1L8OA

Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-phosphoserine phosphatase
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 42
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8oA01
3U13A 4BX3A 1RKQA 3J7TA 4YCNA 3NUQA 1S8OA 5AM4A 3EWIA 4UW9A 2RB5A 2YMMA 3BWVA 5ALHA 5IS2A 1EK1A 1S2OA 3AR4A 3L8EA 2ZOSA 4ZEWA 4HGNA 2BDEA 3AR3A 1VJRA 4EELA 1TA0A 3OPXA 5ALPA 5ALOA 2MSNA 1J97A 4UASA 3WK8A 5ALWA 1LVHA 2MU1A 3WK9A 2C88A 3QUCA 2W4MA 1SU4A 3N07A 3NANA 1SWVA 2Q4TA 1N8NA 1RLMA 4DCCA 1RQLA 4BNDB 2GHTA 3WKEA 1QH9A 4XQ0A 2ODAA 1Z88A 2G0AA 2HI0A 2YBDA 4XOUA 4AS2A 3A1DA 1AQ6A 2ZBGA 5ALIA 2B8EA 2FEAA 3FZQA 3SLRA 3IJ5A 1Z4NA 3N8GA 3U7FB 3AR9A 3L0CA 4Y2YA 4Y2XA 3QU2A 1QYIA 2HCFA 1L7OA 3VAYA 2WF9A 3L0BA 5AIBA 4YCLA 3ONNA 2Q4RA 2I55A 5AKXA 3KC2A 1FEZA 4CE6A 2YMLA 3L1UA 5AKIA 3ZI4A 1L8OA 5AI5A 1TJ5A 5AW9A 1MH9A 3I1YA 3NRJA 2AGVA 5AKHA 1IWOA 2WF7A 4DW8A 3SKXA 4BEVA 4CF5A 4OCZA 4MUMA 3IRUA 3I76A 2NYVA 3ET5A 3ZX5A 2CFRA 5ALDA 3GYGA 4QQFA 2C8KA 4KNWA 5AW4A 1RRCA 4Y2QA 1RQNA 1ZRNA 2ZG6A 2G06A 4Y3UA 3QUQA 2OA0A 5AI6A 4J2TA 4CF3A 3U7GA 1VJ5A 5ALLA 1YNSA 5AW0A 2IOHA 3QLEA 5ALJA 3U7HB 5AW8A 3L0YA 1QQ7A 1ZOLA 1QQ5A 3ZVMA 4UM5A 2ZBDA 4XE5A 5AW5A 3WKAA 5AW1A 5IT0A 3WK6A 3AR6A 5E0OA 2YJ4A 3UM9A 1NRWA 5AK6A 1U7PA 1X42A 1ZD5A 4JDPA 2CFTA 4UM7A 5AVWA 4YH1A 3NAMA 5ALFA 4E88A 4J03A 3CZ4A 3ED5A 4HGOA 3ZWDA 4DWOA 4CF4A 4EX6A 1Z4QA 2FPWA 1RKVA 3EPRA 2PQ0A 2FPXA 2YMPA 2JAOA 3KD3A 3I28A 3ESRA 3IB6A 4Y2TA 4KX5A 2IOFA 3QU4A 5AVQA 3PCTA 1RMTA 3SKYA 3MC1A 3NASA 3WGVA 1RLTA 3SF0A 3D6JA 1U2TA 4F71A 2JAWA 3QGMA 2R8XA 5AKGA 5A3SA 4Y2PA 1PW5A 3ZTWA 5ALMA 3AR5A 1YV9A 5T41A 2EARA 5AVTA 4C4SA 1Z4KA 2HF2A 3KBBA 4BEWA 4FFDA 2G80A 5AVXA 1RDFA 2I54A 1U7OA 1ZJJA 3A3YA 3F9RA 4Y2JA 2AH5A 2B30A 3PGVA 4HYTA 2DQSA 2RBKA 2YMQA 1RMYA 1Z4JA 4KNVA 4PNHA 3OCXA 3ZVLA 5A3RA 1VFPA 3WK5A 1ZRMA 2Q5EA 1L8LA 2NO5A 3I6BA 4ZEVA 2FUCA 2HOQA 2YJ3A 2C9MA 2G08A 4RETA 5ALRA 4Y2UA 4BYGA 2GHQA 3WK7A 2P69A 2HDOA 5AICA 3HLTA 5AVRA 4FYPA 1XPJA 1Z5GA 3E81A 2BDUA 1XP5A 5AW7A 3QYPA 2QLTA 3TLMA 5ALUA 3A1CA 1Y8AA 4OFZA 1L6RA 3QU7A 5AIAA 3OCYA 3DAOA 2FI1A 2C4NA 2AUTA 4HAIA 3SMVA 3FPSA 5FP0A 1ZD3A 2WHEA 5AI0A 4EEKA 3W5AA 1KYTA 3OCWA 2I6XA 1O03A 4UATA 2OYCA 2G07A 2YFYA 5ALYA 1RLOA 3ET4A 2D2VA 2PR7A 3AR2A 3PGLA 2RARA 5A3QA 2HSZA 5AHXA 2HEGA 5ALXA 4YIKA 5AKZA 2WM8A 1YJ5A 4EZEA 3W5BA 1WR8A 2P27A 5AM1A 1WZCA 3QU5A 2HF7A 2X4DA 4BNDA 5AI9A 4UMDA 3QUBA 1CR6A 5AVVA 1T5TA 3CNHA 5ALTA 2EATA 3DV9A 1NF2A 3UMGA 2WF8A 2JAUA 3QUTA 2R8ZA 3FGOA 1TJ3A 2ZBEA 2B0CA 2QYHA 1RC8A 3OCUA 4YCMA 1ZD2P 2CFSA 4O8CA 3W5DA 4Y2VA 4BX0A 2FPRA 3B9BA 5AM5A 2OM6A 4KN8A 5AW2A 5JJBA 5AM0A 3MPOA 3U7EB 3PDWA 3SHQA 3W5CA 2P9JA 1T9ZA 4B6JA 3ZVNA 2GMWA 2R8EA 4L57A 3L8HA 4OD0A 3ZW7A 5ALQA 2I34A 5AW6A 3FVVA 1RMQA 4ZEXA 3BA6A 5AKKA 4HGPA 2G1AA 1Q92A 3OTQA 3SD7A 4UAVA 5AM2A 4KX3A 1K1EA 1Z5UA 3UMBA 4AP9A 3E8MA 3NALA 3AR8A 3ZWKA 3FM9A 3QX7A 3E58A 3WKBA 1Q91A 5AK4A 5AW3A 2CN1A 3QXGA 5AKLA 3L5KA 5AVSA 1WVIA 3WKCA 4BX2A 1RKUA 5AVUA 1NNLA 5ALGA 4KYTA 2B1RA 2RAVA 1TJ4A 4C4RA 2GFHA 1T5SA 1F5SA 1CQZA 1TE2A 2IOFK 4RESA 2HO4A 2HHLA 3U19A 3B8EA 2W11A 5AKEA 3L7YA 4UU0A 1Z4PX 3A1EA 3R4CA 4OHFA 3RFUA 1L7NA 2C8LA 1O08A 3NIWA 2O9JA 2GO7A 1ZD4A 5ALZA 2YN4A 3OCZA 3N5KA 4NFLA 2B1QA 4IG4A 4L6AA 1U02A 3ZUPA 1JUDA 3L8GA 5AVZA 4XPZA 3K1ZA 4GIBA 4G63A 1Z4MA 4EENA 2I33A 3UMCA 1Z4LA 3S6JA 1ZS9A 1YMQA 2NO4A 2EAUA 2IA5A 4YGYA 4YIHA 4UARA 4MWOA 4F72A 2ZBFA 2IYEA 4NAVA 3QU9A 2WFAA 2PKEA 3MMZA 3N1UA 1Z4IA 5AKYA 4CNQA 4L6CA 4G9BA 5ALNA 2BY4A 4HGRA 3L1VA 1L7PA 4UMVA 2YY6A 1U2SA 3FPBA 1XVIA 5ALKA 4I9FA 4HGQA 5IT4A 4FE3A 2P11A 3N28A 4Y2RA 3ZTYA 4AS3A 4GXTA 3KZXA 4NV0A 3WK4A 3DNPA 3R09A 3WGUA 4QJBA 4NWIA 3L8FA 3EF0A 5ALSA 4UU1A 3E84A 2FPSA 2FDRA 2FUEA 1L7MA 3DDHA 5AVYA 3ESQA 2B82A 4I9GA 4BKMA 3M1YA 2R8YA 4Y2SA 4C4TA 3R9KA 2VKQA 4EX7A 2G09A 2OBBA 3AR7A 5ALEA 5ALVA 2JARA 1LTQA 3KOOA 4JB3A 3ZU6A 3B9RA 1WPGA 2I7DA 2YJ5A 3KDPA 3U26A 5AI4A 3WKDA 4IFTA 2HX1A 2ZXEA 3RF6A 1RPZA 5AK5A 3ZX4A 4H1WA 3P96A 2W43A 1YS9A 4DFDA 3QNMA 5AKJA 4UMFA 3M9LA 5AM3A 2O2XA 4NABA 2YJ6A 1QQ6A 3OCVA 2WF5A 3EF1A 2B8JA 1EK2A 1SWWA 3HYCA 2WF6A 2JGAA 1J8DA 5AI8A 1YDFA 5AK3A 5AESA 4UAUA 3MN1A 1N9KA 4UMEA 4BBJA 2FPUA 1Z4OA 2AMYA
chains in the Genus database with same CATH superfamily
3C4JA 3F5QA 1ZVKA 4MUNA 2OBLA 1RYYA 1KVTA 3OIVA 3ENWA 4X91A 5DULA 2ZOSA 2EFCB 4D46A 2F3UA 5I7HA 4RF2A 2MAXA 4DAEA 4XVCA 3OOWA 1EI9A 2O06A 4HKTA 1JXLA 4DBLC 1P1CA 2O5VA 3RHZA 2JVKA 1R0SA 4NCAA 3WYBA 1CQIA 2L18A 1MJNA 1Q16A 3MQ2A 2ZB8A 3LBNA 3IJ5A 1NOIA 1E9SA 3PUYA 1YC5A 1NZFA 4N7BA 2JGMA 2Z3ZA 4QX6A 5BWCA 3VZQA 5L9XA 5I8PA 5CVJA 5CD9A 3D5TA 1YU9A 2CF6A 2FP4B 4L5JA 4QUBA 2X0NA 1SC1A 3GGDA 4QRDA 3I76A 2JIDA 3KLOA 3R0QA 3B9QA 3LHIA 4W1SA 4L51A 1R4NA 1ULTA 1OAAA 2ZYUX 2OENG 3QPCA 2OLKA 1Z73A 2XSZA 5IVKA 5CCBA 1R6BX 4NXZA 4JX8A 3T5PA 2RQ5A 3FX2A 1RYMA 3MFQA 3UJNA 3UWPA 1NRWA 4GQIA 3QXSA 5KC8A 1JIKA 4EPXA 4BO3A 2BHRA 4QEDA 3DOIA 2X14A 1BXRB 3JARB 2R44A 1L3VA 3DLBA 3QE4A 4DSOA 2XITA 4KN6A 1W6RA 3NVZA 4N5DA 1AD2A 4LWZA 1HQDA 1SCIA 3DW1X 2QWXA 1J39A 4L7QA 3W1WA 1KL7A 1JRLA 4H3VA 4UAYA 5ILGA 1D4FA 5DYWA 5JPCA 1M1YB 2EFJA 2P6PA 1HKHA 5G4KB 1KO8A 4B76A 3I5YA 3A26A 5FTWA 4F96A 2Q8NA 4U0KA 1LQ2A 2QE7A 4WBSA 3SX2A 3DZGA 3KETA 2IZ7A 3HGTA 3RVPA 3T3HA 4IKOA 4Q4AA 3U4DA 1WSWA 1P61B 3VR5A 1R15A 1QK5A 1WY7A 2C4WA 3AHEA 1WD7A 8ICVA 1ZCBA 3TSWA 4F3KA 4FSHA 3SYKA 5CA0F 2AVDA 2Q3MA 5K5EA 3P19A 1KJWA 3MJVA 3I83A 5M3BA 5EAIA 1DKQA 1RYHA 3VPSA 3ZDFA 2JFGA 4YLYA 3RK1A 5LKRA 4TTQA 1KQGA 1PZMA 4UMDA 4EPYA 2LHTA 3KQVA 3RTVA 1S9DA 2UYYA 3NHZA 3UAGA 2AE1A 4L4ZA 3MUFA 3M6MD 1C1HA 1HYBA 3BJIC 1T8YA 3IAM6 5CFLA 1TQ8A 4RD2A 2ZJ7A 4XCVA 3W6ZA 2ID8A 3KYBA 3OECA 3A4VA 3PD7A 3EDCA 3H42B 1DXHA 4I4TB 3N6RA 1YCHA 5C80A 1TJYA 4TMXA 3F2DA 3SJAA 9LDBA 2ZI7A 2WD8A 3ABZA 1XEWY 3G0CA 4L4YA 1KGDA 2DT5A 4Z4QA 5G4LA 2UYOA 4OQFA 3ZI7A 1H2FA 1KIMA 3INYA 4HDKA 1G291 4JEMA 2AIRA 4B2YA 1QHXA 1C1YA 3COPA 3V2HA 5TQ2A 1Z2DA 2Q5LA 4KFRA 1T36A 3BCRA 4L16A 5A9RA 4CNQA 3RFAA 4TMFA 4TRJA 1THTA 3Q2IA 1QGOA 4LW8A 1HE1C 1GILA 4QYIB 5AQ1A 3IOYA 2HQBA 4DOCA 5LU9A 4NE2A 5EJGA 5E9JA 5IT4A 3SI8A 1CULC 4O0IA 4FYIA 1PD0A 1LUAA 1LDYA 3ZQ4A 3LWLA 3I0MA 1US8A 4OHOA 1YVRA 2HHHB 3JQCA 3VDRA 4KW7A 4PR0A 2ODNA 3CUSA 3ENKA 1JQEA 4QU9A 3GQCA 1V4NA 1FSPA 3FR7A 4RZSA 2L69A 4IFTA 4QDOA 2HX1A 4XVUA 4P4LA 4PHGA 2CUNA 4P53A 4F4IA 3HC7A 4E5DA 3ICWA 3H9JA 1AQLA 5JXIA 2PKCA 1E3DA 2QRPA 2GAOA 2OGWA 1AV7A 3BWCA 2Q3HA 5DWQA 2PFGA 1R5NA 2YXEA 2C0PA 2WFLA 4C7BA 5IWAB 1T6YA 1F12A 3WOVA 2GN0A 2XMPA 3QSYA 2NT3A 2XVTA 5J2IA 2CV0A 1OVGA 4M60A 4M1WA 4R1TA 3THVA 4DSLA 2HQOA 3A3NA 3EY4A 4O2RA 2QXTA 2MSNA 1WETA 4KLCA 3G2NA 1KMHB 5EOZA 2BBTA 2DCUA 1BWSA 3QJYA 2AHOB 1Y80A 3ZWMA 3MG9A 2I91A 2C2ZA 4PV7A 5ESWA 5BOSA 4DLTA 5I6DA 1N2JA 3ECSA 2JEZA 1HRKA 4EHHA 3QOFA 4AZ3A 3PGA1 4MVCA 5C2JB 3MT9A 4J4HA 1JH8A 4TYQA 4RV4A 3NRJA 1MQAA 2Q0QA 3KKZA 2ZDGA 2HPVA 4ARAA 5NLLA 1VJDA 1D2EA 1OFTA 3T6KA 3NYWA 5KTOA 3W8DA 1L4GA 3SNKA 1NUSA 3HRKA 4CTNA 1X7YB 5A6SB 3IE0A 1JLLB 1RHJA 3QTBA 3F9CA 4CW7A 1ZSNA 2X6RA 2XOKA 2JAPA 2R47A 3VSAA 3DP9A 2FSSA 2Z2JA 5K01A 1GGJA 4KQMA 3RRHA 3GZNB 3TQFA 4BTEA 1DMRA 1I7NA 5IC5A 4OIFA 1HQYE 2E89A 2Z83A 2XCTB 3T7RA 2QVCA 1PV2A 2WAOA 1DELA 1TVAA 5GONB 3R5XA 4BKRA 1W49A 4JLPA 1E1RD 2GOYA 3PEWA 3TOZA 1DKRA 4KAAA 3KV3O 3Q7EA 4ZHQB 1R16A 1QTMA 2ZRGA 2XWPA 2FEKA 2FUCA 2GBLC 4RA6B 4ALJA 5TPWB 4Q44A 4TRMA 5J0PA 4QT0A 2ZYAA 4RCYA 4TLDA 3CSDA 4O2BA 4R1SA 4YJDA 5BWOA 2PKYX 3T15A 4HPJB 5BN5B 5FP0A 1KOJA 3E7PA 3UK1A 3U9LA 2FKAA 2NXJA 1D07A 4EOGA 3MGAA 2X41A 2O8DB 5AKZA 2B1IA 3DMGA 3ZV5A 2X5NA 1JHDA 5HZHA 2Z8ZA 2PPLA 3PSPA 2BUAA 4OL9A 3JY6A 1AKEA 1ORTA 3PPYA 5H82A 1NK0A 3P1JA 3H2YA 1SHUX 4NPHA 2OXTA 3PRJA 4N47A 1BKYA 1L4KA 4QSMA 3UICA 5J2JA 4ROTA 3K53A 4KX3A 3L4BA 1Q84A 1BXKA 4QE3A 2ES6A 4EBEA 3PXAA 3TZCA 2BR4A 4D4HA 3KQKA 5JXGA 1UWKA 4R9UC 2XBMA 1GKIA 5IRCD 2CCJA 4BWFB 4WOKA 4O59O 1CY4A 1QP0A 4LVOA 1ABFA 2A84A 4MZDA 3V80A 1EE9A 2GFIA 3LMKA 2FPIA 5ARDA 2P40A 2O0MA 2H3VA 4HMPA 4B3GA 3SQDA 3UPUA 3K1ZA 7ICRA 3GJ5A 4G8JA 2ZWIA 1HDCA 3LW7A 4URHA 2Q6KA 1JU4A 1JVNA 2LV8A 4LX8A 1YJQA 5KYGA 4H7FA 3BX1A 3N59A 4CL3A 4HXGA 4DGSA 1C7ZA 3DW3X 1JTVA 5AVYA 4WLFA 2ZR0A 3RU7A 1U65A 3FB1A 3NHBA 3DWEX 2XE8A 2VKQA 5CB8A 3ZPXA 2YJ5A 1NZDA 2CNLA 1GEEA 2B6HA 1VRVA 1SOVA 4F5OA 1N4AA 4K28A 1WOYA 4RXTA 1V7QA 3PX4A 4BDTA 2IZOA 1I7SB 2P4EA 4K40A 4AXXA 5IN5A 4IJ6A 5CT8A 3OZ7A 1MN6A 1RKQA 1D0SA 3KZNA 3SOZA 3HYSA 4BC1A 4HLCA 3FVTA 1G5FA 3V2GA 4QPZA 2AFIA 4DDMA 2DHQA 3A9CA 3S55A 4NQZA 2MSEB 2ZXFA 4ER5A 5LQUA 4ZVTA 4IGEA 1JX4A 3I4FA 1LDGA 1U04A 3M5DA 4A6DA 1PS8A 5KFTA 3B36A 3LI2A 1E1KA 2L42A 5AK0A 3QBEA 3CVYA 3M6IA 5CCDA 2O2IA 2E1FA 1ZOOA 4BFYA 4RX1A 5FBVB 4NY1A 2FKNA 4LTMA 4RVNA 1SC9A 3CF2A 3KQPA 4WWHA 3CX7A 2ZRDA 2YQ4A 1M2NA 1A7JA 1TJ5A 4K9OA 3IUPA 1QHFA 2XXBA 4R71A 3IUNA 1EJ6A 2EQYA 1W5SA 1W94A 4ZCSA 4MLPA 3RG8A 1TJNA 4CGZA 3H5OA 1WRBA 2IPAB 1IJBA 3UQ0A 5ICGA 4EA7A 4IL5A 2OBNA 1V45E 2ANCA 3A14A 3HX0A 1JJVA 1KPHA 3TZKA 2CUTA 5CJPA 1RABA 2XNDD 3UT6A 1NBOA 3WB0A 4JB2A 1ZM4A 3ZGXA 1GG9A 2IZZA 2Z5LA 4KLMA 2IS2A 4ZAZA 3P9QA 4ZK2A 3BE4A 4C5AA 1X6JA 2CJYA 3AQEA 4YTEA 1B0XA 2RK4A 2E49A 4Y2TA 5HF8A 1Y8QA 3SVTA 5HS6A 5KU7A 1B1AA 2ODBA 4ZVNA 4PLHA 2KX7A 3M33A 4Q9DA 5C1PA 2HN9A 3KEFA 2B30A 4L6IA 1ZQWA 4C1BA 2R6FA 2UUPA 4HWOA 2VYNA 2LR0A 3FGPA 3CVJA 3EC2A 5F7ZA 2FRVA 1NW9B 3CRW1 2XD4A 4J0EA 2AR9A 1FFHA 1K6XA 2ZIAA 4PGMA 3B6ZA 1P1IA 3G82C 1U1DA 2IWRA 5E2AA 5JR3A 2FMKA 4JJEA 3RB0A 1FSSA 1MABA 4WNIA 3G0BA 1GYQA 2ODPA 1BH6A 1EDBA 4U5XA 4X7MA 4EY5A 1Y8ZA 5AHXA 4G8CA 4DQUA 3OSZA 3WRYA 1Z9BA 1KZ4A 4QULA 3QVKA 1R8QA 2GZ3A 3FWKA 3AIIA 2UYHA 2ARKA 1IG3A 3ADKA 3KVVA 3V46A 2XY7A 5DNYB 3A9TA 5K8IA 4EZ6A 4Q4DA 4N0MA 3V4LA 2YX8A 4O3SA 4QM6A 1N5XA 3HRDD 2F43A 3FCOA 3IBGA 4BP8A 3E8MA 2G72A 3C8HA 3ER6A 2W9XA 2OEPA 2JHPA 2WOOA 5AJTA 1W52X 2V0GA 1UBHS 5D01A 1GL7A 3ZV7A 4ANFA 3NB0A 2KJ9A 4AIIA 4EJFA 3M5CA 3UXNA 3ELUA 3ORSA 2PLNA 3AM3A 4REMA 2H57A 1IM2A 1XK6A 1Q50A 3SYNA 4I4TF 2H1VA 1GGHA 2P9CA 2HKIA 1M6EX 3V8BA 1XRMA 3BRCA 3RFVA 1X7XA 1UMCA 1KH2A 5F3WB 3TRJA 1RYSA 5KFIA 2JFHA 2PMKA 4KRYA 3PX3A 3QW2A 1UQVA 3ROKA 1OU0A 3TZLA 4ZAWA 2VDUE 1DQRA 1DTEA 2Y76A 2BY4A 4CLXA 2F3NA 1JR3A 1JFFB 4TLAA 3MOGA 1ZK1A 4BFCA 4P3PA 3UEOA 4L4SA 4M46A 1P0IA 3JQ9C 1JKJA 8ICYA 2XUGA 1LW6E 2P4QA 4BEJA 4D9HA 4PO8A 7ICMA 4H0NA 3O03A 4HDSB 1EX9A 3WQHA 3I32A 1JI3A 2GD0A 5C8DA 4CEHB 5FBLB 1IHDA 2F76X 2BAGA 3H86A 9ICXA 2AA3A 4M54A 5KAPA 5LWQA 3EBPA 1CUSA 5HF5A 4MICA 3D7KA 2JZNA 5JAZA 3OFND 4QFDA 3K70D 3KG2A 4J9PA 3FGNA 3WB1A 1VOTA 2KKPA 4XI9A 2HSWA 1P7PA 1RXEA 2X8AA 2I22A 1Y48E 4PZNA 4B3SB 3ACBA 1GRVA 3L1JA 3QKRA 2F8SA 1I7DA 2QTWB 3GPDG 3PFIA 3LGXA 2BFCB 1EEXB 1OUMA 1NXVA 3ETEA 1XZBA 4B2LA 2JGLA 4P4MA 2V6MA 1W88A 4UDXX 4BNZA 3I2HA 1E77A 2E4VA 3HDHA 4N7JA 4Y0AA 2PV0A 1UBEA 4LGCA 5LN1A 2I2XB 2R1ZA 1Z17A 4B5KA 5EMJA 3NOXA 4WN9A 4B6SA 2C82A 5AKHA 1T2NA 4ZI5A 1B6RA 2QRUA 3FJOA 3ET5A 2J9ZB 3TADA 3VAZA 2PAAA 4F4XA 2OE2A 4TMZA 4LY6A 2XNSA 4ALKA 2ECPA 2IGBA 3OT1A 1W5TA 3CNQS 2VSFA 3P71T 1N6PA 4A0QA 3JQFA 4O4HA 2CFCA 3EZ7A 1RW4A 1FLVA 5DV9A 2V9ZA 2C2EA 1BVRA 1RCUA 3OIWA 4BQIA 4HYQA 1RAAA 3SF0A 5B1DA 1DADA 2V6BA 3SJZA 3T41A 2B7CA 1C8VB 4U2EA 2VRCD 3HHEA 4XWTA 3HJBA 2XA1A 1AKWA 3IAM1 1V7CA 4FW9A 1N7IA 4DFMA 5GONF 4Q7MB 5CHGA 3ENZA 4DM3A 4GNKA 1PT5A 2PFNA 5FAXA 2J3LA 4FFLA 2WWRA 3EXEB 2QD4A 4ZHQF 2PT5A 4PFQA 1POWA 5EUBA 2G6TA 2I8LA 2JRZA 1Q0SA 3PLNA 4NENA 3AUSA 1Z7YA 3UMJA 4C8OA 1Y82A 4YJHA 2HGSA 4AC9A 3HY4A 4EI9A 3PT9A 3U7JA 3RGGA 1GVHA 2VJKA 2YNMD 3L6RA 3EGXA 1WAMA 4LSGA 4C0WA 5JZMA 1QB7A 1QGAA 2X4DA 4XTCS 4J1NA 4TXMA 3H8VA 3BXFA 2YYZA 1F7UA 3AFIA 4PSCA 3HFRA 4CM6A 1KYYA 2A5YB 1EFVB 1VP3A 5KQPA 4ECRA 4YMMA 5E7IA 4CR7A 3M9WA 1YQQA 2O0KA 1P9RA 1F1BA 4EP1A 3ZY3A 1ZGCA 1OWOA 4HEJA 4EJSC 5EXSA 3L8MA 4PO9A 1JAIA 5HJEA 3UK0A 3SQXA 4YI3A 5G5GA 3QLJA 4QARA 2OLJA 4DKJA 3FR8A 1R50A 1U9LA 4PYLA 2QUBA 2RH4A 4BU0A 1UCVA 3F2CA 1Z38A 3I2FA 5AP9A 1IXZA 3I2JA 1EQ2A 2VJDA 1K68A 1H8HD 2DWUA 3WFIA 3F1LA 1ZSVA 4AJ9A 2F00A 2H3QA 4J7CA 1P6QA 5F9HA 1D8TA 2EAUA 1V8ZA 4LE2A 2AT1A 3B6EA 4YIHA 2G0NA 2PJDA 4Q8EA 1ONNA 4L6CA 4Z9BA 2R6JA 2FMFA 4KBGA 1LBHA 4JAVC 4P84A 4H7KA 5L3VA 3RTCA 4F56A 3HA7A 2VUIB 5E6UB 2JPDA 1PO7A 1JBKA 1TK9A 5I4KA 1H5UA 4QPNA 3PICA 3GEBA 3KWLA 3V00A 5IHXA 4D0RA 3GRFA 3DM9B 4Z0HO 1L7RA 3OFJA 2J41A 3QVGB 2WUDA 3EB9A 2YJNA 1C3XA 4QLBA 4I2EA 4V39A 3I3OA 4M53A 3RBXA 3KVOA 1EB9A 2CYAA 4LFCB 1V26A 3QK7A 2HSJA 2WILA 2JKYA 3OWXA 1NNUA 1WBJB 2CLEB 5YASA 4A9AA 4RPGA 2IE8A 1TD9A 1WTAA 3WZ2A 4JENA 4N5MA 4V0OA 4ZQCB 2J45A 4MS4A 2FOIA 3V8PA 3DAFA 1IWPB 4JOBA 5D85A 3LK6A 4DBZA 5DW0A 3PQ3A 4XZ3A 2OD9A 1Q20A 2ZT5A 3PB3A 1NQ5A 3ZNOA 4Q4JA 4V1CA 1RT9A 1WCXA 5L4SA 4R68A 4UTRA 3AFMA 5HYVA 1MIHA 3TLBA 1JJBA 3NVYA 3SQOA 4UBKA 4B35A 2QVLA 3QPWA 5EP4A 4I8XA 4RZUA 3LL7A 3WL8A 1I1HA 1CQJA 1M2WA 3UG6A 1Z00A 1FEZA 5ERYA 1PZFA 1J6UA 2IUTA 3KKNA 5IIOA 1KJ8A 4IIUA 3ILSA 4J76A 2H1LA 5KJ1A 1GNPA 3I3SR 5CFRA 5LQSA 4A1FA 2FZEA 4JSTA 4XSGA 1QRAA 4N0DA 1ZI9A 3BIFA 3QUAA 3W5HA 4M6WB 2FWMX 3FYDA 1U8YA 2P2DA 3GILA 3VVMA 1UT8A 3L0YA 2AOXA 1SVOA 2CFIA 3HPOA 5FA5A 1QAMA 1A8UA 5AW1A 4UNRA 1ZQJA 1TB4A 3HDGA 1TAUA 3IE2A 4ECWA 4RQAA 2RG1A 2KJ5A 1X1CA 1Y8RA 2BGWA 1BFDA 4PIPA 2QX8A 4FFVA 3HA2A 4YCAA 3C2KA 2FPMA 1E8DA 1XKQA 1XAHA 5GOTA 1NLFA 4FDVA 1CFZA 3I8XA 2FFAA 4XWKA 3VPCA 3RNOA 3VSCA 3WIUA 2HU8A 4QOHA 4K8RB 4C2UA 2Q3JA 1SBIA 4E3WA 5IXJA 3CT6A 3CKKA 4PO3X 2Q5EA 1LWOA 1TT5A 3PFWO 4P0PA 4EDFA 3ESBA 1Z0DA 3JASA 2GO1A 1XCLA 3KUXA 4FMCF 1W48A 3LFHA 5HBGA 1AXRA 1YIOA 3F8TA 4P83A 4QEZA 4UOZA 2Y9PB 3TRDA 5H4GA 3SR6A 4RA9A 2D2VA 2C2BA 4M76B 4RHUA 1DAKA 1E2EA 4RVGA 2JFNA 2DY1A 4XUGB 1TK0A 3PF9A 1GRQA 4R7TA 2PYZA 3I01A 2HF7A 2PEZA 3MVEA 3BT7A 3NWBA 2VAPA 5DMHA 1D9DA 2FW9A 5B7GA 2IP2A 4A7PA 3V72A 4NKRA 3G0OA 1IAQA 1EWRA 4KN8A 3W5CA 2TMDA 4DSAA 3CYMA 3SBDA 1SB3C 3IP8A 2JI8A 3KKEA 2IYLD 3AR8A 3E58A 1Q91A 3PKJA 5L6LB 2XCPA 4G85A 2GASA 5DHSA 4CG3A 1T5IA 1KJIA 2W7OA 4HMQA 4C3OB 1SU6A 2X13A 5DBGA 1CQZA 1DDGA 3B8EA 3IKMB 1ZIXA 2IZ0A 3D5QA 3FMGA 1DXSA 1C8BA 1P77A 2X7HA 2FSGA 4WZ6A 2FMTA 2J0VA 1TIBA 4DR5B 3W2TA 3KQTA 4MUJA 1JWAB 1ZC3A 2GBLA 3CG4A 3A36A 2E8PA 3EULA 4QYXA 4H4DA 1VCHA 4NOLA 1ADFA 4ER6A 2QX7A 4HATA 1UDAA 4DV5B 4R54A 4B46A 1RR6A 4UUBA 2VUHB 1KIAA 1I2DA 2HNBA 3L8FA 4M86A 4RZ3A 3BFKA 4UB2A 3I8SA 2VSQA 4JBIA 2VDPB 3QVUA 2ZCJA 3WHIA 4P36A 2RDIA 1BNCA 1BSVA 4F4JA 2E37A 5H8WA 1ZI8A 2ERXA 4ED7A 3ROEA 3BB1A 3M9LA 2HMUA 4C30A 3QPBA 1NWCA 2QORA 1W0KD 3EEOA 1KMIY 1VCOA 5DYTA 1E4VA 5JVDA 1GAXA 3L4EA 4UBBA 2QN9A 4TQAA 3J7TA 2OHFA 1MJFA 3ZYZA 2FFBA 2RB5A 1M6VA 4TLLB 4V0SA 3LY5A 3RW9A 2WV9A 3NXKA 1VJRA 1R2QA 4AJLA 3ABIA 4EELA 4KRGA 4EF6A 4RD6A 4PYRA 5ABPA 1CF2O 4NLKA 3SZRA 1U8FO 1NU8A 1LDMA 1ZQQA 3DCJA 3NGDA 4YFYA 2WPDA 2HPHA 3M6VA 3PC4A 1P81A 3A1DA 1KMMA 1OFGA 1YTLA 1N77A 2GB4A 4XEHA 1WDKA 3WDSA 2D1TA 1L7AA 1JHZA 2LDXA 5B1EA 1E4OA 1R6TA 1TMGE 4U00A 2FG7C 4WOBA 1Z0IA 3CUTA 5T8KC 3EE6A 2OV1A 4IDFA 2CLHB 4JMUA 5EMMA 5KSZA 4KXLA 2FF5A 1RQNA 4UHJA 2QT1A 4BLOA 3L2OB 3W0LB 2QI9C 1RG6A 2HLDA 2ZYDA 3VZSA 3UAWA 1E2LA 3GFVA 1NQOA 4PX5A 3N7RC 4F2SA 3BE6A 4EY7A 4KMOA 3HVJA 5EC8A 3PVXA 1IZ0A 1GRCA 4I14A 2R8JA 4O63O 3R6WA 1BWRA 2IEGA 4FZ5A 5JADA 1JVBA 3CIOA 3N8IA 4KX5A 5EMKA 5GPBA 4CM3A 7ICPA 1Y3HA 4C9BA 1SJ9A 2C5HA 1T34A 2II6A 3OP1A 4L8WB 3I5XA 4J9VA 4YV1A 1SVLA 3AEKB 3CHYA 2KHVA 3L40A 5D3MA 5FRDA 3CPEA 2EWMA 2PMEA 3L84A 4LTDA 4B9TA 1S3IA 3GFKB 3HWRA 3T5KA 1GUBA 2W3RA 4I5FA 2ZREA 2I6GA 3V1TC 3K9WA 3GDHA 1YR3A 3S2UA 2FQQA 2DUJA 5C8YA 2DUMA 2R8IA 3CCFA 3A6DA 4W5WA 4O5KA 3QEMA 2QS9A 4KVAA 3UT0A 2NSDA 2NZJA 3JD2A 5JNRA 4WY8A 3TUJC 3IAXA 3QX3A 2C4MA 4PCAA 4RF4A 2DGDA 1MXFA 4KXVA 4LHZA 4CLDA 3WVNA 4NBWA 2FHPA 4LZAA 1I2ZA 4MQBA 3STTA 4POAA 3H5AA 3WGHA 5B2FA 1YJ5A 2HBKA 4C6TB 4QFMA 1VCIA 1RQPA 5KSYA 4C5CA 3DFMA 1M8FA 7REQB 1Z2PX 3DO5A 2YR0A 5SZJA 5B6IA 1ZZGA 2JLWA 3R3WA 1R9MA 3HXQA 1E62A 3ES9A 3AV0B 1PFKA 3UMBA 4GPAA 3WTBA 1MO2A 2I2FA 4DN6A 2X1MA 4FIZA 4UTXA 5L53A 4FBUA 2RKOA 3PRYA 4E5YA 2CKDA 2ZSJA 2VNSA 3L4KA 3BD9A 2KVCA 4U2FA 2ADOA 4F9GA 2D1FA 2A1UB 3K70C 3NC0C 3AP2A 2HA6A 4N4AA 3IOMA 2HJ9A 2DBYA 5TEWA 3DEHA 5IWCA 3ITEA 3F78A 4C06A 4N6OA 3H1PA 1ADGA 4XX0A 3PJEA 4DY4A 2I62A 1X7ZA 3VYWA 4DV2B 1R64A 4PYQA 1KDVA 5BNFA 4EUHA 1YO6A 2V03A 3N6XA 1QKJA 1N5MA 1TOAA 4HADA 1ZR2A 3TAHA 2IEYA 1AU9A 3B5EA 2FSPA 3LCRA 3UCEA 5IFLA 4Q93A 4GXKA 3ORRA 1X94A 1U2PA 3G85A 4DHWA 1JR3E 5IDQA 3ESXA 1YT5A 2ALJA 1GP2A 1CUIA 4DLYA 4HV4A 1CDZA 4M7RA 3X2SA 1CCWA 4HWRA 1OQAA 4OKIA 5J0SA 2WSSA 1PD1A 3PEFA 3K1AB 5GV7A 2ZJ3A 3THWB 4CKWA 4UMFA 4C03A 3GJ6A 3BORA 4QZIA 2H0QA 4Q21A 4DXAA 1U8XX 3RVKA 3F2VA 2BEWA 3P9IA 4QHSA 4F3OA 1K0UA 3WRVA 3JV7A 3BJYA 1DGJA 5CT9A 2JK1A 3DV0B 3FCXA 1M2JA 2NU6B 4IJWA 4QJIA 3TOVA 2X6QA 9ICWA 1BDJA 2GZ2A 2OCGA 1V35A 4AZWA 5KOJB 2JD2A 4KVGA 4URZR 1M7HA 2ZSIA 1NJ8A 4M1TA 1MB4A 4DY6A 2WU0A 1JDNA 3E70C 1KEVA 3FJYA 2V4RA 1H0KA 2XMZA 1YI1A 4IAOA 5I9MA 2YC4C 1YJXA 2XX3A 3IIMA 5KC9A 1A9XA 2IXGA 5JUWA 1BQ4A 3M6ZA 5H9WA 3WMXA 2QL6A 2I55A 4Q1FA 3N8DA 3MCVA 2FMUA 2H5IA 1A5AB 3REQA 4P7JA 4LQLA 2QNIA 3CPHA 4MW4A 1JALA 3GMTA 4LYEA 3K0EA 3EGDB 1T4MA 2QG9A 2C2GA 3JQ9A 4RABA 1TZCA 3AI7A 1JG7A 4P22A 1G0OA 1Z6TA 2YNMC 3K0AB 1Y6ZA 1U2EA 1FP7A 1D6SA 2JCXA 3G7UA 3O1LA 5HZKA 1C9MA 3G79A 2EZYA 4IDPA 1W4LA 3S2YA 2ZBDA 3LRXA 4C7XA 3NCTA 4I4NA 1P2BA 4U3JB 1GPUA 3ESCA 4X5VA 2NPFA 4O3QA 3NAMA 4DMGA 3R3UA 3EDYA 5DTQA 4GOKA 2ALZA 4NBNA 4B8YA 5EIXA 5BR4A 3MELA 4R0NA 5I9SA 2YMPA 4WEQA 1FLDA 1JHYA 2OY0A 3LV8A 5F3DA 4QA9A 4WLNA 2WYUA 4AY2A 3RYFB 4R2HA 2W4IA 4FZRA 2ZS8A 3R5FA 2VYVD 3DMFA 1AM4D 2O8CA 4AJNA 3E15A 3LD9A 4KNYA 5F5NA 1DRGA 4I9UA 5HGJA 1H22A 2J0EA 2QMQA 3KJQA 2BBWA 2EZ8A 3AUUA 1PJ2A 2LVBA 1B6SA 3EZLA 5EZSA 3RS2A 4ZVVA 3PW4A 3A1WA 1XP5A 2PZEA 4R66A 5H0IA 4LJLA 1U0RA 3FYTA 1KC1A 1B6GA 1U6IA 4QG3A 4ZI7B 4IINA 4C14A 1NK8A 4DC1A 4S1OA 1OYOA 4EY6A 4FS3A 1Y98A 1NUAA 4D8WA 1S8NA 2HEGA 5DKFA 1WU8A 1T2VA 3ILYA 1VMAA 4GKJB 4YP9A 1M0TA 1KH3A 5EZQA 2G5PA 4HBZA 2R6CA 3NDIA 4JP2A 1WX1A 4I1PA 3PG5A 4QBTA 1XQYA 1NR5A 1J33A 1PCXA 4MWZA 4BVBA 4UTZA 3X1DA 1EUCA 1GG2A 4EJ6A 3P9KA 3RWOA 2D1YA 3CISA 4HGPA 1ABBA 1OAOC 3I0ZA 1EP1B 2CYBA 1FO4A 2Q6VA 1XHLA 1QBGA 1ZY2A 1CZOA 3UJ3X 4EPWA 2EL7A 4DJTA 1FUUA 1Z08A 3QOXA 1TO6A 4LIPD 1Y7HA 2EF0A 2GFHA 4MMZB 3I9LA 3OKCA 4FOTA 4CL2A 4EIWA 4KPFC 1GCGA 3WO1A 1PJQA 5T4FA 2G6BA 1ZRHA 1XNQB 2C9YA 2ZIEA 3HABA 3TSYA 4OSEA 3LY8A 4ZMSA 3NV9A 1USKA 1GUDA 4QL3A 1BHQ1 1ZNYA 1X9XA 2KZ3A 4PTYA 3QM1A 4OMUA 4RH0A 2HJVA 3N2KB 3SM9A 5KMGB 3I01M 4HL6A 2EXXA 3NRZA 5ALSA 3DS8A 3CWZA 2Y6VA 1T1EA 1ZM2A 3PYMA 2DPHA 4U8GA 4XFJA 1OTHA 2FQ1A 2PD6A 1E79D 4WLEA 2AMFA 5A7HA 2JBAA 1O6CA 1H2ZA 3X1JA 4ZTUB 4K0KB 1IHPA 5JNWA 3LHDA 2VO1A 3GPCA 1PL7A 1SWWA 3HYCA 2BM0A 5CAEB 1PDOA 5MHTA 3F5EA 1XQ1A 4E30A 1UC4B 4EJSA 3IAHA 1T6XA 4EBBA 4OK5A 3C1OA 1EK1A 4PR3A 2I9GA 2BDEA 3FHJA 3GEIA 1N8TA 3R7FA 1ZH8A 5ALOA 4FEYA 3LZCA 1DEAA 1Z6QA 3VMMA 5HG0A 1ZD8A 1C4WA 4OLBA 4A36A 2GHTA 1AT1A 5HHIA 1PGOA 4NY8A 2QV7A 4F50A 3KJEA 3E7XA 1NAIA 5FOTA 1G19A 4I8DA 4WTOA 1XNRB 2NU8B 3TVDA 2HCFA 1LLUA 5KOHA 5KYYA 1EUDB 4YCLA 4RMJA 3ONEA 2HT1A 6NULA 1WXGA 3RV3A 5A2QA 4LVUA 4XWWA 1U4BA 2HXYA 3OQJA 2WQ7A 3TD2A 1SV0C 3IQIX 4G24A 4K6CA 2W58A 3E2MA 1OZ0A 3T9EA 3QHAA 1BHJA 5LMZA 2FOXA 1TD1A 2C8KA 3DMPA 1FTNA 1RI4A 4J7AA 2C9ZA 3DE0X 2XNJA 1ILWA 4GT1A 3R3JA 4F5NA 1ZRSA 1F0YA 5EUQB 3MW8A 3ZC3A 3KHKA 4FM9A 1ULBA 4IZHA 3AF3A 2ODQA 3DMHA 2PD4A 5TDHA 1J20A 1HO3A 4BNWA 4TMVA 3WLOA 3VAAA 3BCUA 1X7HA 5JWOA 3SSAA 3W6OA 1SQ5A 2UXCB 1H9CA 3RLFA 4A0SA 3NBXX 3UQ2A 3SZGA 1N6NA 1OYYA 3HPRA 3QYFA 4J91A 3D4PA 1IUPA 3OQ1A 1F60A 4Y0NA 8ICAA 5IJ0A 3UAZA 5DX1A 2A3VA 4MCJA 2ZSHA 4ZZ3A 4RK4A 4NU0A 4EGFA 3SSNA 4N76A 3OZVA 3RPEA 2JHFA 2NG1A 2DBZA 4E12A 3AKCA 3ZBUA 2DQSA 3NUGA 5KQLA 3A7DA 3DTNA 1ISSA 1B8PA 4OQ4A 1E1RA 4DSFA 4RYLA 2KBEA 4E0DA 3O74A 3GIDA 5DGCA 4L5BA 4M7WA 3PFBA 3SIRA 4ZOCA 3N2NA 1T94A 2ZPUA 3N53A 3DOJA 2Y9TA 4Q1DA 1VLLA 4P31A 2BHSA 1F0PA 4X1IB 2P1DA 1XPOA 4CIWA 1XQWA 1KI8A 2O5CA 4TSFA 5ALTA 4UAWA 1DOZA 3MJTA 3FGOA 4FWIB 2PX4A 2XNKA 4WUTA 4C6HA 1EB8A 3NONA 4KL8S 5DNVA 4XYEA 2EP8A 5BUQA 1NNEA 1L8AA 3ZEAA 5HWSA 4HN2A 4BNVA 2W9BB 1YR9A 2C00A 3BS5A 1EAMA 4O2AA 1CUAA 4YRMA 3C3EA 2Y0SC 3KPJA 3OLVA 2X5JO 4YO7A 3WRWA 2NU7A 3WKBA 1AE1A 3SYRA 3RUAA 5IM4A 4BYMA 1Y4UA 2BFDA 2PE5A 4DWIA 3H3FA 1U8EA 4HWGA 5GADl 3V8MA 2IUYA 1HMPA 3E2IA 3PEEA 3ZKWB 3NQ41 2AYXA 3W7BA 4YJGB 3DZIA 2XDQB 4KH1A 5G0TA 4MUBA 3BXEA 1H1LB 4AJOA 3V4RA 1XDBA 1JX6A 4I50B 1ZP6A 4UARA 3IOEA 1ABEA 1MT0A 4S05A 5LCXA 2G9QA 2PL1A 3BICA 5AXCA 3QXHA 1KC3A 2GI4A 4G5FA 4NAHA 1DIBA 1A7UA 1YASA 3HSSA 3KTQA 3KHSA 2QARA 4KYIB 2FTKE 2KE7A 3A0BU 1II9A 3HZHA 3DDHA 3ZHCA 2A1JA 4L5YA 1XVVA 4J8PA 1G20E 1BHO1 3SC3A 4CMBA 1CIVA 3Q11A 1R0ZA 4Z7JA 1RPZA 4DQSA 3ZDRA 8GPBA 1OT5A 4WRRA 2G71A 5IUNC 4W9NC 1RJWA 2VT6A 1ZH4A 3BF8A 4MW9A 2PI5A 3RSOA 3AVWA 1SCUA 1JYEA 1NBME 2A1IA 3PXBA 4BLRA 3R20A 4EHAA 3WGIA 5K3DA 3LVQE 4RADA 5J4VA 3BS7A 1EBUA 2HHJA 4OI1A 3OMXA 3MGVA 1ESCA 1CC1S 1Y89A 3WG9A 1I4TD 1PLLA 4FDAA 5EA2A 3EQ7A 5L45A 4G0VA 1YZFA 3BQMB 1PGQA 3JW8A 1RYRA 1K6IA 1X8LA 3KP1A 3ND6A 3ZS8A 4OKNA 3DBLA 4ENQA 4B8ZA 1X6VA 1DRKA 1QNLA 4AS2A 3RYTC 4E33A 1PYOA 3U7FB 4ND3A 2NO7A 3O91A 1YBAA 5TQ0B 1LRLA 1OXXK 2ZWAA 1N6IA 3FUTA 3WMFA 4EGCB 2FWNA 3AVUA 4UM8B 3UB3A 3ZXSA 2P2NA 2DGZA 4Q9HA 4JGIA 5CB4B 3EIQA 5JSZB 1E5TA 3IMKA 1AOXA 3M3HA 4U39A 3ND5A 4BMNA 4CTKA 4I2JA 1FSFA 1NGSA 1Z13A 3H2JA 2AB0A 3QLEA 1TTPB 5JWHA 4X8LA 4M0FA 3BB4A 3QQPA 2VT2A 2OVBA 3VBEA 5JJCA 2C2MA 3FYUB 1R0CA 4P4GA 5EE0A 3GHHA 4XH9B 2ZRQA 1T9BA 3N7PD 4QWCA 1RIFA 1BMQA 4OH7A 4CF4A 4GFJA 2XNDA 2ZI5A 4EO7A 4B0OA 1EFRA 3IAS6 1U9YA 2CHUA 2P9HA 2E2WA 5TGDA 5BYBA 3K0FB 4WCDA 1Z74A 1N6KA 2NNWB 4P4PA 3O8RA 5IINA 1AKVA 2H4XA 4WUVA 3TXAA 4DGQA 2HJWA 1O77A 1LDNA 2GT1A 3E9NA 1F9EA 1E2JA 1YU6A 1YB1A 1XFDA 4RETA 1RP7A 3IPRA 4KE9A 1XPJA 4MW2A 1Q7CA 4E5UA 1CFJA 1T2FA 2SCUB 1SVMA 3FYHA 2UXDB 2OR3A 1AKYA 3CZCA 5TPZA 1AF4A 2ZBUA 3K0HA 4MAFA 1D9FA 4UQOA 5ICSA 1XEXA 3QVMA 1Q74A 4OQZA 2YFYA 3EPKA 4L0MA 3NMUF 2GSDA 2W0SA 3KUCA 4JKYA 2BKVA 5CRIA 3FSGD 5F5LA 5T8KA 3K6SB 4UC0A 5CNKA 4RH3A 3R3SA 1W8IA 4ZI7F 4RULA 4BNDA 5AVOA 3Q3JB 1T2UA 1BXGB 2CWDA 3UTCA 2ZB2A 4HNHA 3FLBA 3T1NA 2YFHA 2Y99A 3RUDA 1ZQ1A 5BVHA 4X92A 4CCAA 5C0YA 5IZ4A 3EEBA 4NZZA 3EXHB 3PE4A 1NASA 3N8NA 1S0VA 4DIDA 1ODCA 1J4AA 3I09A 2E4AA 2C3OA 3N7TA 4TS4A 3FZYA 4Z2YA 2G9NA 3E0QA 4Y1EA 5CP2A 5BQPA 2LNDA 4IO0A 3MWKA 4RVCA 1P5ZB 3FKSA 1ZICA 1ZGAA 3T8YA 1U0BB 3E2EA 2V5AA 4ZOHC 5G1OA 1K3TA 3R74A 2FLVA 4D7AA 1RTKA 1G2OA 3EGVA 2Z5FA 2X1LA 2RB4A 3SM3A 4ED8A 1U1EA 3V97A 1II0A 3PQEA 5ALZA 1YOBA 1GTL1 2OXCA 1PX2A 4RZRA 3IKVA 1Z4MA 3I04A 1ZJZA 2WG0A 1TECE 3S2ZA 1SZPA 4MWOA 1QK4A 4L76A 2I7CA 2KKVA 4HGRA 3IKLA 4LPKA 4UAZA 1KHTA 3WHKA 2AHRA 1OWMA 1NYLA 1EVKA 3BQNB 1JQDA 4Q05A 4G2NA 1K06A 2F62A 2HRQA 4BZXA 5CYFA 1LI4A 4RFSB 3JVUA 1GZ5A 2GCPA 5ALEA 4NCIA 4G97A 5CLIA 4POOA 4AAYA 3NS1A 2GJ4A 1XL0A 4IICA 1TPZA 3FOBA 2HHWA 4KG7A 3RT7A 1PJBA 5IP5A 2QTVA 2C29D 2WF6A 3CNLA 3KLMX 3V8NA 4B3FX 4RTPA 1MZVA 1XZCA 3U13A 1OGIA 1TGYA 2ZSUA 4NXMB 3PEUA 2A1AA 1XOIA 4HDRB 1L8XA 2VYFA 1B00A 4RO0A 1I2CA 3H1FA 5LA6B 2DY0A 2YFQA 4UASA 2JFYA 3KUDA 3OFNA 3U37A 3ZHUA 3O4RA 4L5CA 5JNUA 3E9YA 3R9IA 3IV6A 4PNPA 7ICHA 4MF2A 5CT5A 2INGX 1GGKA 5FOSA 3N9IA 2CL7X 4IXWA 1GYRA 3KLNA 1QYWA 1M34A 2C83A 1NURA 3E9EA 2OHIA 3HB0A 1LK5A 1W93A 5A4AA 1R12A 3BXHA 4KGXA 3L1UA 4PGHA 3CC8A 2IP4A 2GYYA 3P2MA 3OSUA 3OZTA 4BEVA 1RI5A 5J4YA 1F5NA 4W1QA 3FVQA 4LUCA 2QQGA 3UGJA 2E8MA 5F9MA 2COUA 5KYUA 2XVZA 2W98A 1HG1A 2XICA 4RTRA 4WDQA 4KQEA 1M5UA 3OA0A 4G65A 4QC2A 3W3AD 5IPFA 3K8OE 1LA2A 4XE5A 3H5RA 2P78A 4BVJA 3VO8A 1X42A 1HSOA 1FDTA 4UM7A 3KFXA 4JI4B 3QFFA 3UW1A 3PDUA 3FG9A 3H5WA 2PNFA 1SM4A 2KJ8A 4CLRA 2JAOA 2H1IA 5IKPA 3IODA 2G4CA 3SICE 3RHSA 4MK4A 2W2LD 4UBIA 4FFDA 3L7BA 2XA9A 4BCBA 1I33A 1F14A 3WX0A 2FPLA 2M32A 1KBOA 2YY7A 3UFXB 5EIWA 2FEWB 5HRCA 3T54A 2BI7A 3D6VA 1V39A 2AVNA 2HQSA 4J16C 1OE0A 4G01B 4R2IA 2YXLA 4D41A 2BVNA 2IMWP 5KYNA 4IRKA 2AOUB 3IJPA 1E2NA 3MB5A 5C8XA 6GPBA 1ENYA 4M7OA 1U2DC 3UXEA 5E4JA 3RB6A 2FCRA 2CLMB 3JQ6A 4GD3Q 3MGGA 4IGFA 1LWNA 2CUKA 5KNBH 1NXPA 2Z30A 2IRWA 2OXEA 1KEWA 1LB2B 3W7VA 2YNMA 3SF8B 3FTEA 2AV6A 1P4JA 1DEOA 2PXCA 1IN4A 3MXTA 4DNQA 2JGEA 3KKQA 4W9MC 4DA8A 1A50B 4GL2A 1DAIA 3N86A 2WKRA 4PAOA 4E5MA 4HNUA 5IHPA 4R05A 3I8OA 3I9JA 3SQWA 2PYIA 3OG9A 3ZWOA 1GFWA 1ML3A 3AG5A 4OQXA 2NO9A 4M89A 3GRRA 4CEIA 5HF6A 4F97A 9ICIA 4JU8A 4F2PA 1I3MA 2HA0A 3D8SA 4LDJA 4LQCA 4FD2A 5I4CA 2AXQA 2H0AA 4BFTA 3ORHA 1P17A 3ZHQA 5FLEX 3MRXA 1LNQA 4DJDC 3VR1A 1H8HA 5LLSA 2R1TB 2H00A 2J3EA 4LGMA 2AF4C 2YY6A 4LNUB 4PN7A 1YS6A 2XB8A 5FTNA 4I50F 2HZ7A 3ZJUA 2VQEB 1U45A 3WV5A 1SUAA 3TFSA 3AFNA 2A1TR 5HR5A 4RQ2A 4JI6B 1KR2A 2I7DA 2ENWA 3R6LA 3G2QA 4OAOA 3EA5A 5IN4A 1EKXA 3IT2A 3ZWQA 1WKVA 4YX9A 2R1UA 2X76A 3PXEA 3OF3A 2JANA 4KLLA 3W78A 2W2QA 1BPDA 1OAOA 1A04A 4P3XA 1QHIA 2F9LA 5K7SA 3MD0A 3NVKI 4B48A 1YIAA 1FFUA 2FEPA 3MCAA 1LLDA 4CMEC 3G8YA 4GDMA 3QH4A 1K8QA 2C20A 1ZN7A 3N75A 1P2SA 1VGQA 5EWLB 3OBBA 3UB4A 2P90A 2G7MC 1EXDA 1MG5A 1FFGA 3U09A 4TX1A 1Q6YA 3EEYA 4BGIA 1VLMA 3OEED 2P3QA 1KBZA 1SGGA 4FFBA 4W7HA 1W85B 4YUWA 5B55A 4LZOA 4HWSA 1VL1A 1SB9A 4X66B 3I42A 2PRYA 4D4JA 3H2KA 4UTOA 3GFFA 3H13A 4W9RA 4IHJB 2BGIA 3CVXA 3OIFA 3P0HA 4WZAB 4ESEA 3I6YA 1NBIA 4DW8A 2UZ1A 3GG2A 3ZQJA 4MRNA 4NCXA 4FINA 1FFXB 4BNJA 3JD3A 2YV3A 1KDPA 3U3RA 4EY4A 5K3BA 4AXBA 4MR7A 1WDLA 1WQ3A 4RJKA 3RJEA 4CM9D 4DS5A 721PA 4KFUA 3HP7A 3F4LA 3AY3A 5I51A 3SXUB 3C7CB 4TV9B 2VCYA 4NH4A 3AK4A 4NPAA 3JYHA 4FD3A 2QP9X 2WTEA 4DNOA 4X9XA 3UH0A 1ZVJA 5AVQA 4ER7A 2Q9CA 3CLSD 1JWBB 1ISHA 3FOZA 3ETDA 1T3ZA 1T9HA 1GUAA 4C4SA 1R10A 2QTTA 5C4MA 3E3AA 5A4IS 4NLBA 3VZDA 3A3YA 1NQVA 1G8JA 4TXNA 4A27A 3N2GB 2OFFA 3M9MB 1RAIA 2YFKA 1SURA 3KVYA 3BS4A 1W75A 1HE4A 2Q0SA 3DTVB 5KG3A 4RGBA 2YHSA 2XYHA 8ICGA 1Z83A 4N0EA 2Z2IA 1I2BA 4W7SA 1JR2A 5DQGA 3NHJA 2VK1A 8OHMA 1MX5A 4QGBA 4DF4A 3T3GA 2REBA 4HAIA 1V1RB 1TKDA 1EXMA 4M87A 4KXFB 1HM5A 1L5SA 4J0DA 3V7WA 2ZIXA 1TL7C 1ZDMA 2C5EA 3BGSA 2ES4A 4GQBA 3MMSA 1DFIA 1Z3EB 4JROA 3T3EA 3L0ZA 4LF8B 1SV0A 3DYVA 3Q98A 2MJLA 2ISSD 1KRXA 1ZVMA 5EZ6B 4EZEA 1TM5E 5BW6B 3RD5A 2GBCA 5FXMA 5IT5A 1D7OA 1NUQA 2ZSFA 4DQDA 4B81A 5U4XA 2A58A 4C2AA 1GTMA 3VC7A 4K6GA 4RDCA 2RRDA 4FEAA 1QLJA 4YT2A 4KQ9A 2WAAA 4Y6LA 3ZKAA 4TTTS 4RV5A 5FUWA 1H5NA 1Z29A 2DSTA 5FORA 1XL1A 1KRHA 2OC4A 1L4FA 8ICRA 3JD1A 4R40A 3COVA 3GVXA 3Q4GA 1R6XA 2G5HB 4AZ0B 4FLFA 4DQLA 4ZT4A 5AVSA 3RAJA 4IBOA 3IPXA 2AZXA 3E18A 4C4RA 4M9LA 1T24A 4MRMA 1QIMA 4WESB 3JWIA 1KI1A 3K9QO 4ZDKA 1KI4A 5PGMA 4PFKA 5DM70 3HUDA 1ZL0A 2OWDA 1NDHA 1UKVY 3D64A 4F3RA 2I03A 3V4PB 2VANA 4YMHA 2SICE 3BMCA 3IMGA 4UTVA 4Q4CA 1MV5A 2WTXA 3COJA 2WIGA 5FWYA 5LZ8A 3ZLUA 3I1IA 1PLKA 4Q4LA 3H65A 2Q1WA 2FQWA 4QICA 1VA4A 1JJAA 2Z1DA 3B7PA 2V7BA 2K60A 4WVLA 4EPRA 4LK3A 2XRFA 1YKFA 3R9KA 1N7JA 4QUHA 2RC6A 2KNJA 1NV9A 4EHDA 2NUPA 1EXVA 2ZUDA 3ZXYA 1H94A 3CONA 4QECA 4OPMA 4URYR 4XD2A 2C4VA 3K9HA 2V65A 4QBHA 2YIVX 1YB4A 2J6CA 2YRWA 3AL3A 1U7DA 3A4MA 4JLVA 3ZD8A 4LJ9A 1Z82A 2DQZA 2HREA 3SQLA 2RJNA 4PINA 3TQSA 4ZCMA 3GQBA 1VA5A 4PL2A 3DWIA 1YZYA 4KU4A 1J8QA 5HJ5A 5FDFA 3O38A 3GJXC 1YMVA 4Q1BA 1TEHA 3IE1A 5K8UA 3WYEA 4NZPA 1BCRA 3I04M 5JRDS 1YHYA 2EKBA 4J2OA 5ALIA 3T94A 1WZ2A 5A4KA 2QMYA 5NULA 3IAS1 1T43A 4DNFA 4WASA 1V11A 1UXOA 4X20A 4WECA 4NYMQ 3LPDA 4CCWA 1J23A 1NI5A 2I2AA 1W46A 4PX9A 2C1ZA 1WDTA 1UKYA 3ETCA 4J9SA 4P82A 3PVZA 3UATA 3DE4X 3T5HA 4RTSA 4BB0A 1BMTA 2ZTEA 3I92A 4MI6A 4MINA 2ZI6A 2J87A 3S28A 5A9SB 2G5TA 2J9GA 1KFEB 3RDPA 3OKPA 1PNQA 1QZZA 2HF8A 1H9BA 2C7VA 2HV9A 3ZU4A 3OKAA 3B1FA 2VA3A 3ZGOA 2AK3A 3RJ9A 2GRUA 4F0JA 4W9NA 5ALFA 1JJIA 3CW9A 4EA6A 2Q7OE 4L8GA 5G0WA 2CF5A 3QP9A 2IOFA 4C2BA 3H9UA 5IAJA 1UPFA 2EDUA 1U2TA 1SXPA 4XQGA 1JHOA 2H2FA 3V42A 4WXMA 4R8UA 1BDIA 2ZP1A 4H31A 2P6MA 3PGKA 2MDTA 2PZKA 1W36B 3T3NA 4Z7QB 1R0RE 2C61A 1QTQA 2H2IA 2A9QA 2X7XA 2B20A 2DLCX 4NCBA 4YFVA 4IL6U 2Z9CA 4YAFA 3HN2A 2NN3C 1G6OA 4OQMA 5DBIA 2BHNA 2QLJA 3HW8A 1LF5A 2LD4A 5DB4A 4NCHA 2VXCA 4TZ6A 3S2FA 5HIIA 3A6EA 4IQ8A 3V7JA 1UC5B 1K3UB 5BT9A 3PHLA 2KEYA 5ALXA 4IJUA 4KWCA 3DEEA 1VBMA 2WT9A 3ERCA 3BMQA 4OATA 2ZVQX 5LIRA 1EZ1A 1LZKA 5JNTA 3DV9A 3ZUGA 2Y68A 3IHQB 1CY1A 5EWMA 1L5HA 3UHFA 2B0CA 3PX0A 3QENA 4YMOA 5DDMA 4RPKA 1Q1BA 4C7YA 2KW5A 3OHSX 1CERA 4QSHA 1ZAYA 1JMSA 2LRHA 4MJ3A 4GZMA 1P60A 4ZEXA 3SS7X 2A88A 2O1XA 4TYYA 3QNUA 3VR0A 4GP9A 5I9NA 1AHNA 1JXQA 4WGGA 4DUPA 1D0VA 1AZLA 2XDYA 4OJMX 4I1SA 3L5KA 1E94E 4PPFA 1YD7A 5FULA 1NW8A 2NYRA 4BJHB 4RM2A 2D4AA 4JYBA 4IQUA 5CT4A 1DCKA 4KN5A 3QBJA 1KJQA 2AFIE 4BO8A 2ZUTA 2C8LA 2FXIA 4OEHA 1IU9A 1WHSA 2E5LB 2JA1A 1DE0A 1G4HA 4BAZA 3VX3A 5I3ZA 3FPHA 5JLAA 1YB5A 2Q8QA 3SIXA 2JV3A 5GZ6A 1BRTA 4IIJA 1NMQA 1E18A 3L7DA 1GA6A 2B35A 2G9VA 3JQPA 3AM9A 3V8EA 4KC0A 1X80A 2JGKA 1U98A 2EZ9A 4BLTA 2YXNA 4RQUA 2QBYB 5IYZB 2R60A 4HWKA 4P0QA 5KTMA 3QXJA 1FP4A 3O4VA 3R7WB 4R3UC 4GVXA 3MOIA 1Z0SA 4BNIA 3KAJA 5DNDA 3TLKA 1K6MA 3D81A 4G89A 4DT1A 5AK3A 3AEYA 3IN5A 3M6AA 2OZKA 4FB4A 2KTQA 4E2FA 1L4HA 1XQVA 3L46A 3HBFA 7ICTA 2VEOA 1SPBS 3WQQA 4TVSA 3RKRA 3OH8A 4OMCA 3LC1O 1PR4A 5C37A 4G37A 1CLUA 2HIMA 5DSZA 2B94A 3PWSA 2E4YA 2PSFA 5DIFA 4Q5IA 4DYHA 1EGMB 4X7PA 1GG8A 1S8FA 3EXAA 1E32A 2CLOB 3D4OA 1HX7A 1M34E 4IHQA 1UJMA 2LCFA 4O5OA 2A19A 2P2YA 4KPGA 4AYTA 4MUFA 3SEFA 4C3VA 2ZRHA 4BLVA 2PT9A 3VU9B 1GM5A 2YZMA 5DG9A 4UBMA 4PBRA 1VRWA 2P0EA 1WZUA 1ZQNA 2IL1A 4IHJF 4ZN6A 4GXJA 2UVVA 2X0DA 1GPJA 1DAFA 2HA5A 4AJHA 1SGWA 1TMYA 5AJUA 4OXKA 2Y93A 1OWNA 4C0HA 4YALA 4LXTA 3C74A 2HBJA 3IB6A 3GH1A 5DLQC 1WCIA 4U9HS 2FPPA 3DB2A 5SY9A 1P7YA 2EZTA 2VRNA 4ZZ0A 1SKRA 2QZJA 4MUEA 1PQ4A 4C0XA 1ZISA 1P73A 2W8LA 4AF8A 2IUFA 5FYQA 1CUBA 1KI2A 2IX9A 2OCBA 4C6SA 2BFMA 4RVFA 4ALLA 1IB6A 5T4HA 1WOMA 2D74A 4DAOA 2YJ3A 1Q5PA 3QF4B 2GJ8A 5JD5A 3C6XA 4FP9A 5DASA 1I7LA 2WHXA 5L95A 3M4JA 5T57A 4MKIA 4F84A 4ZKDA 2YHBA 3IVMA 5ESXA 3CR7A 4LY9A 2ZE7A 4OP1A 3P5SA 4H7DA 4F4DA 4LDAA 1ZC4A 4H6WA 2QAGC 4BHTA 1P5FA 4G9GA 2WWTA 3TE7A 4BUGA 1TCBA 3K96A 4LVNA 3O8OA 1Z0UA 2VJMA 3M8SA 4A6PA 2K4HA 1M1NB 1JZTA 3RO7A 5IZCC 3ILVA 4DXHA 1QAOA 2QTGA 4D42A 2OV2A 4MWDA 3HJFA 5L3QA 3NTVA 1O7JA 4UHDA 5BNTA 1N3IA 1T9GS 1N9GB 3SU8A 2EFEB 2WAMA 4N40A 1HT1E 1GXSB 3LRTA 4LG1A 5EHNA 4WZBA 1IC6A 3A6FA 4EK9A 3ECAA 3UMSA 4HTFA 2Z8YA 3PC7A 2HUPA 2H3HA 4L07A 3EVNA 1C7QA 3B3JA 2A7XA 3GDOA 4F5RA 5DRYA 3DFIA 4YDRA 3OPVA 1EXNA 2R9VA 3PNQA 4M1SA 1JDBB 2QE6A 1D0IA 5HKOA 5DHRA 2WZQA 1AURA 2Z6QA 4IOMA 5BMVB 5ALNA 1FX0B 3QY0A 1M8GA 5KNIA 3FY4A 3AKEA 1OC4A 1NF8A 3KJNA 3EYZA 1JEYA 1N32B 2PX3A 2BEVB 2O2DA 3S29A 1U2DA 3U3DA 2A4MA 2NAPA 3THXB 3KT3A 4LJKA 3IURA 4MW1A 4US9A 5SYMA 5DHQA 3AO0B 2JF0A 1FYWA 4ZDJA 1TZBA 3VGPA 3KTAA 1PNOA 2O8EB 4K6OA 4LHWA 3TLGB 4F04A 1FW6A 1E79A 2P8JA 4Q0MA 3H83A 2LYHA 2XJ9A 1HXHA 2Q7XA 4FW8A 1ODFA 2QP3A 3DOEA 3ZI0A 4EBCA 1VE7A 1YB2A 1GTJ1 1H6BA 3TB4A 3I6ZA 3G5MA 2VP9A 3OWHA 1AQYA 2C5FA 3LGSA 3D8UA 4CIYA 3SZ2A 2Z5GA 2VHCA 4ZQEA 2L2QA 2B21A 1SHZA 4AF6A 1S77D 3E1SA 3WLKX 2V3CC 1U1IA 1C14A 5BY2A 1KEUA 4DBLE 2GCIA 3FDFA 5LFAA 3T99A 4R1UA 3ALRA 3ETGA 4GQAA 1U8ZA 4BFWA 1TAGA 1NQXA 4A26A 2PT6A 4KMMA 4A0HA 1J2EA 3S1AB 1ORWA 5B3JC 2QDXA 2PWYA 3OCJA 3B3AA 4UU8A 2XUPA 3GYGA 3L06A 3RUIA 4PPYA 1RM5A 2VPQA 5I4BA 1NJFA 1E7MA 3R5SA 5DB6A 5E38A 5IAOA 3R0IA 2IH2A 2O3TA 4RTKA 4BNUA 3F7MA 2I6QA 1E2UA 3D43A 1ZQSA 2QKYA 2V55B 4I5DA 4QUDA 4E88A 3GCXA 2G5CA 2ORWA 5HEKA 1UBFA 5DFAA 5KBYA 3GLIA 2BQRA 4DV6B 1DUSA 1U94A 2X22A 1VSVA 1TKCA 1CY7A 4RU9A 5KNCH 1Z56C 2OXRA 4PHHA 1VB5A 1DCFA 2AG6A 2DWPA 4YRIA 1CJCA 2FRXA 2VCHA 5GP1A 2GTIA 4CMEA 4EY3A 4YLGA 2QTFA 4GBMA 3LE8A 2FW7A 3BEOA 1ZWLA 1J2JA 4GOMD 1S4MA 2ZIWB 2VJYA 3OJSA 3VDNB 8ICBA 3FN4A 2H2WA 4CG1A 1GUFA 4EB8A 1HLFA 1UDRA 1KPIA 4DCJA 8ICXA 2OEHA 4NFSA 4CTMA 4OFZA 2MTBA 3GDGA 3S99A 1VLHA 3VYRB 3OQVA 3S4YA 3SY8A 1G21A 3DONA 5CG1A 5KFQA 1ONBA 4YIKA 3LKDA 1HTBA 2APJA 1NW3A 4XYBA 1P1FA 2VHTA 4LVCA 4BBAA 2QD5A 3CUUA 3HJNA 2WNIA 3V4FA 8ICKA 3AONB 4XXHA 2HY7A 4AK9A 5BN1A 3W5DA 4BX8A 2VTBA 3PDCA 3R9XA 1NVFA 5AM0A 1T9ZA 1YCGA 2EJVA 2HXGA 2O2CA 1YF3A 4RPZA 4FNMA 2ZRJA 2GK4A 3EUAA 4MQEB 5H3LA 5JD3A 5DMXA 1KFDA 4I55A 3NALA 3OPNA 3GVHA 4YJ2B 5FFFA 2W7PA 1GFZA 4XRRA 2HF9A 4LJSA 5EJMA 3LUDA 1M6HA 4C8NA 1T5SA 3W2GA 3Q8XB 2Q0ZX 2H1HA 1FNCA 1ZLYA 3MZ0A 3NM4A 4LWOA 3B1KA 2ZSDA 2DWQA 1FUKA 4D74A 4WK6A 4CKYA 2IELA 4OQLA 9ICLA 7ICUA 4RHFA 4GKBA 1BXZA 2PSEA 1ZQPA 4NATA 2PUTA 2OMKA 3JR3A 2G67A 2IBMA 5JECA 2AQHA 3H0EA 1QQTA 1T3LA 4UUMA 3GBVA 3USES 3CR3C 2ISQA 4MVJH 3NORA 2R8GA 4RL6A 4JKIA 4S2EA 1CF9A 2F6RA 1DEXA 5HR6A 3IG8A 4XM1A 3DL0A 4DIUA 2QLNA 4FWBA 2ONYA 4UB4A 5J4LA 1KEEB 5H59A 1M6NA 3QKWA 4QZGA 3U1TA 3FPFA 4HFNA 2W54A 3IYLW 3COYA 1R4MA 2ZTDA 5IKEA 3RSHA 4UAGA 2R6R1 5FNVA 5IYZF 2YXDA 4UAUA 3EG9B 3GEPA 4ZXPA 1SOAA 1RRGA 3NHAA 4X62B 4FHCA 3MCZA 5EERA 4FCTA 1WSAA 3SZLA 3L7MA 1H2HA 3GCDA 2I87A 3BWVA 1RYDA 2JZBA 1J1ZA 5DOVA 1ED1A 5LP1A 3WBJA 3A2NA 4XDYA 3UB2A 5AOVA 1XKTA 4BNYA 1MAVA 4JH0A 1JIXA 3GZ4A 3VH2A 1DJLA 1EM8A 3WXBA 1O6GA 2WF9A 1D04A 2AMJA 2HA3A 2ZS7A 4R65A 3BTUA 3SLKA 5DSTA 2UZAA 2GWHA 2RKBA 1QS0A 2NRTA 1ZVQA 2QPOA 2Z7JA 2NYVA 1VIVA 1T0JB 1N34B 1QQAA 1WMSA 2WVAA 1O54A 1IHXA 2OV4A 3NU1A 1CUYA 1WZIA 1YACA 1UZNA 3D8HA 3MB8A 4N6NA 4CF3A 5BQXA 2CLDX 3U7HB 2E87A 2W8BB 1YE3A 3OOEA 1PZHA 3N2ZB 2GJKA 4BDSA 4D82A 3F74A 3K92A 3FTPA 2D2EA 1RZ3A 1EINA 2XXAB 1Z2AA 1NRXA 1VL2A 2WT4A 2Y67A 1PJCA 1AA9A 5KSPA 4YXWD 3IDSA 1TQDA 5BSMA 2JASA 4NYMR 5LB4A 1ZXBA 2GDJA 2PGJA 1Q0TA 1EG2A 5JTUA 1A4XA 3L7AA 3JPWA 2V4UA 1KHHA 4TKUA 2BFEA 4OJ6A 4HVTA 1UDWA 2GLTA 4TOIA 2REQB 4WXRA 2YY5A 1KL9A 4DL5A 3RC8A 3KQWA 1EE1A 1PK3A 3EGIA 3COZA 1G64A 2KV2A 3VCBA 2DWOA 5MN4A 4DSIA 4ZV7A 5MFPA 3A58B 1E8NA 1MN8A 2OHXA 3SZ3A 1YQEA 3GDWA 4K81B 4MEXA 4BB6A 1ZQCA 1OZHA 4XQ9A 4DUZB 3W5AA 3WYCA 4L8FA 1W87A 2ZWOA 3AKZA 2AKAB 2PR7A 2DPIA 4MR9B 4YRNA 2WHPA 1W5FA 2AKYA 2RG7A 4PVCA 4EY8A 4H6XA 5BSEA 2OWEA 2IYPA 2Y0PA 4TTJA 3LW8A 4UBJA 2VNJA 4LHSA 2QGNA 3FSGA 5EKUA 4MRSA 5KVSA 1V9SA 2Y2UA 2FXVA 4IIFA 3EXFB 2R8EA 1J8MF 4QIWF 2KQUA 5FCDA 3OHAA 1H4VB 3D6HA 2A9OA 5B66U 2WP0A 3WFZA 2F17A 3C41J 3NBYC 1ZBQA 3O2QB 3PSFA 4KYTA 4HX2A 1KW4A 2J0UB 1Z1VA 3UV7A 3D7NA 1C1XB 1I6KA 4WHMA 4GGPA 1UMDA 1NW6A 3GV7B 4C89A 1Z4PX 1MB3A 3R4CA 4D9CA 5DVZA 2QA5A 4DQVA 3AVVA 3ZZ1A 3V34A 1WMAA 3D0KA 3DOCA 1D9ZA 1YRLA 3UXOA 4WY2A 5JTIA 4RVUA 1DBRA 5EHQA 5FHRA 3X1XA 4O0MA 3HGMA 4CF7A 4YP6A 2J5QA 4ZI2A 3MK31 1GJRA 2OXOA 2HHUA 4MROA 4GPEA 3CNOA 3VJLA 3NT5A 3FGZA 2AQKA 3NCHA 4QHTA 1D9XA 3P9RA 2VDMB 4TL8A 2G36A 1YCFA 2PGDA 3DF7A 2WWYA 2GOLA 1U0NA 3ASVA 3F1KA 1AX9A 1I7QB 4KQHA 2VSNA 3AERB 5EPOA 4LY3A 1GEGA 5A0TA 4QD3A 4BFSA 1JFRA 1OROA 1QIIA 2A0UA 3J81A 3W1EA 3BWMA 3GZTB 2Z8YM 1J8DA 3EVFA 4L02A 3EZ6A 2TSYB 4NEGA 3DVSX 3AHCA 2QPTA 2Z6UA 4L1KA 2XH8A 2EFYA 3N05A 4D5EA 2VJ5A 2ECKA 1E0DA 3WWDA 4RK0A 4JWTA 2ZQYA 4PLPA 1CE8A 5IS2A 3PHGA 1YMUA 5E8RA 2YYAA 4HB2A 1EGQA 4YRPA 4CLHA 2PZ8A 1EX6A 3CMMA 3UA3A 1JZQA 5D00A 3L8DA 2VN8A 2WE8A 1GT91 4GI7A 2XTZA 5JJKA 2DKFA 1DAHA 3TAPA 1SU8A 3A7EA 4G5GA 3T0GA 4RKRA 1GGMA 3GAFA 3KHTA 4EPVA 1MRSA 1XLUA 1Q21A 2LPEA 1XA3A 2ZCVA 3B3FA 2YTZA 2N1RA 3WQBA 2WMNB 2A0WA 5IDYA 1SUEA 2IKSA 3WLMA 1A72A 2GPNA 5EE3A 2W2PA 1PR2A 2CHVA 2ZG6A 2W00A 4DS3A 4B7AA 4NNOA 4TZ0A 2BM9A 3C0KA 3REGA 3KK0A 5ALLA 2NUAB 2CMFA 3GAMA 3JYNA 4TVOA 3TZHA 4KZKA 4QNMA 5F1YA 4F9FA 1F4VA 3UUEA 4KRFA 3K4QA 1AUOA 4HGOA 4HNSA 1DQZA 2H4FA 3WLRA 3A6LA 4GVLA 3F90A 3HJRA 3W3AA 1UJBA 1GL9B 1XWWA 3EDOA 2AQIA 2RDMA 3VYUB 4L9WA 2HD4A 1EK6A 4MVJF 4OJKA 4Y98A 3C97A 1TV9A 3A4YA 3I4CA 2B78A 4BIMA 2P2SA 2HHVA 3CW8X 4LN1A 1B0ZA 5DHUA 1NMSA 1UMBA 3ZLBA 1OJLA 2IZ6A 3QVXA 4F12A 2W2LA 1VI5A 4BNFA 4YRGA 3V32A 2X9GA 3WYFA 4OU4A 3E81A 4COOA 2WSBA 2VK8A 2CDAA 2GD2A 2PKXA 3QHPA 3JU3A 4X1YB 4C0SA 2C4NA 2ATEA 4FYVA 2CD7A 1FFWA 1ILEA 2IBTA 2X3FA 1IMJA 3ISBA 3STHA 1RHKA 2BP7B 1N33B 2AG8A 2OOSA 4OI4A 3W9UA 2WM8A 3USZA 3NHSA 3CLUD 2QM0A 4Q02A 5K0ZA 1F4LA 1LBIA 2PS9A 5GQSA 3OTWA 1C8LA 2R5FA 3C3KA 2WW8A 4PICA 1U0EA 1XWIA 1TJ3A 3ZIUA 1L4BA 1F2UB 5KYXB 3VPDA 3M3PA 2MT9A 5M2QA 3AHFA 5C7YA 7ICIA 2Q5FA 1FFCA 3LWMA 2O3JA 2B92A 1H6AA 2B1GA 1ZGGA 1Z8FA 2BFAA 1M5TA 3LUBA 1S2GA 4BWYA 1P4GA 1L5FA 5E4YA 3TTYA 1BU8A 1A2QA 2I7TA 4D9BA 1Y3CE 2LUOA 1JPNA 4EF5A 2J5XA 4KI0A 5CFZA 5DGTA 4O4LA 5TMBA 1XZDA 2IYSA 3WYDA 4C08A 4W8OA 5M29A 4KE6A 5BQFA 2AW5A 4YJ2F 4BKPA 3RSLA 3IMFA 4I36A 4PSKA 1GCOA 2B99A 1NBEA 2VQ6A 4GPD1 3T1HB 1YS1X 3DBRA 2AD5A 3ROTA 3BIOA 4HTAA 4REOA 4B3CA 2Y05A 2HTFA 4HAYA 1WCNA 1K89A 2PKEA 3GGPA 4XIJA 3N3BC 1A6SA 1EFUA 1RWBA 3Q9SA 3STVA 2PZBA 3AVTA 4WOCA 3DNPA 5C7LO 2QAGA 1NI3A 4JLSA 4RE6A 4F3CA 4WD3A 4G0XA 2IHBA 4BAGA 3G13A 1T3SA 4BO5A 4IUBS 2CBXA 4Q3KA 4IKPA 3B9RA 4YCXA 4GLXA 5IZCA 1V3QE 3IMCA 4JCCA 1U5BA 2G40A 2QQFA 3HJGA 3B6JA 3ASZA 4RYDA 2B8JA 3FSRA 4JC0A 2XQKA 1KZ7B 4DUGD 2H4WA 3CLRD 3ZDZB 1HR0B 2A0XA 1MIOA 4LYJA 2HHSA 4G5OA 4IDQA 4BV9A 16PKA 3KWMA 3VZCA 3R0JA 2WUEA 2VDVE 1RHQA 1YQTA 1G5IA 1LVHA 4PG6A 4PG4A 3UXHA 2OOKA 2OFXA 3N07A 1F8GA 5E4TA 1CYEA 4ITRC 3OM8A 2UVPB 4PU0A 3IUBA 1IZYA 2VRCA 2JJQA 3JQGA 4MPJA 4XDHA 3OOHA 1LBSA 2RHGB 2FMQA 3P20A 4KVZA 3TEMA 3OEEA 4QO7A 1ZW1A 1EVLA 3LM8A 1ZONA 4WXHA 4UHKA 1E2DA 1ZHFA 3UENA 1FNBA 2VDLB 4DA0A 2PRIA 3GIKA 2BJHA 4B9SA 2D0DA 4H7IA 1COKA 4IW3B 4GBED 3L18A 4DTIA 3Q5EA 2F8MA 3G02A 1BYUA 4XGKA 2GN9A 2JHDA 4ID9A 4EYGA 3NHYA 2HCBA 3OQ6A 4EMSA 1BCSB 1PUIA 3W77A 4GLBA 4EL5A 3LBFA 3OQHA 4FXOA 2WWGA 3RVQA 2DR2A 4W5HA 1ECLA 3KKLA 1QZTA 3GLIE 2GYWA 4X0EA 3A11A 5A5EA 1EHIA 3PX7A 1SUWA 1DLJA 5CLFA 5CTAA 4QPDA 1XZ8A 1CNMA 1UEIA 1DKUA 4BU1A 1UPBA 4QPCA 1NVVR 4INAA 3EK2A 2X19A 1NBAA 3RYCA 3Q3HA 4W5RA 4BMZA 2VHVA 1M2FA 2RHTA 4B3HA 1RZUA 4UUQA 2O59A 4FYPA 2GRAA 1F9AA 2EERA 4QRHA 3O9ZA 2DJIA 4YO8A 1EFCA 1YFZA 3TSCA 3GHYA 1VCNA 5FT9A 3HCBA 4UEOA 4Q7QA 1R5JA 2PQMA 4AP6A 2VBGA 4HNGA 4Z4IA 3HXLA 2PBRA 4HDQB 5B3JA 5A1JA 3MDAA 2VT7A 1Q15A 3HM2A 2JGRA 2ON6A 1RWKA 1THGA 5AM1A 1Q83A 3I5MA 1KOLA 4G0OA 1NZJA 2W2MA 1TVKA 4QPJC 2C2DA 4WKNA 2NTNA 2P6OA 1V9LA 2B0JA 1EP3B 1PGPA 1KN5A 1NONA 5JDIC 1JMKC 1MOSA 4DDHA 3JZIA 3WWCA 4LMRA 1X8KA 3IIJA 7GPBA 3HKEA 3JALB 1BDMA 3G8BA 4R51A 3P0FA 2R86A 3CB2A 3SN6A 2QHXA 4X8OA 3A06A 3FPKA 1YS2X 1RXYA 2W6ZA 2AJ8A 3LPMA 4M0EA 3IVAA 3RCBA 1Z68A 5J2AA 3RRJA 2PS3A 2BMVA 1V5EA 1CIJA 1HTWA 3HFGA 3D4IA 3LKVA 2Q5HA 5IMBA 3VC8A 3SQMA 3ENQA 3GIJA 1Z37A 3BMNA 2IU4A 3EOAI 3FBTA 2A2ZA 4PFSA 5DNUA 2O2HA 3O83A 4J7XA 3I62A 2KS6A 3WE7A 4DL3A 1VXOA 2OM2A 1VHQA 4Y1RB 4M37A 1LKYA 1Q0LA 5JXHA 3V6LA 3T5MA 4JYPA 3OO0A 3DBHB 3PRHA 4CGYA 3MGKA 3TZQA 4EI7A 3Q5DA 4Y6RA 2ECOA 2FW6A 4Y2RA 4U02A 2C57A 4JYCA 2BT4A 8ICQA 5B64A 2X15A 2M0NA 1ITZA 3DOUA 4RFLA 5EHZA 4BJ6A 5CA0A 1FNSA 3NRBA 1XRQA 8ICPA 1NVMB 3ED1A 1O57A 1XP8A 2IOYA 5CB4F 4RPYA 3F49S 4B6FA 4FHZA 3DE5X 4OLHA 3EPJA 4MYUA 4MLCA 3SP1A 3K71B 1MJ5A 5HKAA 3FPJA 4YUAA 4KGZA 1HOTA 1GT6A 2H7VA 1TU4A 1JH9A 4GBJA 4FOLA 1Z5OA 3BDPA 1TDJA 3I4LA 3CR8A 8ICNA 2OCDA 4E6EA 2G1KA 2OZVA 5LJLA 3B60A 1HLGA 3OTOB 2EZ4A 2LW7A 3FE2A 1QPGA 2C97A 1JL3A 1BPBA 1GQOA 4Z3KA 4L28A 3CEHA 1RQ7A 3B78A 3MMNA 2XTMA 1NLMA 4M8NE 1L1EA 1WL8A 4MB6A 4L8VA 1RQLA 4CLEA 5LR6A 4N48A 1E5XA 5FI3A 3LZDA 3KUKA 1IXSB 2P9EA 4PHFA 5BN4A 3BL5A 4CU5A 2OCKA 2P79A 4E13A 1GO3F 2VOJA 3AEZA 1U1GA 1QVWA 3KSZO 5AJXA 3UJDA 4DIOA 2W55A 5I9BA 4TVKA 2RCYA 2CFRA 2Y1FA 2G7ZA 1M2VB 3B6MA 1Y3AA 3LF1A 2P41A 4DA9A 5BPHA 1KFKB 3FBGA 2O7QA 4FT4A 4MFFA 1FSZA 1N6LA 1YDWA 3NR2A 2P35A 2D2IA 2P9TA 2YX1A 3WNVA 1SOWA 4DLLA 2PNJA 4LJRA 1EVYA 2XQGA 1ESEA 3NAGA 2GEDA 4J03A 1CR1A 4YN3A 1Z4QA 1N0IA 4BCCA 1MV8A 3BRSA 4NOJA 5ADUS 3ORYA 1UMKA 3VTAA 2C7QA 2ETVA 1MW9X 4P5PA 4TTSA 4AZTA 3P0RA 1PHPA 3ZTWA 1S6YA 3KSMA 1R74A 3UJPA 4EA9A 1ID8A 2XC9A 2CHEA 3JQAB 1E92A 1AB5A 2G1UA 4UB3A 2HBMA 4EFNA 3D8TA 2Y1CA 3DR3A 3ZH9B 3O8NA 2W2TA 4JOCA 1G98A 3QE9Y 1N1MA 2O3RA 1SBYA 5IJAA 3NFRA 4G0QA 4WW0A 5TARA 4X85A 5KFXA 1RD4A 3QYJA 2R1VB 3L7JA 3COWA 3RAQA 1C7FA 4Q6WA 1LLCA 5EIFA 4X65B 3ISCA 1E60A 4Q3AA 4ECZA 4M0CA 3R8FA 2VA8A 4JC8A 2FW1A 1GGEA 3MRVA 4MNTA 3H0CA 1UPAA 3LUJA 3Q8SB 1N2IA 3F5SA 2Z9DA 4LDRA 1J5EB 4R64A 1PDWA 4MYRA 4RNDB 4EZBA 1IRXA 3BZKA 4TN5A 3LCVB 3IGFA 4HZUA 4IDNA 2A5DA 1JU3A 1FMLA 3AI2A 3U44A 4TXHA 1H4SA 4LOKA 1Q77A 3U16A 4K6FA 1RS0A 2DRIA 2CD9A 3EXG2 3QLTA 3JWGA 1QCZA 4MA4A 2H8GA 3TBFA 4HAZA 4P86A 4GEKA 1H2WA 3HA5A 1PNRA 4KXMA 1ZQTA 3HEAA 2XUIA 4GPIB 2QRVB 5E7MA 1W0KA 1HQKA 4EF4A 5JO0A 1I3LA 1NK4A