1L8HA

Dna protection and binding by e. coli dps protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
TNLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAKDDDTADILTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title DNA Protection and Binding by E. Coli Dps Protein
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2002-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1l8hA00
4IWKA 2Z90A 3PVRA 3QHBA 4KVRA 5J9VA 2IU2A 5GU0X 5JKMG 1AEWA 3KXUA 2XJMA 5J8SA 2JD70 1VJXA 2V2RA 3A9QA 5GU2X 2ITBA 1HRSA 3E1QA 3KWOA 3UNOA 1B71A 3UOFA 4DASA 3F36A 4KVSA 4LPJA 4LPNA 4ML5A 4CMYV 3SE1A 3F32A 3E6SA 1JGCA 5D8RA 3HL1A 3FI6A 2C2UA 5LG8A 3QZ3A 2ZG8X 3E2CA 3R2OA 4M34A 2ZA6A 3QVDA 3PVTB 4DZ0A 4LPMA 5CMQA 4AM4A 4M33A 1QYBA 5CZUA 3PVTA 5JKMA 2IB0A 3R2SA 1KRQA 4MKUA 2CLBA 2GYQA 3BKNA 5D8OA 4XGSA 4MN9A 4ERUA 3KA8A 1R03A 3SIDA 3BVKA 3PWQC 2HTNA 1NF4A 2C6RA 4RC6B 2JD80 4DYZA 2CHPA 5D8QA 1LB3A 3E6RA 2FZFA 5FFDA 3WVUA 1RCCA 4RC6A 3KA9A 4TOGA 4LQJA 5FFBA 1DATA 1Z4AA 2FKZA 4CVTA 1EUMA 2QQYA 4PG1A 1MFRA 3PW8C 3PVYB 5CMRA 3F35A 2RBDA 2VXIA 3QHCA 2FHAA 3F38A 3HIUA 3E1JA 3PVYA 2WLUA 2XKQA 4CY9A 2Z5QA 2ZURX 4DYUA 3T9JA 2VZBA 4ZTTA 1JTSA 2OH3A 3IS7A 2UX1A 5E1UA 3BVFA 5K53A 3PW1B 4Z5SA 4CYAA 2WLAA 3F39A 2CF7A 2ZA7A 2Z5PA 2ZG9X 2C2JA 2BW1A 3PW1A 3KA6A 4PGKA 3RAVA 2IY4A 4ZKXA 4MY7A 2V2OA 3BVEA 3NP0X 2V2LA 3ISFA 3Q4NA 4PGIA 1BCFA 3U90A 1H96A 2QF9A 3R2HA 5C6FA 4U3GA 2V2MA 1IESA 4CVPA 3SHXA 1S30A 4LQNA 1J30A 1S3QA 2CN6A 1BFRA 3RE7A 2YW6A 3BT5A 1VLGA 4P18A 2V2NA 3ERZA 4TO9A 5HJHA 1JREA 4TOEA 4YKHA 5D8YA 5FFCA 5LBHA 2V2SA 3E1PA 1F30A 1S2ZA 2F7NA 2OC5A 5JACA 1TKPA 3KA3A 2BKCA 4Y08A 2YJJA 1RCEA 3MPSA 4XKTA 2GS4A 2Z6MA 5JKLG 3KX9A 3WNWA 4ZL5A 4Z3BA 4EVBA 1N1QA 2D5KA 2V2PA 2FL0A 4ZKHA 1LKMA 1JIGA 1JI4A 1JKVA 1TKOA 2FJCA 2CN7A 3PWQA 3AK9A 1MOJA 3AJQA 2FG8A 1YUXA 4ETRA 2XJOA 3R2KA 4II4B 2XGWA 3OGHA 4II4A 4ZLWA 3FSEA 1DVBA 2GYDA 2V2IA 3PW8A 5GOUA 4RC5B 1RCIA 4TOBA 3Q4QA 4CVSA 3F34A 5ERKA 1YV1A 3R2RA 4RC5A 4RC8A 4MUDA 1NF6A 5HQOA 5JKLA 1O9RA 3F33A 3VNXA 4ISMA 4TW3A 2XJNA 4ZL6A 3H7GA 4AM2A 2W0OA 3GHQA 4R42A 3EGMA 1VELA 4LQVA 3Q4OA 4TOAA 3QD8A 3FVBA 1Z6OM 2BK6A 5D8SA 1JKUA 1RCDA 1NNQA 4TOFA 2ZG7X 2G4HA 1SQ3A 1LKPA 3IQ1A 4AM5A 1ZS3A 3PZAA 5I4JA 3AJOA 3IS8A 4XKSA 1L8IA 4A25A 4DE6A 1UMNA 4RC7B 4M35A 3NP2X 4LYXA 2HR5A 4TOCA 5FEJA 3GVYA 4RC7A 4CYBA 1BG7A 4EVDA 2WTLA 3NOZX 1UVHA 2X170 3O7RA 1VEQA 3BVIA 2JD60 4EVCA 3ES3A 4PG0A 3QB9A 4OYNA 4DYXA 4ZKWA 1VEIA 4REUA 4DI0A 1DPSA 3RD0A 2VXXA 4TODA 1F33A 1QGHA 1SOFA 3E1OA 3RGDA 4DYYA 1XZ3A 4MJYA 4ITTA 1GWGA 2C2FA 1FHAA 3PWFA 3RBCA 3F37A 2V2JA 3E1MA 5LG2A 4ZJKA 3AF8X 3AF9X 3O7SA 1ZUJA 2CEIA 1L8HA 3R2MA 3E1LA 4KVQA 4E6KA 4IWJA 1RCGA 3A68A 2Y3QA 5D8XA 5FFEA 1O9IA 5IX6A 2FG4A 3AF7X 5HJFA 3OJ5A 1RYTA 1YUZA 4ISPA 3R2LA 5E2DA 5AXSA 2YW7A 2YJKA 5LS9A 3Q4RA 3E1NA 1XZ1A 2CLUA 2FFXJ 3ISEA 5GU3X 2V15A 5J93A 1TJOA 3EZ0A 4ZMCA 5GN8B 3UOIA 3WVWA 2CIHA 5K52A 1JYBA 5GN8A 2PYBA 2C41A 5D8PA 4EVEA 4ITWA 3KA4A 2ZA8A 3BVLA 3AK8A 3AJPA 4QUWA 3EZUA 5ERJA 3SH6A 1TK6A 2CHIA 1LKOA 4IXKA 1IERA 1Z6OA 1OTKA 3TA8A 5GU1X 1JI5A 2BJYA 4CMYA 4LYUA 5J8WA 4LQHA 3GE4A 4XKUA 1NFVA 3PVRB 4TOHA 3WVVA 2Z5RA 5FFAA 4CVRA 4M32A
chains in the Genus database with same CATH superfamily
4IWKA 2Z90A 3PVRA 3QHBA 4KVRA 3N6OA 5J9VA 2IU2A 5GU0X 5JKMG 1AEWA 3KXUA 2XJMA 5J8SA 4KXRB 2JD70 1VJXA 2V2RA 3A9QA 5GU2X 2ITBA 2V8UA 1HRSA 3E1QA 3KWOA 3UNOA 1B71A 3UOFA 4DASA 3F36A 4KVSA 4LPJA 4LPNA 4ML5A 4CMYV 3SE1A 3LKDA 3F32A 3E6SA 1JGCA 4W4LB 5D8RA 3HL1A 3FI6A 2C2UA 5LG8A 3QZ3A 2ZG8X 3E2CA 3R2OA 4M34A 2ZA6A 3QVDA 3PVTB 4DZ0A 4LPMA 5CMQA 4AM4A 2G38B 4M33A 4YVZA 1QYBA 5CZUA 3PVTA 5JKMA 2IB0A 3R2SA 1KRQA 2CLBA 2GYQA 4MKUA 3BKNA 5D8OA 4XGSA 4MN9A 4ERUA 3KA8A 1R03A 3GGZA 3SIDA 3BVKA 3PWQC 2HTNA 1NF4A 2C6RA 4RC6B 2JD80 4DYZA 2CHPA 5D8QA 1LB3A 3E6RA 2FZFA 5FFDA 3WVUA 1RCCA 4RC6A 3KA9A 4TOGA 4LQJA 5FFBA 1DATA 1Z4AA 2FKZA 4CVTA 1EUMA 2QQYA 3C21A 4PG1A 1MFRA 3PW8C 3PVYB 5CMRA 3F35A 2RBDA 2VXIA 3QHCA 2FHAA 3UFBA 3F38A 3HIUA 3E1JA 3PVYA 2WLUA 2XKQA 4CY9A 2Z5QA 2ZURX 4DYUA 3T9JA 3VV9A 2VZBA 4ZTTA 1JTSA 3FRSA 2OH3A 3IS7A 2UX1A 5E1UA 3BVFA 5K53A 3PW1B 4Z5SA 4CYAA 2WWXB 2WLAA 3F39A 2CF7A 2ZA7A 2Z5PA 2ZG9X 2C2JA 2BW1A 3PW1A 3KA6A 4PGKA 3RAVA 2IY4A 4ZKXA 4MY7A 2V2OA 3BVEA 3NP0X 2V2LA 3ISFA 3Q4NA 4PGIA 1BCFA 3U90A 1H96A 2MGYA 2QF9A 3R2HA 5C6FA 4U3GA 2V2MA 1IESA 3C1ZA 4CVPA 3SHXA 1S30A 3GGYA 4LQNA 1J30A 3JZ9A 1S3QA 2CN6A 1BFRA 3RE7A 2YW6A 3BT5A 1VLGA 4P18A 2V2NA 3ERZA 4TO9A 5HJHA 1JREA 4TOEA 4YKHA 5D8YA 3M6JA 5FFCA 5LBHA 2V2SA 2OKCA 3E1PA 1F30A 1S2ZA 2F7NA 2OC5A 5JACA 1TKPA 3KA3A 2BKCA 4Y08A 2YJJA 2AR0A 1RCEA 3MPSA 4XKTA 2GS4A 2Z6MA 5JKLG 3KX9A 3WNWA 4ZL5A 3KHKA 4Z3BA 4EVBA 1N1QA 2D5KA 2V2PA 2FL0A 4X0JA 4ZKHA 1LKMA 1JIGA 1JI4A 1JKVA 1TKOA 2FJCA 2CN7A 3PWQA 3AK9A 1MOJA 3AJQA 2FG8A 1YUXA 4ETRA 2XJOA 3R2KA 4II4B 3C1YA 2XGWA 3OGHA 4YXMA 4II4A 4ZLWA 3FSEA 1DVBA 2GYDA 2V2IA 3L0MA 3PW8A 5GOUA 4RC5B 1RCIA 4TOBA 3Q4QA 4CVSA 3F34A 5ERKA 1YV1A 3R2RA 4RC5A 4RC8A 4MUDA 1NF6A 5HQOA 5JKLA 1O9RA 3F33A 3VNXA 4ISMA 4TW3A 2XJNA 4ZL6A 3DBYA 3H7GA 4AM2A 2W0OA 3GHQA 4R42A 3EGMA 1VELA 4LQVA 3Q4OA 4TOAA 3QD8A 3FVBA 1Z6OM 2BK6A 3VVAA 5D8SA 1JKUA 1RCDA 1NNQA 4TOFA 2ZG7X 2G4HA 1SQ3A 3JZAB 1LKPA 3IQ1A 4AM5A 1ZS3A 3PZAA 5I4JA 3AJOA 3IS8A 4XKSA 1L8IA 4A25A 4DE6A 2N02A 3D19A 1UMNA 4RC7B 4M35A 3NP2X 4E40A 4LYXA 2HR5A 4TOCA 5FEJA 3GVYA 4RC7A 4CYBA 1BG7A 4EVDA 2WTLA 3NOZX 1UVHA 2X170 3O7RA 1VEQA 3BVIA 2JD60 3C23A 4EVCA 3ES3A 3KDQA 4PG0A 3QB9A 4OYNA 4DYXA 4ZKWA 1VEIA 4REUA 4DI0A 1DPSA 3RD0A 2VXXA 4TODA 1F33A 1QGHA 1SOFA 3FRRA 3E1OA 3RGDA 4DYYA 1XZ3A 4MJYA 4ITTA 1GWGA 2C2FA 2Y44A 1FHAA 3PWFA 3RBCA 3F37A 2V2JA 3E1MA 5LG2A 4ZJKA 3AF8X 3AF9X 3O7SA 1ZUJA 2CEIA 1L8HA 4WJG4 3R2MA 3E1LA 4KVQA 3V3KB 4E6KA 4IWJA 1RCGA 3A68A 2Y3QA 3W54A 5D8XA 5FFEA 1O9IA 5IX6A 2FG4A 4YXJA 3AF7X 5HJFA 3OJ5A 1RYTA 1YUZA 4ISPA 3R2LA 5E2DA 5AXSA 2YW7A 2YJKA 5LS9A 3Q4RA 3E1NA 1XZ1A 2V8TA 2CLUA 2FFXJ 3ISEA 5GU3X 2CWLA 2V15A 5J93A 1TJOA 3EZ0A 4ZMCA 5GN8B 3UOIA 3WVWA 2CIHA 5K52A 1JYBA 5GN8A 4W4KB 2PYBA 2C41A 5D8PA 4EVEA 4ITWA 3KA4A 2ZA8A 3BVLA 3AK8A 3AJPA 4QUWA 3EZUA 5ERJA 3SH6A 1TK6A 2CHIA 1LKOA 4IXKA 1IERA 5HU6D 1Z6OA 1OTKA 5JDOB 3TA8A 5GU1X 1JI5A 2BJYA 4CMYA 4LYUA 5J8WA 4LQHA 3GE4A 4XKUA 1NFVA 3PVRB 4TOHA 3WVVA 2Z5RA 5JDOA 5FFAA 4CVRA 4MXPA 4M32A
chains in the Genus database with same CATH topology
4IWKA 2Z90A 3PVRA 3QHBA 4KVRA 3N6OA 5J9VA 2IU2A 5GU0X 5JKMG 1AEWA 3KXUA 2XJMA 5J8SA 4KXRB 2JD70 1VJXA 2V2RA 3A9QA 5GU2X 2ITBA 2V8UA 1HRSA 3E1QA 3KWOA 3UNOA 1B71A 3UOFA 4DASA 3F36A 4KVSA 4LPJA 4LPNA 4ML5A 4CMYV 3SE1A 3LKDA 3F32A 3E6SA 1JGCA 4W4LB 5D8RA 3HL1A 3FI6A 2C2UA 5LG8A 3QZ3A 2ZG8X 3E2CA 3R2OA 4M34A 2ZA6A 3QVDA 3PVTB 4DZ0A 4LPMA 5CMQA 4AM4A 2G38B 4M33A 4YVZA 1QYBA 5CZUA 3PVTA 5JKMA 2IB0A 3R2SA 1KRQA 2CLBA 2GYQA 4MKUA 3BKNA 5D8OA 4XGSA 4MN9A 4ERUA 3KA8A 1R03A 3GGZA 3SIDA 3BVKA 3PWQC 2HTNA 1NF4A 2C6RA 4RC6B 2JD80 4DYZA 2CHPA 5D8QA 1LB3A 3E6RA 2FZFA 5FFDA 3WVUA 1RCCA 4RC6A 3KA9A 4TOGA 4LQJA 5FFBA 1DATA 1Z4AA 2FKZA 4CVTA 1EUMA 2QQYA 3C21A 4PG1A 1MFRA 3PW8C 3PVYB 5CMRA 3F35A 2RBDA 2VXIA 3QHCA 2FHAA 3UFBA 3F38A 3HIUA 3E1JA 3PVYA 2WLUA 2XKQA 4CY9A 2Z5QA 2ZURX 4DYUA 3T9JA 3VV9A 2VZBA 4ZTTA 1JTSA 3FRSA 2OH3A 3IS7A 2UX1A 5E1UA 3BVFA 5K53A 3PW1B 4Z5SA 4CYAA 2WWXB 2WLAA 3F39A 2CF7A 2ZA7A 2Z5PA 2ZG9X 2C2JA 2BW1A 3PW1A 3KA6A 4PGKA 3RAVA 2IY4A 4ZKXA 4MY7A 2V2OA 3BVEA 3NP0X 2V2LA 3ISFA 3Q4NA 4PGIA 1BCFA 3U90A 1H96A 2MGYA 2QF9A 3R2HA 5C6FA 4U3GA 2V2MA 1IESA 3C1ZA 4CVPA 3SHXA 1S30A 3GGYA 4LQNA 1J30A 3JZ9A 1S3QA 2CN6A 1BFRA 3RE7A 2YW6A 3BT5A 1VLGA 4P18A 2V2NA 3ERZA 4TO9A 5HJHA 1JREA 4TOEA 4YKHA 5D8YA 3M6JA 5FFCA 5LBHA 2V2SA 2OKCA 3E1PA 1F30A 1S2ZA 2F7NA 2OC5A 5JACA 1TKPA 3KA3A 2BKCA 4Y08A 2YJJA 2AR0A 1RCEA 3MPSA 4XKTA 2GS4A 2Z6MA 5JKLG 3KX9A 3WNWA 4ZL5A 3KHKA 4Z3BA 4EVBA 1N1QA 2D5KA 2V2PA 2FL0A 4X0JA 4ZKHA 1LKMA 1JIGA 1JI4A 1JKVA 1TKOA 2FJCA 2CN7A 3PWQA 3AK9A 1MOJA 3AJQA 2FG8A 1YUXA 4ETRA 2XJOA 3R2KA 4II4B 3C1YA 2XGWA 3OGHA 4YXMA 4II4A 4ZLWA 3FSEA 1DVBA 2GYDA 2V2IA 3L0MA 3PW8A 5GOUA 4RC5B 1RCIA 4TOBA 3Q4QA 4CVSA 3F34A 5ERKA 1YV1A 3R2RA 4RC5A 4RC8A 4MUDA 1NF6A 5HQOA 5JKLA 1O9RA 3F33A 3VNXA 4ISMA 4TW3A 2XJNA 4ZL6A 3DBYA 3H7GA 4AM2A 2W0OA 3GHQA 4R42A 3EGMA 1VELA 4LQVA 3Q4OA 4TOAA 3QD8A 3FVBA 1Z6OM 2BK6A 3VVAA 5D8SA 1JKUA 1RCDA 1NNQA 4TOFA 2ZG7X 2G4HA 1SQ3A 3JZAB 1LKPA 3IQ1A 4AM5A 1ZS3A 3PZAA 5I4JA 3AJOA 3IS8A 4XKSA 1L8IA 4A25A 4DE6A 2N02A 3D19A 1UMNA 4RC7B 4M35A 3NP2X 4E40A 4LYXA 2HR5A 4TOCA 5FEJA 3GVYA 4RC7A 4CYBA 1BG7A 4EVDA 2WTLA 3NOZX 1UVHA 2X170 3O7RA 1VEQA 3BVIA 2JD60 3C23A 4EVCA 3ES3A 3KDQA 4PG0A 3QB9A 4OYNA 4DYXA 4ZKWA 1VEIA 4REUA 4DI0A 1DPSA 3RD0A 2VXXA 4TODA 1F33A 1QGHA 1SOFA 3FRRA 3E1OA 3RGDA 4DYYA 1XZ3A 4MJYA 4ITTA 1GWGA 2C2FA 2Y44A 1FHAA 3PWFA 3RBCA 3F37A 2V2JA 3E1MA 5LG2A 4ZJKA 3AF8X 3AF9X 3O7SA 1ZUJA 2CEIA 1L8HA 4WJG4 3R2MA 3E1LA 4KVQA 3V3KB 4E6KA 4IWJA 1RCGA 3A68A 2Y3QA 3W54A 5D8XA 5FFEA 1O9IA 5IX6A 2FG4A 4YXJA 3AF7X 5HJFA 3OJ5A 1RYTA 1YUZA 4ISPA 3R2LA 5E2DA 5AXSA 2YW7A 2YJKA 5LS9A 3Q4RA 3E1NA 1XZ1A 2V8TA 2CLUA 2FFXJ 3ISEA 5GU3X 2CWLA 2V15A 5J93A 1TJOA 3EZ0A 4ZMCA 5GN8B 3UOIA 3WVWA 2CIHA 5K52A 1JYBA 5GN8A 4W4KB 2PYBA 2C41A 5D8PA 4EVEA 4ITWA 3KA4A 2ZA8A 3BVLA 3AK8A 3AJPA 4QUWA 3EZUA 5ERJA 3SH6A 1TK6A 2CHIA 1LKOA 4IXKA 1IERA 5HU6D 1Z6OA 1OTKA 5JDOB 3TA8A 5GU1X 1JI5A 2BJYA 4CMYA 4LYUA 5J8WA 4LQHA 3GE4A 4XKUA 1NFVA 3PVRB 4TOHA 3WVVA 2Z5RA 5JDOA 5FFAA 4CVRA 4MXPA 4M32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWK A;  2Z90 A;  3PVR A;  3QHB A;  4KVR A;  5J9V A;  2IU2 A;  5GU0 X;  5JKM G;  1AEW A;  3KXU A;  2XJM A;  5J8S A;  2JD7 0;  1VJX A;  2V2R A;  3A9Q A;  5GU2 X;  2ITB A;  1HRS A;  3E1Q A;  3KWO A;  3UNO A;  1B71 A;  3UOF A;  4DAS A;  3F36 A;  4KVS A;  4LPJ A;  4LPN A;  4ML5 A;  4CMY V;  3SE1 A;  3F32 A;  3E6S A;  1JGC A;  5D8R A;  3HL1 A;  3FI6 A;  2C2U A;  5LG8 A;  3QZ3 A;  2ZG8 X;  3E2C A;  3R2O A;  4M34 A;  2ZA6 A;  3QVD A;  3PVT B;  4DZ0 A;  4LPM A;  5CMQ A;  4AM4 A;  4M33 A;  1QYB A;  5CZU A;  3PVT A;  5JKM A;  2IB0 A;  3R2S A;  1KRQ A;  4MKU A;  2CLB A;  2GYQ A;  3BKN A;  5D8O A;  4XGS A;  4MN9 A;  4ERU A;  3KA8 A;  1R03 A;  3SID A;  3BVK A;  3PWQ C;  2HTN A;  1NF4 A;  2C6R A;  4RC6 B;  2JD8 0;  4DYZ A;  2CHP A;  5D8Q A;  1LB3 A;  3E6R A;  2FZF A;  5FFD A;  3WVU A;  1RCC A;  4RC6 A;  3KA9 A;  4TOG A;  4LQJ A;  5FFB A;  1DAT A;  1Z4A A;  2FKZ A;  4CVT A;  1EUM A;  2QQY A;  4PG1 A;  1MFR A;  3PW8 C;  3PVY B;  5CMR A;  3F35 A;  2RBD A;  2VXI A;  3QHC A;  2FHA A;  3F38 A;  3HIU A;  3E1J A;  3PVY A;  2WLU A;  2XKQ A;  4CY9 A;  2Z5Q A;  2ZUR X;  4DYU A;  3T9J A;  2VZB A;  4ZTT A;  1JTS A;  2OH3 A;  3IS7 A;  2UX1 A;  5E1U A;  3BVF A;  5K53 A;  3PW1 B;  4Z5S A;  4CYA A;  2WLA A;  3F39 A;  2CF7 A;  2ZA7 A;  2Z5P A;  2ZG9 X;  2C2J A;  2BW1 A;  3PW1 A;  3KA6 A;  4PGK A;  3RAV A;  2IY4 A;  4ZKX A;  4MY7 A;  2V2O A;  3BVE A;  3NP0 X;  2V2L A;  3ISF A;  3Q4N A;  4PGI A;  1BCF A;  3U90 A;  1H96 A;  2QF9 A;  3R2H A;  5C6F A;  4U3G A;  2V2M A;  1IES A;  4CVP A;  3SHX A;  1S30 A;  4LQN A;  1J30 A;  1S3Q A;  2CN6 A;  1BFR A;  3RE7 A;  2YW6 A;  3BT5 A;  1VLG A;  4P18 A;  2V2N A;  3ERZ A;  4TO9 A;  5HJH A;  1JRE A;  4TOE A;  4YKH A;  5D8Y A;  5FFC A;  5LBH A;  2V2S A;  3E1P A;  1F30 A;  1S2Z A;  2F7N A;  2OC5 A;  5JAC A;  1TKP A;  3KA3 A;  2BKC A;  4Y08 A;  2YJJ A;  1RCE A;  3MPS A;  4XKT A;  2GS4 A;  2Z6M A;  5JKL G;  3KX9 A;  3WNW A;  4ZL5 A;  4Z3B A;  4EVB A;  1N1Q A;  2D5K A;  2V2P A;  2FL0 A;  4ZKH A;  1LKM A;  1JIG A;  1JI4 A;  1JKV A;  1TKO A;  2FJC A;  2CN7 A;  3PWQ A;  3AK9 A;  1MOJ A;  3AJQ A;  2FG8 A;  1YUX A;  4ETR A;  2XJO A;  3R2K A;  4II4 B;  2XGW A;  3OGH A;  4II4 A;  4ZLW A;  3FSE A;  1DVB A;  2GYD A;  2V2I A;  3PW8 A;  5GOU A;  4RC5 B;  1RCI A;  4TOB A;  3Q4Q A;  4CVS A;  3F34 A;  5ERK A;  1YV1 A;  3R2R A;  4RC5 A;  4RC8 A;  4MUD A;  1NF6 A;  5HQO A;  5JKL A;  1O9R A;  3F33 A;  3VNX A;  4ISM A;  4TW3 A;  2XJN A;  4ZL6 A;  3H7G A;  4AM2 A;  2W0O A;  3GHQ A;  4R42 A;  3EGM A;  1VEL A;  4LQV A;  3Q4O A;  4TOA A;  3QD8 A;  3FVB A;  1Z6O M;  2BK6 A;  5D8S A;  1JKU A;  1RCD A;  1NNQ A;  4TOF A;  2ZG7 X;  2G4H A;  1SQ3 A;  1LKP A;  3IQ1 A;  4AM5 A;  1ZS3 A;  3PZA A;  5I4J A;  3AJO A;  3IS8 A;  4XKS A;  1L8I A;  4A25 A;  4DE6 A;  1UMN A;  4RC7 B;  4M35 A;  3NP2 X;  4LYX A;  2HR5 A;  4TOC A;  5FEJ A;  3GVY A;  4RC7 A;  4CYB A;  1BG7 A;  4EVD A;  2WTL A;  3NOZ X;  1UVH A;  2X17 0;  3O7R A;  1VEQ A;  3BVI A;  2JD6 0;  4EVC A;  3ES3 A;  4PG0 A;  3QB9 A;  4OYN A;  4DYX A;  4ZKW A;  1VEI A;  4REU A;  4DI0 A;  1DPS A;  3RD0 A;  2VXX A;  4TOD A;  1F33 A;  1QGH A;  1SOF A;  3E1O A;  3RGD A;  4DYY A;  1XZ3 A;  4MJY A;  4ITT A;  1GWG A;  2C2F A;  1FHA A;  3PWF A;  3RBC A;  3F37 A;  2V2J A;  3E1M A;  5LG2 A;  4ZJK A;  3AF8 X;  3AF9 X;  3O7S A;  1ZUJ A;  2CEI A;  1L8H A;  3R2M A;  3E1L A;  4KVQ A;  4E6K A;  4IWJ A;  1RCG A;  3A68 A;  2Y3Q A;  5D8X A;  5FFE A;  1O9I A;  5IX6 A;  2FG4 A;  3AF7 X;  5HJF A;  3OJ5 A;  1RYT A;  1YUZ A;  4ISP A;  3R2L A;  5E2D A;  5AXS A;  2YW7 A;  2YJK A;  5LS9 A;  3Q4R A;  3E1N A;  1XZ1 A;  2CLU A;  2FFX J;  3ISE A;  5GU3 X;  2V15 A;  5J93 A;  1TJO A;  3EZ0 A;  4ZMC A;  5GN8 B;  3UOI A;  3WVW A;  2CIH A;  5K52 A;  1JYB A;  5GN8 A;  2PYB A;  2C41 A;  5D8P A;  4EVE A;  4ITW A;  3KA4 A;  2ZA8 A;  3BVL A;  3AK8 A;  3AJP A;  4QUW A;  3EZU A;  5ERJ A;  3SH6 A;  1TK6 A;  2CHI A;  1LKO A;  4IXK A;  1IER A;  1Z6O A;  1OTK A;  3TA8 A;  5GU1 X;  1JI5 A;  2BJY A;  4CMY A;  4LYU A;  5J8W A;  4LQH A;  3GE4 A;  4XKU A;  1NFV A;  3PVR B;  4TOH A;  3WVV A;  2Z5R A;  5FFA A;  4CVR A;  4M32 A; 
#chains in the Genus database with same CATH topology
 4IWK A;  2Z90 A;  3PVR A;  3QHB A;  4KVR A;  3N6O A;  5J9V A;  2IU2 A;  5GU0 X;  5JKM G;  1AEW A;  3KXU A;  2XJM A;  5J8S A;  4KXR B;  2JD7 0;  1VJX A;  2V2R A;  3A9Q A;  5GU2 X;  2ITB A;  2V8U A;  1HRS A;  3E1Q A;  3KWO A;  3UNO A;  1B71 A;  3UOF A;  4DAS A;  3F36 A;  4KVS A;  4LPJ A;  4LPN A;  4ML5 A;  4CMY V;  3SE1 A;  3LKD A;  3F32 A;  3E6S A;  1JGC A;  4W4L B;  5D8R A;  3HL1 A;  3FI6 A;  2C2U A;  5LG8 A;  3QZ3 A;  2ZG8 X;  3E2C A;  3R2O A;  4M34 A;  2ZA6 A;  3QVD A;  3PVT B;  4DZ0 A;  4LPM A;  5CMQ A;  4AM4 A;  2G38 B;  4M33 A;  4YVZ A;  1QYB A;  5CZU A;  3PVT A;  5JKM A;  2IB0 A;  3R2S A;  1KRQ A;  2CLB A;  2GYQ A;  4MKU A;  3BKN A;  5D8O A;  4XGS A;  4MN9 A;  4ERU A;  3KA8 A;  1R03 A;  3GGZ A;  3SID A;  3BVK A;  3PWQ C;  2HTN A;  1NF4 A;  2C6R A;  4RC6 B;  2JD8 0;  4DYZ A;  2CHP A;  5D8Q A;  1LB3 A;  3E6R A;  2FZF A;  5FFD A;  3WVU A;  1RCC A;  4RC6 A;  3KA9 A;  4TOG A;  4LQJ A;  5FFB A;  1DAT A;  1Z4A A;  2FKZ A;  4CVT A;  1EUM A;  2QQY A;  3C21 A;  4PG1 A;  1MFR A;  3PW8 C;  3PVY B;  5CMR A;  3F35 A;  2RBD A;  2VXI A;  3QHC A;  2FHA A;  3UFB A;  3F38 A;  3HIU A;  3E1J A;  3PVY A;  2WLU A;  2XKQ A;  4CY9 A;  2Z5Q A;  2ZUR X;  4DYU A;  3T9J A;  3VV9 A;  2VZB A;  4ZTT A;  1JTS A;  3FRS A;  2OH3 A;  3IS7 A;  2UX1 A;  5E1U A;  3BVF A;  5K53 A;  3PW1 B;  4Z5S A;  4CYA A;  2WWX B;  2WLA A;  3F39 A;  2CF7 A;  2ZA7 A;  2Z5P A;  2ZG9 X;  2C2J A;  2BW1 A;  3PW1 A;  3KA6 A;  4PGK A;  3RAV A;  2IY4 A;  4ZKX A;  4MY7 A;  2V2O A;  3BVE A;  3NP0 X;  2V2L A;  3ISF A;  3Q4N A;  4PGI A;  1BCF A;  3U90 A;  1H96 A;  2MGY A;  2QF9 A;  3R2H A;  5C6F A;  4U3G A;  2V2M A;  1IES A;  3C1Z A;  4CVP A;  3SHX A;  1S30 A;  3GGY A;  4LQN A;  1J30 A;  3JZ9 A;  1S3Q A;  2CN6 A;  1BFR A;  3RE7 A;  2YW6 A;  3BT5 A;  1VLG A;  4P18 A;  2V2N A;  3ERZ A;  4TO9 A;  5HJH A;  1JRE A;  4TOE A;  4YKH A;  5D8Y A;  3M6J A;  5FFC A;  5LBH A;  2V2S A;  2OKC A;  3E1P A;  1F30 A;  1S2Z A;  2F7N A;  2OC5 A;  5JAC A;  1TKP A;  3KA3 A;  2BKC A;  4Y08 A;  2YJJ A;  2AR0 A;  1RCE A;  3MPS A;  4XKT A;  2GS4 A;  2Z6M A;  5JKL G;  3KX9 A;  3WNW A;  4ZL5 A;  3KHK A;  4Z3B A;  4EVB A;  1N1Q A;  2D5K A;  2V2P A;  2FL0 A;  4X0J A;  4ZKH A;  1LKM A;  1JIG A;  1JI4 A;  1JKV A;  1TKO A;  2FJC A;  2CN7 A;  3PWQ A;  3AK9 A;  1MOJ A;  3AJQ A;  2FG8 A;  1YUX A;  4ETR A;  2XJO A;  3R2K A;  4II4 B;  3C1Y A;  2XGW A;  3OGH A;  4YXM A;  4II4 A;  4ZLW A;  3FSE A;  1DVB A;  2GYD A;  2V2I A;  3L0M A;  3PW8 A;  5GOU A;  4RC5 B;  1RCI A;  4TOB A;  3Q4Q A;  4CVS A;  3F34 A;  5ERK A;  1YV1 A;  3R2R A;  4RC5 A;  4RC8 A;  4MUD A;  1NF6 A;  5HQO A;  5JKL A;  1O9R A;  3F33 A;  3VNX A;  4ISM A;  4TW3 A;  2XJN A;  4ZL6 A;  3DBY A;  3H7G A;  4AM2 A;  2W0O A;  3GHQ A;  4R42 A;  3EGM A;  1VEL A;  4LQV A;  3Q4O A;  4TOA A;  3QD8 A;  3FVB A;  1Z6O M;  2BK6 A;  3VVA A;  5D8S A;  1JKU A;  1RCD A;  1NNQ A;  4TOF A;  2ZG7 X;  2G4H A;  1SQ3 A;  3JZA B;  1LKP A;  3IQ1 A;  4AM5 A;  1ZS3 A;  3PZA A;  5I4J A;  3AJO A;  3IS8 A;  4XKS A;  1L8I A;  4A25 A;  4DE6 A;  2N02 A;  3D19 A;  1UMN A;  4RC7 B;  4M35 A;  3NP2 X;  4E40 A;  4LYX A;  2HR5 A;  4TOC A;  5FEJ A;  3GVY A;  4RC7 A;  4CYB A;  1BG7 A;  4EVD A;  2WTL A;  3NOZ X;  1UVH A;  2X17 0;  3O7R A;  1VEQ A;  3BVI A;  2JD6 0;  3C23 A;  4EVC A;  3ES3 A;  3KDQ A;  4PG0 A;  3QB9 A;  4OYN A;  4DYX A;  4ZKW A;  1VEI A;  4REU A;  4DI0 A;  1DPS A;  3RD0 A;  2VXX A;  4TOD A;  1F33 A;  1QGH A;  1SOF A;  3FRR A;  3E1O A;  3RGD A;  4DYY A;  1XZ3 A;  4MJY A;  4ITT A;  1GWG A;  2C2F A;  2Y44 A;  1FHA A;  3PWF A;  3RBC A;  3F37 A;  2V2J A;  3E1M A;  5LG2 A;  4ZJK A;  3AF8 X;  3AF9 X;  3O7S A;  1ZUJ A;  2CEI A;  1L8H A;  4WJG 4;  3R2M A;  3E1L A;  4KVQ A;  3V3K B;  4E6K A;  4IWJ A;  1RCG A;  3A68 A;  2Y3Q A;  3W54 A;  5D8X A;  5FFE A;  1O9I A;  5IX6 A;  2FG4 A;  4YXJ A;  3AF7 X;  5HJF A;  3OJ5 A;  1RYT A;  1YUZ A;  4ISP A;  3R2L A;  5E2D A;  5AXS A;  2YW7 A;  2YJK A;  5LS9 A;  3Q4R A;  3E1N A;  1XZ1 A;  2V8T A;  2CLU A;  2FFX J;  3ISE A;  5GU3 X;  2CWL A;  2V15 A;  5J93 A;  1TJO A;  3EZ0 A;  4ZMC A;  5GN8 B;  3UOI A;  3WVW A;  2CIH A;  5K52 A;  1JYB A;  5GN8 A;  4W4K B;  2PYB A;  2C41 A;  5D8P A;  4EVE A;  4ITW A;  3KA4 A;  2ZA8 A;  3BVL A;  3AK8 A;  3AJP A;  4QUW A;  3EZU A;  5ERJ A;  3SH6 A;  1TK6 A;  2CHI A;  1LKO A;  4IXK A;  1IER A;  5HU6 D;  1Z6O A;  1OTK A;  5JDO B;  3TA8 A;  5GU1 X;  1JI5 A;  2BJY A;  4CMY A;  4LYU A;  5J8W A;  4LQH A;  3GE4 A;  4XKU A;  1NFV A;  3PVR B;  4TOH A;  3WVV A;  2Z5R A;  5JDO A;  5FFA A;  4CVR A;  4MXP A;  4M32 A; 
#chains in the Genus database with same CATH homology
 4IWK A;  2Z90 A;  3PVR A;  3QHB A;  4KVR A;  3N6O A;  5J9V A;  2IU2 A;  5GU0 X;  5JKM G;  1AEW A;  3KXU A;  2XJM A;  5J8S A;  4KXR B;  2JD7 0;  1VJX A;  2V2R A;  3A9Q A;  5GU2 X;  2ITB A;  2V8U A;  1HRS A;  3E1Q A;  3KWO A;  3UNO A;  1B71 A;  3UOF A;  4DAS A;  3F36 A;  4KVS A;  4LPJ A;  4LPN A;  4ML5 A;  4CMY V;  3SE1 A;  3LKD A;  3F32 A;  3E6S A;  1JGC A;  4W4L B;  5D8R A;  3HL1 A;  3FI6 A;  2C2U A;  5LG8 A;  3QZ3 A;  2ZG8 X;  3E2C A;  3R2O A;  4M34 A;  2ZA6 A;  3QVD A;  3PVT B;  4DZ0 A;  4LPM A;  5CMQ A;  4AM4 A;  2G38 B;  4M33 A;  4YVZ A;  1QYB A;  5CZU A;  3PVT A;  5JKM A;  2IB0 A;  3R2S A;  1KRQ A;  2CLB A;  2GYQ A;  4MKU A;  3BKN A;  5D8O A;  4XGS A;  4MN9 A;  4ERU A;  3KA8 A;  1R03 A;  3GGZ A;  3SID A;  3BVK A;  3PWQ C;  2HTN A;  1NF4 A;  2C6R A;  4RC6 B;  2JD8 0;  4DYZ A;  2CHP A;  5D8Q A;  1LB3 A;  3E6R A;  2FZF A;  5FFD A;  3WVU A;  1RCC A;  4RC6 A;  3KA9 A;  4TOG A;  4LQJ A;  5FFB A;  1DAT A;  1Z4A A;  2FKZ A;  4CVT A;  1EUM A;  2QQY A;  3C21 A;  4PG1 A;  1MFR A;  3PW8 C;  3PVY B;  5CMR A;  3F35 A;  2RBD A;  2VXI A;  3QHC A;  2FHA A;  3UFB A;  3F38 A;  3HIU A;  3E1J A;  3PVY A;  2WLU A;  2XKQ A;  4CY9 A;  2Z5Q A;  2ZUR X;  4DYU A;  3T9J A;  3VV9 A;  2VZB A;  4ZTT A;  1JTS A;  3FRS A;  2OH3 A;  3IS7 A;  2UX1 A;  5E1U A;  3BVF A;  5K53 A;  3PW1 B;  4Z5S A;  4CYA A;  2WWX B;  2WLA A;  3F39 A;  2CF7 A;  2ZA7 A;  2Z5P A;  2ZG9 X;  2C2J A;  2BW1 A;  3PW1 A;  3KA6 A;  4PGK A;  3RAV A;  2IY4 A;  4ZKX A;  4MY7 A;  2V2O A;  3BVE A;  3NP0 X;  2V2L A;  3ISF A;  3Q4N A;  4PGI A;  1BCF A;  3U90 A;  1H96 A;  2MGY A;  2QF9 A;  3R2H A;  5C6F A;  4U3G A;  2V2M A;  1IES A;  3C1Z A;  4CVP A;  3SHX A;  1S30 A;  3GGY A;  4LQN A;  1J30 A;  3JZ9 A;  1S3Q A;  2CN6 A;  1BFR A;  3RE7 A;  2YW6 A;  3BT5 A;  1VLG A;  4P18 A;  2V2N A;  3ERZ A;  4TO9 A;  5HJH A;  1JRE A;  4TOE A;  4YKH A;  5D8Y A;  3M6J A;  5FFC A;  5LBH A;  2V2S A;  2OKC A;  3E1P A;  1F30 A;  1S2Z A;  2F7N A;  2OC5 A;  5JAC A;  1TKP A;  3KA3 A;  2BKC A;  4Y08 A;  2YJJ A;  2AR0 A;  1RCE A;  3MPS A;  4XKT A;  2GS4 A;  2Z6M A;  5JKL G;  3KX9 A;  3WNW A;  4ZL5 A;  3KHK A;  4Z3B A;  4EVB A;  1N1Q A;  2D5K A;  2V2P A;  2FL0 A;  4X0J A;  4ZKH A;  1LKM A;  1JIG A;  1JI4 A;  1JKV A;  1TKO A;  2FJC A;  2CN7 A;  3PWQ A;  3AK9 A;  1MOJ A;  3AJQ A;  2FG8 A;  1YUX A;  4ETR A;  2XJO A;  3R2K A;  4II4 B;  3C1Y A;  2XGW A;  3OGH A;  4YXM A;  4II4 A;  4ZLW A;  3FSE A;  1DVB A;  2GYD A;  2V2I A;  3L0M A;  3PW8 A;  5GOU A;  4RC5 B;  1RCI A;  4TOB A;  3Q4Q A;  4CVS A;  3F34 A;  5ERK A;  1YV1 A;  3R2R A;  4RC5 A;  4RC8 A;  4MUD A;  1NF6 A;  5HQO A;  5JKL A;  1O9R A;  3F33 A;  3VNX A;  4ISM A;  4TW3 A;  2XJN A;  4ZL6 A;  3DBY A;  3H7G A;  4AM2 A;  2W0O A;  3GHQ A;  4R42 A;  3EGM A;  1VEL A;  4LQV A;  3Q4O A;  4TOA A;  3QD8 A;  3FVB A;  1Z6O M;  2BK6 A;  3VVA A;  5D8S A;  1JKU A;  1RCD A;  1NNQ A;  4TOF A;  2ZG7 X;  2G4H A;  1SQ3 A;  3JZA B;  1LKP A;  3IQ1 A;  4AM5 A;  1ZS3 A;  3PZA A;  5I4J A;  3AJO A;  3IS8 A;  4XKS A;  1L8I A;  4A25 A;  4DE6 A;  2N02 A;  3D19 A;  1UMN A;  4RC7 B;  4M35 A;  3NP2 X;  4E40 A;  4LYX A;  2HR5 A;  4TOC A;  5FEJ A;  3GVY A;  4RC7 A;  4CYB A;  1BG7 A;  4EVD A;  2WTL A;  3NOZ X;  1UVH A;  2X17 0;  3O7R A;  1VEQ A;  3BVI A;  2JD6 0;  3C23 A;  4EVC A;  3ES3 A;  3KDQ A;  4PG0 A;  3QB9 A;  4OYN A;  4DYX A;  4ZKW A;  1VEI A;  4REU A;  4DI0 A;  1DPS A;  3RD0 A;  2VXX A;  4TOD A;  1F33 A;  1QGH A;  1SOF A;  3FRR A;  3E1O A;  3RGD A;  4DYY A;  1XZ3 A;  4MJY A;  4ITT A;  1GWG A;  2C2F A;  2Y44 A;  1FHA A;  3PWF A;  3RBC A;  3F37 A;  2V2J A;  3E1M A;  5LG2 A;  4ZJK A;  3AF8 X;  3AF9 X;  3O7S A;  1ZUJ A;  2CEI A;  1L8H A;  4WJG 4;  3R2M A;  3E1L A;  4KVQ A;  3V3K B;  4E6K A;  4IWJ A;  1RCG A;  3A68 A;  2Y3Q A;  3W54 A;  5D8X A;  5FFE A;  1O9I A;  5IX6 A;  2FG4 A;  4YXJ A;  3AF7 X;  5HJF A;  3OJ5 A;  1RYT A;  1YUZ A;  4ISP A;  3R2L A;  5E2D A;  5AXS A;  2YW7 A;  2YJK A;  5LS9 A;  3Q4R A;  3E1N A;  1XZ1 A;  2V8T A;  2CLU A;  2FFX J;  3ISE A;  5GU3 X;  2CWL A;  2V15 A;  5J93 A;  1TJO A;  3EZ0 A;  4ZMC A;  5GN8 B;  3UOI A;  3WVW A;  2CIH A;  5K52 A;  1JYB A;  5GN8 A;  4W4K B;  2PYB A;  2C41 A;  5D8P A;  4EVE A;  4ITW A;  3KA4 A;  2ZA8 A;  3BVL A;  3AK8 A;  3AJP A;  4QUW A;  3EZU A;  5ERJ A;  3SH6 A;  1TK6 A;  2CHI A;  1LKO A;  4IXK A;  1IER A;  5HU6 D;  1Z6O A;  1OTK A;  5JDO B;  3TA8 A;  5GU1 X;  1JI5 A;  2BJY A;  4CMY A;  4LYU A;  5J8W A;  4LQH A;  3GE4 A;  4XKU A;  1NFV A;  3PVR B;  4TOH A;  3WVV A;  2Z5R A;  5JDO A;  5FFA A;  4CVR A;  4MXP A;  4M32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...