R8B A;  2LGS A;  4GB9 A;  1FCL A;  1PGX A;  4CYE A;  1HZ5 A;  2AQ1 B;  2BGF A;  5DCN A;  1WGG A;  4HPL B;  1VZ8 A;  2G3Q B;  1T0S C;  2M56 B;  1L2N A;  4RNA A;  2D5G A;  2BWE S;  3NHE B;  4WWM A;  2RSU A;  2WGS A;  2KZR A;  2W3R A;  1UWM A;  1T0Y A;  4XWT A;  2WU5 B;  3AXC A;  4XE0 A;  2MCN B;  1V97 A;  1EWY C;  1IGC A;  2BWF A;  4WJQ A;  1RFA A;  2RR9 A;  4YSZ B;  5HKH A;  1SEB D;  2WXF A;  2KKC A;  1BT0 A;  3U7D A;  3Q3F A;  1WIA A;  3HVZ A;  1WYW B;  1ACC A;  1RYJ A;  2FID A;  2WDT B;  3KYD D;  4L2Y A;  4AS1 A;  3FIL B;  2CU3 A;  3AEA B;  4E3C A;  4IM2 A;  1OEY J;  3EUB 2;  3ZXV A;  2J4X A;  4MDK E;  3BVM A;  4FUL A;  4PYU A;  5GMV A;  2JXX A;  2C7N B;  4GDK B;  3Q2A C;  3AEE B;  3DWG C;  2GI9 A;  2Z0D B;  2O6V D;  4CO7 A;  2TSS A;  4K3B A;  1VR9 A;  1UGJ A;  4A90 A;  4KSK C;  3NJT A;  2GOW A;  1FEH A;  2MSE D;  2BF8 B;  2HJ1 A;  3DVG Y;  5AUK A;  3C19 A;  2JZZ A;  3DVN U;  3RUL A;  4AWJ A;  2FBW B;  3JYU A;  2C60 A;  4C80 A;  2MWS B;  4F8C B;  3VFK A;  1LGR A;  4O1N A;  2KLC A;  4XDD A;  2WDR B;  5DPW A;  2BBC A;  2MBH A;  1QOB A;  4JWS C;  2R2Q A;  2KN5 A;  4GMV A;  3E9S A;  2MEK A;  3ZDT A;  2JPH A;  2L00 B;  1N60 A;  1NVI D;  1CMX B;  4KKJ A;  3JW0 X;  4KZ0 A;  3QX1 A;  4WAF A;  1XLP A;  2KT7 A;  1PQS A;  1NYR A;  4BKS A;  1E0Z A;  5IN7 A;  1H4R A;  2Y5P A;  3BWU D;  2WNM A;  4XDC A;  2E6X A;  2NPT B;  4YWG G;  1M94 A;  3BK1 A;  4YXD B;  4NJC A;  1MG4 A;  4HJG E;  3R3M A;  2QSD A;  2WXM A;  4S17 A;  1F1H A;  2GBR A;  5C2T B;  3LJ3 A;  1FFU A;  3N1Y C;  3A33 B;  1WX9 A;  4F7Z A;  3EGR A;  2WDV B;  4WJO A;  2PVG C;  1FFV A;  5BMG A;  2LAS A;  5FKA C;  3UQA A;  2DHZ A;  2KWC A;  4LCD E;  1WJ6 A;  2CHX A;  2L8J A;  2KQ4 X;  1M4V A;  4AP4 C;  3RD2 A;  3EC8 A;  4FJV B;  2EMT A;  1UBI A;  2MA9 B;  3IXS A;  2L0T A;  2WP9 B;  2O2V B;  3R2T A;  2K39 A;  1R4N I;  1KLG D;  4IM3 A;  2XK5 A;  4MJS B;  3VQI A;  1E90 A;  1QOG A;  1OGW A;  4RH6 A;  3PRM B;  2K8H A;  1T3Q A;  2L1A A;  1I4R A;  3NVZ A;  1F2R I;  3P63 A;  2ONQ A;  4MT5 A;  2K8B A;  1D5X C;  1JAL A;  2JRI B;  1R4M I;  5E6O A;  2N7J A;  2KC1 A;  1OFF A;  5LLI A;  3AEC B;  4J6I A;  1E7P B;  3AE5 B;  2KQ7 A;  1TKE A;  2L32 A;  3W1S A;  1ZXI A;  3IAM 1;  1KTK A;  2IBI B;  4KDI C;  3K9P B;  4AQ7 A;  1WGK A;  3GE3 C;  1AW7 A;  4ZRQ A;  2D3A A;  3P4R B;  3RNG C;  5T8I A;  2IYD B;  1X1M A;  4DK5 A;  1TBE A;  4OVV A;  1Q1O A;  1WI0 A;  3M95 A;  2V3P A;  4NAM A;  3ML9 A;  5AZF A;  1KH0 A;  4PS8 A;  2KN4 A;  3GP7 A;  2DZI A;  2INP E;  5HI1 A;  3P2B A;  3DVG X;  2FNJ B;  3X23 A;  2LVP A;  3VR8 B;  1WXQ A;  2MJD A;  3NZU A;  3U4E G;  4ZYS A;  4G11 A;  1UWX A;  1YJI A;  1STE A;  1EM7 A;  3UQB A;  3AMZ A;  1GC7 A;  2WS3 B;  1V1O A;  4DXF A;  2DYO A;  3KW5 B;  3W5U B;  4L23 A;  4K3C A;  2KDB A;  4A3P A;  3IG3 A;  3A1Q B;  1CK1 A;  5D3I B;  2LFI A;  1DGJ A;  1E7V A;  2ZEQ A;  2AYO B;  2WXH A;  2GRI A;  3T9L A;  4CHK A;  4JLC A;  2L3Z A;  3DPD A;  1E5W A;  2JYE A;  4YL8 A;  3GB1 A;  1SJH D;  1P7E A;  1V80 A;  4W9H A;  3RT3 B;  2L0F A;  3UIP B;  3L10 B;  3P1M A;  2Z0E B;  4DHJ B;  1DOY A;  5BYS A;  1FPY A;  2J0J A;  4DHJ D;  4IM0 A;  3W1S C;  2JWU A;  3RNA C;  3TCA A;  4A6Q A;  2J42 A;  4A8X C;  2CHW A;  4P6V F;  1V6E A;  1YX5 B;  2INC C;  3WAO A;  2CS4 A;  1Q0W B;  4MEL A;  3DDC B;  3MJ5 A;  1WX7 A;  3AE9 B;  3AE6 B;  3MHS D;  4RGO S;  2MH7 A;  3ZLZ A;  4HPM B;  2V4L A;  2PVO D;  3KLS X;  3RNB C;  1HA5 A;  4B95 A;  3W2D A;  1TKY A;  1C9F A;  1QQR A;  5BMH A;  4W9I A;  1U4A A;  1V1P A;  1QKZ A;  3APF A;  3NVW A;  3AB5 A;  1P3Q U;  2GB1 A;  1BUI C;  2V4I B;  4M0W B;  5C1Z A;  3ZKJ C;  4BKT A;  2KFK A;  3A1Q A;  1WR6 E;  4N59 A;  4M8M A;  2XBB C;  1XT9 B;  1S3S G;  1D4B A;  2IPK D;  2EKI A;  2WXO A;  2DYM A;  4OZB A;  5EE3 A;  1VRA B;  1EF5 A;  1XXG A;  2WU2 B;  3LDZ E;  3R66 C;  4M02 A;  3NVV A;  1FRD A;  1E7U A;  2ZVN A;  4W9D A;  3AE1 B;  1IBX A;  2RDG A;  4NZL B;  1Z2M A;  1JWS D;  4MM3 A;  3DBL B;  3HIZ A;  1WYG A;  2MHJ A;  3RZW C;  1K50 A;  3P4S B;  1WXA A;  2YVC A;  1T0Q C;  1TY2 A;  2J7Q B;  3QJZ A;  3PZD A;  3VDZ A;  2BYV E;  2HDE A;  2W9N A;  2WX1 A;  1I4P A;  4RCO A;  4IWQ A;  4FA6 A;  2GBK A;  2FAZ A;  4EEW A;  3VH3 B;  5C3J B;  5G5H A;  5H92 C;  1TS4 A;  4B0M A;  5L83 A;  4E74 A;  3C0R B;  3DCG A;  3HUI A;  4YTN B;  5FK9 C;  5D2M B;  2KAC A;  3U52 E;  1VLB A;  1JQ4 A;  1CZP A;  3VHT C;  2LGD A;  1V5T A;  1VD2 A;  4ZHO A;  4I6P A;  2NCN A;  3EFC A;  4FBJ B;  2KC2 A;  4PT5 A;  3IHP C;  4RM9 A;  1N6Z A;  3TUO A;  1RFK A;  1WY8 A;  2BYE A;  2QHO A;  4MJS A;  2I1J A;  2KHW B;  4IKG A;  2OJW A;  4LNI A;  1YQ4 B;  1K8R B;  1I4X A;  2KDE B;  2WXK A;  4WWN A;  2IO0 B;  5IO9 A;  2KMM A;  4GOC A;  1JCK B;  1XLQ A;  3VRB B;  1FXT B;  1WE6 A;  1FXA A;  4A3O A;  3AEB B;  1WRI A;  4EZL A;  3ZUN A;  5J2R A;  2UU7 A;  4KGR A;  1GJZ A;  4CQN A;  1AAR A;  3Q6B A;  3A9J A;  2LGY A;  2ZVO A;  2LGI A;  4ANW A;  5E6J A;  4W9L A;  4OW0 A;  4NAW A;  4B0E A;  1LO5 D;  3A4R A;  2LJ5 A;  2PLP A;  1KLU D;  1V8C A;  1FNW A;  5DPS A;  3N20 C;  4EOY A;  1C77 A;  2EMS A;  4HKZ E;  1I4Q A;  1WFY A;  3LYY A;  1GUA B;  1ZPS A;  2FE8 A;  3VRA B;  4DHZ B;  1Y56 A;  1XD3 B;  4E71 A;  3PLU A;  2AEH A;  1WF9 A;  2ZCC A;  3SDL C;  2G9H D;  1TS5 A;  2K9X A;  1WE7 A;  1TKG A;  1V1P B;  2KVR A;  2JZP A;  2QIE B;  2KDM A;  2BTE A;  1FM0 D;  1WM2 A;  1XLO A;  2K0P A;  4URK A;  3APD A;  1K53 A;  1C4P A;  3Q3J A;  1AWD A;  2NBV B;  2FCM A;  3Q8F A;  4NQL B;  2OED A;  2WXL A;  2DNF A;  2N7E A;  4K7W A;  4PK1 A;  2L05 A;  3BK2 A;  2KQS A;  2W3S A;  4GDK A;  3QQ8 B;  1LM8 B;  3KH0 A;  4I6L B;  3UF8 A;  1Y8R C;  2DBY A;  4WWO A;  3ZRC A;  1YN5 A;  4HWI B;  1GB1 A;  4M00 A;  1J8C A;  1YIW A;  4UDU C;  3JSV B;  1QOA A;  2IZV B;  4C7Y A;  3H6N A;  1HE8 A;  3R7R A;  4JE3 B;  2NMQ A;  4MH0 E;  5IP4 D;  2NTS A;  3I57 A;  4G0N B;  1WXM A;  4BBN C;  2CR5 A;  4HDQ A;  3AE8 B;  3V3X A;  3KUZ A;  4NPN A;  4LNF A;  2ZNV B;  3T8M A;  3WAL A;  5AUI A;  2KAN A;  3CST A;  2N7D A;  2EEL A;  1PGA A;  2LZ6 A;  4HCP B;  2D2Q A;  2NBW B;  1N61 A;  2MBB B;  2V3N A;  2PTL A;  2H89 B;  2M4N A;  4ARC A;  1ZE3 D;  3U7Z A;  2GBM A;  3VXW A;  4FJY A;  3Q8C A;  1JW9 D;  4YTP B;  3KUC B;  2KDF B;  3AU5 A;  2PPH A;  3N3K B;  3R7Q A;  3IAS 1;  1JWU D;  1OQR A;  1D3Z A;  1KLV A;  4D2K A;  3N1Z C;  4II2 B;  3H7P B;  2K6D B;  1Q10 A;  1UH6 A;  4LJO B;  3CF6 E;  2KX0 A;  1FMA D;  1KF6 B;  4XX5 A;  1L0Y B;  2HTH A;  4US9 A;  3W5V B;  3ZJV A;  3UIN B;  3QAR A;  2N9X A;  2ON8 A;  3BZD B;  1RLF A;  3AI5 A;  1WSP A;  2JXT A;  3I3T B;  2MW5 A;  3VAW A;  1SE4 A;  2C5L C;  2I38 A;  4BOS C;  3X0W A;  4TMA B;  1VZ7 A;  3FKY A;  4FJZ A;  2AX5 A;  2C7H A;  3ZDM C;  1BML C;  3L13 A;  2GBN A;  2YEP B;  1E8Y A;  3KQ4 A;  3SR6 A;  2LRU A;  2FUH B;  3CMM B;  3TJP A;  3AU4 A;  1OQQ A;  3MC0 B;  4BOZ B;  1SIF A;  3PSE B;  5CHV C;  4AOF A;  4N58 A;  4DDI D;  3PZ8 A;  4REZ A;  3URY A;  2JUO A;  1FIQ A;  1UUP A;  4KVG B;  1XCQ L;  3OAW A;  3L16 A;  5JHA A;  5J18 A;  4WUR A;  1R4N B;  3MFG A;  1XEE A;  1ZXH A;  1SGH A;  4ICU A;  1S1Q B;  3L08 A;  2DWQ A;  3QIJ A;  4ANV A;  1ENF A;  4GXB A;  2VZK B;  2W54 A;  5E6N A;  4P16 A;  4TQ1 A;  2Y5C A;  5JH5 C;  1DYQ A;  3QCA A;  2Z59 B;  3RI7 C;  4W9K A;  3TBL D;  1WWT A;  3BII D;  3MC9 A;  3V6E B;  2W82 A;  2WHI A;  3H7P A;  2AQ2 B;  3RPF C;  1EUV B;  3N30 A;  3PZ7 A;  1I42 A;  4WH4 A;  1IBX B;  4ASW C;  3C8Y A;  4HRO A;  2OOB B;  3W1Y A;  3DBH B;  2KWD A;  4RGM A;  2HTM E;  3NS8 A;  3B2F A;  2FCQ A;  3T3O A;  1FD6 A;  4MAC A;  4TKN A;  4HPP A;  2JY6 A;  4BZA A;  2JWZ A;  3ZNI D;  3T3N A;  2MQJ A;  2ICI A;  1L6U A;  2LMC A;  1YQ3 B;  1ZOY B;  2MX2 A;  1JRP A;  3I5J C;  3AUL A;  3U30 A;  1SE3 A;  2KFK B;  2XNA C;  2JU6 X;  4MSQ B;  4W9E A;  1MFW A;  2L52 A;  1V2Y A;  1XLN A;  4W9G A;  4XYC A;  1NEK B;  2CKH B;  1SF0 A;  3BYY B;  4JL9 A;  5CX3 A;  1MPE A;  1QIL A;  1FO4 A;  2CJO A;  3VUY A;  2IO1 B;  4ITK A;  1IPG A;  2OJR A;  3VTW A;  1C4C A;  4KDL B;  4MSM B;  3PVL A;  4IWO A;  2IY1 B;  3JSV A;  3NY5 A;  2RPQ A;  2D11 A;  5AZH A;  1SXT A;  3V6C B;  1ZKH A;  2HJ8 A;  3ZYY X;  3RCZ A;  1PFD A;  3ZW3 A;  2OHF A;  1H8C A;  2L83 A;  1A5R A;  1SE9 A;  5LXI B;  2EKE C;  3B0A A;  4GIV A;  2BVC A;  2WX0 A;  1HTO A;  4P1B C;  2FIF A;  2VZK D;  4KX6 B;  2V9H A;  2QCZ A;  5FR6 A;  4JGH B;  4LNN A;  3PV1 A;  1UBQ A;  4PS7 A;  4LTU A;  4GLS C;  5HG2 A;  3PT2 B;  1YX6 B;  1WMH A;  1NYQ A;  4ZRI A;  1EU3 A;  3AE3 B;  1TY0 A;  1CJE A;  3U2S C;  3BVG A;  3TEX A;  3ZGZ A;  1YD8 U;  1C1Y B;  2IND C;  2KOX A;  3EFU A;  3RNC C;  1E8X A;  1VZ6 A;  1VDV A;  2SEB D;  1NDD A;  3Q3O C;  3Q8E A;  1SSN A;  1N5X A;  1F52 A;  2KMC A;  1TT5 B;  3OG5 A;  2ZPN A;  5CHF A;  4ANU A;  1KRH A;  2L76 A;  3RN9 C;  4YSX B;  5JZE B;  1E8W A;  1YMH E;  3E56 A;  3Q3M C;  4N9F 4;  1HZ6 A;  1NBF C;  3DVN V;  4NAW B;  2MLB A;  2W55 A;  4K81 A;  2MBO A;  2X38 A;  2WXG A;  3HK0 A;  3LB8 C;  4DBG A;  3A9J B;  1FNV A;  2MJ3 A;  2QMT A;  1KFY B;  4LDT B;  3W9C B;  5I4D A;  2IJ0 A;  4EFO A;  1L7Y A;  3RYT A;  4ANX A;  2KTR B;  2M0A A;  3ENE A;  4LJP B;  2D10 A;  2IDY A;  1GB4 A;  4DHZ E;  2E3T A;  4B6W A;  4LLG M;  5JHB A;  5EE1 A;  3ABV B;  3PRE A;  3B2G A;  4BFR A;  1D6E C;  1YN3 A;  3AV8 A;  1QF6 A;  1T5X D;  2ZJD A;  5IKC M;  3UIO B;  5J17 A;  3VH4 B;  4I6N B;  3ZNZ B;  3PRP B;  4MGY E;  4ZDV A;  3L17 A;  5FR3 A;  1P1A A;  3Q8B A;  1IGD A;  4WQO B;  4P7I A;  1WJN A;  2A5U A;  1XF5 L;  4EUT A;  2DAF A;  2N1W A;  3NVY A;  2JSV X;  2VH1 A;  1WM3 A;  3MTN B;  1N63 A;  1NEN B;  4GDL A;  1UNS A;  2ZNV C;  3DBH I;  2KTF A;  1P0R A;  4RM8 A;  3S2A A;  4IDI A;  1MI0 A;  1GOZ A;  2M0X A;  1MVK A;  2BB6 A;  4FHJ A;  4J3O D;  3DWM A;  2C9W B;  1P7F A;  2D3C A;  4TQ0 A;  5G2N A;  2NTT A;  3VTU A;  3R2I A;  3OWE B;  5LXH A;  4XC2 A;  5JXV A;  3SFE B;  4HLE A;  4XZ4 A;  1V9J A;  4KGT A;  2DLB A;  1DOI A;  1F77 A;  3TEW A;  1TS3 A;  1WJ4 A;  3EEC A;  2RDB C;  1NI2 A;  4MM3 B;  3A4S C;  4HXD A;  3CWI A;  2K25 A;  1B9R A;  1I4H A;  2DYB A;  1I35 A;  1YJJ A;  2NPT A;  4HK2 A;  1WR1 A;  1WGH A;  4K7U A;  2PE6 B;  1TJE A;  3HM6 X;  1V86 A;  2JYT A;  4N6E B;  2GLS A;  3GOE A;  4G3X B;  2FUG 1;  4ZRJ A;  2NVU I;  2JF5 A;  4Q2J A;  1PDX A;  4A55 A;  4EE2 A;  4KIK A;  1MJD A;  1L0V B;  4KZC A;  2LWP A;  2K3U A;  1WZ3 A;  2K8C A;  4M0W A;  1BXT A;  1AN8 A;  3HHM A;  1OEY A;  2LI5 A;  2KWV B;  1PGB A;  3WCQ A;  3KUD B;  2NBU A;  1AYF A;  1YQB A;  1ZDV A;  2XN9 C;  1MG8 A;  2WWZ A;  1WGY A;  1E6E B;  3V62 A;  5AEK B;  1EF1 A;  5LNK 1;  3ZVV A;  2BKF A;  2RGF A;  3AH7 A;  3P42 A;  3IT6 B;  4ACF A;  4A20 A;  3NUH B;  2J0M A;  5MPO A;  4YSY B;  1ZUD 2;  3KWV A;  2LJI A;  1YN4 A;  4PS3 A;  3AN1 A;  3ZRF A;  1T0R C;  5TR5 A;  3NOB A;  3ALB A;  2BPS A;  2M8S A;  1WZ0 A;  1MHX A;  2BS3 B;  4FLH A;  1R7S A;  2C7M B;  1XO3 A;  3DBS A;  1UGM A;  3MHZ A;  4BAX A;  3WAM A;  2JQR B;  2BYF A;  2N9K A;  2FCS A;  2WYQ A;  1TS2 A;  2KNB A;  2IGG A;  2M1M A;  3NS1 A;  3AE7 B;  3CIR B;  3B08 A;  1ZW7 A;  3HRD D;  4W9J A;  2IGD A;  4H2A A;  2KK8 A;  1E8Z A;  4KV2 A;  4FAD A;  1FRR A;  4FN2 A;  2LVQ A;  3IT4 B;  3V05 A;  3NRZ A;  3Q3N C;  1L4D B;  4RMA A;  2V0G A;  3ETR A;  4NNJ B;  4OZC A;  1SIJ A;  1SE2 A;  2BYT A;  2KJH B;  5BYQ A;  2LRW A;  2RDH A;  3NG0 A;  3GZN B;  3QA8 A;  3V61 A;  1JRO A;  5IOI A;  1PUT A;  2JX5 A;  2XEW A;  2D3G A;  3P4P B;  4HJK A;  4GGQ A;  4NQK E;  2LGX A;  1SB3 C;  1V49 A;  1R4M B;  2I1K A;  1IP9 A;  3KYC D;  2DZM A;  1QLB B;  3ML8 A;  2V1Y A;  1ET9 A;  2IO2 B;  4MGI E;  2KX3 A;  4LK0 M;  3SHQ A;  2BQQ A;  3B1L X;  3B9J A;  2ZZP B;  3NZ3 A;  1F2R C;  1GC6 A;  3RUI B;  4OVU A;  1SBB B;  3GZN I;  5G5G A;  1F0Z A;  3MP9 A;  3AM9 A;  4HKQ A;  2QC8 A;  3ZIM A;  2CU1 A;  3ZTD A;  2Y3A A;  4OVZ A;  3VVW B;  3UI3 A;  1TZ1 A;  2WDQ B;  4KSL C;  2D3B A;  2KWU B;  4ICV A;  3WAP A;  1I7H A;  2KXJ A;  1ZGU B;  2MP2 A;  4ZRK A;  2N0S B;  3DHH C;  3H9D A;  2BB5 A;  2B3A A;  2UYZ B;  1A70 A;  2LEK A;  4IC7 B;  3QAQ A;  5D7G A;  2J53 A;  4LDT D;  3QHT A;  3RNF C;  2XK5 B;  5DPR A;  5KHQ A;  1C3T A;  2LHE A;  2O2V A;  3KVF B;  3JVZ X;  2WXJ A;  3QWZ B;  2WXN A;  2QDF A;  3AEG B;  3RFZ B;  2WXP A;  1XQQ A;  2KDI A;  2KO3 A;  5CHW A;  2FCN A;  3DQV A;  3DBL I;  1V81 A;  2CJN A;  4EKU A;  1OTR B;  4W9C A;  1F9J A;  2KVZ A;  1LXD A;  3ONS A;  4HCN B;  3ZQ4 A;  3N9Y C;  1RM6 C;  5DPT A;  3RMK C;  2RD0 A;  3TEZ A;  3EA6 A;  1HQR D;  2Q5W D;  3LXF A;  1C79 A;  2JRH A;  3AEF B;  3A9K A;  3ZNH B;  3AE2 B;  3M62 B;  1DOX A;  4RGT A;  2N1V A;  3WAN A;  1FXI A;  2MJE A;  4WQM A;  4S0R A;  1K52 A;  3Q14 C;  3A9K B;  3K9O B;  3TMP B;  4IWP A;  3DHI C;  4IG7 B;  2RPV A;  3RNE C;  1L5P A;  4RF0 A;  1YOV B;  2KD0 A;  3I63 C;  5GXG B;  3ZJT A;  4TV3 A;  3ZNG C;  2K5P A;  1HXY D;  4US8 A;  4GSW A;  1JWM D;  4KGS A;  2I2Y A;  1UEL A;  3PGE A;  3SFD B;  4MEM A;  1TYG B;  1GNU A;  2SAK A;  3SD5 A;  1ZDX A;  1K51 A;  3U8Z A;  3M63 B;  3HM3 A;  4YT0 B;  3IBE A;  3N32 A;  4BKG A;  4EZK A;  1KJT A;  3Q69 A;  5C23 A;  1ZP0 B;  4HVB A;  4GU2 A;  1WRD B;  3MJW A;  5D94 A;  3GE8 C;  1J7C A;  4M01 A;  5EE0 A;  2ZPY A;  1E9M A;  4B9K A;  2A4Z A;  2LUE A;  3OLM D;  4C56 C;  2N9L A;  1JWB D;  1HEZ E;  1XCT L;  4ARI A;  2KAJ A;  1QT9 A;  4GN1 A;  4RGN A;  3FAH A;  2KLG A;  2CHZ A;  4LNO A;  1GPX A;  4OHJ A;  1EU4 A;  3FIL A;  2QEJ C;  1LQB A;  3VUX A;  4AJW A;  2GMI C;  2ZW1 A;  4HEA 1;  5BYR A;  1ET6 A;  4USA A;  1C4A A;  1ISN A;  3TEY A;  1P9D U;  4AJY B;  2N4F A;  2PW9 A;  3PLV A;  5HHD G;  3TL5 A;  4XGA B;  2PJH A;  4AUQ C;  1RWS A;  2KJ6 A;  4ZYN A;  3SU8 X;  2VRR B;  3DBR I;  2D07 B;  2LD9 A;  2INN E;  2BS2 B;  4C4V A;  2MBQ A;  1WH3 A;  3BVZ A;  2O6V A;  5BO4 B;  2LHD A;  1VJK A;  3PTF C;  3N1X C;  3D32 A;  4RFB A;  3HVD A;  1UD7 A;  3DHG C;  4NJ6 A;  3WA0 A;  4XWW A;  4P1C C;  2WXI A;  5CTR C;  3VTV A;  2BKR B;  2DZJ A;  4A9A A;  1V5O A;  3PHX B;  4PYZ A;  4WJN A;  1YNT E;  2ACZ B;  2HD5 B;  4WWP A;  2DZK A;  2WLB A;  1UZX B;  3OJ4 B;  2GBJ A;  4IUM B;  1L6V A;  2O6V B;  3DBR B;  1KM7 A;  4II3 B;  1LFD A;  4C4V B;  4G50 A;  4ZHP A;  4MGZ E;  3Q8A A;  4DDG D;  2H88 B;  1JRU A;  2KMA A;  1WJU A;  1G6J A;  3FC4 A;  3H1U A;  4BKS D;  1J19 A;  1C76 A;  3ZTC A;  1ESF A;  3L54 A;  1D5M C;  2DX5 B;  1WMH B;  3PHW B;  3ZJU A;  5G55 A;  2PMV A;  2IGH A;  3PS6 A;  1N5W A;  2ZCB A;  3L0W B;  3PO0 A;  3L4P A;  1TZO A;  3PPA A;  4FXC A;  5EDS A;  1IYF A;  2AQ3 B;  4NY0 A;  3VUW A;  2YLM A;  5HFY A;  2NS5 A;  2IO3 B;  2LXC A;  1ROE A;  2K6Q A;  2ZW0 A;  4OZA A;  5KHO A;  3EHV A;  2WXQ A;  2Z8L A;  2JVC A;  4YTM B;  4L1B A;  3TIX A;  3ZXR A;  4M8N A;  2K22 A;  2R2O A;  2AL6 A;  2DEN B;  1TGZ B;  2JZ3 B;  1J7A A;  1SJE D;  2WQY B;  5AZG A;  3I9V 1;  4DXG A;  4JX1 C;  2JT4 B;  5IAA C;  1YJ1 A;  1JWA D;  1L0X B;  2REX A;  1GG3 A;  2X8X X;  2G45 B;  2AL3 A;  4IOI E;  5E6P A;  1FNU A;  1NI3 A;  1WGD A;  1D5Z C;  4IW0 A;  3ECI A;  2QJL A;  2J0K A;  2PKO A;  4DQO C;  2KYW A;  4NJ7 A;  1TIF A;  2N9E B;  3NZS A;  5EE9 A;  2B76 B;  2PEA A;  4KIK B;  1WX8 A;  1QZE A;  2G1E A;  2IY0 B;  2NR2 A;  3BYT B;  1WGR A;  1RRB A;  4ZRP A;  3RZF A;  2N9P C;  3CSF A;  3VR9 B;  2M17 A;  4JQW C;  2YEP F;  1CQV A;  4RF1 A;  4BVU C;  4JWU C;  2Y5B B;  2WXR A;  2J52 A;  1EO6 A;  1EWC A;  1E10 A;  2BS4 B;  1KOT A;  2RMM A;  3BY4 B;  4R3D A;  2KFJ A;  2R61 A;  1JML A;  1T6B X;  3UGB B;  4ZOH C;  3DOW A;  2KJR A;  2DAJ A;  4EZJ A;  2V3S A;  4JIO U;  3WIM A;  2BW2 A;  1L4Z B;  3GS2 A;  3O65 B;  4QAY A;  4TUU A;  4KKI A;  3V60 A;  1FCC C;  1C78 A;  2MRP A;  2HE7 A;  5IA7 A;  4HDO A;  2UWQ A;  3ZO5 B;  2G4S A;  4MGK E;  3QC8 B;  1GAQ B;  4BBN F;  5L95 C;  4WAA A;  1HTQ A;  1QOF A;  2BT6 A;  4C7Z A;  1I4G A;  4DXA B;  3QK0 A;  3KWL A;  1Z5S B;  1P98 A;  4WIP A;  4MH8 A;  2G4D B;  4WJP A;  4X57 B;  2VH2 A;  4GDL B;  1PYW D;  3M3J A;  1N62 A;  2QIL A;  4JPS A;  2LUM A;  4W9F A;  3PRZ A;  2ASQ A;  2MBE A;  3H7S A;  3AE4 B;  4K1R B;  2K1F A;  2MP2 B;  3APC A;  1J7B A;  5TSS A;  3O13 A;  4FHK A;  2L7R A;  1VCB A;  1J0G A;  2LXA A;  4HRS A;  3MC8 A;  1IUE A;  5D6J B;  5D3D A;  4C00 A;  4LNK A;  1RAX A;  5BMI A; 
#chains in the Genus database with same CATH homology
 3WAP A;  4MSQ B;  2DYM A;  4K7S A;  4W9E A;  1WXV A;  2KXJ A;  1EF5 A;  3LDZ E;  3R66 C;  3IFW B;  1V2Y A;  1ZGU B;  2MP2 A;  4W9G A;  4ZRK A;  2PE9 A;  3OJ3 A;  1WXS A;  2CKH B;  3H9D A;  1TTN A;  1Q5W B;  1E7U A;  4JL9 A;  5CX3 A;  2ZVN A;  2B3A A;  2UYZ B;  4W9D A;  2KTR A;  4IC7 B;  4DWF A;  3QAQ A;  5D7G A;  3VUY A;  1OQY A;  4LDT D;  3QHT A;  2IO1 B;  2XK5 B;  1IPG A;  2OJR A;  5DPR A;  3VTW A;  5KHQ A;  1C3T A;  3IVF A;  1Z2M A;  3BIN A;  4F1S A;  4KDL B;  2AWT A;  4MSM B;  2O2V A;  3PVL A;  4MM3 A;  3KVF B;  3JVZ X;  3HIZ A;  4IWO A;  2IY1 B;  3JSV A;  3NY5 A;  3RZW C;  2LVO A;  2RPQ A;  2D11 A;  3QWZ B;  5AZH A;  1WXA A;  2YVC A;  3V6C B;  2J7Q B;  1ZKH A;  4GB9 A;  2HJ8 A;  4CYE A;  3QJZ A;  3RCZ A;  3ZW3 A;  1H8C A;  1XQQ A;  1A5R A;  1SE9 A;  2KDI A;  2KO3 A;  3PZD A;  5LXI B;  5DCN A;  2BGF A;  3VDZ A;  1WGG A;  2BYV E;  2W9N A;  4HPL B;  2WX1 A;  2FCN A;  5CHW A;  2G3Q B;  3DQV A;  4IWQ A;  4FA6 A;  2EKE C;  2GBK A;  3DBL I;  2FAZ A;  4EEW A;  1V81 A;  3VH3 B;  4EKU A;  1L2N A;  3B0A A;  4GIV A;  1OTR B;  4W9C A;  2WX0 A;  1F9J A;  2BWE S;  3NHE B;  2FIF A;  1LXD A;  5L83 A;  2RSU A;  4E74 A;  3C0R B;  3ONS A;  3DCG A;  4HCN B;  5D2M B;  2KZR A;  1T0Y A;  5DPT A;  2RD0 A;  3AXC A;  4JGH B;  5FR6 A;  3PV1 A;  2MCN B;  1UBQ A;  4PS7 A;  3VHT C;  2BWF A;  3PT2 B;  1YX6 B;  1RFA A;  1WMH A;  2LGD A;  1V5T A;  2JRH A;  3A9K A;  1VD2 A;  2RR9 A;  4WJQ A;  4ZRI A;  3ZNH B;  3M62 B;  5HKH A;  2N1V A;  3WAN A;  4I6P A;  1YD8 U;  2NCN A;  4FBJ B;  2KC2 A;  2KKC A;  1C1Y B;  1BT0 A;  3U7D A;  3IHP C;  3Q3F A;  1WIA A;  3A9K B;  2KOX A;  3EFU A;  3K9O B;  1WYW B;  4IWP A;  4RM9 A;  3TMP B;  1E8X A;  1WY8 A;  2BYE A;  2QHO A;  4MJS A;  2FID A;  2WDT B;  4IG7 B;  3KYD D;  1NDD A;  2KD0 A;  2I1J A;  2KMC A;  4TV3 A;  3ZNG C;  4IM2 A;  2KHW B;  4E3C A;  2ZPN A;  5CHF A;  4ANU A;  1K8R B;  2L76 A;  1OEY J;  2KDE B;  5JZE B;  1E8W A;  4GSW A;  4MDK E;  1UEL A;  3PGE A;  4FUL A;  4N9F 4;  4PYU A;  4WWN A;  2IO0 B;  1NBF C;  4MEM A;  5GMV A;  2JXX A;  4GOC A;  2C7N B;  1GNU A;  1FXT B;  1WE6 A;  4GDK B;  3DVN V;  4NAW B;  3SD5 A;  4A3O A;  2MLB A;  4K81 A;  3U8Z A;  2MBO A;  3M63 B;  3HM3 A;  4EZL A;  3IBE A;  2Z0D B;  2O6V D;  3N32 A;  3ZUN A;  4BKG A;  4CO7 A;  5J2R A;  4EZK A;  1KJT A;  3HK0 A;  5C23 A;  4HVB A;  4DBG A;  4GU2 A;  1GJZ A;  1WRD B;  3A9J B;  3MJW A;  5D94 A;  1AAR A;  4KSK C;  3A9J A;  2LGY A;  4LDT B;  2GOW A;  2ZVO A;  4ANW A;  2MSE D;  2BF8 B;  3DVG Y;  4EFO A;  1L7Y A;  2ZPY A;  4W9L A;  3RYT A;  4B9K A;  2A4Z A;  2JZZ A;  3DVN U;  4NAW A;  4ANX A;  2LUE A;  3OLM D;  2KTR B;  3ENE A;  3RUL A;  4AWJ A;  4LJP B;  2D10 A;  3A4R A;  3JYU A;  2C60 A;  4DHZ E;  2LJ5 A;  4B6W A;  2MWS B;  5DPS A;  5JHB A;  4F8C B;  3VFK A;  4EOY A;  3PRE A;  2KLC A;  4GN1 A;  2EMS A;  4BFR A;  2KLG A;  1WFY A;  5DPW A;  2ZJD A;  2CHZ A;  3UIO B;  2MBH A;  2R2Q A;  1GUA B;  5J17 A;  2KN5 A;  4GMV A;  1LQB A;  3VUX A;  3VH4 B;  4I6N B;  4AJW A;  3ZNZ B;  3PRP B;  2GMI C;  4MGY E;  4DHZ B;  3L17 A;  3ZDT A;  2JPH A;  1P1A A;  2L00 B;  4ZDV A;  1CMX B;  1XD3 B;  4WQO B;  3JW0 X;  4KZ0 A;  4E71 A;  1ISN A;  4P7I A;  1P9D U;  1WJN A;  3PLU A;  2AEH A;  1WF9 A;  2A5U A;  2ZCC A;  3QX1 A;  4AJY B;  3SDL C;  4EUT A;  2N4F A;  2DAF A;  2N1W A;  1PQS A;  3PLV A;  3TL5 A;  1WE7 A;  4BKS A;  2KVR A;  1H4R A;  2PJH A;  4AUQ C;  2KJ6 A;  1WM3 A;  4ZYN A;  3SU8 X;  3MTN B;  1WM2 A;  2VRR B;  3DBR I;  2D07 B;  2LD9 A;  2NPT B;  4URK A;  3APD A;  1M94 A;  2MBQ A;  1WH3 A;  2ZNV C;  3DBH I;  4GDL A;  2O6V A;  5BO4 B;  3R3M A;  2KTF A;  1P0R A;  4RM8 A;  3S2A A;  3Q3J A;  2NBV B;  2FCM A;  3PTF C;  2GBR A;  2M0X A;  3D32 A;  3LJ3 A;  4NQL B;  3A33 B;  1WX9 A;  4F7Z A;  2N7E A;  4FHJ A;  4K7W A;  2C9W B;  1UD7 A;  4NJ6 A;  2L05 A;  3WA0 A;  4WJO A;  5CTR C;  4TQ0 A;  2KQS A;  5G2N A;  3VTV A;  2BKR B;  2LAS A;  3UQA A;  2DZJ A;  4GDK A;  3QQ8 B;  3VTU A;  1LM8 B;  2DHZ A;  2KWC A;  1V5O A;  3PHX B;  4PYZ A;  4LCD E;  4WJN A;  1WJ6 A;  3KH0 A;  4I6L B;  5LXH A;  4XC2 A;  2CHX A;  1Y8R C;  4WWO A;  3UF8 A;  2L8J A;  3ZRC A;  2HD5 B;  4HLE A;  4HWI B;  4AP4 C;  4XZ4 A;  1V9J A;  4WWP A;  3RD2 A;  3EC8 A;  1J8C A;  4FJV B;  2EMT A;  1UBI A;  2MA9 B;  2DZK A;  1YIW A;  1WJ4 A;  3EEC A;  3JSV B;  2IZV B;  2L0T A;  1NI2 A;  1UZX B;  3H6N A;  3A4S C;  4HXD A;  1HE8 A;  2O2V B;  3R7R A;  3OJ4 B;  2GBJ A;  2K39 A;  4IUM B;  1R4N I;  2O6V B;  1KM7 A;  2K25 A;  4II3 B;  2DYB A;  1LFD A;  4IM3 A;  4MH0 E;  1I35 A;  2XK5 A;  4G50 A;  2NPT A;  4MJS B;  3VQI A;  1E90 A;  4MGZ E;  1OGW A;  4G0N B;  4HK2 A;  1WR1 A;  2K8H A;  3PRM B;  1WGH A;  1WXM A;  4BBN C;  2CR5 A;  4DDG D;  4HDQ A;  4K7U A;  2PE6 B;  1JRU A;  2KMA A;  3KUZ A;  1WJU A;  3HM6 X;  1G6J A;  1V86 A;  2JRI B;  2K8B A;  4NPN A;  3H1U A;  4BKS D;  2ZNV B;  3T8M A;  1J19 A;  1R4M I;  5E6O A;  3ZTC A;  2KC1 A;  3WAL A;  3L54 A;  3GOE A;  4G3X B;  2KAN A;  2DX5 B;  3CST A;  1WMH B;  2N7D A;  3PHW B;  5LLI A;  4ZRJ A;  2LZ6 A;  2NVU I;  4HCP B;  2D2Q A;  4J6I A;  5G55 A;  2JF5 A;  2NBW B;  3PS6 A;  2KQ7 A;  2MBB B;  3W1S A;  2IBI B;  4KDI C;  2M4N A;  3K9P B;  4KIK A;  2ZCB A;  2IYD B;  3L0W B;  2GBM A;  4KZC A;  2LWP A;  3VXW A;  1X1M A;  1WZ3 A;  3PPA A;  4DK5 A;  1TBE A;  4FJY A;  5EDS A;  1IYF A;  4OVV A;  1Q1O A;  2K8C A;  4NY0 A;  3VUW A;  1WI0 A;  2YLM A;  3HHM A;  3KUC B;  2KDF B;  3M95 A;  1OEY A;  2LI5 A;  2NS5 A;  2KWV B;  3AU5 A;  3ML9 A;  5AZF A;  2IO3 B;  2PPH A;  4PS8 A;  3KUD B;  2LXC A;  2K6Q A;  3N3K B;  3R7Q A;  2DZI A;  2NBU A;  1YQB A;  5KHO A;  1MG8 A;  3EHV A;  1D3Z A;  2WWZ A;  1WGY A;  2JVC A;  1KLV A;  3V62 A;  3TIX A;  4II2 B;  3H7P B;  4M8N A;  2K6D B;  5AEK B;  1EF1 A;  2R2O A;  1UH6 A;  4LJO B;  3ZVV A;  3P2B A;  2BKF A;  2RGF A;  3CF6 E;  3DVG X;  2KX0 A;  2AL6 A;  2DEN B;  2FNJ B;  1TGZ B;  2JZ3 B;  4XX5 A;  3X23 A;  2LVP A;  4A20 A;  2J0M A;  5AZG A;  2HTH A;  3NZU A;  3UIN B;  2JT4 B;  3QAR A;  1YJ1 A;  5IAA C;  2N9X A;  2REX A;  1GG3 A;  1RLF A;  4G11 A;  2G45 B;  2AL3 A;  3AI5 A;  4PS3 A;  5E6P A;  3ZRF A;  1WGD A;  3I3T B;  2MW5 A;  5TR5 A;  3VAW A;  3UQB A;  3ECI A;  1GC7 A;  2C5L C;  2J0K A;  3NOB A;  4IW0 A;  3ALB A;  3X0W A;  4BOS C;  2BPS A;  2M8S A;  1WZ0 A;  4NJ7 A;  2C7M B;  4FJZ A;  4FLH A;  3DBS A;  1UGM A;  2C7H A;  2DYO A;  3ZDM C;  3KW5 B;  2N9E B;  3NZS A;  3L13 A;  3WAM A;  2PEA A;  4KIK B;  1WX8 A;  2GBN A;  1E8Y A;  1QZE A;  2BYF A;  2KDB A;  4A3P A;  2IY0 B;  2FCS A;  2NR2 A;  3IG3 A;  2WYQ A;  2LRU A;  3A1Q B;  2FUH B;  2KNB A;  2M1M A;  1WGR A;  1RRB A;  3CMM B;  3RZF A;  3B08 A;  2N9P C;  3CSF A;  1ZW7 A;  2M17 A;  4JQW C;  4W9J A;  3TJP A;  3AU4 A;  1E7V A;  4BOZ B;  4BVU C;  1SIF A;  2ZEQ A;  2AYO B;  3T9L A;  2KK8 A;  4CHK A;  1E8Z A;  2Y5B B;  3PSE B;  4JLC A;  5CHV C;  4AOF A;  2L3Z A;  1EO6 A;  3DPD A;  4DDI D;  1E5W A;  4KV2 A;  4FAD A;  2JUO A;  4FN2 A;  2LVQ A;  4YL8 A;  1V80 A;  1KOT A;  4W9H A;  4RMA A;  4KVG B;  3RT3 B;  2L0F A;  3BY4 B;  4NNJ B;  3OAW A;  3L16 A;  5JHA A;  5J18 A;  2KFJ A;  3UIP B;  3L10 B;  2Z0E B;  2KJH B;  3UGB B;  2LRW A;  3DOW A;  1SGH A;  4ICU A;  1S1Q B;  2DAJ A;  2KJR A;  4EZJ A;  3QA8 A;  3L08 A;  3V61 A;  2V3S A;  4DHJ B;  4JIO U;  3WIM A;  3QIJ A;  2J0J A;  4ANV A;  4DHJ D;  3O65 B;  4IM0 A;  3W1S C;  4TUU A;  3TCA A;  3V60 A;  2CHW A;  2XEW A;  4GXB A;  2D3G A;  4HJK A;  1V6E A;  1YX5 B;  2HE7 A;  2MRP A;  4TQ1 A;  5E6N A;  5IA7 A;  4HDO A;  2UWQ A;  4GGQ A;  4NQK E;  3ZO5 B;  2G4S A;  3WAO A;  2CS4 A;  5JH5 C;  1Q0W B;  2LGX A;  3QC8 B;  1V49 A;  4MEL A;  3DDC B;  4MGK E;  4WAA A;  4BBN F;  5L95 C;  1WX7 A;  3QCA A;  2I1K A;  2Z59 B;  1IP9 A;  4W9K A;  3TBL D;  4DXA B;  3QK0 A;  3KYC D;  3V6E B;  1Z5S B;  1P98 A;  2DZM A;  3H7P A;  3MHS D;  2G4D B;  4WJP A;  4X57 B;  3ZLZ A;  1EUV B;  4HPM B;  3ML8 A;  3N30 A;  2V4L A;  1I42 A;  4GDL B;  2V1Y A;  4ASW C;  3M3J A;  2IO2 B;  2OOB B;  3W1Y A;  4B95 A;  4MGI E;  2KX3 A;  3SHQ A;  4W9F A;  3B1L X;  3PRZ A;  2ASQ A;  4W9I A;  2MBE A;  1U4A A;  2ZZP B;  3NS8 A;  3H7S A;  3APF A;  2FCQ A;  1GC6 A;  3RUI B;  4OVU A;  1P3Q U;  4K1R B;  2K1F A;  2MP2 B;  4TKN A;  3GZN I;  3APC A;  4M0W B;  5C1Z A;  2JY6 A;  4FHK A;  2JWZ A;  3ZKJ C;  3ZNI D;  2L7R A;  2MQJ A;  1VCB A;  1J0G A;  4BKT A;  2LXA A;  2KFK A;  1WR6 E;  3A1Q A;  2CU1 A;  2MX2 A;  5D6J B;  4M8M A;  3ZIM A;  2XBB C;  1XT9 B;  3ZTD A;  3VVW B;  3AUL A;  1TZ1 A;  3U30 A;  1S3S G;  4KSL C;  1RAX A;  2KWU B;  4ICV A;  2KFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...