1L8OA

Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 42
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8oA01
2FPWA 1Q91A 2B8JA 4UARA 3U13A 3OCYA 2BY4A 4B6JA 2MSNA 4C4RA 3HLTA 2G08A 2PQ0A 2AMYA 1TE2A 2FPUA 4EX6A 2HSZA 3ZUPA 3PDWA 5AESA 2C9MA 4MUMA 3AR2A 1JUDA 5ALWA 3ZTYA 2B8EA 4YCMA 5AI4A 4QJBA 4KX3A 5AI8A 2AH5A 3L0BA 1Z4MA 1RMYA 2FUEA 4I9FA 2G06A 3AR4A 5ALKA 2CFSA 4C4SA 3QXGA 1S8OA 1EK1A 2R8XA 2YJ5A 5AKIA 3UMCA 4UU0A 2P9JA 5ALXA 3NANA 4EEKA 5AIBA 4OD0A 1RPZA 1XPJA 4DW8A 3BA6A 4RETA 4BEVA 3ZI4A 4Y2UA 4F71A 1U7OA 1T5SA 3TLMA 2GHTA 2G07A 1WZCA 2I55A 4Y2YA 1RKUA 4Y2PA 3OCWA 3ONNA 3ED5A 3M1YA 1X42A 1RRCA 2YN4A 1J8DA 1NNLA 2HX1A 4Y2QA 5ALUA 3KOOA 1RMTA 1L8OA 3L7YA 3N07A 2ZXEA 3WK9A 1Z88A 3ZWDA 2R8EA 3EF0A 2ZBDA 2B82A 4KN8A 3AR3A 2YJ3A 5FP0A 5AVTA 3CZ4A 1CR6A 3U7GA 1RC8A 5AM4A 2IOHA 3RFUA 5IS2A 3WK5A 1ZOLA 4CF5A 3N8GA 4HAIA 5E0OA 3L1VA 3UMGA 1AQ6A 2YFYA 4JDPA 2IYEA 3ZX4A 4CF4A 1N8NA 3ZVLA 5ALOA 3EPRA 2HF7A 5AW4A 1U2TA 2IOFA 2B30A 3OCVA 1U7PA 4YCLA 1TJ5A 2YMLA 3E84A 2EATA 1TA0A 2FEAA 3OCXA 3MPOA 2AGVA 3ET4A 4J03A 2I7DA 3UMBA 1Z4KA 2QYHA 2RB5A 3IRUA 3KD3A 4YIKA 2WFAA 2P27A 2C8LA 3MMZA 2WM8A 3QLEA 3QUQA 4Y2RA 2WHEA 3AR5A 3QU4A 1Z4QA 2RAVA 3ESQA 1VJRA 3ZVNA 2HOQA 4Y2XA 2ZOSA 2HHLA 2O9JA 2FPRA 5AM2A 5AW8A 2HCFA 5AKHA 5AW3A 1SU4A 1Y8AA 1YDFA 3IJ5A 2B0CA 2YMPA 3QUBA 1XVIA 1ZD2P 5ALRA 3NALA 5AICA 5AK3A 1RKVA 4IG4A 2Q5EA 1ZJJA 4BNDB 5IT4A 5AI5A 3SHQA 1WVIA 4HYTA 4Y3UA 3FM9A 2OYCA 3SD7A 2HO4A 3ZVMA 4XQ0A 1L8LA 3OCUA 5AM1A 3NRJA 4Y2TA 3WK4A 3FZQA 5ALSA 1Z5UA 4Y2VA 2C88A 3L1UA 3VAYA 2I54A 5AKYA 2FPXA 2GHQA 4UATA 3KC2A 1O08A 2HEGA 2C8KA 1EK2A 1J97A 4UASA 3D6JA 2O2XA 4RESA 5T41A 3EF1A 2YBDA 5AK5A 2JAOA 2PR7A 4AS3A 1ZRNA 3U7FB 1RQLA 5AVUA 1QH9A 3AR8A 1L7PA 3HYCA 2BDUA 2YJ4A 3QU5A 1L7OA 2W11A 3W5BA 2PKEA 3I28A 5AVSA 2NO4A 2WF9A 3QYPA 1WPGA 2FUCA 3AR9A 5AVVA 2EAUA 4UMVA 2HDOA 4L6AA 4UMDA 4KNVA 4UMEA 5AI9A 5ALDA 5ALNA 2WF6A 5AKLA 5AM0A 5AVQA 5ALVA 2EARA 3PGLA 4YGYA 3WKEA 3QGMA 2FI1A 3U7EB 2ZBEA 3M9LA 4PNHA 3FPSA 3OPXA 3SMVA 3QX7A 3WKAA 2W43A 2HI0A 1QQ7A 4MWOA 5AVZA 4Y2JA 5AI6A 5AKJA 4UM5A 5A3SA 2JAUA 3DV9A 2YJ6A 4AS2A 2FPSA 3QU9A 1YS9A 5AW7A 4AP9A 2GFHA 2MU1A 3A1EA 2C4NA 4UU1A 5AM5A 3N5KA 2ZBFA 3IB6A 1S2OA 5A3RA 3N28A 4ZEXA 2YMMA 1CQZA 1XP5A 4EX7A 1Z4NA 5ALMA 3AR7A 5AHXA 1YNSA 4XE5A 4HGPA 1RLOA 4XPZA 2D2VA 3DAOA 1KYTA 3FPBA 4I9GA 5AK4A 3KZXA 3GYGA 3B9BA 5AK6A 2B1RA 3QU2A 3MN1A 5ALEA 3DDHA 3ET5A 5ALYA 3FVVA 4GIBA 1Z4LA 3WK8A 1L7MA 4OFZA 4DCCA 2WF8A 4KNWA 3K1ZA 1YJ5A 2AUTA 2P11A 3BWVA 4OHFA 1ZD5A 3F9RA 2OA0A 1Z4PX 2W4MA 3QNMA 3MC1A 4NWIA 5AW9A 3WKBA 4UM7A 5AW1A 3R09A 3S6JA 4BBJA 3AR6A 1U02A 3B8EA 1RLTA 5AVWA 5AW5A 2GO7A 2I34A 2I33A 2X4DA 3L5KA 3WGVA 4CE6A 3U19A 1WR8A 4L6CA 5AVYA 2CN1A 3A3YA 3WKDA 3E58A 3KDPA 4NFLA 3NUQA 4NABA 5AI0A 2NYVA 5AM3A 3I6BA 2OBBA 4BYGA 4L57A 3R9KA 1Z4IA 3P96A 5ALJA 4HGNA 3NASA 4Y2SA 2ODAA 1L6RA 3QU7A 2BDEA 3OCZA 2GMWA 4NAVA 5ALPA 5IT0A 1SWVA 2OM6A 4OCZA 1QQ6A 5A3QA 4UMFA 3W5DA 2P69A 2QLTA 1QQ5A 4ZEWA 2YY6A 1IWOA 1VFPA 1Q92A 3EWIA 1U2SA 3SKXA 1K1EA 2G1AA 4G9BA 1RMQA 5AVRA 3L8HA 3CNHA 4YH1A 1L7NA 4BKMA 1ZS9A 3NIWA 3ZWKA 3J7TA 1RLMA 4E88A 4YIHA 3SF0A 2I6XA 2FDRA 1VJ5A 2G80A 1LTQA 4DFDA 1N9KA 1YV9A 3PGVA 4UW9A 3WGUA 1PW5A 4IFTA 4KYTA 2Q4TA 4G63A 1ZD3A 2NO5A 3A1DA 4CF3A 2YMQA 3ZU6A 3L8GA 3L0YA 5AKEA 1RDFA 2WF5A 5AIAA 1RKQA 2CFRA 1FEZA 4FYPA 2RBKA 4FFDA 3U26A 2G09A 3L8EA 3L8FA 4JB3A 5AW2A 4BEWA 3ESRA 1TJ4A 5AKXA 2R8ZA 2WF7A 3U7HB 2R8YA 2ZBGA 4HGQA 2HF2A 4NV0A 1TJ3A 5ALQA 4HGOA 3WK7A 1NRWA 1NF2A 4J2TA 4UAUA 4C4TA 1LVHA 2Q4RA 5AKKA 1ZD4A 2RARA 2ZG6A 3ZW7A 3ZTWA 4ZEVA 3A1CA 5ALZA 4EZEA 4CNQA 4FE3A 4EENA 1RQNA 5ALFA 4HGRA 4BX2A 2VKQA 3DNPA 3I76A 4XOUA 1QYIA 1Z4JA 2JGAA 4KX5A 3I1YA 4UAVA 5ALTA 3RF6A 3QUTA 5ALGA 2JARA 5ALLA 3FGOA 4O8CA 3L0CA 1O03A 3N1UA 4BNDA 2IA5A 1T9ZA 4DWOA 4F72A 1YMQA 3WKCA 2CFTA 3ZX5A 1SWWA 5ALHA 3E81A 5AW6A 3W5AA 5AKGA 3B9RA 1Z5GA 4H1WA 2G0AA 2B1QA 4GXTA 5AKZA 3WK6A 2JAWA 3SKYA 1Z4OA 5AW0A 3OTQA 5ALIA 4QQFA 3PCTA 1MH9A 3QUCA 2IOFK 3W5CA 3NAMA 2DQSA 3UM9A 4YCNA 3KBBA 5AVXA 4EELA 5JJBA 4BX0A 1ZRMA 3E8MA 3SLRA 3R4CA 4BX3A 1T5TA 1F5SA
chains in the Genus database with same CATH superfamily
3O8DA 2H3QA 4NLNA 4U3JB 3DMDA 2GYWA 2IXEA 1FK8A 5IXJA 4AMGA 4YAIA 4NL9C 9ICOA 1CQJA 2ZSJA 5K8JB 1N6LA 3MEQA 3VA7A 1G17A 1K6MA 4KC0A 5EJ9A 2J09A 4UNSA 2QPAA 1ACJA 1ZI8A 2D1QA 2EFJA 2X0DA 1VM6A 7ICGA 3EOAI 3KIPA 4QOHA 1GDHA 2Y9MB 2FOLA 2O5VA 3EDYA 5SZKB 2FPUA 1GCIA 3CTMA 4LZOA 3HCAA 4G1UC 2GEFA 5AESA 1E1KA 4MZDA 1N2CA 1OAKA 4EA6A 1J0CA 4NX2A 3A6PC 4IDCA 4EMTA 5CM8B 5KNBD 4M9LA 1GPBA 2QM3A 4JOQA 4HH1A 4U6QA 1P3JA 5AI4A 3AERB 4BRWA 4PPYA 2SICE 4M3NA 1CY8A 3KJNA 4KX3A 4RIEA 2EW8A 2GNPA 3L0BA 4BPRA 1IVNA 3EAQA 2Q0SA 1WV0A 3BM5A 2N1RA 4YCXA 1AGRA 1AXRA 1CS4C 3EGDB 3HGMA 5ICGA 1YT5A 4RF2A 2ODNA 3AJAA 1QTNA 3PQCA 4L8GA 2EAMA 4PGAA 3VPFA 2J4DA 2H2WA 3UFXB 5JRTA 1ESZA 2CXSA 2D3DA 3VYRB 1DQZA 1JI3A 5JAIA 5L7YA 1THGA 3P9PA 1EUCB 1ZA2A 3O3OB 3ZW7A 4ROTA 3QQ5A 4S1TA 4N76A 3E2IA 1IM4A 1Y1QA 3F3KA 1YR9A 4JQSA 4G07A 4IMJB 1GLNA 4OP1A 5EQJB 1U7OA 1T5SA 3WGIA 2GHTA 1NVUQ 2K87A 4NJ8A 1AV6A 3QOYA 1WUHS 2D0PB 2GLUA 3G2MA 3TRHA 1Z7BA 3L7DA 4ISCA 1FU7A 3JQPA 3UF0A 1X1AA 2BH9A 1J8DA 1JQJC 1FVFA 1ZCBA 3PQ4A 1EQUA 4RHUA 4ZO9A 4OJLA 1A2OA 2AFHE 3L0OA 1D1TA 2ONYA 5JAQA 9ICFA 3L7JA 3X1MA 2M9NA 1NBMD 2R48A 5EIEA 1SK9A 1AGYA 1U0TA 5C34B 3BULA 1HTBA 2NNLD 4UTZA 2X2FA 1TI7A 4BP1A 1V7CA 5BV0A 1NJSA 5BUSA 3UHOA 2YJ3A 1M72A 1MVLA 3NT2A 5CK5A 5AT1A 5KHOC 3ABQB 3KZVA 4ED2A 1OA1A 1RI5A 3E15A 3UH1A 3TZQA 2IYUA 3ORHA 2X5KO 4M37A 1EX7A 5A4FS 1VPLA 3CVYA 4QEZA 2JH7A 1XSNA 3LQFA 4XVHA 2C3OA 2HM7A 2IDMA 2JCGA 4BZXA 4E7OA 3GLKA 2RKBA 4AJEA 3OWHA 1QRTA 3B9PA 2C0QA 4KQ2A 1UDCA 3H5WA 4F84A 4H7KA 4RTNA 4CF4A 3N2YA 3UOGA 3IDSA 3CXUA 1LA2A 4PPQA 4XRRA 4ALKA 4UOZA 1HORA 4UQLA 1WUDA 2PYZA 1Z47A 3LLMA 4QL3A 3HJBA 3PEVA 2ZUTA 2ZUBA 2Z7JA 1N63A 2IYZA 2QW0X 5KFGA 3KEOA 4F4ZA 5CPFA 2WILA 1TJ5A 1EWKA 2I6UA 4GNKA 2YMLA 1CY4A 1I2AA 3I37X 5BPCA 1E6EA 3O38A 4D9GA 2FEAA 3OE4A 1QGOA 2QGNA 3NJ4A 3H4BA 3OZAA 1DFGA 4J03A 4O3NA 1AUXA 2G9NA 3UKOA 4LN1A 4Q1AA 1F8GA 3AWIA 3TW0A 5JPDA 1K6JA 2XAAA 4P92A 5C81A 4NOKA 4MV1A 2QB5A 1ODCA 3RJ5A 3RYIB 5EUMA 1SV0C 2JRLA 1QLWA 2QTBA 4URZR 5HBGA 1NKEA 1PLJA 1Z4QA 1ZI9A 4NAHA 3ESQA 5F1PA 1VPWA 4B8ZA 4MUKA 4DLAA 3IUYA 1UM9A 5K4LA 4R2JA 3WV4A 2LBOA 1P0PA 4JLBA 4RL6A 3F49S 1EFHA 1V6SA 2IPAB 2C5FA 4GD3Q 4LYJA 4A03A 4HNHA 3STTA 2NNWB 8ICLA 3F5AA 2V6JA 4GR9A 2I9KA 3JX9A 2OPBA 3RRHA 3OI7A 5IDYA 3YASA 4D92A 4I55F 1D7OA 2AHOB 1VCMA 3AM5A 1RZVA 1U94A 4TQ9A 4DLLA 3KJEA 5L3ZA 3I9LA 4RE5A 2CXUA 4IIUA 1JIXA 2WSMA 3VC2A 4LZDA 5LQMA 3HSKA 4CEIB 1PI3A 1CJBA 3DQPA 2Q5EA 1V1RA 1E2EA 4ESOA 5KVVA 5JJLA 4U7GA 4A0QA 2ZYWX 1NBHA 1N4AA 5TY0A 1O0BA 1AKQA 1TT5B 3IDQA 4PSKA 1TRKA 3EFBA 4INJA 1F8YA 5ERGB 3UJBA 1YFLA 1JIUA 3OOYA 1FTYA 2ZIAA 1ODTC 4L85A 4MV6A 2B5OA 3ZDBA 4RKQA 3K6SA 4S3MA 5DRYA 3VI3B 2HVHA 3E4CA 2J6CA 1NW4A 4LQLA 4P4SB 4EB3A 5F77A 1P5ZB 2YIVX 2GYUA 1PGPA 2Y9PB 2JD0A 3O73A 1VPEA 3JATA 1HQYE 1THMA 3P2IA 1IXZA 5EWMA 3QWHA 4EGSA 3K7EA 5JLAA 1FFCA 1WZEA 2JGJA 2XUZA 3I05A 3KJIA 4P33A 2XA2A 3V1NA 1TQ8A 3M6XA 1X9GA 3OJFA 4J07A 5BO5A 1J97A 2EP5A 3EDRA 5EC8A 1XNRB 1H2RS 3NWPA 3ZE7A 2L2QA 2WIBA 3PIRA 4IX1A 5FL3A 2YR0A 1BPEA 1TYZA 1GU0A 1M66A 3RVKA 5LQSA 3TVTA 4OJNA 4KLRA 4BE7B 5C32A 3NVWA 3QYJA 5F9FA 3FTCA 4URVR 5AVUA 4D79A 1YC2A 1X7ZA 5DQGA 3A1SA 1BS2A 2ZIEA 3PGJA 4EIWA 5EJ5A 2PFSA 2DGZA 1NXVA 3PXDA 4DLZA 4URXR 2NSDA 1KPIA 4IHJB 1IG3A 5DM4A 2AGOA 9ICBA 4PYIA 2PJRA 1PX0A 4KUHA 2HUPA 4XR4A 4HQNA 2NPOA 1F0NA 1GHTA 4R51A 3WR5A 1G291 1WPGA 2J1LA 2D5CA 2UYYA 3LQ1A 4MS1B 2W9BA 4RMHA 4Y9TA 3B3FA 4PHHA 4ZOBA 4KN7A 4QYTA 5FYQA 5C0OE 4A2CA 1CERA 2R86A 1U2PA 3HR8A 4QDZA 2W3RA 1CCWA 1UK7A 3I73A 4MRMB 1A2BA 3OM9A 4KLSA 4N3AA 2C9OA 4K4HA 4QC2A 1OIVA 4E13A 7GPBA 5K8UA 3AFMA 5IUKC 3CKMA 1I0LA 3FWPA 1Q84A 1MEOA 5AOAA 2NT3A 4M55A 2FG7C 4B45A 2JZCA 4KOEC 3GWGA 5J2DA 3GEHA 4C0QC 1CJKC 4X8HA 3RHZA 2XVZA 3CLTD 1MO2A 3SN6A 1LD3A 4GW3A 3ZY3A 4DIKA 2H7CA 2W43A 2A7QA 2W9XA 3Q12A 1AQJA 4U9HS 5THXA 5K3DA 1SHKA 4D8TA 3BVPA 3AMVA 5F1OA 1ECPA 2CNKA 3T4EA 3F2IA 2DWCA 2RH5A 5FBKA 4V1CB 1JQEA 1YQWA 1MA0A 3PS9A 4L2IA 2DERA 5LD2B 4QZFA 3A4IA 3Q7TA 2CVOA 2JH1A 1ZH0A 1K6IA 1UINA 2FPSA 3AQFA 2N0SA 1HF3A 2VQ3A 4A2QA 1ED1A 5ES4B 2Q0HA 5E4JA 2N75A 1PZXA 4IQ4A 2V7VA 3D6VA 2WA2A 3N2NA 4HDNA 3M70A 1YR2A 2WJAA 3WQSB 2R8OA 3BMOB 3IDAA 4D2IA 5JECA 1CJTC 3IQHX 1E5VA 1A71A 2B3DA 4C4PA 3VNVA 3IGFA 2IGBA 5TQ2A 4M46A 3UA3A 4M87A 2CLOB 4FBGA 4BGIA 3W2EA 4C7ZA 1KYYA 2IEYA 3O7WA 3GZNA 2RONA 4AC9A 1SOAA 1EHCA 3EODA 4P6VF 1WPRA 1KYTA 1I5EA 2WLSA 4IXTA 1SXJB 3N6XA 3A06A 5E9JA 4NEQA 1SUAA 2ZB3A 1H65A 3W2IA 3QU2A 1NK8A 3RJFA 2DBYA 4D3XA 3GRFA 4KGZA 8ICWA 4CTJA 2W03A 3OO1A 2Z8YM 5FWXA 5DZSA 1KP3A 1W59A 5EGSA 4OP2A 4WY5A 1C4KA 4IQWA 2PBLA 1HO3A 1OY1A 2Q9UA 4WOJA 3CH7A 4OJQA 2QR3A 3ZVKA 5BRJA 3C14C 4D5GA 3I01M 1EWYA 1Z7WA 4OFZA 2W22A 5ECDA 1ECGA 1KRHA 1QO7A 2GK7A 4KPGA 4R16A 4E5DA 1VL2A 4MS3A 4A0HA 5CA0B 1SVNA 4FB4A 1FFDA 3R3JA 4XDYA 3EXEA 4JFAA 5DQHA 2A59A 2W71A 4GM0A 3QNMA 2JFWA 4TKMA 5IEBA 3MC1A 5DTEA 3WBFA 5CYOA 5BNZA 4YR2A 1U0JA 1HRKA 2HRRA 3DOCA 4M2YA 1XEWX 5H83A 1A9OA 1P8AA 2ZBPA 2DBRA 2ZLBA 5IFLA 3PHJA 4JI3B 5LM3A 4I2DA 3UJ9A 1K8YB 1TU0A 4OKIA 1UCFA 2F1IA 2OHJA 3GDOA 2PV7A 3DHWC 3CW2C 1EM8B 2DQZA 1NL3A 4RHFA 4LRTB 1DKOA 3CCCA 2RH8A 4XCVA 4LXIA 5I9TA 4JENA 1AZLA 4KG7A 5GONB 3LBNA 4K9LA 3OICA 5EYPA 4QQRA 2P8SA 3VU1A 2R6AA 3BS7A 1A77A 5HJEA 3IL2A 1H2WA 9ICJA 13PKA 5D3QA 2BZ1A 2E4XA 4B9TA 4Z4FA 5F73A 3DMPA 3IVCA 4DQKA 3UJNA 1UWVA 5G5GA 4RUKA 1NOKA 1IH8A 1U2DC 1GG2A 1RHQA 3OCZA 1EPUA 3PFNA 5K0LA 3USZA 2PVCA 3RYHA 3KSRA 1QPGA 3U61B 4MQBA 2GD2A 5A3QA 1CJCA 1D4FA 2EL9A 5IT0A 5T7BA 4KUGA 1XK6A 1PQWA 3RH6A 4IIBA 3CKYA 5L1JA 4BKPA 4WLVA 4MPDA 2VF7A 2IX3A 1EAYA 2YY6A 1IWOA 2MHCA 3NVAA 2ONJA 2WNSA 2WC1A 3LY9A 1RYHA 3QX8A 1AZTA 1U2SA 3ND6A 1ST2A 4O4IF 3RRBA 4F0JA 4WE3A 2XY5A 3OM1A 3ENZA 3KZMA 4I9NA 4Z86A 3U9TA 2V5UA 5HCUA 4I2CA 4TM8A 4FMDB 5IK2A 2KZZA 3ZWKA 1KI6A 1NTRA 1PFVA 3J7TA 4RTQA 2ZREA 2WM9B 1BMDA 2PSDA 1X9IA 5FNVB 1FJXA 1XUOA 2AMFA 2LM1A 3PWTA 4DN6A 3SSNA 3CVXA 4BWGA 1WHSB 3NC4A 5CT8A 5HUHA 4PCVA 3ZHZA 1CDOA 2EYUA 1DT5A 2Q50A 4MR7A 4ED0A 5EIBC 3PX7A 3NNDA 2WKWA 3EXAA 3CF0A 2NO5A 1NW7A 4RS3A 3HPOA 4CM5A 4CKCA 4UD6A 4UHFA 1ZVQA 3OZTA 1ZOOA 4BV9A 4QAQA 1DINA 3O6VA 4LJXA 1XSLA 2YV3A 1XRLA 4G37A 4HDKA 3RK1A 2WF5A 3CUTA 5IPFA 4GFDA 2XGOA 1MV5A 3GV0A 4TLCA 4OQXA 2XB9A 5AIAA 3A1UA 1BH6A 3M6AA 4OU4A 1FE8A 4KXXA 5G3ZA 3O1IC 2JH8A 4FYPA 1TQHA 2C07A 4E4YA 3U1VA 4L9SA 4QZCA 1M3SA 2OFFA 1B7GO 2YVKA 4YUVA 1WBDA 3LP6A 7REQB 1RJ9B 5K0EA 5FD8A 1Z6TA 3DCNA 3PNBA 2R5FA 2W0SA 4OM8A 3V7UA 2GGSA 4ZVOA 1SPBS 1SFRA 2FW9A 1ZK3A 1NBMA 1P6QA 5ALQA 3PGA1 4I50A 3LHKA 3W2GA 4HGOA 5M3BA 3W8RA 3WB1A 2RGNA 1V7PC 4D81A 1II8B 4EHHA 3P94A 2DPHA 1RFLA 2EIHA 2IUFA 3EJ6A 2QV0A 1NLYA 2I7CA 3AIIA 1ULBA 2YWBA 2E4AA 1P2GA 5K0FA 1M74A 2Y4NA 3U3JA 3LVFO 2ILTA 5C1IA 1KVSA 2GI4A 3H4DA 3R5FA 4INPA 4UVEA 1GQSA 2HFKA 1KP2A 4WCFB 5K8IA 3TDMA 3QE4A 3DFZA 1BDHA 4L5YA 5JMOA 2UYGA 4FE3A 3H05A 3K94A 4CLRB 3INGA 1D2AA 4L4ZA 2WAMA 1DVRA 1A4UA 2C4KA 2G7ZA 1N6KA 3W9UA 2WAAA 1Q20A 2C8VA 4HN9A 3VR6D 4YRMA 4CL0A 1R12A 3UVEA 2IOQA 3FCXA 3R5KA 4AJIA 3MABA 2E1RA 4LCEA 1MIOB 1HMYA 4PPNA 3WE7A 2J0SA 2Q62A 5AHRA 1HMPA 4M8KA 1CF4A 4ZHQA 5JU6A 4WK4B 4UTPA 4Z2AA 2JZBA 4ONEA 3N1UA 5LZ5A 3U3DA 4QNMA 3EDMA 4RMIA 3WKCA 5DP2A 4LYEA 1MC1A 3NBXX 4ZXFA 4Z54A 3CRZA 3STWA 3H5LA 2AG6A 3BE4A 4UNIA 2ZSDA 5C8XA 1P2SA 3CWCA 2NGRA 5L53A 2ECKA 5D46A 4LXHA 3WYFA 2BF4A 3AF0A 1WP4A 4I19A 3W5AA 4IGAA 4DT1B 1WV1A 1NNUA 1JR3E 1QTIA 2ZDGA 2RAFA 1QHNA 4R66A 4MV0A 1UBTS 5AW0A 1PWXA 1WW8A 1XZQA 2IT1A 1RC1A 4YLYA 5K3OA 1RIIA 1XXHE 1OLXB 4BNKA 1Z0UA 1N92A 2EEZA 5JC1A 2VHZA 4C4OA 1IBLB 1L4BA 1TOAA 3PGKA 4PXYA 5SYMA 4N6OA 1K4KA 1Q1GA 2OB2A 4ZCMA 2D0IA 3R9XB 4IR9A 1TU3A 2YV2A 3B13B 5C5EA 1MZPA 2CMDA 2HBMA 3LW7A 3A1WA 1EUZA 3KBBA 1JZSA 1X7WA 1CUFA 3PENA 4MVJE 4UQPA 1JFFB 3TGWA 3IQWA 5CFMA 1JHYA 4RTRA 2O8DA 5SY9A 4Z0HO 5FKJA 1JDPA 2EZXA 2CXPA 4JCOA 3ABOB 3DVRX 3IP5A 2XKJE 1UBNA 1NSTA 4TKUB 2UUBB 1PJZA 3KKMA 2DKXA 2B5VA 1D8YA 3AK4A 3N9IA 4KXVA 4M0LA 2JLSA 4RHCA 4RQ2A 1TM5E 5D5QA 4UFPA 5IZCC 1C3OB 5LQJA 2COKA 3KWJA 4CDNA 2C4VA 1DC3A 2R2GA 3UENA 4CMIA 5A4MS 4XA8A 3TL3A 4F4IA 5JNWA 4XUEA 1EXNA 1RYZA 2PQ0A 5BQ5A 4NYIQ 4BQEA 4U7FA 5HF9A 4WOPA 1GFZA 4AECA 3JW8A 2WYIA 1T5LA 2IZ1A 1RVDA 3T3PB 4FNMA 3TNLA 5J0RA 4FMPA 4GFJA 4Q12A 1LSSA 3FAKA 2QL9A 4ZQGA 2FPGA 1LI7A 1LFDB 1ZM4A 4GMGA 1E8DA 1OKKD 4QNLA 2PIAA 5AI8A 4DKJA 1NPTO 2ISPA 1RMYA 2JZOA 2GPBA 3SX2A 3RJGA 1HT0A 4P31A 4GXJA 1MIOA 3L6EA 4AKEA 3A31A 3THXA 2FZVA 1Q44A 1ML4A 2HMTA 4O2LA 3SY8A 2XY4A 4U9IS 4B3CA 1N2SA 2D7JA 2OFPA 3GRAA 4IZ6A 2MU2A 1KK1A 1NQAO 3COJA 4BN4A 1Q50A 5SV2A 4ECWA 1JA9A 1B4DA 1U9LA 3ESZA 3FOFC 1UMCB 2Q3JA 2ZCVA 4W9NC 1H3EA 2PSFA 1F44A 3TLMA 1NY6A 1BEUB 1YMVA 4Q4HB 5FX2A 2GTPA 2ENUA 4F4WA 3RAGA 1YIAA 3V55A 4U7CA 2W9CA 1NUQA 4B80A 5G02A 3DCIA 3H83A 4JS0A 4KMRA 3M1YA 2MA1A 1X1BA 2A0XA 1ISHA 2JFZA 3BJZA 2HGSA 2P9HA 4Y8VA 5CIYA 1P1RA 3QV2A 2W9BB 3IIJA 4O4LA 3TNJA 3M9OB 1SGWA 3F6EX 5GZ1A 1Z25A 1EI9A 3KZNA 3VU9B 2A3RA 1YI8A 3CB2A 5ADVA 2HU5A 4KMUA 3IMGA 2IV7A 1GNRA 2K8BB 1T8UA 4NQRA 2EGGA 5FO0A 1P4AA 3PZPA 4PAGA 1MHPA 1MU0A 3KVVA 5EE9A 3MT9A 4P7GA 3JWEA 1ZJMA 2RCYA 5KVCA 3OLQA 4YMTA 1E3JA 3UMVA 2VT7A 3VU8A 4CMKA 4UBBA 2ZRMA 3FDFA 4K9QA 4MUJA 4WZAB 4BV8A 1ZONA 1OILA 1XZ8A 1AX9A 1BA2A 3CF2A 4YQYA 4LMPA 3DO6A 4J0DA 1ST3A 1UFQA 5EQTA 1ISMA 1I4OA 2YXBA 1IN7A 1IONA 3N0VA 5FA6A 1QCDA 4ZT7A 4XVCA 4BC0A 1HDRA 3SAFA 1QO0D 3T8YA 2NZYA 1V0JA 1X14A 3CZRA 1L3IA 3K0EA 4PG5A 1Y6RA 3OE1A 5D5PA 5DBEX 2YZMA 3AYXB 3TI9A 4TMVA 1MTOA 2OD7A 8ICPA 3AX6A 3ZI7A 2EERA 4UB4A 2J85A 3JQ7B 2I4IA 2W9MA 1RYUA 1RBYA 2HMSA 1E4OA 1H0HA 1V2HE 1YRAA 1LS6A 1G5HA 2VATA 1YWGO 4X8LA 4GI5A 5LIPA 3KOMA 1P73A 2GN2A 5EZYB 3ZS8A 2H8GA 1TM2A 2Y76A 1VE1A 1YT3A 1J23A 1U1DA 3D7KA 4GLJA 4LDQA 1SKBA 5A3VA 3ZXUB 1ZZGA 2OXFA 2WFAA 2F1RA 3I2IA 3ABIA 5DT2A 4M1ZA 3K1TA 2IPNA 1IRXA 2X8JA 3AR5A 4M0KA 4RGVA 3RKUA 4BO3A 4US2R 5LQKA 4MV3A 2GASA 3RGWS 4B48A 4F6RA 2QRLA 3N0WA 3LVVA 1RM6C 3F6CA 3MWJA 1VFNA 3L8CA 4CLOA 1C2TA 4AUNA 1L5OA 2WJVA 5TE9A 3VPSA 3MTIA 4G0MA 1AU9A 5KBYA 4P34A 5B1EA 2LE0A 3GUYA 4MRAA 1FJGB 1XIVA 3BWBA 1DG9A 3HDGA 2I78A 3V1UA 3HG7A 1JMSA 2YRFA 3RT7A 5CVCA 2CLLB 3OBBA 4B4OA 4CKEA 1SC4A 4BAUA 4BJ3A 2Q9CA 2WFZA 1OI4A 2XIDA 1AKMA 2VWPA 4RFVA 5CHEA 1PJ3A 2ID4A 2IEAA 5JSZB 2RQ5A 3HBJA 5CK4A 4LI0A 4TXJA 4TWRA 3SHQA 1JYFA 1P75A 2Q7OE 5BRNA 3SIXA 3W9SA 3MELA 1NIPA 1NLMA 1OXXK 1X39A 4EKGA 4L8YA 5CXSA 2OYCA 3DZBA 3C3DA 3GG2A 4Q9DA 2ZYHA 4NVRA 1MFZA 4B4DA 3A32A 3AFNA 2H3IA 3PR1A 3R2JA 4J0FA 4DIFA 4DLPA 2VK4A 2SECE 3OCUA 3GEMA 4Z4CA 3EIXA 4PQGA 5CB4A 4LOJA 4DTIA 4ZEOA 2D7DA 4TTJA 1AGPA 2PXIA 3VISA 1F2TB 1WM1A 1SD1A 5EVCA 1UC9A 3DKPA 4CL2A 2I54A 2G72A 1AZSC 2HIGA 2Q29A 3NP7A 3P7MA 3PYXA 2VSYA 2QMQA 1SO8A 4H4EA 2I3GA 5C1DA 1DMSA 1N0UA 2BFPA 2J3QA 3PX2A 2O20A 1XZJA 2XRMA 3QTBA 3DONA 5D3ZA 3RUFA 5JR3A 5T41A 2AQ4A 1MX9A 4Z6DA 2C7BA 3IOYA 4YO7A 4DHWA 5AK5A 2E8MA 1L5UA 5FORA 1KMNA 3KLMX 4AS3A 1WCLA 1BYIA 2FXIA 3EZXA 1P18A 2B78A 2HQ1A 4Y1RB 2CMGA 4MPTA 4UQGA 4P4TA 2FP4B 4HLNA 3OT5A 3NIGB 4MS3B 1TCAA 2C0CA 5H4HA 1Y9EA 3QU5A 3VAAA 4FDLA 1HR0B 4ZH4A 5K09A 2YC2C 3W5BA 2VUTA 1IN5A 2AUNA 2NSHA 2NO4A 1UA1A 1AC5A 3GFVA 4PGGA 2UU9B 4ALLA 2IDJA 3NH6A 4W5NA 3DM9B 3Q40A 2GSWA 3D3WB 4FBMA 3BGVA 4KLFA 2P40A 2VRNA 4UMDA 5CU7A 1GEGA 4Y1EA 3OQIA 1G20E 4UDNA 3RFFA 4GHWA 4HV4A 1TA9A 1A2QA 1FSSA 3OURA 1ZO8A 3BE5A 1N57A 4PCLA 2KSOA 2Z6AA 1AUPA 4ZQFA 1RQ7A 2JLYA 1VA5A 1S3FA 3L79A 4QWAA 2R96A 3F6PA 2WDPA 3QGMA 3NBKA 1RXWA 4FGZA 3WIVA 4MW7A 5DNAA 1L3CA 4RLFA 2IU6A 2O23A 3GNLA 4YJ2B 5KYGA 5AVOA 2GKGA 3RS3A 1USGA 4ECQA 5H0IA 2I87A 4U1RA 1OWMA 1BRMA 5G0TA 4R8KA 4MJXA 4ZT6A 4BOYA 1LCIA 4X64B 5CB0A 2AWOA 1SKWA 4X90A 1RRFA 3WIEA 4YCBA 5DW0A 1S9DA 1SV4A 1FMTA 2HHAA 2FE4A 2ZJFA 3ND7A 4NG5A 5J4HA 3M3DA 2IP1A 2JVIA 2O2SA 3O8OB 4KQKA 1I36A 3RRXA 1TDJA 4HRAA 1UMBB 1OH7A 2P90A 3HZHA 5AXCA 3W05A 1ORRA 3W5VA 5IKXA 1UBJS 2EJWA 3AL0C 4FEGA 5J63A 4UU1A 3N5KA 4QUHA 3BXGA 3IB6A 3R5XA 1WZUA 4FDMA 1CY6A 5JVDF 4AP5A 4RF3A 5CITA 1C3EA 3HBFA 5FADA 4C8LA 1FUUA 1CQZA 5A3JA 1A8IA 1VKOA 1JBKA 2C9ZA 2C3YA 4NXNB 1OHHD 2XNDD 5HKLA 4LQDA 1NVBA 4YJFA 5IARA 2PTHA 1I4LD 1QQAA 3ZUGA 1QE3A 1PEAA 1QOPB 1SOUA 2XX3A 1RLOA 3PI7A 5DWVA 1KVQA 5B64A 4K4GA 1EAMA 2AXNA 1BXGA 2JMGA 5TX7A 4UDOA 2PWAA 2Q8QA 3D2BA 2K4MA 4K9RA 2VJPA 1FRFS 4C3VA 1REQB 1JFRA 5L7TA 2P6NA 4XDHA 1JEOA 1NNSA 4GM4A 4CLHA 1LVUA 2BR4A 2YIJA 4Y1GA 3VR5H 3W90A 2REQA 2VSFA 3TQSA 2QM0A 4AJKA 3T54A 3KK0A 2O8CB 3QMMA 3OEED 3T0GA 3B52X 3K9HA 2IY7A 3M1AA 4FZJA 4N1AA 2VRCD 4O2AB 1QBGA 1UM9B 3OUUA 4R5HA 1ZJYA 1ZHHA 4D6XA 5CAEB 3KKAA 3GZJA 2HR1A 3LS2A 3TLEA 4UEQA 5SYAA 3GLGB 1N5KA 4BRSA 1TMOA 2I8LA 2FLNA 1DGQA 1VTKA 3H5RA 1DIOB 2NTEA 3N8KA 4I1OA 4DDVA 4Q1FA 1QWOA 2CFIA 2DPLA 1OU4A 5FL7A 1M2EA 1T1EA 2O2CA 4G5QA 4R2IA 3UJ3X 4D3ZA 5LQUA 2V7WA 2O19A 5GZ3A 4EB0A 9ICQA 3MJCA 5MFZA 2XRZA 4JLSA 4RCZA 5B1HA 3R7AA 2PXCA 4BASA 3IE0A 2K5UA 4RZQA 3T9CA 1K3FA 1H6AA 3DLHA 1UZMA 2YWEA 4OMUA 3TS1A 3MJRA 3WSTA 5F7OA 2Q2WA 5BOSA 3P19A 5DDMA 4WDRA 1E89A 7ICTA 4URFA 4NJMB 3PNQA 1LDGA 5JO0A 4N03A 5JEEA 5KSZA 1GPLA 1XAHA 1MOQA 3A3YA 2AR9A 2BI7A 3HFRA 4H15A 1W0KD 4GZ3A 2PRKA 4RD6A 2G83A 1N8TA 2GK3A 3UGKA 3RABA 2C5SA 2HMUA 3M7IA 5AM3A 3Q72A 3RFAA 3A4TA 4GMFA 5JADA 1E1CB 4LF8B 4Z49A 1I7DA 4Z9XA 1T1GA 2BBOA 2IE8A 4GQIA 4M54A 5DM70 4PX2A 1H05A 3AV3A 4R0VA 5KX5A 3TSYA 3H6HA 4X7RA 4BKRA 4EHNA 4X54A 2NUAB 4H3HB 2IUSA 2R8KA 2D7CA 2GOYA 1W49A 3MBOA 4BVBA 2ZUEA 3OF3A 1D1PA 4FZLA 1KQPA 3F5DA 3HZOA 1T6NA 3KFUF 2ET6A 3BFVA 4I5EA 4LY0A 2OT3B 4BQQA 3ZE8A 1Z28A 5KPDA 4RU1A 2HK8A 4ZEWA 3KLBA 3IV9A 1XXLA 4MP3A 4OQ4A 4RNCA 3M6IA 1JEDA 1WAMA 4AZ0B 3QYFA 1LW6E 1I9CA 3WYEA 2OLJA 1VLJA 5EXSA 2AXPA 3D8HA 3ER9A 3OQ1A 2IYPA 2GS9A 5HK8A 4RTJA 4LF4B 2JFVA 4Q4JB 2COEA 5IASA 4A36A 2A3VA 3FMIA 3MBYA 1PR4A 3CR3C 3GOQA 1KDVA 3DXXA 3DOFA 2O2JA 3BT7A 3DMRA 2IXTA 1YACA 1K5OA 5DB7A 4FFMA 4ECVA 4W4TA 2ATVA 4IH9A 1AXEA 3A25A 1Z6PA 5B5EU 1RRGA 4GPBA 1A4RA 4RPJA 3UQYS 4CM8B 4BEBA 1PR1A 1BC5A 2C2EA 4C6RA 1MXHA 2YJNA 4LE0A 3DF9A 2TMYA 3DWEX 1EE2A 2PFPA 4QBFA 3O8NA 2PEZA 5JD6A 1V4VA 2XUQA 3H3XA 1USVA 3L0PA 4PXAA 3RJ9A 4L5AA 4KACA 3TLGB 4FYMA 1YZQA 2I4TA 2ZSHA 3ZYCA 4EJSB 2JJ8A 2J7PA 2M9MA 2XLCA 4M8NE 4ECYA 3PDHA 2ZB4A 3DPIA 4JB3A 1B76A 4YGXB 3RFCA 4P5EA 1SJ9A 4V1CA 1F5NA 3CY6A 3OT1B 1NXOA 3KB1A 4K8OA 1SUDA 4LHYA 1R6TA 4G5FA 1RRVA 4UVHA 3O8OA 3CTPA 4R6WA 1DGSA 1IB6A 2C31A 2C5GA 4YCDA 3U3KA 4IGEA 5I7FA 3WK7A 4N7RA 3V1LA 4GOKA 4QIWC 1UPTA 4KQGA 3BQTA 2BI8A 4PHGA 3TSAA 4V0MA 1G63A 4JKOA 1Q11A 1QRUA 5HP4A 2VHTA 4NLZA 1UJNA 2DQYA 3BB1A 5AQEA 2CT8A 3CZAA 4ABTA 4H31A 4HNGA 2JI9A 1U7WA 3ROMA 4QARA 2RG7A 1RPNA 1U4OA 4KI0A 2PR2A 2ABWA 3EGVA 5DU2A 4OO1J 3LTEA 4A92A 1JEQA 4Y0VA 5ALFA 4Q1VA 3WLNA 2B6NA 4V38A 1LNZA 3WHIA 1LV8A 1EYZA 9ICNA 2OC4A 2VKQA 5LP6A 2BM8A 2OEPA 1BDJA 1T2VA 4IS2A 5J2UB 5JHGB 1JJVA 1G8FA 4MPPA 1WD7A 2PV0A 1MKYA 1PK9A 5HFNA 2ZTCA 3W8NA 1NK4A 3E22B 1UOQA 3E9ZA 2NXJA 1NN5A 1V3TA 3NBAA 3NYRA 3CS3A 5CFPA 1T9ZA 1DKNA 2AVNA 4IX9A 1X38A 4INZA 2O6LA 2QL5A 2DUWA 4MV8A 3RS9A 4DR5B 5LD2C 2QUAA 3BGWA 4AURA 3F1KA 1DKMA 2EP7A 5DASA 5HZHA 4LJ5A 3HDYA 2UVWA 1T0JB 2XMGA 2WWRA 3HSSA 1QF6A 4LDAA 4YPFA 5TVGA 3VPAA 1VBNA 3N8NA 4W9MC 2ZRLA 1W5TA 2PL1A 2JLRA 3IAEA 4KN9S 2YINC 1VHWA 1HY3A 2B1QA 3PDCA 1IG6A 3HWTA 2ZB2A 4IF6A 4WGFA 2AXQA 2NIPA 4FX5A 4BO4A 4ED3A 1ZQ1C 1YS7A 4FEEA 3KE9A 4DRZA 1RXSA 5ALIA 1K4YA 3CX4A 4LAFA 5IG2A 4D9JA 1MX5A 1A7JA 3KEQA 3MK31 4JUAA 2DUUA 3MCVA 3V1TC 5H9WA 1PYOA 3P4XA 5E2BA 3V6HA 4KO1S 2Q6TA 1MO4A 3ZJTA 2ZPTX 1H2XA 5F5XA 3OHPA 5KAMA 2GJKA 2H59A 1YDWA 4U5XA 3RV4A 3GFBA 9GPBA 1X80B 3NC0C 2HPAA 3VBEA 3HN6A 1D1SA 2JFXA 1GUFA 3T9FA 5HM8A 2PSSA 2QT0A 2CF6A 3D5QA 3LYHA 4I5GA 4P83A 3CBGA 3RFVA 1JF8A 2ZZNA 2O0MA 5CCXA 5E1OA 3L4SO 5F9HA 1F8XA 2IBSA 5JPIA 1DAGA 2FEKA 2OGSA 2EVWX 2ZANA 2I4RA 3RKSA 3AY0A 4UNQA 1VXRA 1OXSC 1WSDA 2Y2VA 1EMDA 1PS8A 3JQ9A 3NWEA 4MMYB 4PHPA 3AUTA 3KQMA 2FSHA 1X13A 4NBVA 2I5PO 3A6FA 5EJ2A 3GV8B 3HLTA 3NI2A 1QH0A 1E98A 3R20A 3FVWA 1KEUA 4FYVA 4JODA 4D3FA 8MHTA 3OE5A 3TQQA 1KFDA 1P9OA 1Z7YA 1I2ZA 1XC7A 4H7JA 3IEUA 1OUMA 4QTZA 5EKTA 3P9IA 2NTYC 1XTZA 5I5GA 4X91A 1F38A 4ZOCA 1IZ7A 4QOEA 1FA9A 4NYJR 3EPLA 4RQ3A 4RPIA 4YCMA 3LUDA 3GZTB 4C8OA 4DPKA 5F2KA 2DKZA 1MCZA 5H1YA 2VH1A 4FKBA 1EB8A 1XE3A 5DBCA 2CBGA 4X94A 3R6TA 5HJ5A 2FPMA 1JFLA 1YHYA 7ICSA 2AOUB 4NMWA 4QGHA 1EK0A 3VSBA 3W5HA 4DR7B 1HZZA 3OEHD 2B4KA 5AKIA 2RHBA 2YJ5A 3D7RA 8ABPA 2NW6A 4X84A 1P5JA 4NXMB 2HBRA 4NMHA 4RLQA 1QLNA 4RY8A 2B99A 1S1MA 4N0MA 1SQGA 4IIYA 3LWDA 3TQIA 4C43A 1O5TA 3WBJA 4ZHQB 3TKAA 1U6IA 5KG6A 2BRUA 2CDCA 4N5NA 3NHSA 4HADA 4X6LA 2B6HA 4UC0A 1TV9A 1Z74A 1CQIA 3ADKA 4DY4A 2G07A 1U45A 4B3DA 1HEUA 1GA6A 2F43A 3GLFB 4RBNA 1IY0A 2A8YA 3ID6C 2P0YA 3R6WA 3ED5A 2XA9A 4IHQA 1X42A 4ED7A 1WD5A 3GVCA 4Q66C 4WCVA 4QFDA 3SXUB 4GOJA 4B3MB 1BQEA 2QORA 2BTOA 3BF7A 3KOOA 4W82A 1VHLA 4DV4B 2ZXIA 1VYVA 3N07A 4M8IA 3RYFA 1PJ2A 2JJ1A 4R98A 1OWPA 2YH2A 2JLUA 2VQ6A 1WZIA 3AYZB 2J67A 2XVTA 2C3PA 3C7KA 4LF6B 1U3VA 2PUHA 1S2IA 4BUGA 2A0WA 4OQNA 5EJAA 3F9CA 3UUFA 1JILA 1BA3A 1N1GA 4KLJA 3T35A 2OVBA 1W25A 5D86A 1L4GA 3QWAA 4F45A 3RFUA 1B3BA 2DPIA 2EBHX 3DWIA 3K9BA 2HY7A 1CUXA 3GCGA 5DXAA 3DUWA 2FW6A 3E1SA 3WS7A 3ETJA 3OJOA 4D8WA 3P52A 5LA6A 4O63O 5EZ5A 2VDWA 4B9NA 1CZHA 4BUZA 1BTOA 4AZWA 1N8NA 4RUAA 2VF8A 3DGFC 3RS7A 2VTVA 2ZU0C 2QJWA 3PFCA 1ISJA 4PL1A 1P7WA 2Q2VA 4PGYA 1Z8NA 1LU9A 2QD2A 3EZYA 1PR6A 2FCAA 4IIJF 4GXKA 5FFFA 4CQMB 3SC2B 4IQTA 1B42A 1DAFA 1A5AB 3ZCTA 4E4TA 1B26A 4BP9A 1I4TD 2D0DA 2O2DA 1KEJA 4CKYA 5C5JA 1KDOA 4D96A 5BOMA 2AK2A 1K88A 2I1VB 2QTRA 1Z2AA 4RKYA 5IKEA 4BNZA 1CR1A 3KQSA 4WPGA 4PZDA 5AYVA 5DDIP 4RFLA 3MPUA 4L6IA 1R50A 1SB8A 4YJFB 3R6GA 4JNKA 3QTTA 2WSBA 4RCYA 2JCBA 2Z4RA 3MMZA 3Q7IA 1TTHA 5JS1A 4YCJA 1DDOA 2QUBA 5KYWB 3MMSA 3GVHA 4YRJA 2UDPA 3BYZA 3JQBC 1GUZA 3IKVA 4P81A 3EFOA 4TLEA 3UT5A 1WBBA 1T3LA 1RR6A 2EXXA 5K8TA 8ADHA 4YMWA 1XZAA 2IYLD 2FWRA 3MRTA 2ES6A 3A9CA 3VPGA 2WFLA 4D0NA 2BE9A 4JP5A 4F2DA 2W83A 3ZCPA 5DNWA 5L1KA 4PVCA 3O0DA 2G5GX 1N2JA 3QBVA 3M1IA 3QX9A 2YRWA 5J2FA 1WVMA 3NTXA 1H0RA 3SXUA 4YUXA 5KCZA 1MW8X 2PKCA 1J2TA 3CF6R 3OC6A 3TLGA 3U3ZA 1Z38A 4DSIA 4TL8A 1XZLA 2CNLA 3SEFA 2CZQA 2P4UA 4CTOA 3CPEA 4IV0A 2B98A 2YL2A 5M04A 4BNYA 4B9LA 4Q7QA 2PDAA 4OTZA 3S4YA 4WK0B 3SYRA 4B73A 2A1UA 2NT4A 3HCDA 4CPDA 2I4MA 5BSWA 1VKHA 3LQ4A 4D4HA 3FTNA 1JQKA 7ICJA 2P6PA 5KMGB 2R5WA 3BEOA 4BWMA 1UJ5A 1WXIA 3B1KA 2GA8A 1UDAA 1EBUA 1E62A 5FBWB 1LPMA 2XXAB 1MGOA 4YP6A 3DC7A 4OL0A 3DNMA 1ZUNA 3JTMA 3AXSA 2Q7XA 1XZHA 1NUAA 4K40A 2CKMA 4E33A 4TX1A 4B9AA 3JQ8A 2QW8A 1F0KA 1M34A 2VHCA 5F64A 2D2EA 5HG0A 2F8MA 5IWCA 5HA5A 1EU1A 2C61A 2HIAA 4WD3A 4E6PA 1ZQMA 3ILHA 3VZQA 1Z2EA 4YMHA 1N0IA 1CETA 3IVAA 2VHUA 3E9QA 4GOLD 2X6TA 3ZGLA 1AOXA 2POCA 2Q3FA 1OX6A 1P0MA 4BIMA 3JALB 3DTTA 2E2WA 4G81A 4C80A 2JRCA 1R4AA 3NV9A 2QROA 5DLQC 3GJXC 2WZDA 3A11A 5F5NA 2HYDA 1UDWA 2BDUA 4Y67A 4M4SA 3P9ZA 4BLRA 2HLNA 4XJVA 3URKA 4G4SO 4AMBA 1XRNA 5HIKA 3OIGA 3A0HU 2GTHA 2RMKA 1CG6A 3H5IA 4DR1B 2VTEA 3PA6A 3QYPA 5KFUA 1PR0A 3QI2A 4IYJA 1COZA 1ZRHA 4KK4A 4XOIA 5GADl 1QRAA 3N3AC 3ZU2A 4GS5A 3VPXA 2H0AA 4K6CA 2V4QA 4P5PA 2PX3A 1SVOA 2HV8A 3GFGA 1E8NA 2AR0A 3RS2A 5FA5A 2WE8A 4DYHA 7ICKA 2NX2A 2GFQA 5ALVA 4TUQA 5B1YA 3QBTA 4JLVA 3TQFA 4NCAA 5FLKA 3DZGA 2ZBEA 2AF4C 4CMIB 1W76A 4IDDA 1QS0B 2FZWA 3VTFA 1WCIB 1RADA 1GTL1 2B2NA 4KE8A 4KMMA 3CLKA 3BJIC 2H18A 3EIHA 4Q93A 5BWOA 5DCYA 5JYEA 2XZOA 5TPWB 4YVFA 1NR7A 4BFTA 2BHTA 1KR5A 2Y71A 8ICXA 1E7MA 3A3NA 4RNDB 2V59A 3FYUB 5AI6A 1H38A 1WA5A 3HKCA 1YR1A 3PC7A 4KQXA 5DYGA 2J08A 3EGXA 4R1TA 3RCBA 4RU9A 4I99A 3DYIA 1XRMA 3NHYA 3NORA 3WX0A 5U4XA 3WNQA 1NJGA 3RJKA 4O4HF 4ND3A 1GDDA 4J3JA 2ZJAA 4E03A 3HXTA 2G8NA 4QPPA 5F2OA 2J33A 1J99A 1R0KA 4Z0PA 3STYA 3GUZA 4Q02A 1FTGA 2C5BA 4ZI2A 5HGXA 3IILA 3SR4A 1EUYA 2BBTA 4CG0A 4TSRA 1XP5A 4B6SA 1MG5A 3QFTA 1HUZA 2W8BB 1WBJB 3IE2A 2QRVA 2VF4X 2WTNA 2EF0A 2HWXA 3A0UA 3B3GA 1SZHA 3EOBI 4I4TA 4K46A 4CT5A 4AS1A 3QEAZ 4EYSA 1UJ4A 1YNSA 3K8YA 3NEYA 4FEAA 3VRHA 1TQ6A 1UC5B 4Q5IA 3IUBA 2D2VA 2X8WA 4IIVA 4ARUA 1U4BA 4ROSA 3R7LA 3A27A 1AHNA 3PDIA 3K9QO 7MDHA 3UK1A 3IUMA 3K20A 5AJUA 1W7AA 2PZ8A 1GRQA 4NJEB 3BMQB 2VKTA 1F9AA 3HPQA 3VR5D 1DFHA 2C54A 1QAMA 1KKMA 3UJHA 4RJ2A 4EY6A 3F6RA 1R8YA 1O77A 4TTRA 3JD0A 2Y8EA 3I6ZA 3H5OA 3B9QA 3V32A 3NUGA 4C2TA 4D7AA 4DCCA 3UQZA 4LGVA 1FDUA 2IZ5A 4KITB 2BR3A 2QD1A 3GDHA 1JU3A 3ICCA 1RXVA 1I3OA 4NM1A 1EP1B 1FLVA 3AT1A 1RYYA 2RH9B 3MJHA 4KKVA 5DHAA 2QDKA 5EIFA 1L1QA 2ZIWB 2OO7A 1KDYA 2XD9A 1DRGA 2BPGA 4M38A 3W9YA 1RAIA 1T26A 2JCXA 4JJGA 1EUDB 1VYUA 4RLSA 1TKCA 1BE1A 3F46A 1FB5A 4NCNA 5A1JA 1KMHB 1S1CA 2C2GA 1K66A 4LK3A 5AW1A 4DOBA 2Q3HA 1TL7C 1WUJS 1H2ZA 1ZCZA 3Q9UA 4B4UA 1EDZA 1QVWA 4B7AA 1GFWA 2P5SA 1U81A 1Y9DA 3MLAA 1GKYA 2BHRA 2MWMA 1WF6A 3CYMA 4QTUB 2ONZA 3BGIA 4HH0A 2E4VA 1E2KA 2Q2QA 1YE5A 2KTQA 3BIFA 1YMUA 1A8QA 4RVUA 5H80A 2Q2OA 1QGYA 5D3MA 2B2CA 2ZVPX 2JXJA 5B37A 1VP9A 1OMOA 3L5OA 5E6SA 1BROA 5CB4B 1YRHA 1KSJA 1W52X 4TKUA 4PYLA 3Q8QB 2OBBA 2ZTDA 5TT1A 4DREA 5FUVA 2XNJA 1O97C 5HIAA 5EP2A 1TK8A 1BHJA 1EKXA 2AK3A 3F71A 4WEQA 3NTUA 1MRNA 2KKPA 2Y68A 4H35A 2BGKA 3DKRA 4Y2SA 1A7KA 1I10A 3FKJA 3MGKA 3N3BC 2DFLA 1LLDA 4GZLA 4YP1A 2JG3A 1L4MA 2ZQYA 2C82A 1F0MA 5J4VA 3OZRA 4FR5A 4WFJA 1KJQA 3WAGA 2BMWA 3JQAD 1KRWA 4QYMA 2OHHA 1XAIA 3WHLA 3ZHBA 2G63A 4S04A 3DOHA 2KQUA 4KAFA 2YWGA 4ZZ2A 5C3UA 2VNJA 3T15A 2FP4A 4MWCA 2BKAA 1MAAA 3WA6A 1E61A 3MBIA 5HK9A 2QG4A 1R3UA 4DCUA 4OHUA 1PGJA 1J5EB 4ZGWA 2J3HA 3BH7A 3KUDA 1L8XA 2V98A 4EEYA 2JLXA 4CHTA 1OXKB 4MKRA 3IR5A 5JWHA 1A82A 3PZBA 1G6HA 1B8OA 1IM5A 2V7BA 3QXXA 2W2KA 3LWZA 3VJLA 1QYCA 2JHCA 4F93B 1KMQA 1VRCA 3AL0B 4M2LA 4DNOA 4PYOA 2GEKA 4FOOA 4I50F 3T5TA 3HBAA 3F5MA 4IXDA 5CFQA 4OB8A 2XWPA 3CUUA 1CPYA 3HABA 2Q0ZX 3T79A 3VV3A 4DFDA 3ZW9A 5LVAA 1DBVO 1PW5A 2FW7A 1DFIA 4KQMA 4OHPA 2AD1A 2Q4TA 1X80A 2C20A 4YP0A 3IKLA 1E7YA 1WEHA 1UZLA 1ZD3A 4IIXA 5J0YA 2R1TA 2JK0A 3T1NA 1SHTX 3EXIB 1IY9A 4C0XA 3JRNA 1XEWY 1L4EA 3JQRA 4QJ4A 3EZ2A 2BIFA 4LKRA 5A7HA 4Y2GA 3OMWA 4DV6B 3FFBA 3TOZA 1CUUA 2AG0A 4OY3A 2E8NA 2IZZA 1YZLA 2RBKA 3FLEA 3S1AB 4QUIA 1V3VA 3QLVC 5B3JA 1IAQA 4J0JA 4PZ0A 4BWVA 1TUIA 4NJMA 3U1TA 2I71A 1BPDA 3EYAA 1LLCA 3KZCA 2QXYA 3P0FA 5ITZA 2OV8A 3KSAC 2GRJA 5H59A 3IPRA 4CKBB 1UBFA 2V7UA 2ZWMA 3Q2OA 1UANA 2X9QA 2CYAA 2EYQA 2AN5A 4URUR 2ALZA 4XWTA 1KZ1A 2CPRA 5JYDA 3WFIA 3V8QA 2QX9A 4RQNA 1U98A 3QG1A 4LDRA 3EA4A 3S2IA 5JTUA 5G5HA 1N7IA 3SEAA 2FX2A 4S0XA 1LVHA 3LCUA 4JBIA 1E7QA 4HKTA 1M6WA 1ODKA 2P9BA 4PS0A 1H5QA 2RARA 4CT0A 2IPLA 1C1DA 3EWNA 4RF4A 3ND9A 2ZYSA 4GEKA 4YX9A 1CF2O 4PSVA 2ZJBA 1V16B 3R5SA 1NX6A 4FDUA 5F7ZA 4BRUA 4ADSG 3ASYA 3ANMA 1JJFA 2NUAA 3GBSA 3HCNA 1I80A 1P1HA 2VJKA 1BXGB 1Y5LA 1BPZA 3S27A 4EYGA 3H0CA 5K0JA 1WUTA 1P91A 1ZIDA 3SF8A 6LDHA 4EG3A 2D1RA 5J2TA 3U4HA 3HKZC 1P81A 3MD0A 4JV1A 1HE8B 1Z4JA 1T3SA 2C96A 4FS2A 5KTTA 3TO5A 1QJCA 3Q5EA 4RGYA 1CUDA 4UBCA 5A0TA 2LDBA 4YJ3B 1P39A 2IEBA 3TCXB 3ZU5A 3VR0A 4DOMA 4OF4A 1W0JA 4GI2A 3L0CA 2VJDA 1XJCA 1TVKA 4NDNE 1U0SY 4BNDA 1LQ2A 4ZREA 1G19A 2ZI5A 3ABZA 4N6NA 3TQOA 1YMQA 4PG4A 1UWLA 1L2TA 3L46A 1TD1A 2PWBA 2WM2A 5B1SA 4BMNA 2J6IA 1FTSA 4PNZA 4AKSA 4R1PA 5AW6A 4QSHA 1KJZA 3DAHA 3WL6A 4A10A 2GBPA 4EVQA 4REMA 1TAQA 2NSJA 1NVFA 4I2VA 1VKNA 4MV5A 4GMDA 3G7NA 2GF2A 2DEUA 2WJGA 3HDJA 4KGDA 1YCHA 2FPOA 5BV8A 4EPVA 1CLUA 3CLRD 3AF4A 3JVIA 4LXUA 1ZYUA 2P9EA 3HP7A 4JLOA 4KEAA 5A6SB 3BZCA 4HPJB 2VQEB 2VA8A 3PIDA 5CT6A 3UXOA 2UZAA 3LD9A 4FC6A 2JI7A 3E5NA 4QQFA 2H06A 2OCDA 2V96A 5L4SA 4YMOA 4B44A 2O0LA 3ZGXA 1UL1X 3W5JA 1PT6A 1JMYA 4CM9A 3S1AA 1U4NA 3NTVA 4HYQA 3ETGA 1GGNA 5A03A 3DDCA 2AD5A 3JAWB 3LBFA 3FJ1A 2B25A 3ZD6A 1X19A 4MLCA 4DMGA 5JJBA 1YA6A 3BWMA 4QVGA 2BJWA 5KFIA 2CVQA 1NZDA 4MQEA 4BX3A 3BL6A 2G5IB 4BQRA 3X0DA 2IODA 4UOQA 2E85A 2TRSB 1E1LA 1XTRA 2GCOB 4F91B 3EQ2A 3NZEA 3ANNA 4GVLA 3MTGA 5DLDA 4BGEA 1VIYA 2H9IA 3C5WP 3LHSA 1MQSA 2W8KA 1P2BA 5A5GA 5BVHB 3ZD7A 3KYBA 1PK8A 2XEXA 3HU5A 2MSNA 4K0RA 4Z4HA 3GJYA 5F9LA 2FMUA 3MDCA 4GWLA 4LGCA 4Z4QA 1LV7A 1E20A 1ZUIA 3U5TA 2CRXA 2EG5A 3EXFB 4QZVA 1M7HA 3PDWA 4QZEA 4BMOB 4BV3A 4JUFA 1L5FA 4UB6U 5DBBA 9ICGA 3R0QA 1SD5A 4EHDA 5I7RA 3DV2A 3C43A 1YRQA 3E3NA 3O1LA 1CVIA 4G3XA 1YXMA 3H0MB 3DSRA 1V39A 1FNBA 4PE5B 3BS4A 3TJRA 1Q12A 4KR3A 1WMDA 4E12A 2H4WA 3UATA 2QD3A 4BDSA 3I5YA 2FUEA 3U39A 2G06A 4RUCA 3HO6A 3NS1A 4YHBA 1SGGA 4CKXA 1VE5A 2QN2A 3ZE6A 1QIGA 2RK4A 1E2MA 3C2QA 4RH3A 4ZYTA 3GRCA 1G8KA 1AD2A 1J49A 1Q3HA 2F2TA 1X40A 1O3YA 1XRPA 1IUNA 1T8PA 2KMLA 2C9BA 2MMCA 3CURA 4MGKR 4RSRA 1XPJA 5BN3B 3CWQA 1EFLA 2F55A 4OUDA 1HG1A 1SBNE 5CIQA 4CFZA 1IZ9A 1BHSA 2WB2A 3WGMA 1U9CA 1VJ1A 2QAGC 3H9JA 3WOHA 4FGJA 4U7HA 2ZRKA 3GXBA 2I55A 3LPMA 1YVUA 1G55A 3LBHA 2RBGA 4UEOA 4WZBE 5DBHX 1RJDA 3LDFA 3L8DA 1L4FA 2NQ2C 4TTIA 1R15A 2CXNA 1FDWA 2W6JD 1EH5A 3E3AA 3IQFA 4Q4LA 4RY2A 4EQZA 4MIKA 4HUQA 4XKJA 1T25A 1Y6JA 5KFMA 3TRIA 2EQ5A 2W2NA 1QG0A 2ZXEA 3ZJ4A 4ZT5A 1O2DA 4TLLB 3RGGA 3TTSA 2RHGB 2RGUA 4MUAA 1CULC 2X0EA 5LWQA 3U09A 2OYRA 4I2BA 3U37A 3JQBA 1KY4A 1HFWA 3RO7A 2PL3A 3NPAA 4PX9A 1JPJA 2VYCA 2YVAA 2QRJA 3KTFA 3STXA 3V72A 3CZ4A 2WI8A 1NN0A 1COWD 1XA0A 2VUIB 4J9VA 4ZAGA 1HXHA 5LYJA 4KSCA 3V2UA 1Q21A 4RIHA 3HVKA 3KHTA 3LC0A 4BDPA 2FK7A 4ZYWA 1AB6A 4GX5A 1IM8A 2C7QA 2EKLA 2W5UA 2XRYA 3EFHA 3FPAA 1EQ2A 1UODA 4QDJA 4WTOA 2O8EB 3DDSA 1KNQA 1L4KA 3ZDDA 4L28A 5GQSA 3DZHA 3H2BA 3GMIA 1T0PA 4NPAA 4GE0A 3M4ZA 2WZCA 3FOAA 4W6ZA 5ALOA 1H2EA 4O2BF 1RACA 3GJ0A 4NK5A 4MTCA 1B8VA 1BWRA 1XFAA 3HJCA 5CXUA 1OH8A 1MAHA 4NZZA 3WO0A 2H5EA 4BE4A 1KJIA 5FFNA 4BP3A 2JV3A 1NU6A 1D4AA 4N7BA 3WHPA 1SBHA 1AHIA 2Y3IA 2ZQ5A 4KAJA 1A69A 2EATA 1S97A 1QHXA 4ZPXA 3JWHA 4XQGA 1XDWA 3IVXA 4ZVLA 2X1LA 2HPZA 3CSSA 5KUTA 3GFFA 4I1SA 5KFVA 4W63A 4BFLA 4LWOA 1M1NA 2VK1A 5B53A 1Z4KA 1Q3UA 2UV8A 1R00A 3M6VA 1U1GA 1P77A 2IQ5A 1FYXA 1CB0A 3LQKA 5DRTA 5EXTA 1Y3IA 3HCCA 1W35A 2YYSA 1US8A 4L3OA 2JFQA 2AEEA 4LZGA 3WDLA 1XPOA 2IPXA 4HL6A 1O95C 1AG9A 3CXRA 3F5FA 3KEGA 1U3WA 3ORQA 3IXLA 2H85A 3DT6A 2ID8A 4HHEA 2CDAA 2IU0A 3WGOA 4DY6A 5JTTA 3OU2A 4KSBA 4Y2XA 1NBME 3JZFA 4JUIA 4A23A 1CHNA 1KI3A 1MB4A 3EA0A 4I50B 5TQVA 1T1IA 3WYNA 2FEMA 2EFYA 4C7OB 4MYHA 3L43A 2H1LA 5CLLA 2HCFA 1WXHA 2QLNA 1J4AA 1W1IA 4I1RA 1R9GA 4OXIA 2RRDA 2J5BA 2ZR0A 3X2FA 3F2BA 4NBRA 2CYCA 3TRDA 3ZBUA 5KOHB 3IJ5A 3UK6A 2JGDA 5ALRA 4B35A 3B9JA 4HLDA 3FWKA 1Z7GA 4B4KA 1RKVA 1X2IA 1J0EA 3A2MA 1ECWA 4EHBA 4P4GA 4LBVA 2Q1SA 3NGXA 4BZQA 3THSA 4FS3A 5C31A 3CRMA 1W4BA 2ZAMA 4HAYA 2VYQA 4R0NA 5CM9C 3X1ZA 4EKYA 2GCPA 5GJWC 3SVZA 3OAAD 4XJSA 4WLOA 1AMOA 1D5WA 2C2MA 5HZGA 3LXMA 3VXKA 4TWZA 3LX6A 5EWEA 2I8CA 3G9TA 4H4CA 4MAMA 3UHJA 8ICHA 4BVGA 2N9UA 4DVGA 3LX5A 2OMEA 2H0QA 1WP9A 3GX1A 3GMSA 1NWCA 1KJ8A 4HP8A 1LBTA 5D00A 5H3HA 4AJ4A 1ILEA 5DTMA 1NXSA 1O94C 3COWA 4OXKA 3SC6A 1N1DA 4JVSB 3R24A 4IQVA 2F48A 4Y7CA 2FQYA 1DADA 2QD5A 3SCZA 3IG8A 3HR7A 4HH3C 1NJZA 3EF1A 1T2EA 2PLAA 2JF0A 3FRHA 3IAM1 4YV2A 1NZPA 4AFNA 3MINA 5C1OA 4RQ6A 1AM4D 1BKYA 1GARA 1YL6A 2NV2B 2A19A 3IPLA 3N74A 3Q3CA 2OQ2A 4XI9A 2R8GA 5DK6A 3EHEA 1K9SA 2DFNA 3IS3A 2CLHB 4L73A 2EQAA 1CFZA 1ZBDA 2VSQA 2YY7A 1OBCA 4NENB 3MTEA 4P93A 2W11A 1GPH1 1C30A 1MVNA 4GOXA 4UQOA 2PTGA 4P1ZA 1U28A 3FNHA 2Q6IA 3KHHA 2G1JA 3JR3A 2JFPA 1L5MA 1C7JA 3BD6A 5DM60 1JYEA 2DH5A 4NBSA 3U7QB 1RU3A 1EJ0A 3PKIA 1IRIA 4PQEA 4UMEA 5E3JA 1J6UA 1Y6ZA 1IIRA 4KZPA 5BY2A 1HIWA 5AM0A 5IJZA 4ML3A 2UKDA 2Z6QA 3MTBA 1C7RA 3ACBA 2EARA 1JKXA 2D1FA 3BG5A 1HH4A 1W88B 2IELA 3SJCA 3WKEA 5H3LA 3TSZA 3AF2A 1C3OA 1XR3A 3NAGA 2F67A 4UJ3A 4LDNA 2I29A 5EINA 2FF7A 4G9GA 4Z9BA 3MIIA 1N78A 2HRZA 3WYGA 1PJ8A 4KH0A 1DO2A 2PQMA 3L7KA 3P2EA 2OHGA 1WY5A 4R2XA 1Q22A 1XAGA 4IVPA 4EBDA 4YXWD 1IY8A 4JSTA 1TZMA 3NG1A 4XAQA 1K8ZB 3UJCA 2XGJA 5EIOA 5A5VA 1GGFA 2V9PA 4KXUA 4HZIA 4HI0E 1LBHA 3IAUA 3LO8A 1DXQA 2Q3LA 4KVGA 2BW0A 1P3DA 4Y9SA 4OH1A 1MPXA 3DV9A 2H52A 2BD0A 4H1UA 5JNLA 3I62A 2ADFA 3FF4A 3CZPA 3UMMA 1PUZA 3IFSA 4KW7A 3WLIA 1G3MA 3FSEA 3OEHA 4GVXA 5TEWA 5FTWA 1EJ6A 3RRJA 3OFJA 2ZWOA 5KYUA 2BLLA 2NZJA 2KLHA 1OBOA 1XEXB 2X0NA 3Q4GA 1QIEA 1FOEB 4ETNA 3GLIE 4RHTA 2IIBA 4EX7A 1UR5A 2PGLA 4ESHA 2I1QA 1Z4NA 3P9CA 4OPMA 3DB2A 5DQIA 1B41A 1KIMA 2RHRA 1C1XB 4CIAA 1BPBA 2TMDA 2AWNA 5L9XA 2DJ5A 2IWRA 1U90A 4ABYA 4L76A 4EB8A 4OX9B 2EDUA 1J8YF 1HK7A 1PD1A 3O4GA 1QGAA 1V71A 5KFCA 3FJYA 1IEXA 1QF7A 2WWXA 1QR2A 3PW7A 3BTOA 4Q18A 4ZU6X 5LZ8A 2WHPB 4HPWA 4ZN6A 2YZ2A 2EJVA 3BCHA 4PHFA 1AKVA 3BD9A 2LTAA 3IPCA 2D13A 4PYRA 1Y7PA 3GUVA 4O2BB 2WJIA 3K15A 5BN4B 5KOHA 1KBOA 2O14A 3FROA 4M8SA 1SPXA 4D43A 1I32A 4E2ZA 3QF4B 1PG2A 3U5ZB 3PHHA 1XXHB 2GCNA 2OCAA 2VRWA 1XTSA 1KE1A 2Y1JA 1L8QA 3U7QA 1YZ6A 1V9SA 1YQ9A 1TB4A 1ZCAA 4ARSA 4C3UA 4X1YA 5BMVA 9ATCA 3CNLA 3K4PA 3O75A 1PRYA 4MVJH 1F8UA 3X1XA 3IM1A 1TKRA 5JARA 4BNMA 4OHFA 3THYB 3PITA 1NJ1A 2ZWVA 4LFCB 5C46F 1EE1A 1L5WA 4CI0B 4WZAE 4MUYA 1CRWG 1BAPA 4NWIA 1GWNA 2VDWB 5AR1A 3U80A 1TW3A 4DDWA 4H16A 4P4SA 1RI3A 1N2CB 3GLRA 3GY0A 1U02A 4C21A 2QTHA 1G6OA 1L3BA 1N2EA 3QVTA 3CIFA 2G5PA 4FLMA 4MYDA 1NZJA 2H2IA 4ZVRA 1RPJA 1Z39A 5IINA 4MIEA 1TW2A 4P2GA 3HYSA 5E8JA 1U7HA 1YK0A 1L8AA 1UP7A 3DEKA 3EMBA 3OZEA 3V4PB 2C3MA 3CWZA 4NU5A 3AU8A 4HB0A 2WIKA 4L6CA 1B6TA 4KMOB 5TB5A 3T94A 5IWAB 4H0CA 1H4SA 4C7VA 2OG2A 3QOXA 3NT4A 3DE1X 3L93A 5TEVA 5FLYA 2VLBA 3RK4A 1A50B 4A15A 1C7QA 2HHVA 3UV6A 3ITDA 2NMVA 5JMTA 1QV6A 2BGUA 3TPFA 2EW2A 4KGVA 3HI6A 3AONB 3L8MA 1BXRA 4MVYA 4IEFB 1QH1B 3NASA 2BL4A 1N6HA 1QG2A 3B6EA 4IUYA 2GH1A 2WP8J 3KHSA 4MYTA 5CPBA 1FXWF 4OHCA 2LD4A 4D3SA 1W1UA 2BC9A 4MVJP 4E32A 1X1RA 4F92B 3AM9A 1NBEA 2BUBA 2VRBA 4CU5A 3RU3A 1W36D 4RQ5A 4I1VA 4UBJA 3G6VA 5FV4A 2GHIA 4G5XA 1ECFA 4GLXA 8ICUA 3ENVA 3HJGA 1HE3A 1GZ6A 1MNQA 4BBAA 3RS5A 1V4BA 4BUJA 1ZCJA 2Q5CA 4FYXA 1GTMA 2REBA 4PFJA 1NYRA 2Q1TA 3WBBA 1CDDA 4X3CA 3WLTA 4ZO6A 1UJBA 3NBFA 5JCOA 1J1ZA 1RMQA 2XF2A 5EWFA 1ZQLA 3KFLA 4GOND 4RXTA 4YI3A 5JD5A 2CLCX 1C3LA 3OPQA 1JU4A 2VQDA 2W6IA 5LOVA 2DPMA 2AOUA 2ZTMA 2OV3A 1Q1QA 3DEIA 1RJ9A 3H8SA 1H4VB 1N2IA 1QSSA 3G68A 4RQTA 5EMHA 1FPQA 3AUXA 4AUMA 3N86A 2JAQA 2I6XA 3B53X 1KYVA 2QE6A 1GTJ1 2HA0A 4TZKA 5KVQA 2P6MA 5FTLA 2NU6B 1KIFA 4UPDA 3W06A 2WAOA 4J4HA 4BX9A 3KAPA 3G23A 3S5UA 3SVTA 1NN3A 2QSUA 3D0OA 3GDGA 5E79U 3E9RA 4DDMA 4G63A 1H4QA 5GV8A 1ZSNA 2OV2A 2ZRIA 3HPRA 1EGHA 4IPTA 3H2YA 3PVXA 3ETDA 4JI6B 2H16A 1YBMA 4LSGA 2G77B 3GO4A 5GTIU 3KZIU 2DCUA 3ESDA 4MI1A 5EXXA 2VK8A 3OEYA 3HUTA 2I2AA 2W6OA 4L16A 1ZVJA 4HDNB 1FEZA 2H1FA 2H3EA 3HFJA 1OXBB 4MYRA 5I6DA 1OFVA 4B6OA 2FU5C 2X4GA 4Z7QB 1V37A 1E1QA 3N75A 4BEWA 2V4RA 3ELWA 2R8ZA 3MQ2A 3OKAA 1D9XA 4UVGA 3AEKA 1C9KA 1MOZA 2WHXA 2HK9A 4ND5A 4A6XA 4QWBA 4D46A 4RWEA 4QLBA 1OT5A 2PS9A 5KFHA 2TECE 2FLKA 1EK6A 3OUZA 1TJ3A 4FC7A 1Y88A 1WCV1 5E6UB 3T4UA 2QUZA 3G0DA 1KRXA 2Q4RA 2OFXA 4XEUA 1ECJA 1R4ZA 1UBOS 1UC8A 3BXHA 4CM7A 4JB2A 1N62A 1PDWA 4IICA 3A1CA 4F2SA 3UWDA 3TOSA 4KDRA 1FQJA 2IBMA 3N87A 3PC8A 3QVVA 3SFVA 2WWTA 3CH5A 3E9DA 3S1LA 2C9DA 1S7GA 5CMLA 3S40A 4ND1A 2IE0A 4UBIA 2W93A 3KEFA 4YCNA 1KP9A 3I76A 1DC4A 4FU0A 2P9GA 4E21A 2DH6A 2JGAA 4IKEA 4AYBC 4U4AA 3R7SA 5KYXB 4BZPA 4NJEA 2INGX 3OHMA 3QUTA 3N0TA 1KQNA 1BSVA 3DMYA 1ZSYA 3HN2A 3FPGA 1XRJA 3QFFA 5LDGA 4DMCA 4BGDA 4WQMA 1FSFA 2GM4A 3A9VA 3C21A 3A04A 4D44A 1LLFA 4IIFA 1O6CA 1SNYA 3O0TA 2ODTX 1IBKB 1DAEA 3AUOA 5MGNA 1XHEA 3CNEA 3GGCA 4L4XA 2QG9A 1E5XA 1IHPA 1T29A 1VCHA 1HEKA 4QUJA 3UUWA 4F2HA 2VAPA 1P2TA 5I4CA 2R3SA 1YQEA 4MH0R 4YS6A 2FZLA 2XNKA 4UB1A 3ZLBA 3KCQA 2BFEA 1E1QD 4DL9A 3F96A 4WBNF 1P9LA 3K0KA 2F59A 3K73O 2O2EA 4WNAB 3RIHA 3U7RA 1Q2XA 3ZE9A 4IF4A 4MUIA 3C3BA 2JAWA 4H7EA 1FMFA 1KBUA 4IUDS 5TVKA 3F8SA 3TH5A 2JGNA 4C29A 1Z6QA 1ULUA 2RGDA 2QEQA 1A8UA 1NJ2A 2A9JA 2WUDA 3BMXA 4O2RA 2IHNA 1FSGA 4CMGA 5IULC 4H7FA 1C8KA 4F8EA 1RWVA 1LTHR 2PH3A 2VT3A 3QVJA 1QHSA 4A8HA 4Q82A 3JTEA 4E2FA 1NVXQ 2XE7A 5FL7D 1AQIA 3WA7A 5GV7A 3IHLA 3H1TA 1G21A 2OAP1 4CEJA 4B7ZA 3CF4A 3DVAA 1I7QB 4J0QA 3A4MA 4LPKA 2MSWA 3MB8A 1ZGGA 1VKJA 3R4CA 4M36A 1AXGA 1F5SA 2HK6A 2VRCA 2W6ID 3PWZA 4FUTA 2QARB 3T5JA 1T6YA 2CEAA 3INYA 2CLDX 4XUDA 1SXJA 2NUBA 2P3QA 4GRDA 3B3AA 4PTYA 1EFRA 1UBSB 3BD7A 1NF3A 3VDXA 3TF5A 1PVPA 2PUBA 3VDNB 4C4RA 1WY7A 4JP3A 3P9XA 2O1SA 2PGXA 3PPIA 2Q28A 4ER5A 2NP7A 1F60A 4ARCA 4ZJPA 2A9FA 1AE1A 4C04A 3GXOA 1RAEA 3KQVA 4RSHA 3LWMA 2VEOA 4EQ6A 2NZ2A 2OOSA 5ILOA 1U7DA 1R0CA 3UIEA 3IP9A 2V4ZA 3M4YA 1P7PA 2R7NA 4YEDA 4R0MA 3OFVA 1OHHA 5T5QA 3ZWCA 3E0XA 3NHRA 4LNAA 4Q16A 4CV1A 5LMZA 4YUZA 2DETA 2C4TA 1PTJC 4WVLA 3DO8A 5ENDA 3AR4A 3D4NA 1N7JA 3SQWA 1IHDA 3OQMA 2XMQA 4C4SA 4KPYA 3M6LA 4A7PA 2BFCA 3BMNB 4BFYA 3IRVA 4C30A 1CFJA 4JASB 4F4HA 2GZHA 3A4LA 4AXBA 3LTNC 1JN0A 1QQTA 4CLDA 1P2DA 4C08A 1XN1A 3NANA 4KV7A 5I51A 4EJMA 1U9IA 4X1IA 1D2GA 4BN5A 1VRWA 3W79A 1RJWA 1ZUHA 1E63A 7ICPA 1U8FO 1ONNA 3VNSA 5K9ZA 4MKHA 4DA8A 4UTNA 1GG5A 2GAIA 1T0UA 4J1TC 2AG5A 2PNFA 4EG6A 1N2BA 3N59A 2CHQA 3FYHA 4FVTA 1IHYA 2KFNA 1RPTA 3HUDA 3I8XA 3ORSA 4RJLA 3SM9A 1RZTA 5AUPB 2V6MA 2J9YB 3NNSA 3OGUA 1Z0FA 1H9CA 5F23A 2NRXA 1M7GA 1NRIA 1NM5A 1Q0PA 3G2NA 1I4EB 1FVHA 1GZDA 3GA7A 3A6KA 4RTMA 1X8XA 1QSGA 2RAPA 4GO1A 4TS3A 5ARDA 4CM1A 2PMKA 1EFAA 5GZ6A 3BAFA 1ZK4A 1AB5A 3F7NA 2QRNA 4FFNA 1XL1A 2FW0A 1CY0A 1ONSA 2YV4A 3K1RB 4LX8A 1BS9A 2EKDA 1QRSA 4M86A 3VKGA 1ZVVA 2ARKA 3IR6A 5IBRA 4AJPA 1W5FA 4LRWA 5DHFA 4DIMA 4S1PA 3M2PA 2IOHA 2FMSA 2IK8A 3JWJA 4DLNA 3IDWA 4QVKA 1O1YA 5BSKA 5CA0F 3HV0A 1YTLA 3JZAA 1RRKA 1C7ZA 1JG1A 1I5OA 1SUSA 2FMKA 1J09A 2XODA 2ZRBA 4NMMA 3TVYA 3DLAA 4TZTA 3IKMB 4MW0A 5MN5A 3ZK7A 2CLSA 2EHJA 3GJRA 5GONF 1P9NA 4B79A 1IPEA 4D3DA 1X86B 2IYEA 2R6GA 2ICAA 3FPLA 4DSTA 1FY2A 1YAJA 1ZW1A 3SZMA 2CDNA 1RYMA 1DSSG 3O9MA 3GFTA 3Q3JB 1E3IA 3T99A 4WW0A 5G4KB 5DWDA 2X58A 1SCNE 4Y30A 3R8CA 1TEHA 1FSPA 5AJXA 3JAMA 1UAAA 1X7ZB 4KVFA 4DCNA 3LX8A 2PU5A 3CX7A 3DMTC 4DG9A 4ZCTA 2UZ4A 4LF5B 3RTGA 1XROA 4G4IA 5DGCA 2EKPA 3QVXA 4OFWA 4C78A 1Y8CA 3ET4A 4JDUA 3BFJA 1TF5A 3PD1A 4FZRA 2OQRA 2ZJZA 5IANA 1QF9A 1P2VA 1TM3E 2H7XA 3O21A 3MD9A 1UQUA 2RGCA 2ZS7A 5ECGC 4YQFA 1ZAYA 3TFWA 5SZJA 2AIRA 4MICA 2WWIA 1TUEA 4REQB 1DCFA 1Z0JA 3U9SA 5BNTA 1Y8ZA 4FHDA 4GQBA 2F9MA 1JWLA 3ELDA 3CG4A 3RROA 1BMFA 1JIKA 3L7NA 4RZHA 2QP4A 5C52B 4M9XA 2VDJA 4HWSA 1E2NA 1T2AA 1W29A 1XMXA 1C4OA 4TL6A 1O6BA 2Y0DA 4L78A 5K0BA 2ADOA 2OV6A 3EIWA 4M8LA 1T5OA 2OCPA 1PZGA 2WABA 4QZBA 1Z5WA 4RTSA 2RI6A 2ZT6A 6REQA 1TQDA 2R25B 4Y6OA 4RTOA 4IWYA 1BRTA 4J75A 1AF7A 2CHVA 5M7EA 2P75A 3U7IA 4ALJA 4DQPA 3O95A 4P84A 4EHIA 2OLKA 4C4XA 1JXEA 1V8DA 1XZDA 2HD4A 5L3QB 1PJRA 1C4WA 1YDFA 4JN6B 2DY0A 2W7TA 4CM3A 4NFSA 1OSNA 3PQ6A 4E0BA 5KQGA 1K8RA 2A9PA 1JLKA 2WA1A 4CM6A 3K9CA 2NN3C 3D8BA 4ZHQF 3GJ7A 3I01A 3KALA 3RC2A 4MCIA 1UK8A 1D6NA 1Q0RA 1Z75A 2VF2A 1D8LA 2D6FC 4P9NA 4N01A 3ZU4A 4L0DA 1JRPA 4QZIA 1Q7CA 2BMJA 5CB4F 4EYHB 3TKLA 1CX9B 3UB4A 3KUUA 3RVBA 5EN4A 4MO9A 1PK3A 1L8LA 1I5RA 1PFGA 2PKYX 5AJVB 3UMJA 1XNJA 2APJA 2ZIUA 2C2XA 2OG1A 4QE3A 2GWRA 2BHNA 1O89A 3FZQA 4ARAA 4Y2VA 1Z5UA 2JFHA 1UXOA 3IO5A 1VL1A 3JVDA 3QVGA 3NM4A 3K9GA 1Z73A 4DGQA 3DBRA 4HAXA 1Q95A 3IULA 3PUIA 1P4HA 2X41A 4XGRA 5DLEA 3G2QA 3QW2A 4ELVA 2VIIA 2Y92A 4G0NA 1R8SA 1JQAA 3KT6A 1D2NA 1DKQA 3NWJA 2LYAA 4TROA 1EUCA 1V9CA 3JQFC 3DL4A 2PKQP 2NO6A 3ESYA 2ZTEA 4J1QA 1BH2A 3HNPA 4YA6A 1IEVA 2BEVA 3SSAA 5I8WA 4QWMA 5ETJA 1W36C 1F8FA 1QO0A 2HWUA 3OSNA 3JPOA 3D8SA 4UHHA 1GKIA 3TAUA 5JJCA 5LWHA 4REOA 2WJHA 5D2CA 3FD8A 5FUBA 4H3VA 4QJ5A 1QRDA 1SCUA 1V85A 1V43A 1H66A 1XZNA 2X86A 3IAS6 3L6CA 4A8TA 4YRSA 2O6KA 3L04A 3ZNNA 4BJHB 1XTQA 4XXHA 5C4MA 1A0PA 1ZD9A 4CDMA 1Z13A 2PKEA 1A8HA 1U0RA 3F7OA 3AUJB 4YRDA 2QSZA 3DV0B 4Y1FA 5IJAA 3WY9A 5AVSA 2IS4A 1BN7A 2ZZMA 1R16A 1OZGA 2JHFA 2PN1A 4I81A 5KEIA 3FXAA 2ETXA 4KOAA 2HLHA 3DMNA 4HSGA 4LJYA 4KNVA 5FOUA 3KPJA 4N7MA 2PLRA 5ALDA 4V2UA 1ADYA 4ZTUB 1EBBA 3C8HA 3HV2A 4ZEMA 3LHIA 3DE4X 4IDPA 2JIMA 3ZI0A 3T5PA 1Q83A 3CX6A 5AHKA 3DYBA 3KKPA 2GWSA 5EP1A 5AFSA 3DZIA 5J47A 5J1SB 1T2DA 1SAYA 1FIUA 1KETA 1P8JA 3AQEA 2W6PA 1XZMA 3ZCUA 2Z9BA 2G70A 2X5JO 1XD2A 5REQB 1B6RA 2D1YA 2AZTA 3N58A 4WA7A 1DG1G 1TMGE 1MDFA 4P80A 1CUGA 4I5FA 3PKJA 1BVSA 1Z0KA 3HCPA 2HI0A 2IUEA 3THWB 3C5FA 4W5WA 2IY9A 2UUCB 1SC6A 3PR3A 1I6LA 4FDVA 4IR1A 3CNBA <