1L7YA

Solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
MSGGTAATTAGSKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGVGVNPAQPAGNIFLKHGSELRLIPRDRVGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of conserved eukaryotic protein ZK652.3 from C. elegans: a ubiquitin-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN ZK652.3
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1l7yA00
1WGGA 4MELA 5G2NA 4I6NB 3A4SC 2Y5BB 2K8HA 4AJYB 4IUMB 1QZEA 4BVUC 2KWCA 3ZRCA 1GNUA 2MX2A 3W1YA 3VDZA 3GOEA 1WX7A 1YJ1A 4XX5A 4DDID 4LJOB 2DZMA 2K39A 2KJRA 3PTFC 4A3PA 2FIDA 2LGXA 2GBMA 1WGHA 5GMVA 4KIKA 1UGMA 5E6NA 2GMIC 1WF9A 1WGRA 3H6NA 2ZPNA 4BKSD 2XK5A 3ENEA 2J7QB 1WZ3A 3ZDTA 2OJRA 2KWUB 1KOTA 3K9OB 3WANA 3HM3A 3HK0A 2DZIA 2WYQA 3PGEA 3PLVA 2REXA 1V81A 4XZ4A 1TGZB 2KN5A 2BYEA 2DZKA 1RLFA 4KIKB 2KLGA 3PLUA 2KQSA 1OTRB 1NDDA 3ZW3A 1S3SG 2PE6B 4MM3A 1WE6A 2HE7A 2K8CA 3EHVA 5J18A 4GSWA 3RYTA 1WFYA 4NJ7A 4DHJD 3SHQA 1YX5B 4FADA 1KM7A 2N1WA 4P7IA 3ZNID 3DPDA 4OVUA 3L16A 3M3JA 3ML8A 4OVVA 2GBJA 1WYWB 4G3XB 3L17A 4MSQB 1WGDA 1NBFC 2J0KA 3WIMA 1P0RA 2MP2A 3NHEB 3PRZA 3NZUA 3UQAA 4ZRJA 2DYMA 3DBLI 4GDKB 2CHZA 3WAMA 2KTRA 1FXTB 4GN1A 1T0YA 2BPSA 1Q0WB 2RGFA 4EKUA 4EUTA 1VD2A 2CHXA 1MG8A 4YL8A 4FN2A 4ICVA 4BBNC 4W9JA 1YIWA 2KMCA 2DAFA 3AU4A 2YVCA 4FJYA 5IAAC 3RZFA 3A1QA 3H7PB 2MBOA 3PV1A 5C23A 4HK2A 2D10A 4AJWA 3H9DA 3LJ3A 4HXDA 4ANVA 1ZW7A 4DHZE 4BBNF 3NOBA 2EKEC 2KTRB 1EO6A 2ZVOA 1R4MI 4TUUA 2DZJA 3KVFB 5DPTA 1JRUA 2KXJA 3PRMB 4W9LA 3VAWA 2G4SA 4DBGA 2L05A 4WWNA 4FJVB 3A9JB 4W9EA 3ALBA 3MTNB 3ECIA 1XT9B 4KV2A 5CX3A 2GBKA 4DDGD 3PS6A 2NPTA 3VUXA 3QARA 3QAQA 4KSLC 1E5WA 4F8CB 4II3B 4KZ0A 4LCDE 3Q3JA 1AARA 2LRUA 4GB9A 4NY0A 3P2BA 2L00B 1Y8RC 4FULA 4JQWC 4NPNA 2WX1A 3DVNV 2LRWA 2N4FA 3PSEB 4HPLB 3VTWA 1I35A 1WZ0A 4HDOA 1M94A 2KK8A 2MBBB 2O6VA 1Z5SB 2PPHA 2MLBA 3APCA 4FHKA 2I1KA 2NPTB 4WJPA 1WI0A 2N7DA 2XEWA 3L13A 4HWIB 2BKRB 2BYVE 1WM3A 4MGKE 4IW0A 1A5RA 2LZ6A 4KVGB 1WIAA 2KX3A 4PS8A 4W9KA 3IVFA 2L8JA 3VTUA 2KDEB 3PT2B 5DPWA 1H8CA 3B08A 1ISNA 1E90A 2JY6A 2KFKB 5C1ZA 2AYOB 4WWPA 1P98A 4GDLB 4GU2A 1G6JA 2O6VD 4MEMA 1E7UA 1WRDB 3W1SA 2M17A 2IBIB 2W9NA 2O2VB 4AUQC 1WM2A 3KYCD 3CMMB 2D3GA 1I42A 2NCNA 3DVGY 3DDCB 3WA0A 3V6EB 3RT3B 2JXXA 2NBVB 4EZLA 1OEYJ 1U4AA 2Z0EB 2EMSA 2ZJDA 2I1JA 2MQJA 4IM3A 5G55A 1VCBA 2AL6A 3L10B 3DBHI 3QA8A 1WX8A 4B6WA 3A1QB 2DYOA 2LVQA 2JF5A 4MJSA 3U30A 1GJZA 1V49A 4FBJB 1ZKHA 4ZDVA 3TBLD 4AP4C 4K7SA 2FCSA 2ZNVB 4NJ6A 4A3OA 1CMXB 2JRIB 2NS5A 4LDTD 3RCZA 3A9KA 1SGHA 4AWJA 2CR5A 2ZCBA 4G0NB 4WJOA 3VH4B 3ZNHB 3W1SC 1NI2A 4FHJA 1GG3A 1GC6A 2DYBA 4FJZA 4HLEA 1OEYA 4W9DA 4EFOA 2M4NA 5E6PA 1E8YA 1J19A 1XD3B 5KHOA 3JSVB 3R66C 4II2B 3VQIA 5AZFA 4B9KA 3MJWA 4CHKA 3EC8A 2KANA 3QWZB 3UGBB 1IPGA 3DQVA 1J8CA 4MH0E 4URKA 4NAWB 3DVNU 3UINB 2ASQA 2KD0A 2ZEQA 5AZHA 3ZIMA 2D11A 1WE7A 5TR5A 2N9EB 2UYZB 2M1MA 2M0XA 2XBBC 3RZWC 5D7GA 1LM8B 3OAWA 1OGWA 3DOWA 4M0WB 3TMPB 5EDSA 1L7YA 3EFUA 4PS7A 1RFAA 3B1LX 2DHZA 1UBIA 5CHFA 3KW5B 3BY4B 5D2MB 3PPAA 3O65B 4ANWA 4ZRIA 5JHAA 3QC8B 5DCNA 4E71A 2DAJA 2WWZA 1V86A 3PZDA 4GDLA 4WWOA 2WX0A 1KLVA 4M8MA 1EF5A 4PYZA 2PJHA 4ZYNA 5JZEB 2C7HA 3H7SA 5BO4B 2KOXA 4DWFA 1WXSA 2GOWA 5CHVC 5HKHA 4ASWC 3CSTA 3N32A 1UELA 4WJQA 3TCAA 3JYUA 2J0MA 2ZVNA 2L0TA 3L08A 1IP9A 2LUEA 2HTHA 3NY5A 2LI5A 3VHTC 4F7ZA 3WALA 2G3QB 2KX0A 3PREA 4XC2A 1Z2MA 3UIOB 2KTFA 2FAZA 4BKTA 2JZZA 3HM6X 4DHZB 2JT4B 5JH5C 4X57B 4DXAB 1C1YB 3QX1A 4BOZB 2MA9B 1RAXA 3ZUNA 3DCGA 1E8ZA 2KLCA 3TL5A 2C5LC 1WJUA 2MW5A 4IWOA 2K6DB 5FR6A 1Q5WB 4LJPB 4TKNA 4W9GA 2IY0B 3HIZA 2Z0DB 2V1YA 4W9HA 2CU1A 4BOSC 3KUZA 2N9PC 2AWTA 3QIJA 4MGIE 2AEHA 4PS3A 4GXBA 4K7UA 2LGYA 5AZGA 3SD5A 1IYFA 2KC2A 2BF8B 1XQQA 3R3MA 3AI5A 4MDKE 5DPRA 2CHWA 2FNJB 2KNBA 3DVGX 3IFWB 3JSVA 3V60A 5J17A 5KHQA 5LLIA 2OOBB 2BWES 2WDTB 3VFKA 4ANUA 4GIVA 4NAWA 1GUAB 1S1QB 1WH3A 4DK5A 1C3TA 4W9FA 1WR1A 1V6EA 2C7NB 3A9JA 3QJZA 3U8ZA 3ZNGC 4BKGA 3QK0A 2BGFA 2J0JA 3R7RA 2UWQA 2IO3B 2IO0B 2XK5B 4E74A 2C60A 3PVLA 4GMVA 4M8NA 3VVWB 2LXAA 2LVPA 2VRRB 3NZSA 4EOYA 4EZJA 2QHOA 2L0FA 2LJ5A 3APDA 4KSKC 3MHSD 2R2OA 1YD8U 1ZGUB 2C9WB 3BINA 2IYDB 3CF6E 3Q3FA 3QCAA 2GBRA 4WQOB 3HHMA 1WXVA 2L7RA 1YQBA 1K8RB 2LGDA 2K1FA 4ICUA 2MCNB 2O6VB 1Q1OA 2V3SA 2MSED 3I3TB 2KDBA 1TZ1A 2KMAA 3PRPB 5E6OA 5JHBA 3PHWB 2KWVB 2JVCA 2KVRA 4TQ1A 3OJ3A 3V61A 2JWZA 2HJ8A 2MBEA 2MRPA 2RR9A 2CKHB 3APFA 2EMTA 2PE9A 3C0RB 2JPHA 3CSFA 4JL9A 2KHWB 4NNJB 3RUIB 4GGQA 3UIPB 2LD9A 2KO3A 3AULA 3QQ8B 2G4DB 3M62B 2B3AA 2HD5B 1KJTA 2IO2B 3IG3A 3X0WA 3DBSA 4E3CA 1LXDA 2MWSB 4GDKA 3K9PB 1SIFA 2A5UA 1P9DU 2ZZPB 1E8WA 2JRHA 3B0AA 4RM8A 5D6JB 5D94A 3RD2A 4HVBA 1V80A 1F9JA 1D3ZA 2O2VA 2G45B 3L54A 4RM9A 3ZTDA 3UF8A 3GZNI 4HCNB 2DX5B 4I6PA 4J6IA 3H7PA 2NVUI 3ZTCA 3UQBA 1UD7A 4MGZE 1J0GA 2IO1B 1PQSA 4BKSA 4IWPA 4MGYE 3VTVA 2Z59B 3WAOA 3ZO5B 1UBQA 3VUWA 2JUOA 3QHTA 4EZKA 4G11A 1L2NA 4G50A 4EEWA 1WXMA 2A4ZA 3DBRI 2K25A 2ZPYA 2LVOA 3NS8A 4W9CA 4JIOU 1WGYA 1OQYA 4IG7B 3TIXA 3OJ4B 3N30A 4K1RB 5LXHA 2KDIA 1WXAA 2M8SA 4FA6A 3S2AA 2BYFA 2KKCA 4F1SA 3AU5A 3SDLC 3ZLZA 2KC1A 4MSMB 4IM0A 4PYUA 3KUCB 4KDIC 3ZRFA 4TQ0A 1WMHA 5CTRC 3R7QA 1V5TA 3IHPC 5CHWA 2KJ6A 1GC7A 2MBHA 1WX9A 3LDZE 2IZVB 3VXWA 4K7WA 3T8MA 4BFRA 1WJ6A 4IM2A 2N7EA 1RRBA 2KJHB 2YLMA 2GBNA 2IY1B 1WJNA 2ZCCA 3VH3B 3X23A 1WMHB 4AOFA 2RSUA 1HE8A 3KUDB 3N3KB 4ANXA 4CYEA 2D2QA 4FLHA 1EF1A 2D07B 2ZNVC 2KZRA 3D32A 5AEKB 3L0WB 2V4LA 1YX6B 5DPSA 4IC7B 4JGHB 4WJNA 1SE9A 2DENB 4DHJB 2FIFA 4B95A 1BT0A 1R4NI 3V62A 2FCNA 2NBUA 3OLMD 3TJPA 5LXIB 1H4RA 2LWPA 2AL3A 2FCQA 4TV3A 1P1AA 1UZXB 2KQ7A 4CO7A 1WY8A 2K8BA 4A20A 1E8XA 1P3QU 1WJ4A 3A33B 1TBEA 3U7DA 3EECA 2MBQA 1LFDA 3M63B 1V2YA 3ONSA 4WAAA 5L95C 4HCPB 4HPMB 2NR2A 3T9LA 3ML9A 2MP2B 1WR6E 4GOCA 4NQLB 2NBWB 3WAPA 1E7VA 4W9IA 2L3ZA 3PHXB 2C7MB 2KFKA 3A4RA 3ZDMC 2BWFA 4KDLB 2JZ3B 4IWQA 4MJSB 3ZVVA 3V6CB 2N9XA 5J2RA 1LQBA 2PEAA 4K81A 4KZCA 3KH0A 2CS4A 4ZRKA 1EUVB 3AXCA 2N1VA 5L83A 2RD0A 2KFJA 2RPQA 2K6QA 4HDQA 3KYDD 4NQKE 2BKFA 2R2QA 3H1UA 4RMAA 1V9JA 1TTNA 3SU8X 3JW0X 2FCMA 3A9KB 4JLCA 3VUYA 2L76A 2LASA 4LDTB 3ZNZB 2FUHB 3JVZX 1V5OA 3M95A 4N9F4 2LXCA 3IBEA 2KDFB 1UH6A 3ZKJC 4I6LB 5IA7A 3RULA 1X1MA 4HJKA
chains in the Genus database with same CATH superfamily
1WGGA 3AE4B 3I9V1 2LEKA 4MELA 5G2NA 4XWWA 1T6BX 2KMMA 4IUMB 1QZEA 4BVUC 2KWCA 1GNUA 1YN4A 1N60A 3GOEA 4XX5A 1YJ1A 1TS4A 1PGBA 3KQ4A 1J7CA 2FIDA 1WGHA 5GMVA 4KIKA 5E6NA 1RM6C 3ENEA 4RF1A 2OJRA 2BVCA 2KWUB 4ARCA 3E9SA 3PGEA 3PLVA 4UDUC 3ZJTA 3AEFB 1NDDA 3MFGA 1WE6A 2K8CA 3Q2AC 3RYTA 4NJ7A 2D3CA 1YX5B 2LGSA 4FADA 1UF0A 3HRDD 1NBFC 2MP2A 3PRZA 4ZRJA 3DBLI 4ZRPA 2CHZA 1T0YA 1WWTA 3CWIA 3PZ8A 2CHXA 1ZDVA 1CK1A 4FN2A 2H89B 1JRPA 2DAFA 4RFBA 5C23A 1MPEA 3FKYA 2EKEC 1EO6A 3RI7C 2DZJA 3DHGC 1N6ZA 2NMQA 3PRMB 2KAJA 5BYSA 3A9JB 1E7PB 4XDDA 4KV2A 2GBKA 4YWGG 1VJKA 4ZRQA 1C78A 4NPNA 2WX1A 3DVNV 2LRWA 2N4FA 3PSEB 1I35A 3BYYB 4HDOA 2MLBA 1Y56A 2N7DA 2XEWA 3L13A 1F0ZA 1EU4A 4PS8A 3IVFA 2WS3B 3L4PA 3NVWA 5DPWA 1H8CA 1E90A 2BS3B 1D5MC 1L0YB 2AYOB 3W5UB 2KT7A 2L1AA 4GDLB 4MEMA 2AQ3B 2IBIB 2CJNA 2L32A 2D3GA 2NCNA 1SXTA 5IO9A 4IM3A 1ET9A 2KN4A 3R8BA 1GJZA 1V49A 1VZ7A 4FBJB 1MI0A 2E3TA 4ZDVA 4K7SA 3N1XC 3RCZA 4YTNB 3AEDB 4EE2A 2IGHA 2K9XA 1T3QA 2QDFA 5EE1A 1SE4A 3ZNHB 3W1SC 5I4DA 4HLEA 2WHIA 1I4GA 3R66C 3O13A 3VQIA 1NYRA 1N62A 1ZXHA 2KANA 2EKIA 1IPGA 1ZE3D 4MH0E 4URKA 4NAWB 1QLBB 2XBBC 2M0XA 2QJLA 3B2GA 3RZWC 3RPFC 4A90A 3MC8A 1OGWA 4M0WB 3C19A 2M56B 3EFUA 4PS7A 2XNAC 1RFAA 2DHZA 1UBIA 2FBWB 1ZXIA 1D4BA 5JXVA 2JYEA 2LHEA 4B0MA 2WWZA 3PZDA 1FNUA 4M8MA 1EF5A 5JZEB 1GPXA 4DWFA 1LGRA 2GOWA 1UELA 2ZVNA 1F1HA 3VHTC 4F7ZA 2KX0A 2ICIA 2KTFA 3Q8BA 2FAZA 4BKTA 5JH5C 3GE8C 4X57B 2Y5PA 1QOGA 1FD6A 4N58A 2IY0B 3OWEB 3HIZA 2HJ1A 2B76B 2N9PC 2WXNA 3QIJA 4MGIE 2AEHA 4GXBA 4K7UA 1IYFA 2KC2A 3AE5B 3R3MA 5DPRA 2JXTA 3DVGX 3JSVA 1T0QC 2OOBB 4XDCA 2WDTB 2DWQA 4NAWA 1GUAB 2JU6X 4KKJA 1WH3A 4DK5A 1F52A 4W9FA 2OEDA 1WR1A 1JCKB 1V6EA 2C7NB 2BGFA 4BZAA 3R7RA 2UWQA 4C00A 2C60A 4GMVA 2LVPA 2VRRB 2W3RA 1IBXA 4KSKC 3MHSD 4BAXA 2BB6A 1YD8U 2D3AA 2L52A 3CF6E 1VRAB 4WQOB 1K51A 2L7RA 1YQBA 2IJ0A 5E6OA 1TZ1A 2KMAA 3PRPB 4ZHPA 1AYFA 3P63A 4TQ1A 1TJEA 1I4PA 3OJ3A 3APFA 2CKHB 2EMTA 1FM0D 1L4ZB 4NNJB 1N61A 2OJWA 3BZDB 2G4DB 4HEA1 1YJJA 3X0WA 4O1NA 4GDKA 2A5UA 1E8WA 4HVBA 3P4SB 1V80A 3ZTDA 3H7PA 2NVUI 1UD7A 2BQQA 2CJOA 4MGZE 5EE0A 1J0GA 2IO1B 4XWTA 4IWPA 4HPPA 1NENB 3ZO5B 3I57A 3NJTA 2Z8LA 1L2NA 4EEWA 2TSSA 1WXMA 3DBRI 5IN7A 2K25A 1PGXA 2LVOA 1WGYA 4IG7B 5TSSA 2MH7A 1SE2A 4ACFA 2M8SA 4FA6A 3S2AA 2BYFA 3ZLZA 3R7QA 1V5TA 4LK0M 1WJ6A 3V05A 2ZCCA 2RSUA 1HE8A 3AEGB 3N3KB 1DOIA 1ACCA 2D2QA 1YJIA 5H8YE 5BMHA 5AUIA 1CJEA 2LGIA 5HHDG 2FIFA 3N9YC 1R4NI 2FCNA 1C76A 3OLMD 5LXIB 1FIQA 4TV3A 2WXOA 2BBCA 1WY8A 2K8BA 4P6VF 1NI3A 2RMMA 3MC9A 3C8YA 1JWBD 1V2YA 2GI9A 3ONSA 4WAAA 4HPMB 1SSNA 3ML9A 2MP2B 1WR6E 4C7YA 3PHXB 2JZ3B 4IWQA 5J2RA 2N9XA 1LQBA 2ZW0A 4KZCA 4LNFA 5L83A 2KFJA 2N7JA 2RPQA 4NQKE 3H1UA 1TYGB 1V9JA 4LDTB 3ZNZB 2FUHB 3JVZX 2LXCA 3AE9B 2KDFB 2KWDA 5FKAC 5IA7A 1KH0A 2K22A 4AJYB 1QKZA 4YXDB 1WX7A 3RFZB 2INPE 4LJOB 2DZMA 3PTFC 2KJRA 4A3PA 2IGDA 3Q8FA 2GBMA 3BYTB 3LXFA 1WGRA 2ZPNA 4ARIA 2J7QB 4TSSA 2K5PA 2QMTA 1SB3C 3K9OB 4RGOS 3AE8B 3HM3A 4XZ4A 2FUG1 1QF6A 4KIKB 2KQSA 4P1CC 3ZW3A 2PE6B 4MM3A 1BXTA 4N6EB 4KX6B 1KM7A 4P7IA 1WXQA 3TEYA 4MSQB 1FFUA 1JROA 2MJDA 1P0RA 3Q8CA 1VZ8A 1FPYA 1JWAD 5G5HA 1HTOA 2KTRA 1FXTB 2BPSA 1Q0WB 2RGFA 4EKUA 1MG8A 4ICVA 1YIWA 1ESFA 4FJYA 2V0GA 3RZFA 1P7EA 2MBOA 3PV1A 2D10A 4AJWA 4US9A 1RWSA 4PK1A 1ZW7A 4DHZE 4TUUA 5DPTA 3R2IA 1JALA 3ZYYX 2L05A 4NAMA 4W9EA 3AH7A 3ALBA 4XE0A 1KFYB 2X8XX 5CX3A 4DDGD 2KQ4X 3QAQA 2KACA 4KZ0A 2LRUA 4GB9A 4PT5A 2L00B 4JQWC 1E9MA 4OZCA 1N5XA 5IP4D 1M94A 2MBBB 3RNFC 3Q6BA 4WAFA 1QOAA 2NPTB 1WI0A 2WLBA 1WM3A 1ZOYB 3EUB2 4WIPA 4KGSA 2LZ6A 2QILA 2L8JA 1TKYA 3PT2B 1ISNA 3BK2A 2J42A 2W82A 2M0AA 1E7UA 3W1SA 2OHFA 1D5XC 1CZPA 2O2VB 3CMMB 2ACZB 1I42A 3DDCB 2PTLA 2NBVB 4EZLA 4OZBA 2EMSA 4P1BC 3I63C 2AL6A 3QA8A 3DBHI 1WX8A 1ZKHA 1MG4A 4AP4C 2HDEA 4NJ6A 2JRIB 4LDTD 4YTMB 3A9KA 4YT0B 2CR5A 2ZCBA 3VH4B 1NI2A 2DYBA 1OEYA 4EFOA 2QCZA 1J19A 5E6PA 1XD3B 2N9KA 4ZHOA 1WRIA 1TZOA 1L5PA 2AQ1B 3DQVA 3IAS1 1FO4A 2UYZB 2M1MA 3GB1A 4XGAB 2QC8A 1KLGD 4LNOA 1TKEA 3DOWA 5GXGB 1L7YA 1FXAA 1V8CA 3KW5B 5CHFA 2DNFA 2WXLA 3O65B 1ZP0B 4ANWA 2KVZA 1T5XD 2AX5A 3QC8B 5JHAA 2DAJA 1MJDA 3ETRA 1KTKA 2MJEA 3FILA 3H8HA 4PYZA 3H7SA 3HVDA 3TUOA 2RDBC 4WJQA 2J0MA 2L0TA 2LUEA 2LI5A 3UIOB 3I5JC 2GRIA 2JT4B 5C2TB 1C1YB 1DOYA 4BOZB 3DCGA 3DWGC 2KLCA 2C5LC 4WH4A 2MW5A 3N1YC 2K6DB 1OFFA 5FR6A 4TKNA 3UI3A 4W9GA 2EELA 2V1YA 4B0EA 1F77A 4BOSC 2WDRB 1EU3A 5AZGA 2WXGA 3U7DA 4IDIA 3V60A 2BWES 3VFKA 1P7FA 4ANUA 1S1QB 1C3TA 3A9JA 4M02A 3U8ZA 3ZNGC 4BKGA 3E56A 2QHOA 2L0FA 2LJ5A 5HI1A 1Q10A 1L6UA 1XF5L 1C4CA 3HHMA 1WXVA 1SIJA 3U52E 2KDBA 1CQVA 2JVCA 2VH1A 4OZAA 2MBEA 4W9CA 2PE9A 3Q3OC 1KF6B 4N59A 3UIPB 2KO3A 4JPSA 3AULA 5MPOA 2IO2B 3DBSA 3W9CB 1LXDA 2MWSB 1P9DU 5D6JB 2JRHA 1J7AA 1UGJA 1F9JA 5BMIA 2WXPA 4HKQA 3UQBA 4CQNA 1UUPA 1EWCA 4MGYE 2Z59B 2WXKA 3VUWA 2JUOA 4EZKA 1ZPSA 3FAHA 3NS8A 3AEBB 4C4VB 5LXHA 1V1OA 1WXAA 1JQ4A 2L83A 2KKCA 4MSMB 2INDC 2WXRA 3ZRFA 4TQ0A 1WMHA 3IAM1 1TT5B 2WU5B 4DXFA 4BFRA 2R61A 4IM2A 2N7EA 2YLMA 4S17A 2IY1B 3X23A 3VH3B 3ZGZA 2IDYA 1BMLC 1R7SA 1I7HA 2D07B 2ZNVC 2KZRA 4DQOC 2N9LA 1YX6B 2K3UA 4WJNA 4IOIE 1BT0A 2PVOD 3AE3B 1ROEA 2LWPA 4RCOA 1JWSD 1XLNA 1FFVA 1WJ4A 1P3QU 2MBQA 2JZPA 5L95C 1FNVA 2N0SB 4GOCA 3ZJUA 2NBWB 4YSXB 1XLOA 3MJ5A 1FXIA 1B9RA 1TS5A 2L3ZA 1WYGA 3A4RA 2E6XA 3KWVA 1PFDA 3VR9B 3ZXVA 2M19A 2PEAA 3P4QB 4HDQA 1ENFA 2FCMA 4JLCA 3VUYA 4L2YA 3EA6A 1V5OA 2Q5WD 4GLSC 1KLUD 1FRRA 2K8HA 1HQRD 2JWUA 3W1YA 3VDZA 4KGRA 1YNTE 4DDID 2K39A 2LGXA 2J4XA 2LFIA 2XK5A 5H92C 2ZW1A 1WZ3A 2BYTA 3ZDTA 3URYA 1KOTA 2WNMA 3NS1A 2KDMA 2WYQA 2BYEA 1RLFA 2LUMA 2KLGA 3PLUA 5C3JB 1OTRB 1YOVB 1E0ZA 2HE7A 2W3SA 3EHVA 1PYWD 1T0SC 4GSWA 1WFYA 3RNGC 3P1MA 2WP9B 3DPDA 4OVUA 3L16A 3M3JA 3ML8A 4DXGA 1I4HA 3WIMA 4WWMA 2WDVB 1YN3A 1L0XB 3WAMA 3U7ZA 4GN1A 3CIRB 4EUTA 3AEEB 2I38A 4YL8A 4BBNC 4W9JA 1NVID 3AU4A 5IAAC 2UU7A 3H7PB 4HK2A 1RFKA 3AB5A 3DBLB 4HXDA 4BBNF 2KTRB 1EWYC 3KVFB 1JRUA 4LNIA 2G4SA 4FJVB 3ECIA 3R2TA 3PS6A 3QARA 1XLQA 4KSLC 1E5WA 4P16A 4LCDE 4FULA 3VTWA 2AQ2B 4LTUA 2PPHA 3BVZA 3ZQ4A 1D5ZC 1M4VA 1MHHE 1QT9A 4HWIB 2BKRB 3HUIA 4IW0A 1A5RA 1WIAA 2KX3A 3VTUA 2KDEB 3AEAB 3EFCA 2X38A 2JY6A 2KFKB 5C1ZA 1HEZE 1P98A 1XO3A 3AE1B 3KLSX 3WCQA 2M17A 3NG0A 2W9NA 1MVKA 4A55A 4AUQC 5HFYA 1E10A 3WA0A 3V6EB 5EE3A 3RT3B 2JXXA 2K0PA 1U4AA 2Z0EB 5LNK1 1AN8A 4AQ7A 2I1JA 2MQJA 5G55A 2GB1A 2DYOA 2LVQA 2JF5A 4MJSA 1UWXA 1E6EB 3EGRA 1EM7A 3TBLD 2FCSA 4A3OA 3V3XA 1SGHA 4G0NB 4FHJA 1GG3A 1GC6A 4A9AA 5KHOA 3TEWA 3QWZB 3VRBB 1J8CA 3DVNU 3AECB 2ZEQA 3ZIMA 1WE7A 3NZ3A 1TS2A 5TR5A 2LHDA 5D7GA 3N20C 3TMPB 5EDSA 3B1LX 3NVVA 1SE3A 3PPAA 5DCNA 1V86A 2VH2A 3NVZA 4ITKA 4WWOA 2MEKA 2WX0A 2D5GA 2J53A 2PJHA 4WQMA 1OQQA 2C7HA 4C80A 1TY2A 2WXJA 3CSTA 1C4AA 1V1PB 3BK1A 2YEPF 5FR3A 3RNCC 2HTHA 2G3QB 3PREA 1C79A 1SJHD 2JZZA 3HM6X 4DHZB 5D3DA 4DXAB 1RAXA 2BS4B 4ZOHC 3TL5A 2RPVA 4IWOA 1Q5WB 4JE3B 3KUZA 1UNSA 2SAKA 3B2FA 4K3CA 1ET6A 4PS3A 2LGYA 2W55A 1B1ZA 3SD5A 4NJCA 1XQQA 4MT5A 1YQ4B 1PGAA 3LYYA 2FNJB 2KNBA 2V3PA 2BB5A 5KHQA 5LLIA 4GIVA 4KGTA 1R4MB 1R4NB 3QJZA 5BYRA 1K50A 3Q69A 2J0JA 2G9HD 2IO3B 2LXAA 1YN5A 3NZSA 3PO0A 4EOYA 4C56C 2WU2B 4EZJA 3APDA 4RF0A 2R2OA 2SEBD 1ZGUB 2C9WB 2Y3AA 2IYDB 2GBRA 1V97A 1K8RB 2K1FA 2MCNB 1F2RC 3I3TB 1I4XA 2KWVB 2KVRA 2HJ8A 3WANA 2RR9A 4JL9A 2JPHA 3RUIB 3DBHB 4OW0A 2B3AA 2HD5B 1KJTA 2WXIA 2DLBA 1C77A 1VZ6A 1HA5A 4AS1A 4RM8A 3RD2A 4RGMA 4RM9A 3L54A 4HROA 3UF8A 4HCNB 2DX5B 1TS3A 1LO5D 1PQSA 4IKGA 3AMZA 4USAA 3PZ7A 3VTVA 1UBQA 2VZKB 3GP7A 2MJ3A 3U2SC 2A4ZA 3P4RB 4JIOU 3GZNB 3TIXA 1FRDA 3OJ4B 2PVGC 4K3BA 1NYQA 2NTSA 2YEPB 4PYUA 2WXMA 3KUCB 2WXHA 5CTRC 2LJIA 1GC7A 2MBHA 1HZ5A 4OVZA 3LDZE 4HJGE 3VXWA 3AE7B 2D3BA 1GB4A 2BTEA 3KWLA 2GBNA 1WJNA 4MACA 4CYEA 4FLHA 1EF1A 1L4DB 3D32A 3NVYA 5AEKB 2MHJA 5DPSA 4JGHB 1WSPA 2RDGA 1TKGA 2DENB 1MHXA 4HRSA 1YQ3B 3V62A 2NBUA 3RNBC 1P1AA 2KQ7A 4A20A 2CU3A 2Y5CA 1TBEA 2V9HA 3EECA 4Q2JA 1LFDA 3M63B 3FC4A 3FILB 3T9LA 4NQLB 3WAPA 2BW2A 1IGCA 2V3NA 3ZDMC 4KDLB 3ZVVA 3V6CB 5AUKA 3SFDB 4K81A 3KH0A 2N1VA 3AM9A 2K6QA 3KYDD 1FNWA 1SJED 3W5VB 2PIAA 3JW0X 2L76A 2LASA 2JYTA 1FMAD 2LMCA 3M95A 4KKIA 1K53A 3IBEA 1UH6A 3ZKJC 2WXQA 1X1MA 1BUIC 4ZYSA 1I4QA 2QEJC 3A4SC 4I6NB 2Y5BB 1JWMD 3Q8AA 3ZRCA 2MX2A 3Q14C 3RN9C 2ON8A 3DHIC 2GLSA 4M0WA 2NTTA 1UGMA 3VRAB 2GMIC 1WF9A 3H6NA 3Q8EA 4WURA 4BKSD 2FE8A 2PKOA 3Q3NC 2G1EA 2HTME 2W54A 3HK0A 4A8XC 1IBXB 2DZIA 2REXA 1GOZA 1V81A 5EE9A 1XCQL 1TGZB 2KN5A 2DZKA 4RH6A 1QOBA 1S3SG 5J18A 1VDVA 4DHJD 3SHQA 2N1WA 3ZNID 4YTPB 1A70A 5HG2A 2QIEB 4OVVA 2GBJA 1WYWB 3HVZA 3L17A 4G3XB 1WGDA 2J0KA 3NHEB 4LNNA 3NZUA 3UQAA 1AW7A 3W2DA 4S0RA 3TEXA 2DYMA 1TIFA 4OHJA 4GDKB 2PMVA 1QQRA 3LB8C 2I2YA 4NZLB 1VD2A 3NRZA 2KMCA 2YVCA 3A1QA 3H9DA 3LJ3A 4ANVA 4R3DA 3RMKC 3NOBA 2ZVOA 4C7ZA 1R4MI 1SBBB 3VR8B 1FCCC 1YMHE 3MHZA 2KXJA 3VAWA 4W9LA 4DBGA 1QILA 1PUTA 3DBRB 4WWNA 3MTNB 1XT9B 2NPTA 3VUXA 2IGGA 4F8CB 4II3B 1PDXA 3Q3JA 1AARA 4NY0A 3P2BA 1Y8RC 4HPLB 1WZ0A 4QAYA 3T3OA 2KK8A 2O6VA 1Z5SB 3APCA 4FHKA 2I1KA 4WJPA 2BYVE 4MGKE 4TMAB 4KVGB 1VLBA 3BWUD 4W9KA 1L6VA 2XN9C 3BVMA 3B08A 1K52A 4WWPA 4GU2A 4YSYB 5IKCM 1G6JA 2O6VD 3GS2A 1D6EC 1WRDB 1V1PA 3SEBA 3DHHC 2WQYB 1DOXA 1KRHA 1WM2A 3KYCD 3DVGY 3U4EG 1OEYJ 2ZJDA 2INCC 1VCBA 1MFWA 3L10B 1ZUD2 4B6WA 3A1QB 1STEA 3B9JA 3U30A 1DYQA 2INNE 2ZNVB 1CMXB 2NS5A 4LNKA 3RNAC 4AWJA 1JMLA 3BVGA 4WJOA 1C4PA 4FJZA 4W9DA 2M4NA 1E8YA 3JSVB 4II2B 5AZFA 3J9CA 3MJWA 4B9KA 4CHKA 3EC8A 4XYCA 3UGBB 2IPKD 1N5WA 2QSDA 2PW9A 3UINB 2ASQA 2KD0A 5AZHA 2D11A 2N9EB 3AV8A 4D2KA 2PLPA 1LM8B 3OAWA 3AN1A 2JSVX 3N1ZC 1L0VB 1DGJA 2BS2B 3OG5A 3BY4B 5D2MB 3ZJVA 4RNAA 4ZRIA 3DWMA 4E71A 4GDLA 4YSZB 1KLVA 4ZYNA 2JQRB 4RGNA 5BO4B 2KOXA 1WXSA 5CHVC 5HKHA 4ASWC 3N32A 1JW9D 1FCLA 1NEKB 3TCAA 3JYUA 1AWDA 3AE2B 3L08A 3NUHB 1IP9A 3MP9A 3NY5A 3SFEB 4M00A 3WALA 1RYJA 1Z2MA 4XC2A 4REZA 3QX1A 4US8A 2MA9B 3ZUNA 1E8ZA 1SEBD 1WJUA 1I4RA 3GE3C 3BIID 3IT6B 4LJPB 2Z0DB 4W9HA 2CU1A 2AWTA 1XCTL 4C4VA 2BF8B 4MDKE 3AI5A 2CHWA 3IFWB 2BT6A 5J17A 2VZKD 5T8IA 3MC0B 3TSSA 3QK0A 1XEEA 2XK5B 2IO0B 4E74A 3PVLA 1GAQB 4M8NA 3VVWB 3ZXRA 5D3IB 2H88B 4M01A 4J3OD 3BINA 3Q3FA 3QCAA 5E6JA 1N63A 2LGDA 2JX5A 4ICUA 4MM3B 2O6VB 1Q1OA 1T0RC 4FXCA 1GB1A 2V3SA 4JX1C 2MSED 4LLGM 5FK9C 3Q3MC 5JHBA 3PHWB 4A6QA 4H2AA 3V61A 1TY0A 2JWZA 1J7BA 2MRPA 3C0RB 3CSFA 1F2RI 2KHWB 4GGQA 2LD9A 3RNEC 3QQ8B 1IUEA 3IG3A 3M62B 3SR6A 4L1BA 2DBYA 3K9PB 1SIFA 2ZZPB 3B0AA 5D94A 1FEHA 2V4IB 1C9FA 1D3ZA 2O2VA 2G45B 3GZNI 4I6PA 4J6IA 3ZTCA 5BMGA 3IXSA 4BKSA 3AE6B 3WAOA 1HZ6A 3QHTA 1SF0A 4G11A 1JWUD 4G50A 2RDHA 2ZPYA 2WXFA 1OQYA 3N30A 4K1RB 1UWMA 2KDIA 1ZDXA 4F1SA 3AU5A 5IOIA 3SDLC 2KC1A 2WGSA 2ONQA 4IM0A 4KDIC 3IHPC 5CHWA 2KJ6A 1WX9A 3ABVB 2IZVB 3T3NA 3IT4B 4K7WA 4JWUC 3T8MA 1VR9A 1RRBA 2KJHB 4E3CA 4AOFA 1WMHB 4JWSC 3KUDB 4ANXA 2WDQB 1WGKA 3L0WB 1HXYD 2V4LA 5BYQA 1OQRA 1XXGA 4IC7B 1SE9A 4DHJB 4B95A 4MH8A 3TJPA 1H4RA 3P4PB 2AL3A 2FCQA 1UZXB 4CO7A 1E8XA 3A33B 5G5GA 4HCPB 3TEZA 2NR2A 1XLPA 1E7VA 4W9IA 3P42A 4RGTA 2C7MB 2KFKA 2BWFA 4L23A 4MJSB 1IGDA 4ZRKA 2CS4A 1EUVB 3AXCA 2RD0A 2BKFA 2R2QA 4RMAA 1TTNA 3SU8X 1QOFA 3A9KB 4HKZE 4N9F4 1HTQA 2KYWA 2J52A 4I6LB 3RULA 4HJKA
chains in the Genus database with same CATH topology
1WGGA 4MELA 5G2NA 4I6NB 3A4SC 2Y5BB 2K8HA 4AJYB 4IUMB 1QZEA 4BVUC 2KWCA 3ZRCA 1GNUA 2MX2A 3W1YA 3VDZA 3GOEA 1WX7A 1YJ1A 4XX5A 4DDID 4LJOB 2DZMA 2K39A 2KJRA 3PTFC 4A3PA 2FIDA 2LGXA 2GBMA 1WGHA 5GMVA 4KIKA 1UGMA 5E6NA 2GMIC 1WF9A 1WGRA 3H6NA 2ZPNA 4BKSD 2XK5A 3ENEA 2J7QB 1WZ3A 3ZDTA 2OJRA 2KWUB 1KOTA 3K9OB 3WANA 3HM3A 3HK0A 2DZIA 2WYQA 3PGEA 3PLVA 2REXA 1V81A 4XZ4A 1TGZB 2KN5A 2BYEA 2DZKA 1RLFA 4KIKB 2KLGA 3PLUA 2KQSA 1OTRB 1NDDA 3ZW3A 1S3SG 2PE6B 4MM3A 1WE6A 2HE7A 2K8CA 3EHVA 5J18A 4GSWA 3RYTA 1WFYA 4NJ7A 4DHJD 3SHQA 1YX5B 4FADA 1KM7A 2N1WA 4P7IA 3ZNID 3DPDA 4OVUA 3L16A 3M3JA 3ML8A 4OVVA 2GBJA 1WYWB 4G3XB 3L17A 4MSQB 1WGDA 1NBFC 2J0KA 3WIMA 1P0RA 2MP2A 3NHEB 3PRZA 3NZUA 3UQAA 4ZRJA 2DYMA 3DBLI 4GDKB 2CHZA 3WAMA 2KTRA 1FXTB 4GN1A 1T0YA 2BPSA 1Q0WB 2RGFA 4EKUA 4EUTA 1VD2A 2CHXA 1MG8A 4YL8A 4FN2A 4ICVA 4BBNC 4W9JA 1YIWA 2KMCA 2DAFA 3AU4A 2YVCA 4FJYA 5IAAC 3RZFA 3A1QA 3H7PB 2MBOA 3PV1A 5C23A 4HK2A 2D10A 4AJWA 3H9DA 3LJ3A 4HXDA 4ANVA 1ZW7A 4DHZE 4BBNF 3NOBA 2EKEC 2KTRB 1EO6A 2ZVOA 1R4MI 4TUUA 2DZJA 3KVFB 5DPTA 1JRUA 2KXJA 3PRMB 4W9LA 3VAWA 2G4SA 4DBGA 2L05A 4WWNA 4FJVB 3A9JB 4W9EA 3ALBA 3MTNB 3ECIA 1XT9B 4KV2A 5CX3A 2GBKA 4DDGD 3PS6A 2NPTA 3VUXA 3QARA 3QAQA 4KSLC 1E5WA 4F8CB 4II3B 4KZ0A 4LCDE 3Q3JA 1AARA 2LRUA 4GB9A 4NY0A 3P2BA 2L00B 1Y8RC 4FULA 4JQWC 4NPNA 2WX1A 3DVNV 2LRWA 2N4FA 3PSEB 4HPLB 3VTWA 1I35A 1WZ0A 4HDOA 1M94A 2KK8A 2MBBB 2O6VA 1Z5SB 2PPHA 2MLBA 3APCA 4FHKA 2I1KA 2NPTB 4WJPA 1WI0A 2N7DA 2XEWA 3L13A 4HWIB 2BKRB 2BYVE 1WM3A 4MGKE 4IW0A 1A5RA 2LZ6A 4KVGB 1WIAA 2KX3A 4PS8A 4W9KA 3IVFA 2L8JA 3VTUA 2KDEB 3PT2B 5DPWA 1H8CA 3B08A 1ISNA 1E90A 2JY6A 2KFKB 5C1ZA 2AYOB 4WWPA 1P98A 4GDLB 4GU2A 1G6JA 2O6VD 4MEMA 1E7UA 1WRDB 3W1SA 2M17A 2IBIB 2W9NA 2O2VB 4AUQC 1WM2A 3KYCD 3CMMB 2D3GA 1I42A 2NCNA 3DVGY 3DDCB 3WA0A 3V6EB 3RT3B 2JXXA 2NBVB 4EZLA 1OEYJ 1U4AA 2Z0EB 2EMSA 2ZJDA 2I1JA 2MQJA 4IM3A 5G55A 1VCBA 2AL6A 3L10B 3DBHI 3QA8A 1WX8A 4B6WA 3A1QB 2DYOA 2LVQA 2JF5A 4MJSA 3U30A 1GJZA 1V49A 4FBJB 1ZKHA 4ZDVA 3TBLD 4AP4C 4K7SA 2FCSA 2ZNVB 4NJ6A 4A3OA 1CMXB 2JRIB 2NS5A 4LDTD 3RCZA 3A9KA 1SGHA 4AWJA 2CR5A 2ZCBA 4G0NB 4WJOA 3VH4B 3ZNHB 3W1SC 1NI2A 4FHJA 1GG3A 1GC6A 2DYBA 4FJZA 4HLEA 1OEYA 4W9DA 4EFOA 2M4NA 5E6PA 1E8YA 1J19A 1XD3B 5KHOA 3JSVB 3R66C 4II2B 3VQIA 5AZFA 4B9KA 3MJWA 4CHKA 3EC8A 2KANA 3QWZB 3UGBB 1IPGA 3DQVA 1J8CA 4MH0E 4URKA 4NAWB 3DVNU 3UINB 2ASQA 2KD0A 2ZEQA 5AZHA 3ZIMA 2D11A 1WE7A 5TR5A 2N9EB 2UYZB 2M1MA 2M0XA 2XBBC 3RZWC 5D7GA 1LM8B 3OAWA 1OGWA 3DOWA 4M0WB 3TMPB 5EDSA 1L7YA 3EFUA 4PS7A 1RFAA 3B1LX 2DHZA 1UBIA 5CHFA 3KW5B 3BY4B 5D2MB 3PPAA 3O65B 4ANWA 4ZRIA 5JHAA 3QC8B 5DCNA 4E71A 2DAJA 2WWZA 1V86A 3PZDA 4GDLA 4WWOA 2WX0A 1KLVA 4M8MA 1EF5A 4PYZA 2PJHA 4ZYNA 5JZEB 2C7HA 3H7SA 5BO4B 2KOXA 4DWFA 1WXSA 2GOWA 5CHVC 5HKHA 4ASWC 3CSTA 3N32A 1UELA 4WJQA 3TCAA 3JYUA 2J0MA 2ZVNA 2L0TA 3L08A 1IP9A 2LUEA 2HTHA 3NY5A 2LI5A 3VHTC 4F7ZA 3WALA 2G3QB 2KX0A 3PREA 4XC2A 1Z2MA 3UIOB 2KTFA 2FAZA 4BKTA 2JZZA 3HM6X 4DHZB 2JT4B 5JH5C 4X57B 4DXAB 1C1YB 3QX1A 4BOZB 2MA9B 1RAXA 3ZUNA 3DCGA 1E8ZA 2KLCA 3TL5A 2C5LC 1WJUA 2MW5A 4IWOA 2K6DB 5FR6A 1Q5WB 4LJPB 4TKNA 4W9GA 2IY0B 3HIZA 2Z0DB 2V1YA 4W9HA 2CU1A 4BOSC 3KUZA 2N9PC 2AWTA 3QIJA 4MGIE 2AEHA 4PS3A 4GXBA 4K7UA 2LGYA 5AZGA 3SD5A 1IYFA 2KC2A 2BF8B 1XQQA 3R3MA 3AI5A 4MDKE 5DPRA 2CHWA 2FNJB 2KNBA 3DVGX 3IFWB 3JSVA 3V60A 5J17A 5KHQA 5LLIA 2OOBB 2BWES 2WDTB 3VFKA 4ANUA 4GIVA 4NAWA 1GUAB 1S1QB 1WH3A 4DK5A 1C3TA 4W9FA 1WR1A 1V6EA 2C7NB 3A9JA 3QJZA 3U8ZA 3ZNGC 4BKGA 3QK0A 2BGFA 2J0JA 3R7RA 2UWQA 2IO3B 2IO0B 2XK5B 4E74A 2C60A 3PVLA 4GMVA 4M8NA 3VVWB 2LXAA 2LVPA 2VRRB 3NZSA 4EOYA 4EZJA 2QHOA 2L0FA 2LJ5A 3APDA 4KSKC 3MHSD 2R2OA 1YD8U 1ZGUB 2C9WB 3BINA 2IYDB 3CF6E 3Q3FA 3QCAA 2GBRA 4WQOB 3HHMA 1WXVA 2L7RA 1YQBA 1K8RB 2LGDA 2K1FA 4ICUA 2MCNB 2O6VB 1Q1OA 2V3SA 2MSED 3I3TB 2KDBA 1TZ1A 2KMAA 3PRPB 5E6OA 5JHBA 3PHWB 2KWVB 2JVCA 2KVRA 4TQ1A 3OJ3A 3V61A 2JWZA 2HJ8A 2MBEA 2MRPA 2RR9A 2CKHB 3APFA 2EMTA 2PE9A 3C0RB 2JPHA 3CSFA 4JL9A 2KHWB 4NNJB 3RUIB 4GGQA 3UIPB 2LD9A 2KO3A 3AULA 3QQ8B 2G4DB 3M62B 2B3AA 2HD5B 1KJTA 2IO2B 3IG3A 3X0WA 3DBSA 4E3CA 1LXDA 2MWSB 4GDKA 3K9PB 1SIFA 2A5UA 1P9DU 2ZZPB 1E8WA 2JRHA 3B0AA 4RM8A 5D6JB 5D94A 3RD2A 4HVBA 1V80A 1F9JA 1D3ZA 2O2VA 2G45B 3L54A 4RM9A 3ZTDA 3UF8A 3GZNI 4HCNB 2DX5B 4I6PA 4J6IA 3H7PA 2NVUI 3ZTCA 3UQBA 1UD7A 4MGZE 1J0GA 2IO1B 1PQSA 4BKSA 4IWPA 4MGYE 3VTVA 2Z59B 3WAOA 3ZO5B 1UBQA 3VUWA 2JUOA 3QHTA 4EZKA 4G11A 1L2NA 4G50A 4EEWA 1WXMA 2A4ZA 3DBRI 2K25A 2ZPYA 2LVOA 3NS8A 4W9CA 4JIOU 1WGYA 1OQYA 4IG7B 3TIXA 3OJ4B 3N30A 4K1RB 5LXHA 2KDIA 1WXAA 2M8SA 4FA6A 3S2AA 2BYFA 2KKCA 4F1SA 3AU5A 3SDLC 3ZLZA 2KC1A 4MSMB 4IM0A 4PYUA 3KUCB 4KDIC 3ZRFA 4TQ0A 1WMHA 5CTRC 3R7QA 1V5TA 3IHPC 5CHWA 2KJ6A 1GC7A 2MBHA 1WX9A 3LDZE 2IZVB 3VXWA 4K7WA 3T8MA 4BFRA 1WJ6A 4IM2A 2N7EA 1RRBA 2KJHB 2YLMA 2GBNA 2IY1B 1WJNA 2ZCCA 3VH3B 3X23A 1WMHB 4AOFA 2RSUA 1HE8A 3KUDB 3N3KB 4ANXA 4CYEA 2D2QA 4FLHA 1EF1A 2D07B 2ZNVC 2KZRA 3D32A 5AEKB 3L0WB 2V4LA 1YX6B 5DPSA 4IC7B 4JGHB 4WJNA 1SE9A 2DENB 4DHJB 2FIFA 4B95A 1BT0A 1R4NI 3V62A 2FCNA 2NBUA 3OLMD 3TJPA 5LXIB 1H4RA 2LWPA 2AL3A 2FCQA 4TV3A 1P1AA 1UZXB 2KQ7A 4CO7A 1WY8A 2K8BA 4A20A 1E8XA 1P3QU 1WJ4A 3A33B 1TBEA 3U7DA 3EECA 2MBQA 1LFDA 3M63B 1V2YA 3ONSA 4WAAA 5L95C 4HCPB 4HPMB 2NR2A 3T9LA 3ML9A 2MP2B 1WR6E 4GOCA 4NQLB 2NBWB 3WAPA 1E7VA 4W9IA 2L3ZA 3PHXB 2C7MB 2KFKA 3A4RA 3ZDMC 2BWFA 4KDLB 2JZ3B 4IWQA 4MJSB 3ZVVA 3V6CB 2N9XA 5J2RA 1LQBA 2PEAA 4K81A 4KZCA 3KH0A 2CS4A 4ZRKA 1EUVB 3AXCA 2N1VA 5L83A 2RD0A 2KFJA 2RPQA 2K6QA 4HDQA 3KYDD 4NQKE 2BKFA 2R2QA 3H1UA 4RMAA 1V9JA 1TTNA 3SU8X 3JW0X 2FCMA 3A9KB 4JLCA 3VUYA 2L76A 2LASA 4LDTB 3ZNZB 2FUHB 3JVZX 1V5OA 3M95A 4N9F4 2LXCA 3IBEA 2KDFB 1UH6A 3ZKJC 4I6LB 5IA7A 3RULA 1X1MA 4HJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGG A;  4MEL A;  5G2N A;  4I6N B;  3A4S C;  2Y5B B;  2K8H A;  4AJY B;  4IUM B;  1QZE A;  4BVU C;  2KWC A;  3ZRC A;  1GNU A;  2MX2 A;  3W1Y A;  3VDZ A;  3GOE A;  1WX7 A;  1YJ1 A;  4XX5 A;  4DDI D;  4LJO B;  2DZM A;  2K39 A;  2KJR A;  3PTF C;  4A3P A;  2FID A;  2LGX A;  2GBM A;  1WGH A;  5GMV A;  4KIK A;  1UGM A;  5E6N A;  2GMI C;  1WF9 A;  1WGR A;  3H6N A;  2ZPN A;  4BKS D;  2XK5 A;  3ENE A;  2J7Q B;  1WZ3 A;  3ZDT A;  2OJR A;  2KWU B;  1KOT A;  3K9O B;  3WAN A;  3HM3 A;  3HK0 A;  2DZI A;  2WYQ A;  3PGE A;  3PLV A;  2REX A;  1V81 A;  4XZ4 A;  1TGZ B;  2KN5 A;  2BYE A;  2DZK A;  1RLF A;  4KIK B;  2KLG A;  3PLU A;  2KQS A;  1OTR B;  1NDD A;  3ZW3 A;  1S3S G;  2PE6 B;  4MM3 A;  1WE6 A;  2HE7 A;  2K8C A;  3EHV A;  5J18 A;  4GSW A;  3RYT A;  1WFY A;  4NJ7 A;  4DHJ D;  3SHQ A;  1YX5 B;  4FAD A;  1KM7 A;  2N1W A;  4P7I A;  3ZNI D;  3DPD A;  4OVU A;  3L16 A;  3M3J A;  3ML8 A;  4OVV A;  2GBJ A;  1WYW B;  4G3X B;  3L17 A;  4MSQ B;  1WGD A;  1NBF C;  2J0K A;  3WIM A;  1P0R A;  2MP2 A;  3NHE B;  3PRZ A;  3NZU A;  3UQA A;  4ZRJ A;  2DYM A;  3DBL I;  4GDK B;  2CHZ A;  3WAM A;  2KTR A;  1FXT B;  4GN1 A;  1T0Y A;  2BPS A;  1Q0W B;  2RGF A;  4EKU A;  4EUT A;  1VD2 A;  2CHX A;  1MG8 A;  4YL8 A;  4FN2 A;  4ICV A;  4BBN C;  4W9J A;  1YIW A;  2KMC A;  2DAF A;  3AU4 A;  2YVC A;  4FJY A;  5IAA C;  3RZF A;  3A1Q A;  3H7P B;  2MBO A;  3PV1 A;  5C23 A;  4HK2 A;  2D10 A;  4AJW A;  3H9D A;  3LJ3 A;  4HXD A;  4ANV A;  1ZW7 A;  4DHZ E;  4BBN F;  3NOB A;  2EKE C;  2KTR B;  1EO6 A;  2ZVO A;  1R4M I;  4TUU A;  2DZJ A;  3KVF B;  5DPT A;  1JRU A;  2KXJ A;  3PRM B;  4W9L A;  3VAW A;  2G4S A;  4DBG A;  2L05 A;  4WWN A;  4FJV B;  3A9J B;  4W9E A;  3ALB A;  3MTN B;  3ECI A;  1XT9 B;  4KV2 A;  5CX3 A;  2GBK A;  4DDG D;  3PS6 A;  2NPT A;  3VUX A;  3QAR A;  3QAQ A;  4KSL C;  1E5W A;  4F8C B;  4II3 B;  4KZ0 A;  4LCD E;  3Q3J A;  1AAR A;  2LRU A;  4GB9 A;  4NY0 A;  3P2B A;  2L00 B;  1Y8R C;  4FUL A;  4JQW C;  4NPN A;  2WX1 A;  3DVN V;  2LRW A;  2N4F A;  3PSE B;  4HPL B;  3VTW A;  1I35 A;  1WZ0 A;  4HDO A;  1M94 A;  2KK8 A;  2MBB B;  2O6V A;  1Z5S B;  2PPH A;  2MLB A;  3APC A;  4FHK A;  2I1K A;  2NPT B;  4WJP A;  1WI0 A;  2N7D A;  2XEW A;  3L13 A;  4HWI B;  2BKR B;  2BYV E;  1WM3 A;  4MGK E;  4IW0 A;  1A5R A;  2LZ6 A;  4KVG B;  1WIA A;  2KX3 A;  4PS8 A;  4W9K A;  3IVF A;  2L8J A;  3VTU A;  2KDE B;  3PT2 B;  5DPW A;  1H8C A;  3B08 A;  1ISN A;  1E90 A;  2JY6 A;  2KFK B;  5C1Z A;  2AYO B;  4WWP A;  1P98 A;  4GDL B;  4GU2 A;  1G6J A;  2O6V D;  4MEM A;  1E7U A;  1WRD B;  3W1S A;  2M17 A;  2IBI B;  2W9N A;  2O2V B;  4AUQ C;  1WM2 A;  3KYC D;  3CMM B;  2D3G A;  1I42 A;  2NCN A;  3DVG Y;  3DDC B;  3WA0 A;  3V6E B;  3RT3 B;  2JXX A;  2NBV B;  4EZL A;  1OEY J;  1U4A A;  2Z0E B;  2EMS A;  2ZJD A;  2I1J A;  2MQJ A;  4IM3 A;  5G55 A;  1VCB A;  2AL6 A;  3L10 B;  3DBH I;  3QA8 A;  1WX8 A;  4B6W A;  3A1Q B;  2DYO A;  2LVQ A;  2JF5 A;  4MJS A;  3U30 A;  1GJZ A;  1V49 A;  4FBJ B;  1ZKH A;  4ZDV A;  3TBL D;  4AP4 C;  4K7S A;  2FCS A;  2ZNV B;  4NJ6 A;  4A3O A;  1CMX B;  2JRI B;  2NS5 A;  4LDT D;  3RCZ A;  3A9K A;  1SGH A;  4AWJ A;  2CR5 A;  2ZCB A;  4G0N B;  4WJO A;  3VH4 B;  3ZNH B;  3W1S C;  1NI2 A;  4FHJ A;  1GG3 A;  1GC6 A;  2DYB A;  4FJZ A;  4HLE A;  1OEY A;  4W9D A;  4EFO A;  2M4N A;  5E6P A;  1E8Y A;  1J19 A;  1XD3 B;  5KHO A;  3JSV B;  3R66 C;  4II2 B;  3VQI A;  5AZF A;  4B9K A;  3MJW A;  4CHK A;  3EC8 A;  2KAN A;  3QWZ B;  3UGB B;  1IPG A;  3DQV A;  1J8C A;  4MH0 E;  4URK A;  4NAW B;  3DVN U;  3UIN B;  2ASQ A;  2KD0 A;  2ZEQ A;  5AZH A;  3ZIM A;  2D11 A;  1WE7 A;  5TR5 A;  2N9E B;  2UYZ B;  2M1M A;  2M0X A;  2XBB C;  3RZW C;  5D7G A;  1LM8 B;  3OAW A;  1OGW A;  3DOW A;  4M0W B;  3TMP B;  5EDS A;  1L7Y A;  3EFU A;  4PS7 A;  1RFA A;  3B1L X;  2DHZ A;  1UBI A;  5CHF A;  3KW5 B;  3BY4 B;  5D2M B;  3PPA A;  3O65 B;  4ANW A;  4ZRI A;  5JHA A;  3QC8 B;  5DCN A;  4E71 A;  2DAJ A;  2WWZ A;  1V86 A;  3PZD A;  4GDL A;  4WWO A;  2WX0 A;  1KLV A;  4M8M A;  1EF5 A;  4PYZ A;  2PJH A;  4ZYN A;  5JZE B;  2C7H A;  3H7S A;  5BO4 B;  2KOX A;  4DWF A;  1WXS A;  2GOW A;  5CHV C;  5HKH A;  4ASW C;  3CST A;  3N32 A;  1UEL A;  4WJQ A;  3TCA A;  3JYU A;  2J0M A;  2ZVN A;  2L0T A;  3L08 A;  1IP9 A;  2LUE A;  2HTH A;  3NY5 A;  2LI5 A;  3VHT C;  4F7Z A;  3WAL A;  2G3Q B;  2KX0 A;  3PRE A;  4XC2 A;  1Z2M A;  3UIO B;  2KTF A;  2FAZ A;  4BKT A;  2JZZ A;  3HM6 X;  4DHZ B;  2JT4 B;  5JH5 C;  4X57 B;  4DXA B;  1C1Y B;  3QX1 A;  4BOZ B;  2MA9 B;  1RAX A;  3ZUN A;  3DCG A;  1E8Z A;  2KLC A;  3TL5 A;  2C5L C;  1WJU A;  2MW5 A;  4IWO A;  2K6D B;  5FR6 A;  1Q5W B;  4LJP B;  4TKN A;  4W9G A;  2IY0 B;  3HIZ A;  2Z0D B;  2V1Y A;  4W9H A;  2CU1 A;  4BOS C;  3KUZ A;  2N9P C;  2AWT A;  3QIJ A;  4MGI E;  2AEH A;  4PS3 A;  4GXB A;  4K7U A;  2LGY A;  5AZG A;  3SD5 A;  1IYF A;  2KC2 A;  2BF8 B;  1XQQ A;  3R3M A;  3AI5 A;  4MDK E;  5DPR A;  2CHW A;  2FNJ B;  2KNB A;  3DVG X;  3IFW B;  3JSV A;  3V60 A;  5J17 A;  5KHQ A;  5LLI A;  2OOB B;  2BWE S;  2WDT B;  3VFK A;  4ANU A;  4GIV A;  4NAW A;  1GUA B;  1S1Q B;  1WH3 A;  4DK5 A;  1C3T A;  4W9F A;  1WR1 A;  1V6E A;  2C7N B;  3A9J A;  3QJZ A;  3U8Z A;  3ZNG C;  4BKG A;  3QK0 A;  2BGF A;  2J0J A;  3R7R A;  2UWQ A;  2IO3 B;  2IO0 B;  2XK5 B;  4E74 A;  2C60 A;  3PVL A;  4GMV A;  4M8N A;  3VVW B;  2LXA A;  2LVP A;  2VRR B;  3NZS A;  4EOY A;  4EZJ A;  2QHO A;  2L0F A;  2LJ5 A;  3APD A;  4KSK C;  3MHS D;  2R2O A;  1YD8 U;  1ZGU B;  2C9W B;  3BIN A;  2IYD B;  3CF6 E;  3Q3F A;  3QCA A;  2GBR A;  4WQO B;  3HHM A;  1WXV A;  2L7R A;  1YQB A;  1K8R B;  2LGD A;  2K1F A;  4ICU A;  2MCN B;  2O6V B;  1Q1O A;  2V3S A;  2MSE D;  3I3T B;  2KDB A;  1TZ1 A;  2KMA A;  3PRP B;  5E6O A;  5JHB A;  3PHW B;  2KWV B;  2JVC A;  2KVR A;  4TQ1 A;  3OJ3 A;  3V61 A;  2JWZ A;  2HJ8 A;  2MBE A;  2MRP A;  2RR9 A;  2CKH B;  3APF A;  2EMT A;  2PE9 A;  3C0R B;  2JPH A;  3CSF A;  4JL9 A;  2KHW B;  4NNJ B;  3RUI B;  4GGQ A;  3UIP B;  2LD9 A;  2KO3 A;  3AUL A;  3QQ8 B;  2G4D B;  3M62 B;  2B3A A;  2HD5 B;  1KJT A;  2IO2 B;  3IG3 A;  3X0W A;  3DBS A;  4E3C A;  1LXD A;  2MWS B;  4GDK A;  3K9P B;  1SIF A;  2A5U A;  1P9D U;  2ZZP B;  1E8W A;  2JRH A;  3B0A A;  4RM8 A;  5D6J B;  5D94 A;  3RD2 A;  4HVB A;  1V80 A;  1F9J A;  1D3Z A;  2O2V A;  2G45 B;  3L54 A;  4RM9 A;  3ZTD A;  3UF8 A;  3GZN I;  4HCN B;  2DX5 B;  4I6P A;  4J6I A;  3H7P A;  2NVU I;  3ZTC A;  3UQB A;  1UD7 A;  4MGZ E;  1J0G A;  2IO1 B;  1PQS A;  4BKS A;  4IWP A;  4MGY E;  3VTV A;  2Z59 B;  3WAO A;  3ZO5 B;  1UBQ A;  3VUW A;  2JUO A;  3QHT A;  4EZK A;  4G11 A;  1L2N A;  4G50 A;  4EEW A;  1WXM A;  2A4Z A;  3DBR I;  2K25 A;  2ZPY A;  2LVO A;  3NS8 A;  4W9C A;  4JIO U;  1WGY A;  1OQY A;  4IG7 B;  3TIX A;  3OJ4 B;  3N30 A;  4K1R B;  5LXH A;  2KDI A;  1WXA A;  2M8S A;  4FA6 A;  3S2A A;  2BYF A;  2KKC A;  4F1S A;  3AU5 A;  3SDL C;  3ZLZ A;  2KC1 A;  4MSM B;  4IM0 A;  4PYU A;  3KUC B;  4KDI C;  3ZRF A;  4TQ0 A;  1WMH A;  5CTR C;  3R7Q A;  1V5T A;  3IHP C;  5CHW A;  2KJ6 A;  1GC7 A;  2MBH A;  1WX9 A;  3LDZ E;  2IZV B;  3VXW A;  4K7W A;  3T8M A;  4BFR A;  1WJ6 A;  4IM2 A;  2N7E A;  1RRB A;  2KJH B;  2YLM A;  2GBN A;  2IY1 B;  1WJN A;  2ZCC A;  3VH3 B;  3X23 A;  1WMH B;  4AOF A;  2RSU A;  1HE8 A;  3KUD B;  3N3K B;  4ANX A;  4CYE A;  2D2Q A;  4FLH A;  1EF1 A;  2D07 B;  2ZNV C;  2KZR A;  3D32 A;  5AEK B;  3L0W B;  2V4L A;  1YX6 B;  5DPS A;  4IC7 B;  4JGH B;  4WJN A;  1SE9 A;  2DEN B;  4DHJ B;  2FIF A;  4B95 A;  1BT0 A;  1R4N I;  3V62 A;  2FCN A;  2NBU A;  3OLM D;  3TJP A;  5LXI B;  1H4R A;  2LWP A;  2AL3 A;  2FCQ A;  4TV3 A;  1P1A A;  1UZX B;  2KQ7 A;  4CO7 A;  1WY8 A;  2K8B A;  4A20 A;  1E8X A;  1P3Q U;  1WJ4 A;  3A33 B;  1TBE A;  3U7D A;  3EEC A;  2MBQ A;  1LFD A;  3M63 B;  1V2Y A;  3ONS A;  4WAA A;  5L95 C;  4HCP B;  4HPM B;  2NR2 A;  3T9L A;  3ML9 A;  2MP2 B;  1WR6 E;  4GOC A;  4NQL B;  2NBW B;  3WAP A;  1E7V A;  4W9I A;  2L3Z A;  3PHX B;  2C7M B;  2KFK A;  3A4R A;  3ZDM C;  2BWF A;  4KDL B;  2JZ3 B;  4IWQ A;  4MJS B;  3ZVV A;  3V6C B;  2N9X A;  5J2R A;  1LQB A;  2PEA A;  4K81 A;  4KZC A;  3KH0 A;  2CS4 A;  4ZRK A;  1EUV B;  3AXC A;  2N1V A;  5L83 A;  2RD0 A;  2KFJ A;  2RPQ A;  2K6Q A;  4HDQ A;  3KYD D;  4NQK E;  2BKF A;  2R2Q A;  3H1U A;  4RMA A;  1V9J A;  1TTN A;  3SU8 X;  3JW0 X;  2FCM A;  3A9K B;  4JLC A;  3VUY A;  2L76 A;  2LAS A;  4LDT B;  3ZNZ B;  2FUH B;  3JVZ X;  1V5O A;  3M95 A;  4N9F 4;  2LXC A;  3IBE A;  2KDF B;  1UH6 A;  3ZKJ C;  4I6L B;  5IA7 A;  3RUL A;  1X1M A;  4HJK A; 
#chains in the Genus database with same CATH topology
 1WGG A;  3AE4 B;  3I9V 1;  2LEK A;  4MEL A;  5G2N A;  4XWW A;  1T6B X;  2KMM A;  4IUM B;  1QZE A;  4BVU C;  2KWC A;  1GNU A;  1YN4 A;  1N60 A;  3GOE A;  4XX5 A;  1YJ1 A;  1TS4 A;  1PGB A;  3KQ4 A;  1J7C A;  2FID A;  1WGH A;  5GMV A;  4KIK A;  5E6N A;  1RM6 C;  3ENE A;  4RF1 A;  2OJR A;  2BVC A;  2KWU B;  4ARC A;  3E9S A;  3PGE A;  3PLV A;  4UDU C;  3ZJT A;  3AEF B;  1NDD A;  3MFG A;  1WE6 A;  2K8C A;  3Q2A C;  3RYT A;  4NJ7 A;  2D3C A;  1YX5 B;  2LGS A;  4FAD A;  1UF0 A;  3HRD D;  1NBF C;  2MP2 A;  3PRZ A;  4ZRJ A;  3DBL I;  4ZRP A;  2CHZ A;  1T0Y A;  1WWT A;  3CWI A;  3PZ8 A;  2CHX A;  1ZDV A;  1CK1 A;  4FN2 A;  2H89 B;  1JRP A;  2DAF A;  4RFB A;  5C23 A;  1MPE A;  3FKY A;  2EKE C;  1EO6 A;  3RI7 C;  2DZJ A;  3DHG C;  1N6Z A;  2NMQ A;  3PRM B;  2KAJ A;  5BYS A;  3A9J B;  1E7P B;  4XDD A;  4KV2 A;  2GBK A;  4YWG G;  1VJK A;  4ZRQ A;  1C78 A;  4NPN A;  2WX1 A;  3DVN V;  2LRW A;  2N4F A;  3PSE B;  1I35 A;  3BYY B;  4HDO A;  2MLB A;  1Y56 A;  2N7D A;  2XEW A;  3L13 A;  1F0Z A;  1EU4 A;  4PS8 A;  3IVF A;  2WS3 B;  3L4P A;  3NVW A;  5DPW A;  1H8C A;  1E90 A;  2BS3 B;  1D5M C;  1L0Y B;  2AYO B;  3W5U B;  2KT7 A;  2L1A A;  4GDL B;  4MEM A;  2AQ3 B;  2IBI B;  2CJN A;  2L32 A;  2D3G A;  2NCN A;  1SXT A;  5IO9 A;  4IM3 A;  1ET9 A;  2KN4 A;  3R8B A;  1GJZ A;  1V49 A;  1VZ7 A;  4FBJ B;  1MI0 A;  2E3T A;  4ZDV A;  4K7S A;  3N1X C;  3RCZ A;  4YTN B;  3AED B;  4EE2 A;  2IGH A;  2K9X A;  1T3Q A;  2QDF A;  5EE1 A;  1SE4 A;  3ZNH B;  3W1S C;  5I4D A;  4HLE A;  2WHI A;  1I4G A;  3R66 C;  3O13 A;  3VQI A;  1NYR A;  1N62 A;  1ZXH A;  2KAN A;  2EKI A;  1IPG A;  1ZE3 D;  4MH0 E;  4URK A;  4NAW B;  1QLB B;  2XBB C;  2M0X A;  2QJL A;  3B2G A;  3RZW C;  3RPF C;  4A90 A;  3MC8 A;  1OGW A;  4M0W B;  3C19 A;  2M56 B;  3EFU A;  4PS7 A;  2XNA C;  1RFA A;  2DHZ A;  1UBI A;  2FBW B;  1ZXI A;  1D4B A;  5JXV A;  2JYE A;  2LHE A;  4B0M A;  2WWZ A;  3PZD A;  1FNU A;  4M8M A;  1EF5 A;  5JZE B;  1GPX A;  4DWF A;  1LGR A;  2GOW A;  1UEL A;  2ZVN A;  1F1H A;  3VHT C;  4F7Z A;  2KX0 A;  2ICI A;  2KTF A;  3Q8B A;  2FAZ A;  4BKT A;  5JH5 C;  3GE8 C;  4X57 B;  2Y5P A;  1QOG A;  1FD6 A;  4N58 A;  2IY0 B;  3OWE B;  3HIZ A;  2HJ1 A;  2B76 B;  2N9P C;  2WXN A;  3QIJ A;  4MGI E;  2AEH A;  4GXB A;  4K7U A;  1IYF A;  2KC2 A;  3AE5 B;  3R3M A;  5DPR A;  2JXT A;  3DVG X;  3JSV A;  1T0Q C;  2OOB B;  4XDC A;  2WDT B;  2DWQ A;  4NAW A;  1GUA B;  2JU6 X;  4KKJ A;  1WH3 A;  4DK5 A;  1F52 A;  4W9F A;  2OED A;  1WR1 A;  1JCK B;  1V6E A;  2C7N B;  2BGF A;  4BZA A;  3R7R A;  2UWQ A;  4C00 A;  2C60 A;  4GMV A;  2LVP A;  2VRR B;  2W3R A;  1IBX A;  4KSK C;  3MHS D;  4BAX A;  2BB6 A;  1YD8 U;  2D3A A;  2L52 A;  3CF6 E;  1VRA B;  4WQO B;  1K51 A;  2L7R A;  1YQB A;  2IJ0 A;  5E6O A;  1TZ1 A;  2KMA A;  3PRP B;  4ZHP A;  1AYF A;  3P63 A;  4TQ1 A;  1TJE A;  1I4P A;  3OJ3 A;  3APF A;  2CKH B;  2EMT A;  1FM0 D;  1L4Z B;  4NNJ B;  1N61 A;  2OJW A;  3BZD B;  2G4D B;  4HEA 1;  1YJJ A;  3X0W A;  4O1N A;  4GDK A;  2A5U A;  1E8W A;  4HVB A;  3P4S B;  1V80 A;  3ZTD A;  3H7P A;  2NVU I;  1UD7 A;  2BQQ A;  2CJO A;  4MGZ E;  5EE0 A;  1J0G A;  2IO1 B;  4XWT A;  4IWP A;  4HPP A;  1NEN B;  3ZO5 B;  3I57 A;  3NJT A;  2Z8L A;  1L2N A;  4EEW A;  2TSS A;  1WXM A;  3DBR I;  5IN7 A;  2K25 A;  1PGX A;  2LVO A;  1WGY A;  4IG7 B;  5TSS A;  2MH7 A;  1SE2 A;  4ACF A;  2M8S A;  4FA6 A;  3S2A A;  2BYF A;  3ZLZ A;  3R7Q A;  1V5T A;  4LK0 M;  1WJ6 A;  3V05 A;  2ZCC A;  2RSU A;  1HE8 A;  3AEG B;  3N3K B;  1DOI A;  1ACC A;  2D2Q A;  1YJI A;  5H8Y E;  5BMH A;  5AUI A;  1CJE A;  2LGI A;  5HHD G;  2FIF A;  3N9Y C;  1R4N I;  2FCN A;  1C76 A;  3OLM D;  5LXI B;  1FIQ A;  4TV3 A;  2WXO A;  2BBC A;  1WY8 A;  2K8B A;  4P6V F;  1NI3 A;  2RMM A;  3MC9 A;  3C8Y A;  1JWB D;  1V2Y A;  2GI9 A;  3ONS A;  4WAA A;  4HPM B;  1SSN A;  3ML9 A;  2MP2 B;  1WR6 E;  4C7Y A;  3PHX B;  2JZ3 B;  4IWQ A;  5J2R A;  2N9X A;  1LQB A;  2ZW0 A;  4KZC A;  4LNF A;  5L83 A;  2KFJ A;  2N7J A;  2RPQ A;  4NQK E;  3H1U A;  1TYG B;  1V9J A;  4LDT B;  3ZNZ B;  2FUH B;  3JVZ X;  2LXC A;  3AE9 B;  2KDF B;  2KWD A;  5FKA C;  5IA7 A;  1KH0 A;  2K22 A;  4AJY B;  1QKZ A;  4YXD B;  1WX7 A;  3RFZ B;  2INP E;  4LJO B;  2DZM A;  3PTF C;  2KJR A;  4A3P A;  2IGD A;  3Q8F A;  2GBM A;  3BYT B;  3LXF A;  1WGR A;  2ZPN A;  4ARI A;  2J7Q B;  4TSS A;  2K5P A;  2QMT A;  1SB3 C;  3K9O B;  4RGO S;  3AE8 B;  3HM3 A;  4XZ4 A;  2FUG 1;  1QF6 A;  4KIK B;  2KQS A;  4P1C C;  3ZW3 A;  2PE6 B;  4MM3 A;  1BXT A;  4N6E B;  4KX6 B;  1KM7 A;  4P7I A;  1WXQ A;  3TEY A;  4MSQ B;  1FFU A;  1JRO A;  2MJD A;  1P0R A;  3Q8C A;  1VZ8 A;  1FPY A;  1JWA D;  5G5H A;  1HTO A;  2KTR A;  1FXT B;  2BPS A;  1Q0W B;  2RGF A;  4EKU A;  1MG8 A;  4ICV A;  1YIW A;  1ESF A;  4FJY A;  2V0G A;  3RZF A;  1P7E A;  2MBO A;  3PV1 A;  2D10 A;  4AJW A;  4US9 A;  1RWS A;  4PK1 A;  1ZW7 A;  4DHZ E;  4TUU A;  5DPT A;  3R2I A;  1JAL A;  3ZYY X;  2L05 A;  4NAM A;  4W9E A;  3AH7 A;  3ALB A;  4XE0 A;  1KFY B;  2X8X X;  5CX3 A;  4DDG D;  2KQ4 X;  3QAQ A;  2KAC A;  4KZ0 A;  2LRU A;  4GB9 A;  4PT5 A;  2L00 B;  4JQW C;  1E9M A;  4OZC A;  1N5X A;  5IP4 D;  1M94 A;  2MBB B;  3RNF C;  3Q6B A;  4WAF A;  1QOA A;  2NPT B;  1WI0 A;  2WLB A;  1WM3 A;  1ZOY B;  3EUB 2;  4WIP A;  4KGS A;  2LZ6 A;  2QIL A;  2L8J A;  1TKY A;  3PT2 B;  1ISN A;  3BK2 A;  2J42 A;  2W82 A;  2M0A A;  1E7U A;  3W1S A;  2OHF A;  1D5X C;  1CZP A;  2O2V B;  3CMM B;  2ACZ B;  1I42 A;  3DDC B;  2PTL A;  2NBV B;  4EZL A;  4OZB A;  2EMS A;  4P1B C;  3I63 C;  2AL6 A;  3QA8 A;  3DBH I;  1WX8 A;  1ZKH A;  1MG4 A;  4AP4 C;  2HDE A;  4NJ6 A;  2JRI B;  4LDT D;  4YTM B;  3A9K A;  4YT0 B;  2CR5 A;  2ZCB A;  3VH4 B;  1NI2 A;  2DYB A;  1OEY A;  4EFO A;  2QCZ A;  1J19 A;  5E6P A;  1XD3 B;  2N9K A;  4ZHO A;  1WRI A;  1TZO A;  1L5P A;  2AQ1 B;  3DQV A;  3IAS 1;  1FO4 A;  2UYZ B;  2M1M A;  3GB1 A;  4XGA B;  2QC8 A;  1KLG D;  4LNO A;  1TKE A;  3DOW A;  5GXG B;  1L7Y A;  1FXA A;  1V8C A;  3KW5 B;  5CHF A;  2DNF A;  2WXL A;  3O65 B;  1ZP0 B;  4ANW A;  2KVZ A;  1T5X D;  2AX5 A;  3QC8 B;  5JHA A;  2DAJ A;  1MJD A;  3ETR A;  1KTK A;  2MJE A;  3FIL A;  3H8H A;  4PYZ A;  3H7S A;  3HVD A;  3TUO A;  2RDB C;  4WJQ A;  2J0M A;  2L0T A;  2LUE A;  2LI5 A;  3UIO B;  3I5J C;  2GRI A;  2JT4 B;  5C2T B;  1C1Y B;  1DOY A;  4BOZ B;  3DCG A;  3DWG C;  2KLC A;  2C5L C;  4WH4 A;  2MW5 A;  3N1Y C;  2K6D B;  1OFF A;  5FR6 A;  4TKN A;  3UI3 A;  4W9G A;  2EEL A;  2V1Y A;  4B0E A;  1F77 A;  4BOS C;  2WDR B;  1EU3 A;  5AZG A;  2WXG A;  3U7D A;  4IDI A;  3V60 A;  2BWE S;  3VFK A;  1P7F A;  4ANU A;  1S1Q B;  1C3T A;  3A9J A;  4M02 A;  3U8Z A;  3ZNG C;  4BKG A;  3E56 A;  2QHO A;  2L0F A;  2LJ5 A;  5HI1 A;  1Q10 A;  1L6U A;  1XF5 L;  1C4C A;  3HHM A;  1WXV A;  1SIJ A;  3U52 E;  2KDB A;  1CQV A;  2JVC A;  2VH1 A;  4OZA A;  2MBE A;  4W9C A;  2PE9 A;  3Q3O C;  1KF6 B;  4N59 A;  3UIP B;  2KO3 A;  4JPS A;  3AUL A;  5MPO A;  2IO2 B;  3DBS A;  3W9C B;  1LXD A;  2MWS B;  1P9D U;  5D6J B;  2JRH A;  1J7A A;  1UGJ A;  1F9J A;  5BMI A;  2WXP A;  4HKQ A;  3UQB A;  4CQN A;  1UUP A;  1EWC A;  4MGY E;  2Z59 B;  2WXK A;  3VUW A;  2JUO A;  4EZK A;  1ZPS A;  3FAH A;  3NS8 A;  3AEB B;  4C4V B;  5LXH A;  1V1O A;  1WXA A;  1JQ4 A;  2L83 A;  2KKC A;  4MSM B;  2IND C;  2WXR A;  3ZRF A;  4TQ0 A;  1WMH A;  3IAM 1;  1TT5 B;  2WU5 B;  4DXF A;  4BFR A;  2R61 A;  4IM2 A;  2N7E A;  2YLM A;  4S17 A;  2IY1 B;  3X23 A;  3VH3 B;  3ZGZ A;  2IDY A;  1BML C;  1R7S A;  1I7H A;  2D07 B;  2ZNV C;  2KZR A;  4DQO C;  2N9L A;  1YX6 B;  2K3U A;  4WJN A;  4IOI E;  1BT0 A;  2PVO D;  3AE3 B;  1ROE A;  2LWP A;  4RCO A;  1JWS D;  1XLN A;  1FFV A;  1WJ4 A;  1P3Q U;  2MBQ A;  2JZP A;  5L95 C;  1FNV A;  2N0S B;  4GOC A;  3ZJU A;  2NBW B;  4YSX B;  1XLO A;  3MJ5 A;  1FXI A;  1B9R A;  1TS5 A;  2L3Z A;  1WYG A;  3A4R A;  2E6X A;  3KWV A;  1PFD A;  3VR9 B;  3ZXV A;  2M19 A;  2PEA A;  3P4Q B;  4HDQ A;  1ENF A;  2FCM A;  4JLC A;  3VUY A;  4L2Y A;  3EA6 A;  1V5O A;  2Q5W D;  4GLS C;  1KLU D;  1FRR A;  2K8H A;  1HQR D;  2JWU A;  3W1Y A;  3VDZ A;  4KGR A;  1YNT E;  4DDI D;  2K39 A;  2LGX A;  2J4X A;  2LFI A;  2XK5 A;  5H92 C;  2ZW1 A;  1WZ3 A;  2BYT A;  3ZDT A;  3URY A;  1KOT A;  2WNM A;  3NS1 A;  2KDM A;  2WYQ A;  2BYE A;  1RLF A;  2LUM A;  2KLG A;  3PLU A;  5C3J B;  1OTR B;  1YOV B;  1E0Z A;  2HE7 A;  2W3S A;  3EHV A;  1PYW D;  1T0S C;  4GSW A;  1WFY A;  3RNG C;  3P1M A;  2WP9 B;  3DPD A;  4OVU A;  3L16 A;  3M3J A;  3ML8 A;  4DXG A;  1I4H A;  3WIM A;  4WWM A;  2WDV B;  1YN3 A;  1L0X B;  3WAM A;  3U7Z A;  4GN1 A;  3CIR B;  4EUT A;  3AEE B;  2I38 A;  4YL8 A;  4BBN C;  4W9J A;  1NVI D;  3AU4 A;  5IAA C;  2UU7 A;  3H7P B;  4HK2 A;  1RFK A;  3AB5 A;  3DBL B;  4HXD A;  4BBN F;  2KTR B;  1EWY C;  3KVF B;  1JRU A;  4LNI A;  2G4S A;  4FJV B;  3ECI A;  3R2T A;  3PS6 A;  3QAR A;  1XLQ A;  4KSL C;  1E5W A;  4P16 A;  4LCD E;  4FUL A;  3VTW A;  2AQ2 B;  4LTU A;  2PPH A;  3BVZ A;  3ZQ4 A;  1D5Z C;  1M4V A;  1MHH E;  1QT9 A;  4HWI B;  2BKR B;  3HUI A;  4IW0 A;  1A5R A;  1WIA A;  2KX3 A;  3VTU A;  2KDE B;  3AEA B;  3EFC A;  2X38 A;  2JY6 A;  2KFK B;  5C1Z A;  1HEZ E;  1P98 A;  1XO3 A;  3AE1 B;  3KLS X;  3WCQ A;  2M17 A;  3NG0 A;  2W9N A;  1MVK A;  4A55 A;  4AUQ C;  5HFY A;  1E10 A;  3WA0 A;  3V6E B;  5EE3 A;  3RT3 B;  2JXX A;  2K0P A;  1U4A A;  2Z0E B;  5LNK 1;  1AN8 A;  4AQ7 A;  2I1J A;  2MQJ A;  5G55 A;  2GB1 A;  2DYO A;  2LVQ A;  2JF5 A;  4MJS A;  1UWX A;  1E6E B;  3EGR A;  1EM7 A;  3TBL D;  2FCS A;  4A3O A;  3V3X A;  1SGH A;  4G0N B;  4FHJ A;  1GG3 A;  1GC6 A;  4A9A A;  5KHO A;  3TEW A;  3QWZ B;  3VRB B;  1J8C A;  3DVN U;  3AEC B;  2ZEQ A;  3ZIM A;  1WE7 A;  3NZ3 A;  1TS2 A;  5TR5 A;  2LHD A;  5D7G A;  3N20 C;  3TMP B;  5EDS A;  3B1L X;  3NVV A;  1SE3 A;  3PPA A;  5DCN A;  1V86 A;  2VH2 A;  3NVZ A;  4ITK A;  4WWO A;  2MEK A;  2WX0 A;  2D5G A;  2J53 A;  2PJH A;  4WQM A;  1OQQ A;  2C7H A;  4C80 A;  1TY2 A;  2WXJ A;  3CST A;  1C4A A;  1V1P B;  3BK1 A;  2YEP F;  5FR3 A;  3RNC C;  2HTH A;  2G3Q B;  3PRE A;  1C79 A;  1SJH D;  2JZZ A;  3HM6 X;  4DHZ B;  5D3D A;  4DXA B;  1RAX A;  2BS4 B;  4ZOH C;  3TL5 A;  2RPV A;  4IWO A;  1Q5W B;  4JE3 B;  3KUZ A;  1UNS A;  2SAK A;  3B2F A;  4K3C A;  1ET6 A;  4PS3 A;  2LGY A;  2W55 A;  1B1Z A;  3SD5 A;  4NJC A;  1XQQ A;  4MT5 A;  1YQ4 B;  1PGA A;  3LYY A;  2FNJ B;  2KNB A;  2V3P A;  2BB5 A;  5KHQ A;  5LLI A;  4GIV A;  4KGT A;  1R4M B;  1R4N B;  3QJZ A;  5BYR A;  1K50 A;  3Q69 A;  2J0J A;  2G9H D;  2IO3 B;  2LXA A;  1YN5 A;  3NZS A;  3PO0 A;  4EOY A;  4C56 C;  2WU2 B;  4EZJ A;  3APD A;  4RF0 A;  2R2O A;  2SEB D;  1ZGU B;  2C9W B;  2Y3A A;  2IYD B;  2GBR A;  1V97 A;  1K8R B;  2K1F A;  2MCN B;  1F2R C;  3I3T B;  1I4X A;  2KWV B;  2KVR A;  2HJ8 A;  3WAN A;  2RR9 A;  4JL9 A;  2JPH A;  3RUI B;  3DBH B;  4OW0 A;  2B3A A;  2HD5 B;  1KJT A;  2WXI A;  2DLB A;  1C77 A;  1VZ6 A;  1HA5 A;  4AS1 A;  4RM8 A;  3RD2 A;  4RGM A;  4RM9 A;  3L54 A;  4HRO A;  3UF8 A;  4HCN B;  2DX5 B;  1TS3 A;  1LO5 D;  1PQS A;  4IKG A;  3AMZ A;  4USA A;  3PZ7 A;  3VTV A;  1UBQ A;  2VZK B;  3GP7 A;  2MJ3 A;  3U2S C;  2A4Z A;  3P4R B;  4JIO U;  3GZN B;  3TIX A;  1FRD A;  3OJ4 B;  2PVG C;  4K3B A;  1NYQ A;  2NTS A;  2YEP B;  4PYU A;  2WXM A;  3KUC B;  2WXH A;  5CTR C;  2LJI A;  1GC7 A;  2MBH A;  1HZ5 A;  4OVZ A;  3LDZ E;  4HJG E;  3VXW A;  3AE7 B;  2D3B A;  1GB4 A;  2BTE A;  3KWL A;  2GBN A;  1WJN A;  4MAC A;  4CYE A;  4FLH A;  1EF1 A;  1L4D B;  3D32 A;  3NVY A;  5AEK B;  2MHJ A;  5DPS A;  4JGH B;  1WSP A;  2RDG A;  1TKG A;  2DEN B;  1MHX A;  4HRS A;  1YQ3 B;  3V62 A;  2NBU A;  3RNB C;  1P1A A;  2KQ7 A;  4A20 A;  2CU3 A;  2Y5C A;  1TBE A;  2V9H A;  3EEC A;  4Q2J A;  1LFD A;  3M63 B;  3FC4 A;  3FIL B;  3T9L A;  4NQL B;  3WAP A;  2BW2 A;  1IGC A;  2V3N A;  3ZDM C;  4KDL B;  3ZVV A;  3V6C B;  5AUK A;  3SFD B;  4K81 A;  3KH0 A;  2N1V A;  3AM9 A;  2K6Q A;  3KYD D;  1FNW A;  1SJE D;  3W5V B;  2PIA A;  3JW0 X;  2L76 A;  2LAS A;  2JYT A;  1FMA D;  2LMC A;  3M95 A;  4KKI A;  1K53 A;  3IBE A;  1UH6 A;  3ZKJ C;  2WXQ A;  1X1M A;  1BUI C;  4ZYS A;  1I4Q A;  2QEJ C;  3A4S C;  4I6N B;  2Y5B B;  1JWM D;  3Q8A A;  3ZRC A;  2MX2 A;  3Q14 C;  3RN9 C;  2ON8 A;  3DHI C;  2GLS A;  4M0W A;  2NTT A;  1UGM A;  3VRA B;  2GMI C;  1WF9 A;  3H6N A;  3Q8E A;  4WUR A;  4BKS D;  2FE8 A;  2PKO A;  3Q3N C;  2G1E A;  2HTM E;  2W54 A;  3HK0 A;  4A8X C;  1IBX B;  2DZI A;  2REX A;  1GOZ A;  1V81 A;  5EE9 A;  1XCQ L;  1TGZ B;  2KN5 A;  2DZK A;  4RH6 A;  1QOB A;  1S3S G;  5J18 A;  1VDV A;  4DHJ D;  3SHQ A;  2N1W A;  3ZNI D;  4YTP B;  1A70 A;  5HG2 A;  2QIE B;  4OVV A;  2GBJ A;  1WYW B;  3HVZ A;  3L17 A;  4G3X B;  1WGD A;  2J0K A;  3NHE B;  4LNN A;  3NZU A;  3UQA A;  1AW7 A;  3W2D A;  4S0R A;  3TEX A;  2DYM A;  1TIF A;  4OHJ A;  4GDK B;  2PMV A;  1QQR A;  3LB8 C;  2I2Y A;  4NZL B;  1VD2 A;  3NRZ A;  2KMC A;  2YVC A;  3A1Q A;  3H9D A;  3LJ3 A;  4ANV A;  4R3D A;  3RMK C;  3NOB A;  2ZVO A;  4C7Z A;  1R4M I;  1SBB B;  3VR8 B;  1FCC C;  1YMH E;  3MHZ A;  2KXJ A;  3VAW A;  4W9L A;  4DBG A;  1QIL A;  1PUT A;  3DBR B;  4WWN A;  3MTN B;  1XT9 B;  2NPT A;  3VUX A;  2IGG A;  4F8C B;  4II3 B;  1PDX A;  3Q3J A;  1AAR A;  4NY0 A;  3P2B A;  1Y8R C;  4HPL B;  1WZ0 A;  4QAY A;  3T3O A;  2KK8 A;  2O6V A;  1Z5S B;  3APC A;  4FHK A;  2I1K A;  4WJP A;  2BYV E;  4MGK E;  4TMA B;  4KVG B;  1VLB A;  3BWU D;  4W9K A;  1L6V A;  2XN9 C;  3BVM A;  3B08 A;  1K52 A;  4WWP A;  4GU2 A;  4YSY B;  5IKC M;  1G6J A;  2O6V D;  3GS2 A;  1D6E C;  1WRD B;  1V1P A;  3SEB A;  3DHH C;  2WQY B;  1DOX A;  1KRH A;  1WM2 A;  3KYC D;  3DVG Y;  3U4E G;  1OEY J;  2ZJD A;  2INC C;  1VCB A;  1MFW A;  3L10 B;  1ZUD 2;  4B6W A;  3A1Q B;  1STE A;  3B9J A;  3U30 A;  1DYQ A;  2INN E;  2ZNV B;  1CMX B;  2NS5 A;  4LNK A;  3RNA C;  4AWJ A;  1JML A;  3BVG A;  4WJO A;  1C4P A;  4FJZ A;  4W9D A;  2M4N A;  1E8Y A;  3JSV B;  4II2 B;  5AZF A;  3J9C A;  3MJW A;  4B9K A;  4CHK A;  3EC8 A;  4XYC A;  3UGB B;  2IPK D;  1N5W A;  2QSD A;  2PW9 A;  3UIN B;  2ASQ A;  2KD0 A;  5AZH A;  2D11 A;  2N9E B;  3AV8 A;  4D2K A;  2PLP A;  1LM8 B;  3OAW A;  3AN1 A;  2JSV X;  3N1Z C;  1L0V B;  1DGJ A;  2BS2 B;  3OG5 A;  3BY4 B;  5D2M B;  3ZJV A;  4RNA A;  4ZRI A;  3DWM A;  4E71 A;  4GDL A;  4YSZ B;  1KLV A;  4ZYN A;  2JQR B;  4RGN A;  5BO4 B;  2KOX A;  1WXS A;  5CHV C;  5HKH A;  4ASW C;  3N32 A;  1JW9 D;  1FCL A;  1NEK B;  3TCA A;  3JYU A;  1AWD A;  3AE2 B;  3L08 A;  3NUH B;  1IP9 A;  3MP9 A;  3NY5 A;  3SFE B;  4M00 A;  3WAL A;  1RYJ A;  1Z2M A;  4XC2 A;  4REZ A;  3QX1 A;  4US8 A;  2MA9 B;  3ZUN A;  1E8Z A;  1SEB D;  1WJU A;  1I4R A;  3GE3 C;  3BII D;  3IT6 B;  4LJP B;  2Z0D B;  4W9H A;  2CU1 A;  2AWT A;  1XCT L;  4C4V A;  2BF8 B;  4MDK E;  3AI5 A;  2CHW A;  3IFW B;  2BT6 A;  5J17 A;  2VZK D;  5T8I A;  3MC0 B;  3TSS A;  3QK0 A;  1XEE A;  2XK5 B;  2IO0 B;  4E74 A;  3PVL A;  1GAQ B;  4M8N A;  3VVW B;  3ZXR A;  5D3I B;  2H88 B;  4M01 A;  4J3O D;  3BIN A;  3Q3F A;  3QCA A;  5E6J A;  1N63 A;  2LGD A;  2JX5 A;  4ICU A;  4MM3 B;  2O6V B;  1Q1O A;  1T0R C;  4FXC A;  1GB1 A;  2V3S A;  4JX1 C;  2MSE D;  4LLG M;  5FK9 C;  3Q3M C;  5JHB A;  3PHW B;  4A6Q A;  4H2A A;  3V61 A;  1TY0 A;  2JWZ A;  1J7B A;  2MRP A;  3C0R B;  3CSF A;  1F2R I;  2KHW B;  4GGQ A;  2LD9 A;  3RNE C;  3QQ8 B;  1IUE A;  3IG3 A;  3M62 B;  3SR6 A;  4L1B A;  2DBY A;  3K9P B;  1SIF A;  2ZZP B;  3B0A A;  5D94 A;  1FEH A;  2V4I B;  1C9F A;  1D3Z A;  2O2V A;  2G45 B;  3GZN I;  4I6P A;  4J6I A;  3ZTC A;  5BMG A;  3IXS A;  4BKS A;  3AE6 B;  3WAO A;  1HZ6 A;  3QHT A;  1SF0 A;  4G11 A;  1JWU D;  4G50 A;  2RDH A;  2ZPY A;  2WXF A;  1OQY A;  3N30 A;  4K1R B;  1UWM A;  2KDI A;  1ZDX A;  4F1S A;  3AU5 A;  5IOI A;  3SDL C;  2KC1 A;  2WGS A;  2ONQ A;  4IM0 A;  4KDI C;  3IHP C;  5CHW A;  2KJ6 A;  1WX9 A;  3ABV B;  2IZV B;  3T3N A;  3IT4 B;  4K7W A;  4JWU C;  3T8M A;  1VR9 A;  1RRB A;  2KJH B;  4E3C A;  4AOF A;  1WMH B;  4JWS C;  3KUD B;  4ANX A;  2WDQ B;  1WGK A;  3L0W B;  1HXY D;  2V4L A;  5BYQ A;  1OQR A;  1XXG A;  4IC7 B;  1SE9 A;  4DHJ B;  4B95 A;  4MH8 A;  3TJP A;  1H4R A;  3P4P B;  2AL3 A;  2FCQ A;  1UZX B;  4CO7 A;  1E8X A;  3A33 B;  5G5G A;  4HCP B;  3TEZ A;  2NR2 A;  1XLP A;  1E7V A;  4W9I A;  3P42 A;  4RGT A;  2C7M B;  2KFK A;  2BWF A;  4L23 A;  4MJS B;  1IGD A;  4ZRK A;  2CS4 A;  1EUV B;  3AXC A;  2RD0 A;  2BKF A;  2R2Q A;  4RMA A;  1TTN A;  3SU8 X;  1QOF A;  3A9K B;  4HKZ E;  4N9F 4;  1HTQ A;  2KYW A;  2J52 A;  4I6L B;  3RUL A;  4HJK A; 
#chains in the Genus database with same CATH homology
 1WGG A;  4MEL A;  5G2N A;  4I6N B;  3A4S C;  2Y5B B;  2K8H A;  4AJY B;  4IUM B;  1QZE A;  4BVU C;  2KWC A;  3ZRC A;  1GNU A;  2MX2 A;  3W1Y A;  3VDZ A;  3GOE A;  1WX7 A;  1YJ1 A;  4XX5 A;  4DDI D;  4LJO B;  2DZM A;  2K39 A;  2KJR A;  3PTF C;  4A3P A;  2FID A;  2LGX A;  2GBM A;  1WGH A;  5GMV A;  4KIK A;  1UGM A;  5E6N A;  2GMI C;  1WF9 A;  1WGR A;  3H6N A;  2ZPN A;  4BKS D;  2XK5 A;  3ENE A;  2J7Q B;  1WZ3 A;  3ZDT A;  2OJR A;  2KWU B;  1KOT A;  3K9O B;  3WAN A;  3HM3 A;  3HK0 A;  2DZI A;  2WYQ A;  3PGE A;  3PLV A;  2REX A;  1V81 A;  4XZ4 A;  1TGZ B;  2KN5 A;  2BYE A;  2DZK A;  1RLF A;  4KIK B;  2KLG A;  3PLU A;  2KQS A;  1OTR B;  1NDD A;  3ZW3 A;  1S3S G;  2PE6 B;  4MM3 A;  1WE6 A;  2HE7 A;  2K8C A;  3EHV A;  5J18 A;  4GSW A;  3RYT A;  1WFY A;  4NJ7 A;  4DHJ D;  3SHQ A;  1YX5 B;  4FAD A;  1KM7 A;  2N1W A;  4P7I A;  3ZNI D;  3DPD A;  4OVU A;  3L16 A;  3M3J A;  3ML8 A;  4OVV A;  2GBJ A;  1WYW B;  4G3X B;  3L17 A;  4MSQ B;  1WGD A;  1NBF C;  2J0K A;  3WIM A;  1P0R A;  2MP2 A;  3NHE B;  3PRZ A;  3NZU A;  3UQA A;  4ZRJ A;  2DYM A;  3DBL I;  4GDK B;  2CHZ A;  3WAM A;  2KTR A;  1FXT B;  4GN1 A;  1T0Y A;  2BPS A;  1Q0W B;  2RGF A;  4EKU A;  4EUT A;  1VD2 A;  2CHX A;  1MG8 A;  4YL8 A;  4FN2 A;  4ICV A;  4BBN C;  4W9J A;  1YIW A;  2KMC A;  2DAF A;  3AU4 A;  2YVC A;  4FJY A;  5IAA C;  3RZF A;  3A1Q A;  3H7P B;  2MBO A;  3PV1 A;  5C23 A;  4HK2 A;  2D10 A;  4AJW A;  3H9D A;  3LJ3 A;  4HXD A;  4ANV A;  1ZW7 A;  4DHZ E;  4BBN F;  3NOB A;  2EKE C;  2KTR B;  1EO6 A;  2ZVO A;  1R4M I;  4TUU A;  2DZJ A;  3KVF B;  5DPT A;  1JRU A;  2KXJ A;  3PRM B;  4W9L A;  3VAW A;  2G4S A;  4DBG A;  2L05 A;  4WWN A;  4FJV B;  3A9J B;  4W9E A;  3ALB A;  3MTN B;  3ECI A;  1XT9 B;  4KV2 A;  5CX3 A;  2GBK A;  4DDG D;  3PS6 A;  2NPT A;  3VUX A;  3QAR A;  3QAQ A;  4KSL C;  1E5W A;  4F8C B;  4II3 B;  4KZ0 A;  4LCD E;  3Q3J A;  1AAR A;  2LRU A;  4GB9 A;  4NY0 A;  3P2B A;  2L00 B;  1Y8R C;  4FUL A;  4JQW C;  4NPN A;  2WX1 A;  3DVN V;  2LRW A;  2N4F A;  3PSE B;  4HPL B;  3VTW A;  1I35 A;  1WZ0 A;  4HDO A;  1M94 A;  2KK8 A;  2MBB B;  2O6V A;  1Z5S B;  2PPH A;  2MLB A;  3APC A;  4FHK A;  2I1K A;  2NPT B;  4WJP A;  1WI0 A;  2N7D A;  2XEW A;  3L13 A;  4HWI B;  2BKR B;  2BYV E;  1WM3 A;  4MGK E;  4IW0 A;  1A5R A;  2LZ6 A;  4KVG B;  1WIA A;  2KX3 A;  4PS8 A;  4W9K A;  3IVF A;  2L8J A;  3VTU A;  2KDE B;  3PT2 B;  5DPW A;  1H8C A;  3B08 A;  1ISN A;  1E90 A;  2JY6 A;  2KFK B;  5C1Z A;  2AYO B;  4WWP A;  1P98 A;  4GDL B;  4GU2 A;  1G6J A;  2O6V D;  4MEM A;  1E7U A;  1WRD B;  3W1S A;  2M17 A;  2IBI B;  2W9N A;  2O2V B;  4AUQ C;  1WM2 A;  3KYC D;  3CMM B;  2D3G A;  1I42 A;  2NCN A;  3DVG Y;  3DDC B;  3WA0 A;  3V6E B;  3RT3 B;  2JXX A;  2NBV B;  4EZL A;  1OEY J;  1U4A A;  2Z0E B;  2EMS A;  2ZJD A;  2I1J A;  2MQJ A;  4IM3 A;  5G55 A;  1VCB A;  2AL6 A;  3L10 B;  3DBH I;  3QA8 A;  1WX8 A;  4B6W A;  3A1Q B;  2DYO A;  2LVQ A;  2JF5 A;  4MJS A;  3U30 A;  1GJZ A;  1V49 A;  4FBJ B;  1ZKH A;  4ZDV A;  3TBL D;  4AP4 C;  4K7S A;  2FCS A;  2ZNV B;  4NJ6 A;  4A3O A;  1CMX B;  2JRI B;  2NS5 A;  4LDT D;  3RCZ A;  3A9K A;  1SGH A;  4AWJ A;  2CR5 A;  2ZCB A;  4G0N B;  4WJO A;  3VH4 B;  3ZNH B;  3W1S C;  1NI2 A;  4FHJ A;  1GG3 A;  1GC6 A;  2DYB A;  4FJZ A;  4HLE A;  1OEY A;  4W9D A;  4EFO A;  2M4N A;  5E6P A;  1E8Y A;  1J19 A;  1XD3 B;  5KHO A;  3JSV B;  3R66 C;  4II2 B;  3VQI A;  5AZF A;  4B9K A;  3MJW A;  4CHK A;  3EC8 A;  2KAN A;  3QWZ B;  3UGB B;  1IPG A;  3DQV A;  1J8C A;  4MH0 E;  4URK A;  4NAW B;  3DVN U;  3UIN B;  2ASQ A;  2KD0 A;  2ZEQ A;  5AZH A;  3ZIM A;  2D11 A;  1WE7 A;  5TR5 A;  2N9E B;  2UYZ B;  2M1M A;  2M0X A;  2XBB C;  3RZW C;  5D7G A;  1LM8 B;  3OAW A;  1OGW A;  3DOW A;  4M0W B;  3TMP B;  5EDS A;  1L7Y A;  3EFU A;  4PS7 A;  1RFA A;  3B1L X;  2DHZ A;  1UBI A;  5CHF A;  3KW5 B;  3BY4 B;  5D2M B;  3PPA A;  3O65 B;  4ANW A;  4ZRI A;  5JHA A;  3QC8 B;  5DCN A;  4E71 A;  2DAJ A;  2WWZ A;  1V86 A;  3PZD A;  4GDL A;  4WWO A;  2WX0 A;  1KLV A;  4M8M A;  1EF5 A;  4PYZ A;  2PJH A;  4ZYN A;  5JZE B;  2C7H A;  3H7S A;  5BO4 B;  2KOX A;  4DWF A;  1WXS A;  2GOW A;  5CHV C;  5HKH A;  4ASW C;  3CST A;  3N32 A;  1UEL A;  4WJQ A;  3TCA A;  3JYU A;  2J0M A;  2ZVN A;  2L0T A;  3L08 A;  1IP9 A;  2LUE A;  2HTH A;  3NY5 A;  2LI5 A;  3VHT C;  4F7Z A;  3WAL A;  2G3Q B;  2KX0 A;  3PRE A;  4XC2 A;  1Z2M A;  3UIO B;  2KTF A;  2FAZ A;  4BKT A;  2JZZ A;  3HM6 X;  4DHZ B;  2JT4 B;  5JH5 C;  4X57 B;  4DXA B;  1C1Y B;  3QX1 A;  4BOZ B;  2MA9 B;  1RAX A;  3ZUN A;  3DCG A;  1E8Z A;  2KLC A;  3TL5 A;  2C5L C;  1WJU A;  2MW5 A;  4IWO A;  2K6D B;  5FR6 A;  1Q5W B;  4LJP B;  4TKN A;  4W9G A;  2IY0 B;  3HIZ A;  2Z0D B;  2V1Y A;  4W9H A;  2CU1 A;  4BOS C;  3KUZ A;  2N9P C;  2AWT A;  3QIJ A;  4MGI E;  2AEH A;  4PS3 A;  4GXB A;  4K7U A;  2LGY A;  5AZG A;  3SD5 A;  1IYF A;  2KC2 A;  2BF8 B;  1XQQ A;  3R3M A;  3AI5 A;  4MDK E;  5DPR A;  2CHW A;  2FNJ B;  2KNB A;  3DVG X;  3IFW B;  3JSV A;  3V60 A;  5J17 A;  5KHQ A;  5LLI A;  2OOB B;  2BWE S;  2WDT B;  3VFK A;  4ANU A;  4GIV A;  4NAW A;  1GUA B;  1S1Q B;  1WH3 A;  4DK5 A;  1C3T A;  4W9F A;  1WR1 A;  1V6E A;  2C7N B;  3A9J A;  3QJZ A;  3U8Z A;  3ZNG C;  4BKG A;  3QK0 A;  2BGF A;  2J0J A;  3R7R A;  2UWQ A;  2IO3 B;  2IO0 B;  2XK5 B;  4E74 A;  2C60 A;  3PVL A;  4GMV A;  4M8N A;  3VVW B;  2LXA A;  2LVP A;  2VRR B;  3NZS A;  4EOY A;  4EZJ A;  2QHO A;  2L0F A;  2LJ5 A;  3APD A;  4KSK C;  3MHS D;  2R2O A;  1YD8 U;  1ZGU B;  2C9W B;  3BIN A;  2IYD B;  3CF6 E;  3Q3F A;  3QCA A;  2GBR A;  4WQO B;  3HHM A;  1WXV A;  2L7R A;  1YQB A;  1K8R B;  2LGD A;  2K1F A;  4ICU A;  2MCN B;  2O6V B;  1Q1O A;  2V3S A;  2MSE D;  3I3T B;  2KDB A;  1TZ1 A;  2KMA A;  3PRP B;  5E6O A;  5JHB A;  3PHW B;  2KWV B;  2JVC A;  2KVR A;  4TQ1 A;  3OJ3 A;  3V61 A;  2JWZ A;  2HJ8 A;  2MBE A;  2MRP A;  2RR9 A;  2CKH B;  3APF A;  2EMT A;  2PE9 A;  3C0R B;  2JPH A;  3CSF A;  4JL9 A;  2KHW B;  4NNJ B;  3RUI B;  4GGQ A;  3UIP B;  2LD9 A;  2KO3 A;  3AUL A;  3QQ8 B;  2G4D B;  3M62 B;  2B3A A;  2HD5 B;  1KJT A;  2IO2 B;  3IG3 A;  3X0W A;  3DBS A;  4E3C A;  1LXD A;  2MWS B;  4GDK A;  3K9P B;  1SIF A;  2A5U A;  1P9D U;  2ZZP B;  1E8W A;  2JRH A;  3B0A A;  4RM8 A;  5D6J B;  5D94 A;  3RD2 A;  4HVB A;  1V80 A;  1F9J A;  1D3Z A;  2O2V A;  2G45 B;  3L54 A;  4RM9 A;  3ZTD A;  3UF8 A;  3GZN I;  4HCN B;  2DX5 B;  4I6P A;  4J6I A;  3H7P A;  2NVU I;  3ZTC A;  3UQB A;  1UD7 A;  4MGZ E;  1J0G A;  2IO1 B;  1PQS A;  4BKS A;  4IWP A;  4MGY E;  3VTV A;  2Z59 B;  3WAO A;  3ZO5 B;  1UBQ A;  3VUW A;  2JUO A;  3QHT A;  4EZK A;  4G11 A;  1L2N A;  4G50 A;  4EEW A;  1WXM A;  2A4Z A;  3DBR I;  2K25 A;  2ZPY A;  2LVO A;  3NS8 A;  4W9C A;  4JIO U;  1WGY A;  1OQY A;  4IG7 B;  3TIX A;  3OJ4 B;  3N30 A;  4K1R B;  5LXH A;  2KDI A;  1WXA A;  2M8S A;  4FA6 A;  3S2A A;  2BYF A;  2KKC A;  4F1S A;  3AU5 A;  3SDL C;  3ZLZ A;  2KC1 A;  4MSM B;  4IM0 A;  4PYU A;  3KUC B;  4KDI C;  3ZRF A;  4TQ0 A;  1WMH A;  5CTR C;  3R7Q A;  1V5T A;  3IHP C;  5CHW A;  2KJ6 A;  1GC7 A;  2MBH A;  1WX9 A;  3LDZ E;  2IZV B;  3VXW A;  4K7W A;  3T8M A;  4BFR A;  1WJ6 A;  4IM2 A;  2N7E A;  1RRB A;  2KJH B;  2YLM A;  2GBN A;  2IY1 B;  1WJN A;  2ZCC A;  3VH3 B;  3X23 A;  1WMH B;  4AOF A;  2RSU A;  1HE8 A;  3KUD B;  3N3K B;  4ANX A;  4CYE A;  2D2Q A;  4FLH A;  1EF1 A;  2D07 B;  2ZNV C;  2KZR A;  3D32 A;  5AEK B;  3L0W B;  2V4L A;  1YX6 B;  5DPS A;  4IC7 B;  4JGH B;  4WJN A;  1SE9 A;  2DEN B;  4DHJ B;  2FIF A;  4B95 A;  1BT0 A;  1R4N I;  3V62 A;  2FCN A;  2NBU A;  3OLM D;  3TJP A;  5LXI B;  1H4R A;  2LWP A;  2AL3 A;  2FCQ A;  4TV3 A;  1P1A A;  1UZX B;  2KQ7 A;  4CO7 A;  1WY8 A;  2K8B A;  4A20 A;  1E8X A;  1P3Q U;  1WJ4 A;  3A33 B;  1TBE A;  3U7D A;  3EEC A;  2MBQ A;  1LFD A;  3M63 B;  1V2Y A;  3ONS A;  4WAA A;  5L95 C;  4HCP B;  4HPM B;  2NR2 A;  3T9L A;  3ML9 A;  2MP2 B;  1WR6 E;  4GOC A;  4NQL B;  2NBW B;  3WAP A;  1E7V A;  4W9I A;  2L3Z A;  3PHX B;  2C7M B;  2KFK A;  3A4R A;  3ZDM C;  2BWF A;  4KDL B;  2JZ3 B;  4IWQ A;  4MJS B;  3ZVV A;  3V6C B;  2N9X A;  5J2R A;  1LQB A;  2PEA A;  4K81 A;  4KZC A;  3KH0 A;  2CS4 A;  4ZRK A;  1EUV B;  3AXC A;  2N1V A;  5L83 A;  2RD0 A;  2KFJ A;  2RPQ A;  2K6Q A;  4HDQ A;  3KYD D;  4NQK E;  2BKF A;  2R2Q A;  3H1U A;  4RMA A;  1V9J A;  1TTN A;  3SU8 X;  3JW0 X;  2FCM A;  3A9K B;  4JLC A;  3VUY A;  2L76 A;  2LAS A;  4LDT B;  3ZNZ B;  2FUH B;  3JVZ X;  1V5O A;  3M95 A;  4N9F 4;  2LXC A;  3IBE A;  2KDF B;  1UH6 A;  3ZKJ C;  4I6L B;  5IA7 A;  3RUL A;  1X1M A;  4HJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...