1L8OA

Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
b'HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-phosphoserine phosphatase
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 42
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8oA01
2D2VA 4JDPA 3L8GA 2JAOA 4Y2XA 2YMQA 4BX2A 4UMFA 3QUBA 4XQ0A 2YJ6A 5ALWA 3A1CA 1WZCA 5AK6A 4XOUA 4OCZA 3EF0A 4GIBA 5AIBA 1RMTA 2YJ5A 1CQZA 1YDFA 2DQSA 4OFZA 3SKYA 1WVIA 2HO4A 3L0CA 1Z4IA 1Z4MA 3A1DA 4NABA 2FPSA 4G63A 5AK5A 1RPZA 1QYIA 2NYVA 3AR4A 2NO5A 3MC1A 3R9KA 1CR6A 2FPUA 4L6CA 2EATA 2AUTA 2IOHA 3PGLA 1Z5GA 5ALZA 4F71A 3DAOA 3L1UA 5ALMA 4B6JA 3IRUA 3KOOA 5AM3A 3L8EA 2CFSA 4C4RA 2HF2A 4EX6A 1N8NA 4L57A 3E84A 4O8CA 2P11A 2CFTA 2YJ3A 4DWOA 2I54A 3U7GA 4EELA 5AKIA 2WF8A 2Q5EA 3I28A 3DNPA 2HSZA 3EPRA 4HAIA 3ZX4A 1VJRA 3FM9A 3L5KA 1L8LA 1RLMA 5AW5A 4YIHA 5AM2A 1WR8A 2B8EA 5AW1A 4J03A 2G0AA 3QUTA 3U7EB 3RFUA 3NASA 1L7OA 2I7DA 1YMQA 3NUQA 2PKEA 4ZEVA 5AIAA 3WK4A 1FEZA 1ZRNA 1TJ3A 2BY4A 3ONNA 4YH1A 5ALRA 5ALOA 1Z4NA 2ZBEA 2GHQA 5E0OA 2B8JA 3MMZA 2G09A 1Z4OA 5AESA 2R8EA 3CZ4A 4JB3A 4ZEWA 3MPOA 4RETA 1RQLA 3WKEA 5ALFA 3SKXA 3N28A 2C9MA 2IA5A 2YJ4A 3N07A 5AKJA 2O2XA 1ZD5A 3GYGA 1U2SA 3WK7A 3QU7A 3I76A 4YCLA 3U19A 5AVXA 4UM5A 1S8OA 5AM5A 5FP0A 4BKMA 2HDOA 2GHTA 1RRCA 5AVWA 5AW2A 3PCTA 2BDUA 1SU4A 1ZRMA 4IFTA 3UMGA 4DFDA 4F72A 4BBJA 3I6BA 3A3YA 2C4NA 3W5BA 1O08A 1LTQA 2ODAA 5AW9A 3L8HA 5AW3A 4PNHA 4KYTA 5AKZA 4Y2YA 1Q91A 4YCMA 2PQ0A 5AW0A 3QUQA 3KD3A 4KN8A 5AI8A 3NAMA 3FPSA 2EAUA 1ZD4A 3OCXA 2YN4A 4Y3UA 4NFLA 3ZI4A 2B30A 3QU4A 3SD7A 3WKDA 1VFPA 2WF7A 3OPXA 3N1UA 2HHLA 2RBKA 3W5CA 3ZWKA 2FUCA 4EENA 5AM0A 1L7MA 1X42A 3AR8A 2HX1A 3QU9A 3ZU6A 3KZXA 2JAUA 4YGYA 5AM1A 2ZBFA 3U7FB 2RAVA 3SHQA 4UMVA 2C8LA 2WM8A 4UARA 5AKEA 2C88A 2HOQA 3QLEA 2GMWA 1ZJJA 1EK2A 5AKXA 2ZG6A 4Y2TA 3NANA 3BWVA 4RESA 1U2TA 2B82A 3KC2A 3KBBA 4DW8A 5ALJA 1XP5A 5AICA 3WK8A 4CE6A 2IYEA 1T5TA 1ZD3A 1RC8A 2GFHA 3OCVA 4YCNA 3ZUPA 3ET5A 1JUDA 3OCZA 2MU1A 1Y8AA 2W11A 3ZVNA 4QQFA 2WF5A 2YMPA 4UAUA 1QQ6A 2YBDA 2NO4A 1QQ5A 4AP9A 2HF7A 1RKVA 1XVIA 4Y2QA 5AI6A 1L7NA 4GXTA 1F5SA 3ZTWA 2PR7A 1L7PA 3UM9A 4J2TA 4EZEA 4HGRA 2AMYA 3DDHA 2W4MA 5AI4A 2HEGA 1YNSA 4CNQA 2Q4TA 2AH5A 3A1EA 3WKAA 1YJ5A 2IOFA 3F9RA 4HGOA 4C4TA 1YV9A 2BDEA 4MWOA 1Z4JA 3QYPA 3MN1A 2OM6A 5AI9A 5ALEA 1RMYA 3RF6A 4UU0A 1ZS9A 3R09A 3WK5A 4EX7A 4H1WA 2W43A 4QJBA 4YIKA 1RMQA 4IG4A 2FPRA 5AKGA 2ZXEA 3ET4A 3P96A 3SLRA 1RQNA 2I6XA 2WF6A 3K1ZA 4HGPA 2FPXA 3ZVMA 4BX3A 3QU5A 4CF3A 3ESQA 3W5DA 2HCFA 5AK4A 2B0CA 3SF0A 1NRWA 5ALDA 1RLTA 3QXGA 3AR5A 5AW4A 2YY6A 4CF5A 3IJ5A 5AVSA 3J7TA 5AM4A 3ZX5A 4HGNA 3DV9A 5ALYA 3OCWA 1S2OA 3WKBA 3AR2A 4I9FA 3OTQA 5AVYA 3QGMA 5ALTA 1XPJA 4Y2SA 4Y2RA 4BYGA 2P69A 1QQ7A 2O9JA 2WF9A 4OHFA 2OYCA 3PGVA 5AI5A 1YS9A 4BX0A 4Y2UA 5ALNA 2HI0A 5ALPA 3AR3A 3OCUA 2P9JA 4L6AA 3WGUA 2ZBDA 2B1RA 4HYTA 5AVRA 5ALLA 4BEVA 5AW6A 2FUEA 5ALXA 5AW7A 5ALHA 4C4SA 2CFRA 5ALUA 1ZOLA 1RKUA 1O03A 2CN1A 3U7HB 3AR9A 1TJ4A 4G9BA 4KNVA 2JGAA 5A3SA 4E88A 3ESRA 3B9RA 3ZVLA 5AVQA 2FI1A 3NIWA 1L6RA 3L8FA 3BA6A 5IT4A 3L7YA 3M1YA 3QNMA 3ED5A 1VJ5A 3ZW7A 4KX3A 3S6JA 3WKCA 5AW8A 1RDFA 4EEKA 5A3QA 4FE3A 4OD0A 4UW9A 1TJ5A 1T5SA 3WGVA 5AVUA 3W5AA 3PDWA 2I55A 3NRJA 1U7OA 1Z4PX 2FEAA 4UMEA 4CF4A 1L8OA 5ALQA 4BNDB 4Y2JA 1Q92A 2EARA 2ZBGA 2AGVA 4KX5A 2GO7A 1Z5UA 2R8XA 4UMDA 3OCYA 5AKHA 2OBBA 1SWVA 3I1YA 3EWIA 5JJBA 3IB6A 3L0YA 1TA0A 5T41A 1WPGA 2Q4RA 1U7PA 2G08A 2I34A 3SMVA 1U02A 4UU1A 3E8MA 1RLOA 2JAWA 2WHEA 5IS2A 4MUMA 5AKKA 2G07A 3FGOA 4ZEXA 1T9ZA 4UM7A 3UMCA 2G06A 1Z4KA 2B1QA 4FYPA 5AHXA 3AR6A 2JARA 4NWIA 4BNDA 1K1EA 1ZD2P 4BEWA 3WK9A 1LVHA 5AI0A 2QLTA 5ALKA 4UAVA 1KYTA 4XE5A 5IT0A 1MH9A 3B9BA 3EF1A 5ALSA 2OA0A 4NV0A 3N8GA 4UASA 3B8EA 3UMBA 3QX7A 1J97A 3VAYA 1SWWA 1J8DA 1EK1A 2R8YA 4DCCA 5AK3A 3N5KA 1NF2A 3E81A 3ZTYA 2YMMA 4UATA 5AVVA 1NNLA 2VKQA 4Y2PA 5ALGA 4AS2A 5A3RA 1RKQA 1TE2A 3L1VA 2RARA 3TLMA 2X4DA 1Z88A 5ALVA 4KNWA 2RB5A 5AVTA 1AQ6A 2FDRA 1Z4LA 4I9GA 3QU2A 3NALA 3L0BA 4FFDA 3CNHA 1PW5A 3M9LA 3AR7A 5ALIA 1Z4QA 1QH9A 2QYHA 2YMLA 2G1AA 3FPBA 3R4CA 3HLTA 2YFYA 2G80A 3FZQA 3KDPA 4HGQA 3E58A 4XPZA 1N9KA 3D6JA 3ZWDA 4Y2VA 2WFAA 3HYCA 2FPWA 3QUCA 2P27A 3U26A 5AKLA 2IOFK 3WK6A 4AS3A 2R8ZA 1IWOA 2ZOSA 4NAVA 2C8KA 3U13A 2I33A 5AVZA 3FVVA 5AKYA 2MSNA
chains in the Genus database with same CATH superfamily
2QTZA 4ETWA 2PPLA 1UQRA 2YMQA 5JOQA 4XGQA 3O3MB 4PGAA 5IIJA 4FYJA 3V4RA 5KOYA 4MEXA 2E4VA 4F4UA 3ZQ4A 8ICLA 2J09A 4JDUA 4I2DA 3V9PA 3OLCX 1YS1X 2JCSA 3U7RA 4A5OA 3Q2OA 1IK6A 2HDNB 3FDSA 3IB3A 5E7JA 5KFKA 4CT0A 4DM3A 5KQPA 1R8YA 2ACWA 1FTWA 1Z0SA 1IHPA 3H4IA 4C7XA 3D59A 4YH1A 4FC6A 4HS4A 3T5CA 1GRNA 1ILEA 5LMUB 3GJ0A 1B8NA 4KOAA 4OGGA 2BSXA 3V5NA 4C0XA 1BU5A 3WK7A 2MU2A 3NEYA 3K5IA 4UAGA 3BB4A 1LF0A 5CD9A 1WMDA 5FPHA 3OOHA 4FKZA 2XECA 2DZDA 3VPGA 5TPWB 1A04A 4B8ZA 2YWEA 1LPPA 5GVSA 3HB5X 2KB0A 4BBJA 1TPYA 3F5QA 1GKUB 4MVJD 2OE2A 1E1RD 1L4UA 1I3CA 4J9LA 3RTBA 1XA4A 1KO8A 2P9HA 3P2IA 1E3TA 1KFKB 4EZBA 2QROA 2HTEA 3NLLA 3L9WA 3VKUA 5IYZA 1NIPA 4Z6CA 2WAXA 4LDRA 1NW8A 3VTFA 2FG7C 3ZYCA 2BCQA 2B4YA 3CJRA 2GFHA 2VPTA 3MQ2A 2YFHA 4W5JA 1RKXA 2HC9A 1V4NA 2GBGA 2IEIA 4F4ZA 3T9FA 3FTQA 4M7OA 3ZPXA 1M1YA 4GG1A 3S7TA 1SOAA 3ANMA 2B2NA 3AJAA 3IV7A 4IW3B 5BUCA 3JQ7A 4KR7A 3O4FA 5IULC 5C53B 2A5GA 1K08A 4ZCPA 2C3YA 1Q1AA 2PWPA 3ADBA 3F8SA 2ZETA 2VTBA 3SJZA 4RXMA 4HC4A 2PIAA 4LDNA 4RVHA 1E4YA 1DBPA 2ZUFA 2Z3VA 4Q3BA 2V4QA 2UVUA 3J7TA 1S3IA 3MSXA 2VPWA 3AI7A 3VI3B 2X8JB 2VP9A 4A36A 3B38A 1WXGA 3HDYA 1JG6A 3EHEA 5FBLB 3SEQA 2AQ0A 2IIVA 2R96A 3LHKA 5CG1A 3KZMA 1SXHA 4I5FA 3FGZA 3KK0A 2V6FA 2C9ZA 3UYLA 4DEYA 3UMFA 3NMUF 3QYFA 2VN8A 3TMKA 3LVFO 3MLAA 2PX6A 3RHSA 4FQ8A 4XXHA 1VIDA 1ENZA 4GXQA 1FRFS 4I14A 1KSPA 3LD9A 3RT7A 3QVUA 4IFBA 1JLLB 1T9BA 4O4IF 2VTVA 3KAKA 1W85B 5IJ9B 2IV7A 1Z2OX 5JD4A 4TQ9A 2HRQA 2OBBA 3I1YA 2BTQB 3IT0A 4MVCA 3M5DA 4NJEA 1XLVA 3OU7A 2RC6A 4OKNA 3NO4A 3ITDA 3SJ7A 4G1EB 4LQCA 4NP6A 4ON9A 4V24A 4YN4A 2GN8A 3UHFA 4KPFC 2WV7A 5LYJA 3WS7A 4HBZA 4C87A 1JH8A 4B4WA 2G25A 1PLKA 4WY8A 4YQWA 1K4MA 3QMVA 4AICA 4U2CA 5EL0A 3NALA 3A9WA 2A7QA 2CHGA 4YMWA 3S81A 2JCGA 1T3LA 3PR5B 3OMWA 2HCBA 1KKXA 3KU4A 2ZKLA 5FI5A 4F9TA 3NUGA 3S1AA 1I13A 5J5VA 2ZEJA 1U80A 3GEPA 3I2KA 4YT2A 1TX4B 3U13A 3VRHA 4U7PB 2IFTA 4MWCA 5AVKA 3KETA 5FBHA 4YC7A 1JG2A 4JJIA 3NHWA 4A6PA 1SCJA 1EFTA 4JHXA 2B0JA 1WW3A 2FR8A 1PJBA 1W93A 1PWEA 1VLVA 1AUVA 4JMPA 2NACA 1IIPA 4CMIB 1WWKA 1G41A 1A7AA 2UYHA 3R9KA 5JVDF 1BE1A 1HC7A 1Z5GA 3ZD9A 4HWRA 4DS5A 5CH3A 5JWOA 1WZIA 5KG3A 3W8EA 4RXTA 4GX0A 3HN7A 1YRAA 3MR5A 1Y7PA 2W6PA 4OA8A 2C00A 5C32A 2XUFA 4JEUA 5KYWB 5EXEA 1XKXA 1P0FA 1L4EA 3WGTA 5F76A 4GSKA 1NMQA 5DI9A 1NJSA 3T1QA 3MMZA 3EQ2A 3KTQA 3I01M 3K5WA 1YZFA 3H87A 1UC8A 1YSCA 4J4HA 2PRKA 4OM7A 2RONA 3H99A 4BVAA 1B0ZA 4MWGA 4KXVA 3OPVA 1F60A 4RHTA 3G49A 2CJXA 4DJEC 3JR7A 2CKMA 4JKYA 4ZDWA 3TQSA 3NVWA 2CNOA 2Q3JA 5KHLB 3L84A 3BQTA 4WFKA 3C3XA 5J0PA 3EZ9A 1YK0A 1JYEA 1RJ9B 1OAOC 4GPZA 5KVVA 2FPPA 5M3BA 5HBRA 4UEQA 4JC5A 2NZ8A 2OCBA 4ER7A 1UQUA 5CB4F 3FPSA 8ICTA 4Y3UA 4Z2YA 5IFLA 4WCFB 4QEZA 3I09A 4PZZA 3KZXA 3H86A 2RG1A 3TF5A 3VPAA 5G5HA 4RIHA 1BN7A 4W1RA 1R4NB 1P0MA 2NQ8A 4JOCA 4YJKA 4RD1A 2V55B 2VUUA 4FLMA 4YCNA 3GJSA 1LDNA 4N82A 1AHPA 4PGHA 2C2KA 2HHVA 1TTHA 1IHXA 3ETEA 2N1BA 4PZUA 2REQB 4WXYB 2WJIA 2L69A 4FDLA 5B55A 3CN7A 5CNMA 4UU0A 1C1DB 3WRWA 3BH7A 1N57A 1ISJA 1IYZA 1IAVA 2XCSB 4CR6A 2QL6A 4BNXA 3GJ5A 1C7QA 5NULA 3PXBA 5AD1A 1G3MA 1YACA 2EF1A 2RHOA 1YRLA 1H2AS 4OQMA 2O9JA 4X7PA 1F1JA 3FVWA 4HFNA 3WGUA 9ICKA 1D8YA 3ZDRA 4JNKA 4Q37A 3SVLA 2J9ZB 5ALHA 4PNZA 1Z35A 1BVYF 4ZCRA 3QE9Y 1DDIA 1L5MA 1RIFA 4MCHA 3FPJA 3O5AA 3VR4H 3WC4A 2C4KA 1NURA 4RWEA 1XZMA 2R4UA 4BKQA 3OP1A 4EQ6A 2AVDA 5JY6A 1MXFA 4EYKA 5E2BA 4K28A 4ZV4A 3ZHZA 3CSUA 1YDHA 1L7EA 2FJ6A 1WPGA 4UNPA 4IIEA 2FSPA 4NCIA 1QHHA 2WTBA 3Q5GA 1C81A 3U1VA 1THZA 3OF3A 2QX7A 4ZCTA 2K6GA 1O1YA 4E70A 2X5NA 4RO0A 3BJIC 4NLGA 5DHQA 3KLOA 2BZGA 3EGOA 3UXNA 1C7RA 8ICNA 5LXTF 2H4ZA 5DTIA 3LKBA 3FNIA 1QV6A 2XY4A 4DA4A 1GJRA 1M0TA 3QSYA 1BMQA 3TL2A 4N39A 1GYQA 2NTEA 4YT4A 4LW8A 4P84A 3GV8B 4ZGGA 3HLTA 4MB0A 5CRXA 1Q1ZA 2VS1A 4H1VA 2BH2A 2ZUCA 3KFXA 3KSBC 1AO3A 4YA6A 3V34A 4FMCF 1YZUA 3B1FA 1N7HA 2ODTX 1XX6A 3AG5A 2VPIA 2LYAA 2JEFA 3V2GA 4J0EA 4XJSA 4KTVE 3BCUA 5GTIU 3DZDA 5AH0A 2JAOA 2ONZA 3VFDA 3E4CA 1T29A 3DLAA 5DTEA 5FHQA 1AK1A 3IGFA 3T9BA 1E7WA 3VJRA 4BMYA 5KNDH 3ID6C 1E9EA 2W5UA 5K99A 4NDAA 1YS6A 2Q2WA 2H7YA 2CC2A 3HKDB 1MLDA 3R3SA 2WB4A 1X9IA 1KNQA 3ANYB 2VZ9A 5D85A 4G25A 1XMQB 1JV2B 2I54A 1H9AA 1SCUB 3TEFA 3HG7A 1E63A 4ZAFA 3M5CA 3QF4A 3RC2A 2O23A 3WA7A 4MVJM 4P38A 2I7DA 1JIJA 1WW8A 3L6EA 5CPFA 5DEIA 2PAAA 2AGQA 3CR3C 1C9DB 3EISA 5TGDA 4P31A 1C0LA 3A6KA 2YOHA 4GAEA 4CUZA 1LPOA 4EZ6A 3TDMA 1GZ7A 1EDDA 2HHQA 3CNEA 5IK2D 1GGKA 1PYDA 2XB2A 1OW3B 2J9YB 1BNPA 3MJRA 4B3HA 7ICOA 2PCLA 3MCVA 4TL8A 1SCKA 2J7PD 4EHIA 2D5CA 1DJOA 4ETMA 2XTNA 3RQSA 3DM9B 2J5XA 3KZOA 3SD7A 3CPHA 1ZNXA 4ESHA 1FY2A 4YUAA 1QZXA 1FA9A 4ZKEA 5BSEA 1YS7A 1KH3A 5HE9A 4DCPA 5F1OA 2FW9A 3PF9A 4AULA 2B92A 1NHWA 3NHMA 1NQTA 3OC0A 2IBKA 2C3MA 2ZRAA 3ST7A 4NYIQ 4L0MA 1Y8QB 3EVCA 4Y1FA 5GONF 2NUAA 3R7WB 4LISA 3LOQA 5FD8A 1VPWA 3UYKA 4LC0A 3KXLA 1T10A 1KK1A 1QYDA 4IG9A 1ADFA 4BRUA 5K0GA 4BFSA 3WRVA 1H3EA 1DRKA 4B0OA 3ILYA 4K9DA 4N6NA 2AN5A 2FR8C 3N6RA 4YJGB 1EUCA 2DHEA 2QR5A 1R16A 3QQ5A 2AC2A 1TTPB 4C4OA 3RANA 4Q3KA 4EBFA 1ODCA 2IYQA 2OD9A 1T2VA 1B14A 2ZTEA 3OTWA 1Y7IA 4UUOA 2VF4X 2PLNA 3SP1A 1RYEA 1KDRA 2QVGA 1SRQA 3TINA 1T91A 3EGWA 4M21A 2RP5A 3KOXA 4C7VA 3LNCA 4KVZA 3IBYA 5GAJA 3GY0A 1YHNA 1S2MA 1YS9A 4ENQA 1UCVA 5L4LA 3G6VA 3AJDA 4E13A 3BD9A 2NRWA 4XFKA 3PTLA 1XKLA 1LRJA 1Q2UA 1U3WA 2FG6C 2QBYB 2C5HA 1HG1A 5FTJA 4Q9LA 2V7UA 3WL5A 1OQAA 1MV8A 2HSDA 1IZ0A 2UU9B 1W30A 4U7GA 3F67A 5IJXA 1FFUA 4NYMQ 4MV7A 5JI3E 3CXRA 3RT1A 4A6XA 5KOJA 3R5XA 4AJIA 2V7VA 1EDZA 2XJ4A 3RFVA 2HPVA 3GUZA 1MB2A 3NEAA 5E2AA 4R0MA 3H9JA 1C4WA 3QOXA 2F48A 2X7JA 4LJ6A 4N8SA 1IZ8A 1QFZA 4CHGA 3RK1A 3LX6A 3OE5A 1VE6A 2JARA 4GO1A 2IPNA 2WAMA 3G0IA 2DPMA 3K0EA 1EX6A 5T64A 4DPMA 1PJ3A 1PZMA 3JYNA 5EVJA 1IN5A 1KKLA 5CHEA 3NS7A 5HUQA 2R4QA 4CLEA 4PG5A 5IKOA 5ESXA 4MYCA 1P9LA 3BILA 3H2ZA 1EFLA 3UC5A 1ESMA 4ADSG 1C3OB 1G8MA 2W55A 1M66A 4KAFA 3NPMA 3ONEA 4EMBA 6Q21A 5AXCA 2JI7A 1NQAO 3JWHA 4UJ3A 3N86A 1KFBB 3CA8A 2P9TA 1SZJG 1NWCA 1XYGA 4EPRA 4CKWA 2I9KA 4WZAB 2R44A 2XPCA 4F3CA 3HX0A 1F8FA 1DAIA 4YBZA 1BFUA 2OUKA 2QD5A 4JN6B 1VL6A 3OO0A 1JHVA 1FNSA 5ALWA 3SJAA 1VG8A 3BYZA 4CG2A 5J0YA 4UZSA 1W1IA 1AT1A 5MFPA 1DCMA 1YQQA 3O03A 1IN1A 4PGMA 3I39X 3H65A 3WLJA 4DCSA 4HAWA 4RS3A 3HWRA 3KFLA 1LLUA 3MC1A 1T8YA 1HZJA 2EATA 4YRIA 4ZTUB 1Z15A 1LB2B 3IV9A 2JJ2D 1UFOA 4QQNA 3TZHA 1KMIY 4JBWA 3L8CA 1B8UA 2CLSA 4C8MA 4Q4HB 1PO7A 3OC6A 5G0UA 5FUQA 1V96A 5ED0A 1W581 1XB2A 1X9GA 3GIKA 2HREA 1YZLA 3P2EA 2P8SA 3R6GA 3RAFC 1MA7A 4EYHB 3TVTA 2F1HA 3F98A 2Q1WA 3L07A 3ZWAA 3KHLA 4ZYVA 4N3GA 5ISMA 3A6GA 2YKGA 4YR7A 1NXWA 3EXHA 1CK4A 1JTEA 5KVQA 1ZQCA 1GQRA 4WERA 2JJ8A 5B1IA 5H83A 3SDSA 1M74A 2AN9A 3STVA 5CDHA 4D6XA 3LW8A 3ZIAA 1WXIA 2BR5A 3GIMA 1PJQA 1GCUA 1KDHA 4W4TA 2OEPA 3MMSA 5K2MA 4J9NA 4PHAA 1A2QA 4HN4B 3ZJYA 4P4LA 3U7QA 2OP0A 4PTYA 5F3WB 3LY8A 1FYXA 1KERA 1Z0DA 3EA5A 2QY6A 2I22A 1PG5A 3QXSA 4CM9A 1RXEA 1XVVA 4QWDA 2QMYA 3T5AA 2VP2A 2QENA 4B3BA 3FRIA 2ZIZA 4DR6B 1F9EA 3LC1O 1XZLA 2O2SA 3GEGA 2GLTA 1TUBA 1U2TA 1HZZA 3PNVA 3N7PD 1U5AA 2HMSA 3RYIA 2V96A 2IPOA 2R00A 3L6BA 1HQCA 4LYFA 4MYHA 4IIXA 3SAGA 3MJTA 1XMPA 4K9QA 5KZMB 3C3PA 4BNFA 4OX9Y 2YVQA 3LC2O 5D6NA 3ZZ0A 2PCJA 2PKRA 2B61A 3DQZA 4JI5B 3FFXA 3SHWA 3OLZA 1ZJYA 4YBRA 1RHJA 3BH6A 3WK5A 1ZGGA 4HWTA 9LDBA 3IQFA 3OIFA 2ZJZA 5CEFA 3OFND 2WIGA 3DQQA 3K1ZA 2NUPA 1YASA 1NN0A 5HDQA 3QY9A 4L5YA 5FQNA 1ZQJA 5GV7A 2ZAIA 2P7IA 1JHUA 4FUQA 4FOPA 8ICWA 3KWLA 5CAEA 1D1SA 4B17A 5TY0A 4DMGA 1GZSA 3F5FA 3NHPA 1Z5ZA 4JWKA 1AF4A 5IF3A 5ICEA 4GM0A 2HOIA 2ZU6A 1RKUA 4IGAA 1Q95A 3FCCA 1YVUA 4IXWA 2H59A 1KDPA 3BCRA 4Q1FA 4EI7A 3AIOA 5ESRA 2OHFA 1J7KA 3ESRA 1OFUA 4DG5A 4OJMX 2ZIVA 2R6AA 4UB6U 5K8VA 4B09A 1NBME 3GHHA 2PKQO 2K4PA 4DNPA 5DHTA 3SKVA 1ML4A 1QHFA 1ZA2A 3PCRB 5DOVA 1JEYA 1Z7YA 1GL9B 2X40A 1AU9A 3FIUA 2LNDA 4WXEA 3BQ7A 1LFAA 3KSAC 3FGOA 4X20A 3GXOA 3ECSA 4FFWA 2XYHA 4AWXA 2FXIA 1NW3A 2I65A 3EVBA 1ZESA 4OU5A 2OA0A 5HUJA 2HBRA 4QGSA 3EGIA 4IL6U 4UHHA 3UJBA 4U7JA 4YRLA 2Z2KA 1OC4A 4V38A 4R81A 3I0NA 1ATZA 1IV8A 4N40A 2BTOA 4N4AA 4HQKA 4GC6A 3PNSA 3A11A 2HJHA 1E6WA 5JCPA 5DG8A 3PT9A 1Z29A 1XXHB 2REOA 3RJIA 3BWEA 3OSUA 4G56A 1QF9A 2DQNB 4PS1A 1PN3A 2MSNA 4FCCA 1S5PA 3JTEA 3LV8A 3NIBA 4UB2A 1ISGA 4O25A 1KQNA 5K2OA 4U8HA 2WWYA 2FRXA 1KTVA 3EGCA 4AG3A 3MMXA 8ICCA 4ZVVA 4NABA 3M5WA 4QZEA 5BV2P 1U47A 3RVMA 4OVKA 4KFCA 1M6HA 1KLNA 3FG9A 4P3YA 4M0UA 2I7TA 4DRXB 2QXYA 3ELYA 3PX0A 3TWOA 1NFFA 2NPIA 2OXRA 2W9MA 2R1TA 2PFKA 3HXPA 2QLFA 2OSBA 4R1OA 4AC9A 3BF8A 1XNRB 2XYRA 4INAA 3Q12A 3OTIA 1X80A 4KXLA 4PQGA 2BTEA 1LLCA 3HI4A 2WV9A 4ER6A 4MRMA 4AM8A 2H5EA 2EJBA 3EEYA 1WSWA 4HXYA 3DL0A 2NZXA 3PW5A 1INLA 2VBFA 4BWVA 2RGCA 3E9DA 2Q4EA 4GLLA 5EGNA 3MRSA 2QG6A 5J3JA 1C7IA 4QHSA 2JAPA 3RRXA 5AHWA 2GZRA 5L4SA 3TEMA 1BIFA 2ZAYA 1Z5WA 2LD4A 1XZKA 3PVSA 2XGOA 2AX3A 1ZETA 4D46A 5EP3A 3OZRA 3QVXA 1RADA 2QRNA 2JXJA 1JDVA 1JQEA 3ZZUA 3OZSA 3GIJA 2FUG1 5AQEA 3TW0A 3K2QA 1FVXA 3UOAB 4NCNA 1NF8A 1RQXA 2L2QA 3IUQA 4Q3AA 4BJ6A 4TXJA 1KAOA 3WY9A 1RRMA 2ZYTX 2WBLC 1C4OA 3ISBA 3EXIA 1JSLA 1MB3A 5E6RA 5EE9A 3GEBA 2IPXA 1B23P 1QUEA 3L4BA 3TQCA 3UQZA 2J8ZA 3RIGA 3L6DA 2W2KB 5KVAA 2B6GA 4UHCA 3DOUA 1S3FA 2WUEA 5T4HA 1M2VA 2GDJA 4GOKA 2CYBA 2BZ1A 3KZNA 2ECKA 4XDHA 4BO1A 1AK2A 2SNIE 1T3TA 2NYUA 4IG4A 1SGGA 2JHGA 3KZ1E 3G0HA 4PNPA 4N76A 1BDIA 3D4BA 5CDFE 2VVTA 4CF3A 1RQPA 4RIIA 2WZBA 3EY4A 2ZRKA 3RU7A 2D6FA 1Q22A 2X2FA 3I5YA 1P1RA 2ATLA 3UN1A 4EB6B 2PVPA 4R8MA 4BTVA 4J76A 3OJ0A 3D0RA 3FX2A 4LEIA 7ICTA 4QBGB 3D1JA 5FR2A 2ZYGA 5GZ3A 1KVQA 5L3VA 2BFBB 4OHFA 2BFDB 3MS4A 4PIPA 2PQ6A 4G5XA 4C78A 2WFZA 1T34A 5D01A 2ZDHA 4TMVA 3RH5A 5A06A 1GHTA 4G2NA 2OPBA 3VX4A 4TMZA 3ED5A 3EXHC 2DPGA 3OURA 4XB1A 3KKAA 1IPEA 1QDEA 4US2R 1QZ3A 1SGWA 4RMNA 4AWAA 4AJPA 3INGA 1T6YA 4OQYA 1LPSA 4QQ8A 4DYDA 5JS6A 4UE6A 3MJSA 1V3QE 2F64A 1B7GO 1JQ5A 2R6R1 2I4TA 1ADGA 4G01B 5CYGA 2EDAA 1PR9A 1YGPA 1YDEA 1XTTA 2ZTSA 3VZCA 1B74A 5IM5A 4UNNA 2CNWA 2ET6A 3C2QA 3A58B 2BMAA 1S02A 1K6EA 3KOUA 1SZHA 4ZRNA 5JXGA 3T4UA 1U48A 3OEYA 1ZMOA 1HZZC 4B4DA 4LYYA 2ECOA 2R00C 4TURA 3KDPA 3NS1A 2IHYA 2N0SA 1WXEA 4QELA 5BYKA 3NWJA 3N2IA 4EDFA 3C39A 4XKJA 1Z7GA 2C7VA 3UK2A 5F64A 1V3TA 4CCHA 3OZDA 4LSWA 3UICA 4OQEA 2D1FA 4JFAA 2JLZA 3G6XA 2YCLA 3LXMA 1ID8A 6ABPA 4DIBA 1MRZA 3B5EA 4RL4A 4XYMA 4R3WA 3GRRA 4BMNA 4S1PA 3SR0A 3KLBA 4Y1RA 5BN3B 3RCBA 1YA6A 1IUNA 5KSZA 3VYUB 3UV3A 3OMLA 2GNAA 3T0IA 1ECCA 3KXIA 5I6DA 4HWGA 4X45A 5L1JA 5J2GA 4GLBA 3Q3HA 4M1TA 3CE9A 3T15A 3K9QO 1G6OA 8ICOA 1LCIA 1L4BA 4M0FA 2XGMA 3TMAA 2IW3A 1SXJB 1RJDA 2I78A 3IP5A 1T8TA 4KWEA 1QPBA 4PRKA 3RK4A 4W9RA 2NP6A 1V8OA 1ZQNA 3PCTA 1E62A 2E5LB 3UMGA 2O8NA 2JJYA 5HR5A 1WRBA 2IUEA 1OLSA 2ZYDA 4DXDA 3ZY6A 5LZ2A 2ZYUX 4HH0A 2VJCA 1G59A 5KIAA 3PU6A 2Q3MA 2GHRA 3HZOA 1FZQA 1ZQXA 3B0YA 2Q8NA 2UYGA 1Y81A 3W5CA 5AM0A 4NU5A 5IIKA 5F5XA 1R66A 1FVFA 1YUBA 4U5XA 4QUHA 1L8XA 3BFPA 3O2JA 4L76A 2NZVG 2EKQA 3ZD7A 1TCVA 4AFNA 5HA5A 4L5IA 1GKKA 3IE1A 4C6TB 4ZFNA 4O29A 4R64A 3EB9A 3OX2A 4LN1A 2Q1UA 1L7NA 2HPZA 4ZT6A 3SJUA 2A14A 3AM9A 5EUBA 3RRZA 2A9VA 3HTXA 4NDNE 2HW8A 4QZVA 1TMOA 3UFXA 2CNKA 5HKAA 5LOVB 3WKAA 3AX6A 4Q9NA 1YJ5A 3L46A 4H1WA 1EVIA 4QJBA 3EPPA 5KINB 1N4DA 1GAEO 3D3JA 4ZI7B 3WGLA 4CQLB 2X2EA 2DJIA 1H6BA 4ZYLA 1I30A 1E7MA 2ADFA 4E07A 4EVIA 2CDBA 4ARVA 3L4KA 5HNKA 5IN4A 1DBIA 1EB8A 3H2IA 3GVXA 2C4WA 3EF3A 1NYRA 3T4XA 2DE0X 4U6SA 4BP8A 4WADA 3VUFA 3NVZA 2PRJA 4CCYB 4RAOA 4HEA1 1C30A 3A9UA 5EYPA 4Q3OA 3NZEA 4N5HX 1RBQA 4TXHA 4L4UA 5I7VA 3RC8A 1R12A 2A7XA 1ZW1A 1W36B 4YXMA 3NTRA 2O20A 4RQ4A 2QTWB 5TPZD 3M4ZA 1VPDA 2OGSA 3N7AA 5DW3A 3HY6A 3OQOA 5HR7A 4BV8A 4O4LF 1Y5IA 3MOGA 1WYGA 4RMJA 3RODA 4D9GA 3S68A 3WYCA 4KGVA 4BO2A 1XHLA 5ITZB 1U45A 1XRJA 4QBIA 3C48A 3SVTA 4IWYA 4NAUA 2PXIA 4CKZA 3E8MA 2OG1A 3QITA 3U09A 2QL9A 1T6XA 3K6RA 3OEED 2A3VA 5HMLA 1M3SA 1R6BX 3KQNA 2YJTD 1NI4B 5DG9A 3CMMA 1UIRA 5BXYA 3E0QA 2G9QA 2O3SA 3H5TA 4BU0A 9LDTA 1XEWY 2PS0A 2KP7A 3PSTA 2XRFA 2GD0A 1PWHA 3ZTYA 4IR1A 2D5LA 1J1IA 1SJ9A 1PGJA 1Z37A 2VDQB 1XDDA 3MYYA 1CJCA 3PZPA 1JILA 3IRVA 3AEQB 3FB1A 4F3RA 1MAHA 5C8ZA 5T57A 3EC7A 1JG3A 1FW8A 4CI0B 2VYQA 3L4BC 4KPYA 5LP6A 4DSOA 2JFUA 4RNOA 4A16A 3UJ8A 4ZCQA 4YMLA 2ZVDA 2JIRA 3S2EA 3KQSA 4DBVO 1QVRA 4GNRA 4RDIA 4PVCA 4D0NA 3THOA 4IYJA 2HQOA 5C52B 2MWMA 4NBLA 1N92A 3HCOA 2D6FC 1SU6A 2PM8A 5L95A 1B76A 2G6BA 2JV3A 4X84A 1Y8RA 4Y0NA 4NK5A 2BPOA 3KEQA 1N1EA 2J9GA 2YXEA 3QUTA 1ZEMA 5KFLA 3CZ5A 1C8VB 3ZGNA 2OH2A 4EITA 1FS6A 4B8WA 3B9QA 1V9CA 1IY8A 4E30A 4PRYA 4YJ2A 2GERA 3DZHA 5E1BA 3KKAC 2M6RA 3PJRA 1KBQA 4I6EA 4LYDA 1CUHA 1ZD5A 4NU0A 4G3IA 1F06A 4PG6A 4G5QA 1IBCA 2Q50A 3V55A 3EY9A 1U7ZA 2BBOA 1IOZA 4FMDF 4L8YA 5HF9A 2XYVA 2VKTA 2HR1A 4PSVA 4IEIA 2B4RO 2X9QA 4G67A 3V8PA 2C7RA 4AP6A 4L50A 4WLNA 3HZRA 2XQIA 1I3LA 3EGXB 2EQ5A 1QO7A 3SBOA 3PUZA 4C03A 2EWWA 1KAGA 3IDZA 4UDNA 4NF2A 1E7RA 1G5PA 3OIGA 3H16A 1ZI6A 5ELXA 5SYAA 1IWBB 2EKPA 1B0PA 1CUBA 3V8RA 1SVLA 4HY3A 2QRJA 4HQOA 3P5SA 4OO3A 3OQJA 4YAFA 3ZH2A 1AS3A 4K1LA 4JAVC 3JD2A 4GWGA 5D3MA 4GXTA 4WLUA 2EBUA 2RHWA 4FS3A 1F2UA 3R0JA 4BMZA 3GGGA 1UC9A 2CK3D 3RWMB 1X6IA 4ZALA 2W43A 4YIKA 2R751 5FBRB 3MBOA 4P5PA 4M46A 2HN9A 4HNAB 4NCBA 1V5EA 1E1MA 3MQ4A 2PBLA 1E6EA 4NXZA 3S8MA 3ZBTA 2WYHA 3AWIA 2C22A 2B1JA 4P6VF 5TEWA 4BKUA 2QTRA 3OIWA 5KL1B 4Q9IA 3DEAA 3QUSA 2I4RA 3AEUB 4HPXB 3B5JA 2QTCA 5TNXA 2BCRA 1R5OA 2VRBA 1X1SA 2WU1A 1MEOA 1EWRA 4PBSA 1J1ZA 5HTKA 3IHQB 4UNRA 1MMFB 3B85A 2O1XA 4EM6A 3PV8A 4HQ6A 4W8OA 1HDCA 1QS0B 5KYGA 3H19A 5IVPA 1JLRA 1YCHA 1YRQA 4ZHQA 2A92A 2EARA 3AO0B 3HXTA 3HADA 1MNAA 2AOTA 4RZ3A 1W4ZA 4GPD1 4M1KA 3VC7A 3OT1A 4JQYA 3H9QA 1O7JA 1SUPA 1NSTA 1WUJS 1JIXA 4KH0A 1M1UA 3ZKWB 5ALKA 2WWXA 4AF6A 2M9NA 1XMSA 3G2IA 2CVFA 3RYHB 3TTYA 4RH3A 1WHTA 2ZRJA 4EY4A 4BLWA 4RIEA 4R69A 3T7RA 2BUAA 2QZJA 5ALVA 1RJGA 1H0HA 1TZMA 1VB3A 1Y80A 2VAMA 3HUTA 2RJ3A 1U4OA 1XLUA 4GZ6A 4CDGA 1P39A 3ENKA 1Z5PA 2AXEA 5DGHA 4YWJA 4NBRA 3H4BA 3GQBB 4TLEA 1E18A 2X86A 2UUBB 1D5CA 3D6FA 1DDOA 2JD0A 1RJEA 1JR4A 4BUCA 1TF2A 3OZWA 1ZQBA 3KELA 1FQJA 3CX8A 3OAAA 4XWGA 4XYBA 3I92A 4YXFA 3A1DA 3UNXA 1Z22A 4TKMA 3ZK9A 2KE7A 3CKMA 3Q72A 3EK2A 5A6SB 1XJWA 2IUFA 4IM7A 1N78A 4K8RB 3LHDA 2MYTA 1KWGA 5D46A 1UKYA 4O8CA 4DWOA 5K6AA 1X1RA 3GGOA 1FZTA 4HPJB 3H5WA 2NUTA 1G6KA 2VNSA 1PVRA 1NW6A 5K3SA 3KQKA 2ZCVA 3LVRE 3RUHA 4IX1A 2ZVQX 3PHHA 1S2GA 2QN1A 1N5RA 3TLBA 2JIPA 1V1RB 3REQA 1WEHA 3EGEA 2NNWB 3ETLA 2YJ4A 3LAWA 1NBMD 1XNJA 2D7JA 1CR0A 4P53A 4DY4A 5GM2A 4ZEOA 4C88A 5CVEA 1UBGA 5IBCA 4YCSA 1UK7A 4N48A 4II7A 1Q1BA 3HC7A 2O1WA 4H7KA 2NVUB 4N5NA 3UA3A 2YV5A 1VMIA 1VJ0A 4TLMB 3VJKA 4G89A 3SPXA 3OOEA 5AI8A 2IHUA 1WG8A 2VWPA 4W7IA 2FLPA 1GU7A 2JIDA 4DFMA 4DQQA 1D2RA 4HTFB 4WWHA 3I2IA 4FHZA 4D9FA 4TWBA 3RD5A 1X42A 2HX1A 3HB7A 3EQ7A 2OAEA 5CDGA 3JARA 3KHHA 4JJ8A 4X5OA 4EPVA 2BFOA 3VR5D 1DJLA 3T5HA 3EFBA 1GAXA 2O3UA 1N36B 4FPXA 3QPDA 1EBUA 1VMKA 4V0OA 3C6QA 1BW9B 3A26A 2EKBA 4BO8A 4IHJF 3RJFA 4C7JA 1XVIA 3JRNA 5LP6C 1I7SB 4F4YA 2NVWA 5IIOA 1P2UA 1QG6A 5FTKA 2ZTMA 3NV9A 3GH1A 2IYWA 4AKSA 4NHOA 1A71A 3M6WA 5FYDA 4B9TA 3P27A 4OQPA 5TISU 4OXRA 3MN1A 1L5KA 2GOYA 4OQFA 4X65B 3D2CA 2K4HA 2J5QA 4EGSA 2DPYA 2H2DA 4QWMA 2XMRA 2IUTA 5E3IA 3KZIU 1MOQA 5IFKA 4POAA 4S3MA 4J6EA 4INPA 2NU7A 3NHBA 2KW5A 1B2LA 1NVEA 4ED7A 1O2DA 4IIJB 1G64A 3CV3A 3CUVA 5I9IA 3OD1A 2ZYHA 4BYGA 1NV8A 2GZSA 5FKJA 2H3FA 4FS8A 2DKOA 3H2KA 3W05A 4Q1AA 4NECA 1TJ4A 4JBNA 3T35A 4QO8A 1OA1A 2YVKA 3SQLA 4AJNA 121PA 3ZVLA 1B8VA 1M54A 1MN8A 4J1SA 4WNYA 4K6HA 1HNZB 2GSWA 3QKSA 4PR3A 2PWYA 4ITVA 3QWIA 3K0FB 2B9VA 3NRJA 3RNLA 2FEAA 2GXSA 1Z5UA 3PY8A 4NJ8A 4MVJH 4P3XA 2OSVA 2H31A 2G82A 3GMIA 1U7PA 3CWZA 2X5OA 5D3KA 4Z4FA 5G02A 4MUMA 2XGSA 1Q0QA 4B3RB 4MR7B 4DHEA 1VJDA 2QX9A 3HXLA 2AXNA 4WZZA 5DZSA 3N2ZB 3VHRA 1BD4A 2QM8A 3O8DA 3GD7A 3BL6A 3TKYA 3A4MA 5EJ9A 4TQRA 4COOA 4UASA 3V1NA 3UMBA 4YV7A 4XOIA 3GNSA 1HV8A 5ALGA 3K71B 1C9EA 1P0PA 3N2EA 4Q3LA 3N2GA 5KTTA 3K92A 2PZGA 4P9NA 2F3RA 4DLTA 7ICSA 1US8B 2NXEA 5LNK1 5JUMA 3NOVA 4X60A 2BC9A 1TM4E 2FEWB 2AI3A 2XWSA 1LBTA 3Q0IA 3LF2A 1HH4A 4EF4A 2OCYC 4IUYA 3BT7A 1HE5A 1OWLA 2YC2C 1ZXXA 5FWYA 1EE9A 3I1IA 3NG1A 3M6AA 3N7TA 3GJZA 4QPDA 2WJAA 4MKXA 2ZBVA 5H59A 2J3QA 3SQWA 3EF0A 1ZCJA 1HWYA 4LXTA 3EXAA 4ZMBA 1G63A 2LE0A 2WWIA 2H7VA 1JDBB 1SXJE 4MUAA 1NATA 2EZZA 3QJGA 3VNBA 2V8OA 5ENVA 2VP6A 4UNQA 2HLDA 4BMXA 3E15A 5EKXA 1ZQPA 1HT3A 1VLQA 4RJIA 1KJYA 3OWOA 3BAZA 4RVSA 2H0RA 4D81A 2DT5A 5E4FA 3GDXA 4O2RA 4FBUA 4S04A 4UPDA 3AY6A 4B5LA 3PSIA 3R5FA 2ONKA 2H1HA 2A9JA 4Y30A 1PQPA 2OENG 4H0NA 5CGQB 3VR5H 1WUKS 3A9SA 4Y6SA 3QVVA 4BO9A 2P6RA 3MCTA 4ED6A 2KHVA 3WHPA 1MQ9A 4F4IA 5IH7A 5IZCA 5ALFA 1R9GA 2K7FA 4R68A 1E61A 1XVUA 2C78A 2OV6A 3HJFA 4IH1A 5HBGA 4A8HA 4DLPA 5E3HA 1T5IA 5F77A 1H2BA 1TT7A 1KSJA 1LKYB 3PYMA 4F3KA 4KYTA 4C0QC 4Y2YA 1DIHA 1ESCA 1E3DA 3RJZA 5BQXA 1XAJA 4H1TA 8GPBA 2FFRA 3EFOA 3AB8A 1ODJA 1VDZA 4NNOA 2Z2IA 1X19A 4TXNA 4HNVA 1K98A 4BVGA 3V2UA 2FVXA 3VU8A 4O4HF 4O2BF 5REQA 2C77A 4YGYA 4BVEA 2HBLA 1F4LA 1RAAA 1FXUA 3I6ZA 3GIWA 2GPNA 1QIEA 3GJ6A 2ZYRA 2X5XA 1K27A 3FB4A 1HXHA 2ZBPA 1P6UA 3SFTA 1G6HA 2RHFA 3EPIA 3M4JA 5L3SB 1ODTC 3OCZA 3W2FA 3RYCA 4M76B 3NC0C 2NU8A 2JHDA 1QQ5A 1S89A 3JQGA 4F5YA 4NHEA 5JWRA 3S40A 2ZUVA 5CDTA 1UMDA 3D31A 3EVNA 1TNDA 1LY1A 5JLAA 2R11A 2AH5A 2XEXA 5TS3A 2Q2NA 2B1GA 4GX1A 5KJEA 3IAFA 3IELA 1L1EA 3GJQA 3N2LA 3OOYA 2W48A 2WOOA 4HWSA 2R1VB 3NONA 3WVNA 4YRJA 1QG0A 2B0CA 2A9PA 3IV6A 1IUPA 1AHNA 6PFKA 3C5VA 5K6AC 4MIEA 6CHYA 3ZS8A 2W2MA 3IBSA 1Y34E 3PR2B 4YMGA 2TMDA 2QV7A 3FGNA 1V16A 3D1LA 4D92A 4DZTA 3KUUA 4C4SA 3K05A 2DUMA 1P61B 5JT1A 2QMQA 1UKVY 5LYYA 4H1UA 4F8RA 3AK4A 2O8BB 1YF3A 1KZYC 4MPJA 3Q7SA 4KX3A 1NP3A 1N6KA 4TZ0A 3ZIDA 2X1LA 3VR0A 4LJYA 2OVFA 1DOZA 1L5QA 4WI1A 1KO7A 3D2SA 1NBHA 5DLYA 4OATA 4DUGA 4YRAA 1QE0A 4YX9A 2OBLA 4EBDA 1WXHA 2C5AA 3H0RB 1QBGA 2QYSA 2QN8A 3PNCA 5KFZA 1XS9D 3EF1A 2C1EA 1NR7A 4YYZA 4UDXX 1HFKA 3V42A 4B2PA 4LNUA 2YZ7A 5BWMA 5IKXA 2VJOA 1K5PA 2QTAA 1XNSA 3GK3A 1OAKA 4H08A 3RVRA 1A4UA 1V1JA 2XTAA 2FLWA 5J4LA 2OWDA 1E4VA 2W6IA 2P65A 5T3YA 1SCAA 4IJQA 4HDMA 1N61A 5E38A 1GPNA 5I8PA 1ZUIA 1BVUA 2IOFK 3BDAA 4KBGA 5CFZA 5JNLA 2ZFUA 4YXWD 1Y4AE 1SUSA 3JAMA 2PUBA 3OHSX 4Z7QB 4C5BA 5DGCA 3GG2A 2LPEA 4R54A 2PKYX 3B6ZA 4KWCA 4I5DA 3LT4A 5BQ5A 5CP2A 1BDMA 1QKJA 1VSTA 3E2PA 3OMXA 1X92A 1AQLA 3DJFA 4Y6RA 4MIYA 1WM1A 3IR5A 4J0DA 5AM3A 4A27A 1EUDB 3WJ2A 2CEKA 5WRFA 4XD7D 2C2OA 3UUFA 3AUJB 1DBQA 1ZSVA 3AUOA 3CLSC 2XCLA 3K53A 1CPYA 5F3XB 1MVOA 4PEVA 4DQXA 3RAGA 1JKJA 5L51A 5E8RA 4RQ5A 3U4CA 1E94E 1N2ZA 5EHZA 2GK3A 2WPDA 2L5YA 2PLAA 5CR9A 4JR2A 1Z2DA 4RA9A 4AI6A 2HDOA 4DOAA 2PZBA 2M0NA 3K96A 2ZYAA 4PGFA 4NI5A 4ASUA 3KHSA 4KKXB 4WOKA 1T35A 2ZR9A 4DPLA 3FC4A 5B6JA 2EYUA 5HRAA 4B7XA 4LYJA 2CB0A 3IDSA 2DU8A 1ZH8A 1W4BA 2W9BB 4HXGA 1OXXK 3H4TA 2OMKA 2VJLA 2GZMA 1RABA 1PT5A 1PYGA 3TUZC 4FZJA 4DDUA 2NSHA 4B84A 5CYOA 4HH4A 5F3DA 3CRQA 3RIYA 1R0CA 4WECA 5LLSA 1P31A 1GZHB 2DWOA 1VE1A 2H5XA 1ECBA 4H4DA 2ZSBA 1TDJA 1ESEA 3FXAA 3W9BA 1XMVA 3U3DA 1I3MA 1L5FA 1E2JA 4A91A 3IILA 4NZOA 1DTSA 4Q05A 4MJ7A 4CXMA 4HDOB 5FLEX 1QGAA 3DWGA 1KARA 1I2BA 4DC0A 3EWAA 4TWRA 3M1IA 2IOFA 1K0FA 1PFKA 4H3VA 3I3SR 2VSXA 2VSYA 3U0VA 2EDUA 2NYRA 3ZDXB 1SHKA 2VDLB 4G0VA 1RQNA 4MEJA 4EW1A 2P35A 1LNSA 3I61A 3RR7A 4CV2A 1ZM3A 4JHLA 3EXEA 1SQ0A 1ZI8A 3OF5A 4XPIB 2YUTA 3O21A 4TRMA 3DYBA 4J3FA 5T8KA 4PH5A 4BGDA 5K6TA 4YRMA 3M6IA 3VR2A 1FPMA 1LB1B 2ZQYA 3ZGOA 2MYUA 1VL1A 3CLTC 4AWBA 1M34A 3VNQA 3BGSA 4DM7A 1YD7A 5JISA 5ALLA 5BWBA 4DLSA 4M1SA 1R5BA 4C7YA 2ZRFA 1U6KA 5EMJA 2JZBB 4X66B 2PMCA 5IZCC 1N3LA 3AUTA 1X6VA 5T5QA 4BAGA 3SZUA 4WA7A 5J5CA 2HD4A 3V9AA 3HRKA 3CURA 4DV1B 2R7KA 2JB9A 3VVMA 5KFOA 2AUMA 2GYWA 3PO4A 3OLYA 4YRFA 3V8EA 3FTCA 1Y4ZA 1SC1A 1RLOA 2O3QA 3DONA 1T0PA 3JVDA 4UKDA 1XA3A 7ICIA 3IG8A 3IEVA 2C92A 2FWIA 4FFVA 3WK9A 3M3PA 3SM9A 2W8LA 1JRLA 1NVKA 2J6BA 1RWMA 3VZQA 4G37A 3VAYA 3WZMA 5C3MA 4X64B 1S10A 3GT0A 3H1TA 2FEPA 2BEUA 3PENA 4V1CA 2RH9B 3L6UA 1VA4A 4MAMA 2NLOA 1NPYA 4RF5A 2ESRA 1QH1B 2C1ZA 2W9AA 3FSGA 5BVGA 4DQ0A 4N6GA 5A3VA 7AT1A 1HEUA 3FZQA 4J0CA 1A8QA 3RB3A 2IEAA 4M87A 9ICHA 3C3YA 1I10A 3A0UA 2CXQA 2R84A 5IAJA 5BWNA 1JAXA 1CEQA 2WABA 3RVBA 5EKDA 2Q8QA 5F4ZA 1OFHA 3NB0A 1VC2A 4MAFA 3BJZA 2WVJA 3OKFA 1Z4MA 1IRIA 5IYZF 8ICXA 3H2BA 1GN9A 5AXDA 2PMKA 9GPBA 3PDIB 2JBAA 1AHIA 4V0QA 3WR5A 1T2AA 5A4DA 4J0QA 1X7XA 5F2EA 2GPAA 2HMYB 2PGIA 3MWJA 2W71A 3AVUA 3QW4B 4Y9SA 1CBUA 2QIPA 4JY7A 3AERB 3D6VA 1LBEA 2V7BA 2YJNA 3LUDA 1NKSA 1Z6AA 5ADHA 3HBJA 5AW5A 3AP1A 3CIFA 1G5FA 4KN5A 1OBFO 1S9DA 3WX0A 1W8DA 2OHIA 4CM5A 1L7OA 1B1CA 4GKBA 2WHPB 2GEDA 3OZEA 4MP3A 1A1SA 3QV1A 1G7TA 5BQFA 2BFAA 3TBHA 4DABA 4AMZA 4KFTA 4N18A 1XPOA 3D8SA 5DCUA 3AHHA 3TGLA 1XROA 3R3YA 1GCGA 4EFMA 1SKUA 3OSNA 4ELTA 1K5HA 3CNBA 3ADDA 4HTAA 1YE5A 4KR0A 3AILA 2FK8A 2IOQA 3QBJA 3KJFA 2V0GA 4BVJA 3COZA 2H1VA 4LGCA 4BNGA 3QI7A 4CKYA 2Z4RA 4FR2A 2CLIB 3OH8A 3L6CA 2X8AA 5HJ2A 3VSEA 3S2ZA 2QRVA 1HX7A 3MB8A 3TM4A 1N7GA 3TNFA 2RAVA 4QQKA 5AOCA 2PBRA 4J0KA 4ACBA 2HOQA 2Y1CA 3BE6A 4Q9DA 3Q8KA 2JIQA 1UXOA 1MVLA 1U7WA 5CBPB 5ALJA 3ZW9A 4WCVA 2J0UB 3I53A 3A6LA 3ZJTA 2ZM5A 4UHFA 1U0OC 2JA1A 5IAAA 2ZZMA 5A6VA 1OX5A 1GWNA 1NVMB 3DZJA 4JJ7A 4PYIA 2B69A 4DEZA 4JXXA 4D42A 1YMUA 3O2NA 2I29A 3A1SA 4WESB 3X2SA 1AKTA 2VSQA 2GJ4A 4QXMA 3SC3A 1XEXA 4DNFA 2Q3DA 3OEHA 1RE1A 3ZLJA 3C6YA 4TYWA 2FP4A 4EPTA 4NMWA 3SLRA 4WT7A 1Y6GA 5LYJF 1K66A 3Q8QB 2VXBA 2ZI4A 3UWMA 4HGPA 4PX9A 2E8PA 4DQPA 7GPBA 2HYDA 2UXBB 3NJRA 2IF2A 5KG2A 5GZ6A 3B89A 3FLMA 5AVYA 2GVZC 3AZOA 1C8LA 1L7RA 4XGIA 3F2BA 5KYUA 1ZH6A 4UC0A 4AZ0B 4KLSA 1U0SY 1M0EA 3WNQA 3PRJA 1X1CA 1NZJA 4MKRA 2CWWA 3KV3O 2PKQP 1BXGA 2GUWA 1U28A 4GDMA 2IGBA 1C1YA 2A86A 1GUYA 4JUBA 4CMCA 3BS5A 2OCEA 5LB2A 3NRWA 1BKDR 2I3GA 3PICA 1N75A 1T5SA 2PA3A 3WDKA 4KQIA 4RQNA 3D8RA 4BNDB 2JNWA 4Y2JA 3A9VA 1ODKA 3PUWA 2ZWOA 3GGCA 1PVQA 4TQSA 1UPFA 1DRWA 3LKDA 5BV8A 3KOMA 4D4GA 1NBEA 4MQMA 2K60A 1JQJC 4KODA 5FHRA 1T8UA 1CJVC 5IT0A 4ARUA 1DC4A 2WTFA 5JZSA 3UUWA 4AS2A 4L4SA 7ICQA 1WD5A 1PWYE 2O14A 1E4OA 4UD6A 2X0IA 2ZQZA 2FN9A 4NU8X 3VHXB 4IUBS 3LCUA 2IYVA 1DKPA 4M37A 4R9SA 4JLOA 4LC9A 1UH5A 1IWOA 3E2EA 3ZOKA 3MFHA 4DT1A 3FLAA 5AKYA 1Z5VA 1DKQA 4F4KA 1V8BA 4KLGA 1ZISA 1URPA 1CUFA 4RPJA 4GUDA 1Y3HA 3MJVA 2D1RA 4FHEA 1YRYE 2IL1A 1UDRA 2J87A 1CJTC 3MYRA 5AK5A 1PDWA 1YZGA 4F5OA 4ZMSA 3MF4A 3TBKA 5ALMA 5T8KC 5EIAA 4G5FA 2J41A 2EF0A 1B93A 3JASA 3IS3A 4Q18A 3T5LA 3W2EA 3U5ZB 2WNHA 2G1KA 1GTG1 3WBBA 1LNQA 1PEKE 2QTNA 3T7IA 3U80A 2XWBF 2GZAA 4AXXA 4B1FA 2QSUA 5LLDA 3O3NB 3OE7A 3GN1A 3MCUA 3ZJ5A 2FWAA 3DMYA 4J0HA 2ZB3A 3P8ZA 1FDVA 1Q57A 1GP2A 1WBJB 3A9CA 3BGVA 5JBQA 3M8RA 1XN1A 3I4FA 2J9XB 1GQFA 3F6SA 1H93A 3C6XA 2PSJA 1FL9A 2C42A 2GCOB 4BKMA 1FYEA 2IWHA 3USZA 3X0DA 5KQRA 2BQ3A 3ANXA 1UMBA 3GLHB 2HY7A 1ZL2A 5KFHA 4IFTA 3TQQA 5KG7A 4QKQA 3LVWA 1J8MF 4X3CA 3WLKX 3I62A 3E5MA 1IN4A 4BVLA 4Y1EA 2HB6A 3CU5A 1QHXA 3QEJA 4TVKA 4FIDA 4RVGA 4MV6A 3LLMA 3QTLA 4N5MA 2BFPA 3PL5A 4KRGA 2DB3A 1IY0A 2GKSA 1D9FA 3M34A 4L6IA 1SL0A 4QX6A 1WDTA 1FDSA 1JWAB 4BGIA 1ZCAA 2QTFA 3ZLTA 4ZGWA 1OFTA 3U48A 1A96A 1CQIB 1JI7A 4DR1B 2X1VA 3V4SA 2HIHA 2O2YA 4RV5A 5A03A 2JJ1D 3VYRB 4MO9A 1LDEA 4LQDA 5AI6A 4UUQA 5BW4A 5GM1A 5FV4A 4LYGA 1Z9BA 2W2PA 3E48A 1QRRA 1Z2EA 2QI9C 4BRZA 2W4MA 1Z8FA 4L7QA 3E70C 2JIZD 1ITZA 1ZQVA 1QHGA 5K3BA 5K3FA 2REBA 1UM9A 3RVKA 3L8DA 1Z33A 1YNOA 1SKBA 3VKGA 4PC7A 1SXJD 4MIKA 4RZUA 4CMGA 2C7PA 2O2DA 2CE2X 3WIBA 3WNBA 5EOZA 5AK4A 1YIOA 2Q1XA 1UIMA 1MAWA 2CLLB 1NJ1A 5L3QB 3DKRA 3A4IA 4N01A 4DMRA 4RCYA 4PM4A 1NK7A 3OBIA 2WFLA 2KLHA 4N6OA 5C8VA 4UTZA 3P9XA 4MJLA 3SZ3A 1Z45A 6GPBA 4JI3B 2W6JA 1R0YA 3SCZA 3QP9A 5DVZA 1H94A 5FQOA 4PLWA 3DV0B 3UKJA 5BW8A 4LF6B 2RDJA 1RRKA 3DCJA 4G9BA 4KNVA 5JRTA 5DASA 4F21A 4ARZB 1JPNA 1JX6A 1IG6A 1CEXA 1I4TD 5BT8A 1OC2A 4LWZA 3ROZA 4LBWA 1EFUA 3AYXB 3HPOA 2WU3A 4U6PA 4DTCA 1GLVA 2ZRGA 1PVPA 4QNMA 2FPLA 5EMHA 3FWKA 4J1QA 5ADWA 1MR3F 2O05A 2XQVA 2GZ3A 4GMGA 4NX2A 3SI7A 2LVBA 1KOLA 3KPJA 2AQKA 3KCNA 5DK4A 1CZRA 1V26A 2ON6A 5EZ5A 1WVMA 4DQDA 4ZVRA 5KFBA 1U2DA 1YI1A 4D79A 2H1OA 1OIVA 3DDOA 4IBOA 3L79A 4FNOA 2HF9A 2XXJA 1OLXA 3HY4A 5B7NA 1WCLA 4GL4A 2Q4BA 4MW4A 1IVSA 4NZYA 2H06A 3IO5A 2WKSA 9ICIA 1FS5A 4JUCA 1K8ZB 5B7GA 1MRNA 3FPEA 5KEIA 2GUGA 1FE8A 3HBMA 4S05A 4TM7A 1L4KA 1NX9A 5AKLA 4R8UA 1POWA 1I2ZA 4QULA 1B43A 3RR8A 1ZA1A 3O90A 1W36D 2AQ8A 1IL0A 3HGTA 1U9CA 1TKCA 3B0XA 2C0QA 2KSOB 3C2LA 2Q0HA 1RPZA 2QIOA 3GI1A 2IZZA 4UREA 4C7MA 4P4OA 2DUUA 5BMVB 4TZ6A 4J9SA 1DQYA 5KSYA 4IIBA 2AN3A 2PWZA 4IV8A 4LZWA 1I0ZA 3FOCA 4MS3B 2VWQA 4IINA 1FP6A 2HK6A 4TTPA 4M8KA 4HO1X 4F3TA 4ZOAA 2DFDA 4DNOA 2FAXA 3MGAA 2PKEA 2ZQ5A 4E51A 3VTZA 3RBDA 1VE5A 3E9RA 4YPVA 2C9OA 1U28C 2FDXA 3RRJA 2G5IB 4EKNB 5AESA 4KFSA 1RWXA 3FWHA 1HURA 2JH1A 3UPUA 3IEUA 4KMSA 1MIOB 2AWOA 4YV0A 5KFAA 1VIMA 4UU8A 1JEOA 3GPCA 3TFQA 1GZ4A 4ZI3A 1IJBA 1Q17A 4OK5A 5TLSA 3KT0A 2BI8A 2VHQA 5CX4A 4E46A 5DB8A 2X0FA 3GA0A 5DKWA 2PFNA 1W29A 5JJIA 3PX4A 3BPSA 2BMEA 3NIDB 4LMAA 3G68A 1Y7TA 3I4LA 1T24A 4MWSA 1DHRA 1E3EA 4R1NA 1L7MA 2JVJA 2XKAA 4XWOA 2H9IA 2Z56A 1IDN1 2X4LA 1W35A 3AFNA 2GM4A 3J81A 1A8HA 3H3XA 3PR1A 3P0JA 3VU1A 4RQ1A 1TYBE 5DI3B 4EFNA 2BV3A 2Z2JA 4KSCA 4K81B 4EJMA 1F5SA 4WZAE 1P4HA 4IJVA 1RYDA 1E79A 2ZZNA 2XVYA 3G2OA 4I1UA 1S3SA 4URYR 4MMXB 4QU9A 4XX1A 3IERA 2Q2OA 1MQSA 5DTJA 3MTDA 4HVTA 5CITA 4I9NA 1CIVA 3ET4A 1VI5A 4EZIA 1HNWB 1A82A 5IT9A 4KAXA 3MTBA 4HOYA 3A6ZA 2VH5R 5CVJA 4OYHA 4E5PA 5FNVB 2FE4A 2YRFA 2YV2A 1JAZA 1CY0A 4TKVA 4FMPA 1EX1A 2EZXA 3VTAA 4EL5A 1DO2A 1U31A 2KQUA 2DQKA 1XT6A 1E7SA 2VJ4A 3FOEC 1N2SA 4WFQA 3SSAA 2I1VB 5DQHA 1N0IA 1F6DA 3ZWBA 1ZQSA 3V3TA 2FFHA 1MZPA 4HX5A 2DAPA 2FW7A 1SK9A 5FBVB 2ZT6A 2JGKA 4NQRA 1L6RA 3DD1A 1GUDA 2PGNA 1D9DA 4LOJA 4HN2A 1EVEA 3SG0A 4F46A 4Q9KA 3MFIA 2RHBA 1N5KA 3MS7A 5B3JA 2XBUA 4HDQB 5T41A 1KZ6A 4K5QA 3V1TC 5FTMA 2PIDA 1XZ8A 2G72A 3NKFA 1VKZA 3B6EA 3IT1A 2GN0A 3BGDA 2LYBA 2P4QA 2QKQA 1ZRHA 3UJ3X 1KVSA 1P7PA 3KB6A 1ZM2A 4I4TA 5A7GA 1UR5A 3DTVA 2RLTA 4EPWA 4GQBA 1W2GA 3KHGA 2DFPA 4BEBA 5E2IA 3FZNA 1E2UA 2BH9A 4L07A 3WLFA 2I6SA 1NZFA 2G5PA 4I9GA 4ZI2A 2HWWA 3Q2KA 3F5AA 1QVZA 5A0LA 4PO1A 4WMLA 2JLBA 2GNPA 1O58A 4ZYXA 1JFFA 5DWQA 1UDCA 3VZDA 2O6KA 5JI2E 5AJXA 4X6YA 2XT6A 5CT4A 5HK8A 3OUUA 4AS3A 1VYHA 4IZ6A 1LFDB 4MARA 3PRHA 2QUKA 3JPPA 2QI9F 1DJPA 2R7NA 3MWEA 4LF9B 3SEFA 1WO8A 3GG9A 4DYHA 1ZUHA 3SF8B 1LJUA 1RI4A 4JBLA 4JCCA 3SIRA 1GKIA 1ZM7A 2BHTA 3TI0A 2ILVA 1R6AA 1RLJA 3BSFA 4EY3A 3CVWA 5KTKA 4M88A 4OMCA 2W2LA 1AS2A 4PYKA 2J67A 2Z5FA 1BGXT 2VTKA 2D59A 4N0MA 4NCAA 4AJOA 2X19A 3QELB 4EG5A 1XNQB 4V0LA 4B4VA 3AF2A 2EFCB 1QR6A 3PHCA 2MCFA 4DHWA 4JYPA 1EFDN 5LU9A 4WTOA 2YWGA 4WGGA 1Q0PA 3WU2U 4HRVA 3NXSA 4GNKA 1AMUA 1FMLA 1GOTA 4EPYA 4YDRA 2AJQA 3H4DA 1TQHA 4YUVA 4RPKA 5AUPB 3QRWA 5BNIA 4YAEA 3IEXA 3PQCA 2ZBQA 5TDHA 1PFUA 3UAWA 3PSPA 1RYBA 4MV5A 2YV1A 3QF7A 3CZ4A 5DDYA 2WR8A 3AW9A 5IM4A 1EZ4A 2MSLA 3WKEA 4I1RA 5BWCA 2DH6A 2V9WA 3MEQA 3QLVA 5I9SA 5DHSA 4PHHA 2WU8A 4DMLA 1CY7A 3F4KA 5A0TA 2R5WA 3ZKAA 1D2GA 3EGVA 3WFZA 1MO5A 2WD7A 1QFSA 3G02A 4FFOA 4KDCA 1OWMA 3PZRA 2ZXHA 4MI6A 2XMGA 2WP0A 3COYA 1FMCA 2ONJA 1CDDA 3M2TA 1NAIA 5HX7A 4NFLA 4OGKA 1XZBA 1U2DC 2QLBA 1IJKA 5E6UB 5LQNA 1N0HA 1DFIA 5DLPA 1DEOA 3MBIA 1QX3A 1PFYA 3TLKA 1NNI1 1P0QA 2CF6A 5BRNA 3P4XA 1YT3A 3L1JA 3COWA 4CTNA 1JSCA 5D7BA 2GZHA 3T99A 1XP5A 3CVUA 1L9XA 4CE6A 1XCGB 2P0EA 5H4HA 4LY9A 3QMWA 4HAXA 4ZRDA 3JYOA 1XXHE 4GM1A 4O2LA 1SM4A 1NJWA 1SY7A 3EPKA 3C3DA 1JECA 5KREA 5G0TA 4MRRA 3RAPR 5JS8A 3FWNA 1XEFA 5KG1A 4IQ0A 4QUJA 1YR3A 3IUJA 3BKWA 1QG2A 3MIIA 2TRSB 3BQ9A 2FV8A 1GPLA 2B1IA 5KTOA 3BDPA 1VP3A 1ID1A 3DEIA 2CYAA 1EINA 2Z4TA 4OL9A 3FBWA 4IZOA 4KRYA 3T7EA 1R3DA 4CTMA 1U3UA 1V38A 1T1JA 5JDCA 4QFBA 1FVHA 1YA4A 3WV5A 2C0PA 4FKMA 4MX8A 4ZARA 2FCRA 5F52A 4A8JA 1H2YA 1YCFA 3I5AA 5F5NA 4Q01A 4KXWA 5JBIA 1QQ7A 3RJKA 4H9GA 2CWDA 1UWCA 5IDQA 2WUWE 3PUVA 4Z1MD 4XUEA 3LUKA 4Z6KA 3C4JA 4BPRA 2NTJA 1BRMA 1RHRA 4BLSA 4G1CA 4E0BA 1SZPA 1R2QA 4KVFA 1NZDA 1M2GA 3H0LB 4LZOA 1N6RA 2MOKA 3WQRA 3QVMA 4F2DA 3RHZA 5ED4A 3PDWA 3CR8A 4M9JA 3U3KA 4UMDA 3TANA 4E5DA 3GQVA 3EXFB 5EUCA 1EPUA 2LPMA 1A88A 4M1OA 4TYMA 1T2DA 3K9NA 4HYKA 2P1RA 5M5BA 4YV2A 4UM7A 4DMMA 4UQGA 1WUDA 4MUGA 9ABPA 1E8NA 4QXQA 1PK1B 4C80A 4FXPA 4AZSA 3O4HA 2BCUA 4EW6A 1U0TA 5ALSA 3DLPX 4WLEA 2CLMB 1VG1A 2Q6TA 5CT9A 3RBEA 2AOXA 5LN1A 1I7QB 4MULA 4O2AB 3JZIA 1KVUA 1UQTA 5COQA 4KQEA 2BJWA 3WYFA 1PNVA 4IF6A 5K1ZA 1ULUA 3OEWA 2EIXA 2X8BA 4FDMA 3HYCA 2J0VA 2YNMD 3LGSA 4B9EA 4CBVA 4C6RA 3SYTA 1E1KA 4XZ3A 5JO9A 1RQGA 5KT3A 1Y3BE 3ROQA 2XA9A 2HA3A 1B0AA 2PRSA 1GL3A 5K3EA 2H2FA 3ED1A 2Y0DA 1S0VA 3L40A 5FI3A 5FPTA 1JU9A 1I36A 1VE3A 3GT4A 3NQ41 4AKGA 2GRUA 4ED1A 5FADA 4NCJA 1CR6A 1YBHA 3P0RA 1MOPA 1DX6A 1EZ1A 3GLHE 3AESA 4NENA 1G4AE 3CT4A 3KYDA 4CF7A 3AJ9A 1TFRA 4QW8A 9ICFA 2I5HA 4N0DA 3CH5A 1L5UA 3D6TB 4HAIA 3ZJ4A 3DE0X 1P0CA 4WPGA 4CN8A 4O02B 5F7ZA 5EJMA 3EH1A 2QARA 4P4NA 5ALRA 4NBNA 2WE7A 3W6UA 1Z6QA 3T3EA 3STHA 2B4QA 1A5AB 4URFA 3BMCA 4U2KA 1Y8CA 5T6MA 2Z3WA 3DUWA 3KHUA 2Z5LA 2PX5A 1UCFA 5LQKA 4QHYA 1NG9A 4OM8A 2ZUWA 1QQBA 5B3JC 1JG7A 2M32A 2V7TA 3HWX1 4RTRA 3KR9A 1KEUA 5G3ZA 3I6BA 4BFWA 4MDEA 5KFTA 3D4PA 4J1NA 3HVIA 3W7AA 1YONA 3N7RC 4O4LB 3JVUA 4F0JA 5FL7D 4JA2A 1BS1A 4KBFA 3ANTA 4YRSA 4EVQA 1UBHS 1VMEA 4I0WB 4LE2A 1OJ7A 3FF4A 3UMSA 4BLPA 1Z7EA 4NVRA 4RVOA 4D8UA 5JW6A 2H00A 3LT2A 3T12A 1Z0AA 1G5HA 2GCEA 4J7UA 3MAJA 4CIVA 3ACCA 3A7DA 3TQ1A 4JLKA 1RWQA 3C5CA 2QTMA 3UUEA 3OE1A 1O87A 4DIOA 1WETA 3O8QA 3WOHA 5BV7A 5BYBA 1LW6E 1E66A 1CKEA 5EAIA 3U37A 4Z2AA 3HYNA 1LSUA 4C7OA 1M5UA 3FH0A 5D49A 4TSRA 3Q8MA 4EZEA 1GPJA 4TTVA 1E2MA 4IRMA 1P29A 4HQ0A 3MTAA 1Z4JA 5IU6A 3EYWA 3Q2IA 1SC4A 3SQIA 2DPHA 3ZXUB 2CZGA 4F96A 5KJ6A 5AOVA 3RUDA 2W54A 3ZVMA 4ZQCB 1Y6QA 3TAHA 1F7VA 4OH1A 2NV2B 4NH4A 3QFRA 3A2NA 1Q0ZA 3NHFA 5DTQA 4IFIA 3SXUA 4ECWA 3GCDA 4R2MA 2PA0A 2DUYA 2P9YA 3DBHB 1RYZA 1S2OA 2FSUA 4H18A 3GB9A 1ES9A 1LSSA 5JSYA 3ICXA 1Y98A 4IGEA 1KAHA 3U4QB 3SN6A 4IEFB 2AV6A 3INTA 1KL9A 1TW2A 3PKZA 2DTDA 4RQ6A 3I23A 3B9RA 3RUFA 4CR8A 2IHJA 2PE5A 1PJRA 3QLVC 4QPNA 5FH9A 4PWYA 2LMRA 4RGYA 4R40A 2IK8A 1DTWA 1YT5A 3STWA 1G4UR 3VTKA 5IZ4A 4U5QA 3O0FA 1NHGA 1XNGA 3K1AB 1QE5A 2E37A 1SL2A 2OT3B 4ACOA 2VXOA 3T7JA 4P4SB 1KBUA 1ADYA 4PCLA 4NWIA 4QDOA 4ECZA 3NBZC 1B3BA 2GEUA 3UMRA 2NO1A 1GFIA 1GARA 1E5QA 1NOJA 4M9CA 4FMDB 2I62A 5FA6A 3NUZA 2V7PA 4AQDA 3SYNA 3K0KA 4M9SA 1OXTA 5IABA 4P1ZA 2QR2A 4ZODA 4ZEMA 4CUJA 1ZMBA 4B74A 2AOUA 4JLAA 4GYJA 2VNKA 2H3HA 1ZNWA 5LA6A 3MLEA 3E2IA 2JS7A 1CUKA 4YAUA 2Y05A 1GTSA 1M67A 8ICFA 3GVPA 3ABRB 4X1KB 1N6HA 1VBKA 1IMOA 1YWGO 2ES6A 3GRFA 4OK6A 2N47A 4E5SA 1EXMA 1E99A 4E5YA 4QFMA 1NI3A 4NJMA 1IXZA 1MO3A 5FA8A 3NAGA 1ZQRA 2WUFA 3CKLA 2NRTA 5CA1A 4GGPA 3RYTC 3GFVA 1HTTA 3FPAA 2VJKA 1LS1A 1ZIOA 1PQUA 1XKTA 2R8IA 2AA3A 5JDCC 4MOWA 2B3TA 1KEZA 1PL6A 3M4XA 5MGBA 5KPDA 4FQ7A 4FBLA 3F5EA 4A8JC 1ZNQO 5JSQA 1TZKA 1DI0A 3R8CA 3VDMA 3UHJA 2ZTHA 1KW4A 3DWFA 2NPOA 2AYZA 4BWYA 2XVMA 4PXSA 1IOLA 4CQMB 5HQ3B 5ALOA 1NE2A 1IUOA 5G2OA 3HFSA 5B3LA 1A1VA 2QQ0A 2J3KA 3DE5X 3IIJA 3UBTA 2I6GA 4TS3A 1R37A 2WG2A 3PSAA 3FZGA 1Z2PX 3LIIA 2H54A 5TSDA 3RE1A 3AL2A 2PSSA 1QTMA 5JWHA 1HT2E 1CUAA 3TTVA 3LIPA 2FPKA 4P22A 1FFXB 1P8JA 3H5NA 3ZD8A 5IIMA 4RABA 3IAAA 1C1XA 3HJHA 1FQOA 3VSAA 1P77A 4JXJA 3CT6A 1QR2A 2TECE 2GZ2A 4EY8A 1I7LA 3BXGA 3HDJA 3ZUGA 2CSUA 2BMWA 621PA 2PMEA 2DSNA 2ORVA 5AXAA 1F12A 5CXSA 1R9JA 4Q45A 3WHLA 4F5DA 4PFQA 3CY6A 1TJNA 1RKBA 4R01A 4E08A 1J0CA 4A6DA 3SGLA 1M9NA 1Z83A 4ZJYA 2R8JA 1U4SA 1EGMB 2C4MA 4F91B 5EWLB 4G65A 1GU1A 1LBHA 1GTMA 4Q4JB 3LX5A 1VL8A 1W5EA 3IP6A 3JR3A 4JEHA 5KOIA 2F4NA 3TZQA 4TVOA 5BVHB 2WJZB 1M2OB 3GHYA 1H1LA 3CF4A 1CP3A 5AT1A 4YWHA 1RYUA 4MYUA 1LI7A 2F44A 3LECA 3B6MA 1RU3A 3TDNA 1EMDA 1SBZA 1MW9X 4DCVA 2BEWB 4YP0A 4WKNA 2GB4A 4J75A 4AX8A 3JY6A 2KTQA 821PA 1QYRA 2FQQA 2BEVA 3DC7A 2Y0PA 2R9VA 5KMGA 4G6ZA 3KTAB 1E1YA 4FSDA 5LP6F 3CGWA 5FUXA 3KUXA 1KVRA 2N1MA 4LYEA 3IOBA 1ELOA 1JEQB 2BF7A 5BPHA 2X3UA 3SLKA 2F59A 3WBFA 3AW8A 5B5SA 2Q3BA 1O94D 1K7CA 2PBZA 4LOIA 2HM7A 1XPUA 1JHOA 5EUMA 4K6MA 3T5KA 2FY8A 4ID3A 1QGDA 2ZJ2A 1TJ5A 4PYNA 1FTSA 1XJCA 4IIYA 4ZIRB 4GDFA 2X3FA 3L8ZA 3Q8RB 1QQTA 4MVWA 5JYCA 4OHMA 5I4IA 4FYVA 2RGUA 2Q4RA 1KJZA 2I34A 1Q3HA 2JH8A 4DQIA 4QNLA 4K4HA 1SKRA 4YJDA 2K2QB 5SV2A 1PS8A 2QN3A 1DRUA 1NOMA 3BMOA 8MHTA 2XCRB 3HU3A 3QHPA 5LD2C 3MR6A 3BWYA 2IYZA 2IYTA 2IP2A 1G3RA 1XZPA 4FINA 4RZHA 4YJ2F 1SL1A 3CF4G 4B75A 4A15A 2RHDA 5D3QA 4LQ4A 4JVOA 4PJ0U 3LZDA 1U0FA 4FE4A 3ZTTA 3RJTA 3M70A 2PO5A 5C51B 3AT1A 5KJ1A 1NVGA 3KKEA 1Z08A 2RGAA 5B12A 2PEYA 4WZBB 3NDJA 1UBJS 4RQTA 3O2QB 3UAYA 5FDFA 5F7JA 2VP0A 4O4IB 2DFTA 4YAGA 2WM9B 3LQKA 5E7IA 1Z6TA 1W6RA 4DAOA 4F2SA 4IHJB 4P7GA 2V4RA 1WVIA 1PTKA 3OESA 1QO0A 4LCJA 3KHRA 3BQ0A 3IQXA 2CVZA 3KUKA 4CU5A 3DE2X 3TIXB 5KNBA 4WDQA 4MPDA 1DQRA 3TD9A 4IR9A 3EPGA 4DFKA 1BH2A 1U3CA 2Q45A 1RJWA 2CBZA 3U1TA 1IM8A 5CFQA 1E6KA 5TVGA 2MSCB 4LVOA 4B7AA 3UZUA 3TPCA 4B4OA 3RFUA 2O8DA 3CLUC 4D56A 3IPXA 2CV0A 4KLHA 3IAM1 3CSSA 5JATA 3M9XA 4KXXA 5A71A 3GLGA 4G9GA 1P0IA 3HJGA 1XCMA 1X2EA 2FW1A 1DSSG 3EW9A 1JKFA 4JYCA 3B6IA 1J24A 4DR5B 1X9HA 4EUKA 3FNRA 1IHDA 3AETB 3R7FA 4WQMA 3GUVA 1P3DA 3FKJA 4N8DA 3G0GA 4C8LA 4QSHA 2QF7A 3ZGXA 1UBOS 1K9SA 4U6QA 4AY2A 1OHHD 2ODAA 2WWGA 2JGJA 5J43A 5HKBA 3T7DA 1N48A 3GCZA 2QDKA 4US8A 3IPYA 3RSOA 4EOGA 2X0NA 4KN8A 1E3WB 2I76A 2E4XA 4GECA 5JVDB 1XDUA 2Y1XA 4N7MA 4YPOA 4NLCA 4IWNA 2W6CX 3R3VA 4YQZA 3NBKA 1H2HA 1A5SB 1EKXA 4S1TA 1ONOA 4CN9A 2FRVA 3Q7PA 3PHGA 5IXSA 3U6KA 2PU7A 5KTSA 3TXAA 2VDNB 4DDTA 4D82A 5K51A 1IQRA 1ND5A 4DUZB 4ZHQF 4ELUA 3A37A 4PGYA 1EFKA 2YMPA 1XCLA 1NVAA 1LLDA 6NULA 1B41A 2I6TA 8ICSA 3SR6A 2IBSA 3A3PA 1E9FA 3QYAA 3KIPA 2HT6A 1A0OA 4LJKA 2PL9A 1II0A 1KMHB 1RP1A 1PE0A 2PX3A 7YASA 3PI6A 2AFVA 2R7AA 4PC3A 4W5WA 2DFLA 4PV7A 5DYNA 1V25A 2A33A 1VZ3A 2XA1A 3RRYA 5CB4B 3NM5A 4FD2A 2DHRA 4RZSA 3VH3A 1U65A 1H5UA 3MRTA 1D5WA 5KFIA 4B2IA 1YFKA 4RGBA 3ELDA 2G83A 2HXYA 1IQPA 5IBQA 5K8UA 4AY5A 4EG7A 2WTAA 5EJ5A 3BFXA 4UHJA 3UJ6A 1M1XB 2Q4OA 4WOCA 5J47A 5DM4A 2BGUA 4YRQA 5DNAA 5DYGA 4LWPA 4BNKA 1C7ZA 5BR7A 4OHUA 4EQZA 1MABA 3CUKA 3K0CA 2V0CA 5AW8A 5TV2A 4MTLA 3STTA 2W37A 1I6WA 1LDMA 4QWAA 4I1VA 4YREA 1G0OA 3MTGA 4LJLA 4UHDA 5LKAA 5IS2A 4ARBA 3WBKA 4TMXA 5KDDA 3EJWA 4Q9JA 2VP4A 3ULKA 1H66A 1BOOA 4FU0A 3TD6A 3QBTA 1Y9EA 2A6PA 2GWRA 3C3CA 1MH9A 4QUAA 4L02A 3RS7A 2VDOB 3CM0A 3DBLB 4LOHA 3HU5A 4ZZ3A 1VKNA 1KDZA 2QUZA 2PGAA 4B9AA 4LAFA 1OZGA 5KU7A 4G0ZA 3OJUA 2VF5X 3E1SA 3TR5A 3DEJA 1DXQA 4ECUA 2D0OB 2V4MA 2QAGA 2B5WA 3WE7A 3L18A 3I04A 4HGQA 2KM1A 3W34A 4KLJA 2LR0A 3PNMA 2KWIA 1LX7A 4ZOCA 5TEVA 2CJYA 2J5KA 3QFHA 4B6FA 3G6WA 1Z3EB 1Z75A 1CS0B 1G98A 3R9IA 4LBYA 4OSOA 5G4LA 1ST3A 1T15A 4D74A 2Q21A 1P7DA 3ZZMA 3OJLA 4EGCB 1EX7A 1R5JA 1H2WA 1JVNA 1I2AA 8ICEA 1T8RA 2P3SA 1Z62A 3WWYA 3GLRA 5CTAA 1CY6A 2H18A 1VDVA 2D5BA 4C2UA 1BGVA 5BSHA 2A8YA 5BYAA 5ERGB 2NZJA 4RA6B 4MA5A 2EANA 1O6GA 2IX9A 1UPHA 4LVUA 5H70A 4OEHA 8LDHA 2DQZA 5BSUA 3VYWA 1TUIA 3F96A 1XTJA 2GBIA 2Q5EA 3I28A 5LXTB 2ENWA 4LJXA 4HHEA 3PX7A 4W1PA 2COEA 3WA6A 1GSHA 4I1SA 4N5LA 3Q3VA 1PUIA 3O9MA 2QZSA 2DR0A 4UUBA 2C97A 4D3FA 2OXTA 4Z9YA 3G5AA 2C7QA 5H8WA 3OCJA 3D1VA 4MQEA 1T9HA 3T1HB 3FGPA 2D7CA 4LZNA 2IHNA 1LZKA 4FMCB 3BRWD 4UPVA 4EHKA 3NVVA 3VISA 1JJVA 4YMHA 3PLNA 1E2LA 1VIAA 2F17A 4PPGA 2BDUA 1SV4A 2AEFA 4GRDA 2ZSKA 2NG1A 1KYZA 3NWOA 2HHUA 4TT3A 1E3SA 2BF4A 2AVNA 3CUYA 1X38A 1XTVA 4KU4A 4H3SA 1XRRA 3W4JA 2QK4A 5HKKD 5G5GA 4EWLA 4F2WA 1A9SA 2UZ3A 3ADOA 1X40A 4MV3A 2C83A 1DOAA 4NL9A 1RC1A 4RSHA 5ITWA 4ZYTA 3OZTA 4D7AA 3CW9A 4U2GA 2MUTA 4WKPA 3C8MA 3SQMA 1O97C 3MCAA 1ZJJA 1UJ4A 4WEQA 3G0CA 1RAFA 3OM8A 4XIYA 5HYVA 5IMSA 3WBJA 5LMZA 4WN9B 2HF7A 2R2AA 1JXLA 4HFJA 5M04A 2V59A 3T3HA 4EHDA 3C7DB 2VNAA 3PITA 2AC4A 5T7BA 2ACEA 3PNYA 4KXNA 1VE7A 3EMVA 2TS1A 2W04A 2JFXA 4RUKA 2XCQA 2AW5A 2MINA 1QV9A 2VYVD 2Q5FA 4ERNA 3O9VA 3VC2A 3N3BC 3HRIA 3JRXA 5EFOA 3AEKB 1U63A 4IQFA 1Z06A 4UTOA 4DIUA 2BHLA 3ZWWA 1P73A 3AR5A 3NBMA 2AXTU 4G23A 4MQ6A 4C4AA 1RT9A 1IZZA 4Z4EA 5E4YA 1ZJNA 1BCRA 5FWAA 3WYDA 2K8AA 4II3A 5J4VA 1CVRA 4TUYA 3DH0A 3N70A 5EE0A 2V9PA 1JPUA 4J9MA 1EVLA 5FO0A 1J8QA 1JROA 1XU4A 1KAEA 3RS3A 4IRUB 4Q9HA 3KT6A 3S5UA 5EWMA 2XT0A