The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
222
|
structure length |
222
|
Chain Sequence |
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
pubmed doi rcsb |
| molecule keywords |
L-3-phosphoserine phosphatase
|
| source organism |
Homo sapiens
|
| molecule tags |
Hydrolase
|
| total genus |
42
|
| structure length |
222
|
| sequence length |
222
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.3.3: Phosphoserine phosphatase. |
| pdb deposition date | 2002-03-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00702 | Hydrolase | haloacid dehalogenase-like hydrolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | Phosphoserine phosphatase; domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HAD superfamily/HAD-like |
