1L8OA

Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 42
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8oA01
1Z4JA 4J2TA 1ZRNA 5AI0A 4C4RA 3QX7A 3L1UA 3QU9A 3W5AA 5ALYA 4KN8A 1TJ4A 4UMFA 1U02A 2C8LA 3QU4A 5AKHA 4YIHA 2YJ6A 1N8NA 3ZVLA 3I76A 2OA0A 5IT0A 1Z4OA 3VAYA 1U7OA 1T9ZA 1QQ5A 2B82A 4RESA 1QQ6A 3FPBA 1WVIA 3UMGA 3NALA 5AVSA 3CZ4A 3AR5A 4Y2VA 4UMVA 3U7FB 1T5SA 4UAUA 2MU1A 1MH9A 4UARA 4HGRA 4YIKA 2BDEA 5AVQA 3S6JA 3PGLA 2YJ3A 3ZI4A 1WPGA 4BX2A 4DCCA 5ALWA 1RLTA 5AK5A 3NRJA 1ZRMA 3L0CA 3QYPA 1L7OA 5ALZA 3A3YA 2YJ4A 1Z4PX 5AM5A 3OCXA 1RLOA 2P69A 5IT4A 2WF6A 3AR9A 4FYPA 2PQ0A 3FPSA 4Y2XA 2YMQA 3WKAA 3AR2A 1ZD2P 4CNQA 3ZW7A 2B0CA 4Y2SA 4I9FA 3BWVA 4UMDA 3QLEA 5AKKA 2IOFA 3HLTA 3WKDA 4FFDA 2YY6A 3PGVA 4Y2TA 2JARA 3L8EA 2CFRA 1XVIA 5ALHA 2GMWA 1X42A 1RMYA 1XP5A 1VJ5A 2Q4RA 4EZEA 4YGYA 3B8EA 3WKCA 3ZVNA 5AESA 2HX1A 5ALPA 3NAMA 3I6BA 3U7HB 1LVHA 2C88A 3QUQA 1T5TA 4L6CA 2BDUA 3UM9A 3E58A 1SU4A 3W5BA 5AKGA 4PNHA 4YCNA 3AR4A 1RLMA 3QU2A 1ZD4A 3U7GA 3E81A 4KX5A 2QYHA 1Y8AA 2B30A 2B8EA 1Z4QA 3ET5A 4BBJA 3M1YA 3IJ5A 3W5CA 4UMEA 4C4SA 4IG4A 5AM2A 3E8MA 2HSZA 1L7PA 2I33A 3PDWA 2CFTA 4KNVA 5FP0A 3K1ZA 2EATA 5AW9A 2C8KA 1YNSA 2B8JA 2I34A 2RARA 2YJ5A 2AMYA 3ZUPA 4DWOA 4MWOA 3L8HA 2IOFK 4L6AA 5ALVA 2ZBFA 5AK4A 3L0BA 2O2XA 2FUEA 3U13A 3ZVMA 1VFPA 3EF1A 2WF5A 3WKEA 2JAUA 2EARA 3ZX4A 3WK5A 1KYTA 5AKJA 2WFAA 4NAVA 2HI0A 5ALLA 2D2VA 4AS3A 5AVXA 3B9RA 4J03A 3WGUA 4UASA 1VJRA 2FDRA 1Z4KA 4YH1A 1S8OA 5AW1A 2P9JA 1L7NA 2I6XA 5ALIA 5AI5A 1LTQA 4OFZA 3R4CA 3OTQA 3FM9A 4BEWA 4JB3A 1Z4NA 5ALDA 5ALJA 2YFYA 4KYTA 3PCTA 2HOQA 5AW0A 2W11A 2HEGA 3KC2A 3NUQA 2EAUA 4YCMA 3MC1A 5AW4A 1NF2A 4HGQA 2DQSA 5AKYA 2GHTA 4XQ0A 2FPRA 1RC8A 2R8XA 3MN1A 3OCZA 1RMQA 5ALUA 3RFUA 2I55A 5ALQA 1RDFA 4KX3A 4QQFA 2AH5A 2R8EA 4UU1A 4HYTA 4BEVA 4RETA 2GHQA 4HGNA 3FVVA 3OPXA 5AK3A 4UAVA 3QU5A 5JJBA 4BNDA 3DV9A 3ZWDA 3ED5A 1RKUA 4BX3A 1WZCA 5AKXA 3SF0A 1YS9A 3ZX5A 4IFTA 4B6JA 4Y3UA 4NFLA 1JUDA 5AK6A 2WHEA 3WK4A 4EX7A 2ODAA 3U19A 2C4NA 4L57A 3RF6A 5A3QA 1ZS9A 2OYCA 3ZTWA 1J97A 2JAWA 4JDPA 1CQZA 3SKYA 3KBBA 4H1WA 3WK9A 2YMLA 2NO4A 4EX6A 1TA0A 3L1VA 3N1UA 4CE6A 3QU7A 3IRUA 3L8FA 4UATA 1PW5A 2G80A 4NV0A 4OD0A 3SD7A 3QUCA 2HO4A 2CFSA 1Z88A 3M9LA 3BA6A 1WR8A 2W43A 3ESRA 3SMVA 2MSNA 3ESQA 3QXGA 5AKEA 3U7EB 2PKEA 5ALMA 4OCZA 3SHQA 4EENA 3U26A 3QGMA 2FI1A 2IOHA 2FEAA 2B1QA 2RB5A 2JAOA 3UMCA 3A1EA 1YV9A 1TE2A 1ZOLA 2FUCA 2P11A 4Y2PA 5AVYA 2ZOSA 2YBDA 5AVWA 3ET4A 3CNHA 3L0YA 3TLMA 1QH9A 4CF4A 1L7MA 5AVVA 1SWVA 5AW6A 2R8YA 4CF5A 4EEKA 5AVZA 2OBBA 1K1EA 1NNLA 3FGOA 1U7PA 2QLTA 1U2SA 2Q5EA 3E84A 4BKMA 3L5KA 3OCWA 4ZEXA 5AVRA 5ALSA 3IB6A 2G07A 3N5KA 4HAIA 1CR6A 2HF7A 1QQ7A 3NANA 2AGVA 5ALFA 5AI9A 4F71A 3ONNA 3SKXA 4ZEWA 1IWOA 2C9MA 1RMTA 5ALXA 5AKIA 2VKQA 4ZEVA 2FPSA 3WK7A 5ALRA 1Q91A 2FPXA 2R8ZA 5E0OA 4XOUA 4E88A 3UMBA 3AR8A 3J7TA 1AQ6A 5AM3A 4XPZA 4I9GA 5ALNA 4BYGA 1Z4LA 2ZBEA 2P27A 4NABA 3D6JA 3NASA 2PR7A 4BNDB 2W4MA 3OCVA 4F72A 1Z5UA 2I54A 4AP9A 3EF0A 2WM8A 3N8GA 1YJ5A 1XPJA 1RPZA 2Q4TA 2WF8A 1QYIA 2ZBGA 5AHXA 2YMMA 2ZG6A 3AR3A 4UM5A 1RQNA 2GFHA 3GYGA 4FE3A 3W5DA 3KZXA 1SWWA 3AR6A 3R9KA 3EPRA 3HYCA 1Z4MA 5AM0A 1RKQA 2RBKA 4NWIA 4Y2YA 2YN4A 3F9RA 5ALTA 1L8LA 4Y2QA 3DDHA 3L7YA 1YMQA 3B9BA 3N28A 4UU0A 2BY4A 4MUMA 4OHFA 2RAVA 2IA5A 3ZTYA 3ZWKA 5AW7A 5AI6A 5A3RA 4KNWA 5AW3A 3R09A 1F5SA 4CF3A 5AIAA 5AICA 3I1YA 3KDPA 5AW5A 5AIBA 5AM4A 3DAOA 2HHLA 2G1AA 3I28A 3OCYA 1O03A 3WK6A 1EK2A 3MPOA 3SLRA 3L8GA 3NIWA 1Q92A 3EWIA 2I7DA 2B1RA 3FZQA 4GIBA 2G06A 1S2OA 4O8CA 1Z4IA 4QJBA 3KD3A 4BX0A 3AR7A 2WF9A 2G0AA 2HDOA 3QUTA 3ZU6A 3WGVA 4YCLA 4EELA 2JGAA 1EK1A 3A1DA 4UM7A 5ALEA 4XE5A 4Y2UA 2O9JA 5AVUA 2HCFA 4Y2RA 3WKBA 5AI8A 3WK8A 1U2TA 1L6RA 3OCUA 1YDFA 5ALGA 2NO5A 2AUTA 2OM6A 2GO7A 3QUBA 2X4DA 1L8OA 4HGOA 2FPWA 1RKVA 4C4TA 2G08A 2FPUA 5AI4A 5AKLA 1RQLA 1TJ5A 2IYEA 3DNPA 5ALOA 4DFDA 5AM1A 4G9BA 4UW9A 5A3SA 3A1CA 5AKZA 1TJ3A 2ZBDA 4AS2A 1FEZA 1NRWA 5AW2A 3QNMA 4Y2JA 2YMPA 1J8DA 1Z5GA 1O08A 3P96A 4GXTA 2G09A 1N9KA 2WF7A 1ZD3A 2CN1A 1ZD5A 5T41A 1ZJJA 5ALKA 3KOOA 5IS2A 5AW8A 3MMZA 3N07A 2HF2A 1RRCA 2ZXEA 5AVTA 4G63A 4DW8A 2NYVA 4HGPA
chains in the Genus database with same CATH superfamily
4FLFA 3ONFA 1UDXA 4K9NA 2DFTA 1KR2A 1RD4A 3U4AA 2FKNA 3KHSA 4CM5A 2H9AA 1K3UB 4NHOA 4PSCA 1AGRA 2WIBA 3TZQA 2PV7A 2VCEA 3I58A 4RADA 1K86A 2IY9A 2Q29A 2AVDA 2JBHA 3G2QA 3SQNA 3PHGA 4JA2A 1N8NA 1TECE 6YASA 5CR0A 2WWFA 3WU2U 2XUIA 3W79A 1OV4A 3ESAA 4P81A 4HEQA 5EOZA 4MIEA 3KUKA 3VMMA 4UDNA 1YB6A 1T15A 2GNOA 3RKSA 2IUEA 9ICUA 4OA5A 1QZUA 4YQYA 1E1MA 4UMVA 5CT5A 3K0AA 3PW4A 1KKXA 4ILEA 5IN4A 1YMUA 2ZJ5A 3DUWA 3CVJA 3C5HA 3QEKA 2FMFA 4LDJA 1N5IA 4FMDB 4PM4A 3TOVA 1R66A 1XQXA 1K9VF 1MH9A 1L9KA 1L1QA 1U11A 1TO1E 2ETXA 2GTHA 3B7WA 2BFDA 1AX9A 2IP1A 2C2RA 2L19A 3BILA 3SY8A 2BFCB 4LYGA 2YJ3A 3WL7A 3WWOA 2Y1XA 3BMQB 1U8UA 3K4HA 3NBMA 4BMZA 4CMHA 1H1TA 4EVIA 2CV1A 3QVKA 4OSEA 1MQ3A 2GLUA 1JKFA 4MOWA 1N63A 3O26A 1NVBA 5I6DA 2F9LA 2QENA 4LPKA 1QF7A 2JBWA 1ZJNA 4Q05A 1VG8A 4YAOA 4EHHA 2OCLA 3DZIA 2DPJA 1GGVA 1WPRA 3BM5A 3OCXA 3OETA 3P9ZA 4MQEA 3FOEC 5CK5A 3E0XA 1WA5A 4S1WA 4OKIA 1NF3A 4BJ5A 3SXUA 4P7KA 5IC6A 3IDWA 2JS7A 1SK8A 2QORA 4QUBA 3NGDA 3K16A 3OPYI 2H2AA 1ZD2P 3JWHA 1SCJA 1GGKA 4JJEA 4U6QA 1JN0A 1XE3A 3DW1X 2FB9A 4K9QA 5ITZA 3BWVA 1WWVA 5YASA 2W9XA 4EJSA 2CFIA 1S89A 3SEAA 9MHTA 4RQ3A 4A2PA 4Y2TA 4LOHA 1AOXA 3PFCA 3V2UA 3L8EA 4RKWA 1Z2NX 3QPBA 2ZE5A 1LPAB 2CDBA 1IQRA 1Y9EA 1DGSA 3A9UA 3LIIA 3CBGA 4MI9A 4RNCA 4B3CA 4HVCA 3VISA 3RS8A 4B40A 4PYOA 3CGGA 4MRAA 2E8NA 3L6BA 1BH2A 4G0OA 1T26A 5EPUA 4GI2A 3UW3A 4CM4B 1DKPA 4O4LB 3BD7A 3KD2A 4JWKA 4MR7A 3SHOA 1OXSC 3AFOA 2R85A 4FOTA 4RD0A 4GD3Q 3UWDA 3PO5A 5KEIA 3O82A 1KEPA 1YVPA 4L2IA 5CH3A 1ZYUA 1JBEA 3OM0A 3PI7A 4N5LA 5JAZA 2E87A 2GN1A 2IHNA 4E22A 2V0GA 1ECGA 2Z5FA 1HDOA 4I5EA 5A1JA 3HVRA 1ZNWA 4R41A 4CTKA 4URYR 1Z7BA 3QU2A 5H3HA 5KQGA 1O89A 4TWIA 1CFJA 1AZWA 1YRHA 1Q3KA 3D0KA 4RDHA 4L5AA 4L16A 1TVEA 1ZD4A 3FAZA 3VI3B 8OHMA 5JI3E 5JSQA 1PO7A 2ZK7A 2AHOB 2VATA 2IDMA 2WSYB 4M37A 1W4LA 3GIIA 1QYDA 2JH7A 1XIVA 2WUEA 4KSYA 4QUJA 5JH7A 3FX2A 4D46A 5LJIA 2P9QA 1JECA 3VH1A 3TECE 3N70A 4RD4A 5ITVA 3MCTA 2AN3A 1IXZA 1IAQA 1X1QA 2G25A 1IE3A 3JVDA 2XOEA 1CJSA 1QIKA 3R6GA 1RWOA 3LUHA 4JP1A 4MJXA 2EVWX 1BC5A 1YCDA 3HDJA 1VPTA 4B3MB 1JP7A 2CFTA 5LP6F 1BG6A 4JVMA 5G53C 1P0IA 1K4KA 4F2SA 1BX3A 4J0EA 4J6FA 4C21A 4MVJI 1XJ5A 4Z5XA 2UZAA 2CY0A 4QPNA 3BTUA 1NE7A 2PGXA 3ZI7A 2OAEA 3RF9A 3RR7A 2IHJA 1NMXA 2KE7A 3EQ8A 4RWZA 4TVBA 5KDLA 1QVAA 2HK6A 1FYVA 2A78A 4HUQB 4UE2A 5J5VA 1I4TD 1QWSA 1UP7A 1EGMB 4RQNA 9ICKA 1W5SA 3RYIA 5HS6A 4E1AA 1VFPA 3GH1A 2VXBA 3WJ2A 1N6LA 4KO1S 1G21B 3MRXA 4O9MA 1PJ2A 5ICCA 3OBBA 1I6WA 1VMDA 2BD0A 3EFOB 5JMTA 1G7SA 2V55B 4JY7A 1XPRA 1G41A 1GXSB 3N53A 4OQPA 3EJ6A 2ZJ3A 3TCKA 1U0GA 1G2OA 4I2IA 2DHDA 4QATA 1JXAA 1PGQA 4CWAA 2KMDA 4DR3B 3D8NA 1AM4D 3SAGA 1PUXA 2QW8A 5HJ2A 3ZDAA 1SBIA 4WCFA 5KYVA 5H82A 3QUAA 3D1VA 1JG2A 4LNAA 4WMLA 5HX7A 5L7WA 4GLFA 4O5OA 5L45A 1I5OA 3D4OA 4JV1A 3MJEA 1W0CA 2ZT6A 1CPYA 1WUIS 2V7GA 4WOPA 4A82A 2YRXA 5JY6A 2F00A 5BP7A 2JI9A 5KOIA 3JYHA 2IZ7A 2RMKA 1GTL1 4P92A 4WL0A 2BHRA 3S1AB 3M9MB 3UK1A 3ZOZA 3T5LA 2VDJA 2KWIA 1T5IA 3M33A 4QWMA 3OIGA 2VNSA 4TV8A 1ISMA 2QAGB 2WNIA 3V4SA 4YRRA 4GNRA 4BU0A 2FWAA 4QAJA 4ENTA 2ZEJA 3H1TA 4HNGA 3QKSB 2B2XA 4M0MA 9ICLA 4RHCA 5C4IA 1BGVA 1D7AA 1CNMA 1VL6A 3ORHA 4MB0A 4PR0A 4ZODA 4J3FA 3SZ3A 2DKFA 4Q4AA 1ADBA 2ZAGA 2F44A 3Q7EA 4YHHB 5GTIU 4MP8A 4PS0A 2IWHA 3HYLA 1K9SA 5KNDA 2HBLA 1FQJA 3QPAA 4RMGA 4DCVA 5KQLA 5DMHA 1CS0A 4KX3A 4ZV7A 3LY8A 4WN3A 3BVPA 3H19A 1KMCA 4GBGA 3EVEA 3ODPA 1JHAA 5GV8A 4IL5A 5EE5B 4HGNA 1PNVA 3O9MA 4IQ4A 1ZQWA 2R84A 4CI9A 2NRXA 4XAQA 4ED0A 4FDUA 4PXYA 1B4FA 5KFKA 1TK8A 4HQ0A 3ZGLA 5JCOC 1N0UA 1RKUA 2QMYA 3P45A 4NV3A 5CT4A 4GRIA 5AKXA 1T13A 3CYFA 4F2PA 4YRIA 4QBKA 2ZIGA 5J0YA 2W04A 2V5AA 1H4SA 1JE0A 3DKIA 3H97A 3QG1A 5THQA 4BKRA 1ZH8A 3EDMA 1CEYA 1V6CA 3M4YA 1JQ3A 4JWMA 2H18A 4YBZA 3HO1A 2J08A 1TYEB 1ZL0A 2ZAYA 4CQMD 3C3CA 2QEQA 3VR2A 4OLAA 1VSQA 5CNJA 2ZZNA 4C7KA 3TOXA 4ENRA 2A86A 1C0IA 3RS4A 3B5EA 1VE7A 1G5FA 3H4VA 5F1OA 5B6IA 4MQUA 2PJUA 1E58A 3TOSA 3CFYA 3PTZA 3KKMA 1Z0KA 3NEAA 2A88A 2ONCA 2W2PA 2FFRA 1IN7A 3PLNA 2VLIA 1FY2A 4D98A 5HGXA 4EO9A 2VTEA 3OKFA 2H6EA 3CLUC 3EDRA 5FXMA 1XLTC 4JC4A 3L8FA 9ATCA 1AGPA 1GV1A 1HYBA 4P54A 1Z22A 2C83A 3GD7A 3NV9A 4NZYA 3CVUA 5HVNA 5REQA 2J0EA 3CPEA 4AG3A 1N6HA 2LV8A 4P6VF 4OPMA 3PFFA 3PF9A 3T5KA 4E07A 5IFKA 5J2AA 1G19A 2V7EA 1T1IA 3EXIA 1KO4A 3NVAA 2Y76A 1ZQFA 4DQVA 4LJ6A 4RVGA 1NLUA 1DL5A 3B2QA 3RYTC 3X1MA 1X7XB 4UAJA 4EENA 1H6DA 1FFAA 3DJYA 4QWCA 3MWKA 1XZ8A 1CULC 4YJ2A 2ZWPA 3HFJA 4ECYA 5D2CA 1JNXX 1OBHA 3L05A 1WXHA 3TADA 3ENNA 3NONA 1D2AA 1RYUA 2DTXA 4PHDA 3KWLA 3Q2KA 2ERXA 4YAFA 2F1OA 5FFMA 2P90A 5TF4A 4RT2A 1FRFS 2OFPA 3FB4A 3GGGA 3JVVA 3MJCA 2QUAA 3N75A 3BWMA 4CLOB 3KR2A 1EUYA 1T29A 3L49A 4CF4A 5BMVF 3TOZA 2R1TA 4GR5A 2R5WA 1UOOA 4PJ0U 3WAKA 1XDSA 4MHSA 1N0HA 2VZ0A 2DETA 1JKMA 1R37A 1JHXA 4FW9A 2VAMA 1CUAA 3CJTA 4A1OA 3PSAA 4QM7A 1RLJA 4KLJA 1DINA 4X9XA 4DQSA 2ZSIA 1DXHA 1JEYA 1GYQA 3E0QA 1PTJA 3PZPA 1JZSA 1N3LA 3BB3A 3I5MA 5J2TF 2V6JA 1E7RA 2GDZA 4DLEA 1R8QA 2WIFA 3ZN2A 3SYNA 4BKMA 4LDZA 1H05A 5T8KA 4EFMA 5JXWA 4KMRA 1WF3A 1GAEO 2PRSA 4WN9B 2GM5A 1JAXA 3OJLA 1DC4A 3EEOA 2AXTU 3PC2A 3E70C 2P4EA 4ZOCA 5BV2P 3NANA 2WY2D 1RLUA 5M04A 3QVUA 3OZVA 5FCDA 5P21A 4YP0A 3ONNA 2DR0A 1BMTA 4MARA 4BTLA 3V6LA 1OIXA 1U3FA 2OECA 3W5UA 1R0RE 4QYIA 3WNBA 4EPXA 2ZFUA 2W8ZA 2Y1FA 4IYRA 3GI1A 3GPDG 4GO1A 1QKKA 4M4SA 1T8PA 1YK1A 1AQIA 1JLLB 5JAHA 5JW6A 4N41A 2WD7A 4M9UA 3CZMA 5LXTB 2D6FA 4X8HA 2JCXA 1Q7BA 3SOPA 4MW6A 2VHWA 4C04A 5TPWA 3U7IA 4YJFA 4AROA 3O8BA 1FW6A 2FE1A 2YQ4A 4YN3A 4IGIA 3EK2A 3OY7A 3L8YA 4AMUA 1JPVA 1T1JA 4IJ6A 1ZQYA 1A72A 1B6SA 4ZU6X 1US8A 3SXPA 2F8SA 1ZUIA 3ASYA 1Y9ZA 2QAGC 1PL7A 1YZFA 2ZJYA 3ELUA 4PAGA 4XB2A 3O94A 1LDMA 3VUFA 2II6A 3TZLA 4KGVA 1RXCA 1J0DA 2P7HA 2HJVA 3QIVA 4FD2A 4KXFB 4ENPA 2HK9A 5KTNA 3N8GA 2E82A 4OFWA 1RZUA 1KFJB 4RHTA 4XIJA 1OLOA 1ULBA 2NNLD 2DAPA 4J07A 4M0DA 1MH1A 1A2QA 1G2IA 2OD2A 4JSYA 4ZOLB 1G8YA 2PG3A 2ZJ7A 1VL1A 2QVGA 4CZ2A 2FUG1 1QQTA 2E89A 4NNPA 4NARA 3E05A 1VLLA 1XZCA 3QBDA 4BAGA 4ER6A 4DA4A 5F9FA 4MQMA 2CBZA 2OGUA 9ICNA 1F2TA 4Z7NB 1V11A 3NVWA 1XHFA 1HUZA 1TXGA 4PZYA 3QKRB 2DUWA 1LDGA 4P3XA 1X9SA 1FDVA 4GZLA 2IZ1A 3H9GA 4WKCA 1ODTC 5T4EA 3DDHA 2FSFA 5EXPA 1OH8A 3LW8A 3AERA 4QHSA 5DGIA 5KFUA 1AB6A 5BN4B 2D7JA 2I4TA 4DREA 3A1TA 3VC3A 3EZ9A 5FHQA 2QRKA 1YCHA 2QBYB 2K5UA 1Z6QA 2WHXA 3ODGA 4QLOA 2KQUA 1XLUA 4KNWA 5KJ1A 3R7FA 1PZMA 1UPAA 3FTFA 5BOLA 4YACA 1KQGA 3QI2A 4KIJA 3GUHA 4GFDA 5EQJB 5FWYB 1IHDA 3M81A 5KYYB 1B76A 1C3OB 1SD1A 4JOBA 2Z3ZA 5I48A 2R2GA 3MINB 1MUUA 5ARBA 3CTMA 2NXWA 1BJTA 2BGMA 2QS9A 3G49A 4YXFA 5HXAA 4DV7B 2PKQO 2XPCA 3PE6A 3H9QA 4DLSA 1EGVB 2GILA 5IBPA 2DPLA 3EG5A 3STHA 1O4WA 1ZEJA 2Z30A 4L95C 4ZQCB 5IW8A 1MV5A 4DSKA 5LIPA 4A8PA 2G06A 1N9GA 1QVWA 4PYKA 3K73O 2A35A 2EDUA 4H0FA 1NN5A 5CYGA 2BSAA 3ZCSA 2JAPA 1KL9A 1DRGA 2WF9A 5BQFA 2G88A 4HFJA 4MIKA 4WLVA 1FFXB 3ZU6A 1T4MA 2JGDA 1SVMA 4FZNA 1ZD9A 5CP2A 4YQFA 5KNDH 4W5OA 4CMJA 2BZ1A 1GDDA 1X80A 4M60A 1SOMA 3PCXA 3PR5B 1YD7A 2ET6A 4Q1FA 4Y2UA 3FZEA 1X70A 2O9JA 3AVOA 5K9ZA 1ZG3A 5LOVA 3V6HA 2I2BA 4BTEA 4NS4A 1AQLA 1RWPA 2VJNA 2GAAA 1KYQA 4TLEA 4A1FA 2NTYC 2V6IA 3BWDD 3OEYA 1EXNA 4BNFA 2NVUB 1C9NA 1CG6A 3DDCA 3PDJA 3BYZA 5FPYA 3ZV4A 2QV0A 1OI2A 4CF7A 4U63A 3LWDA 5C37A 1L6RA 4KQCA 1YR8A 1JPNA 5JAIA 3H4DA 4Q6WA 4O4JA 3KALA 1CKEA 4GICA 4Y7CA 3QZ8A 3M5PA 1R4NB 1SKMA 3N59A 4UJ3A 1UFRA 3FTCA 3G0CA 1OGJA 4MKXA 4MX8A 5DBIA 4COKA 3LMKA 4EY4A 2RK6A 3NVDA 2JFWA 1C4KA 3PD0A 2R8KA 3GRKA 3D7NA 1ISSA 2ZUSA 3LUPA 3QWHA 2X15A 1NVVQ 4E46A 3PVXA 3PCRB 4O2AA 5HTOA 3NOQA 4LXXA 3KS9A 2C3UA 5IAKA 2VJBA 4EKNB 5L95A 4G9BA 2OLJA 1ANKA 4DUGA 3K05A 5L8VA 1SBTA 2EFJA 4N6OA 3K9FC 1NXSA 1V95A 1ODKA 3P2EA 1PP4A 4PG5A 2E4AA 3WSWA 2AFIB 3SR6A 1WAMA 2A9KA 2YY7A 1YI1A 4HFRA 3ZVKA 2O8BB 4TWAA 1DHRA 5F9MA 2FUNB 4FS3A 4WI1A 1Q84A 4ATNA 1MP0A 1QO0A 1J9GA 2PTHA 1EX7A 4GP9A 4QZBA 3OLWA 3MNFA 1JDJA 5IKPA 3FWYA 3EC2A 4X93A 3QH4A 3C6KA 3FWPA 4JUAA 2AFHA 3VPAA 5I8WA 4PC2A 1OR8A 4D9MA 5KOHA 1LFDB 3H2KA 1PUZA 2XXBA 1J4AA 1A96A 1XNSA 4EBDA 2GJ9A 3OG9A 1XEAA 2B7BA 2F1JA 3DYIA 3ND8A 4LG1A 1PL8A 4PEVA 4MAAA 4DNOA 3SR3A 4C3VA 1SKYE 3N07A 3EPHA 3X43A 4G3IA 2ZSHA 1KI6B 3BIWA 4GOLD 4LY3A 4US0R 2AXPA 4B6EA 1JSZA 4EKIA 2CLDX 1XHEA 1MLDA 2I7XA 3PJGA 4BAUA 1D2HA 5DLYA 4E5VA 5GIOE 5HHTA 2C2HA 3BZKA 1UWLA 1U8XX 1E99A 1R15A 3P2KA 3ZGXA 3UQ2A 4ZMSA 5KQRA 2IUTA 3QX7A 3KKZA 5TQ2A 3OZXA 3WWEA 1WZ2A 5AHOA 3BDPA 3ZZ1A 3SX4A 2WC1A 2AB0A 3KHGA 5B3LA 5B6PA 3ZCRA 2AMLA 3D2BA 3S40A 4JXXA 2HUNA 1X3LA 1V16B 1SVWA 2IL1A 1ESNA 1HZJA 2WVAA 1JHDA 1QZZA 4GLOA 4IDNA 3ABOB 3Q98A 4W5JA 5FNZA 4AY6A 4AJOA 2BKUA 2BUBA 3KHTA 1GZSA 2O2DA 1E69A 1ABBA 3J81A 1TMGE 2B4RO 1AO0A 5EJIA 1SQ5A 1OXMA 1W96A 2FLVA 5HQTA 4BNDB 2ABWA 2DWCA 1UIMA 4QU5A 4BFCA 1MW9X 5I3ZA 4DV5B 4RZRA 2FZ4A 5L1MA 2JFUA 2X2PA 1SUPA 3JYOA 1WUKS 4MR8A 4EPRA 1HT3A 3HWRA 4WJLA 2C96A 1QK5A 2PMFA 4PSDA 1A98A 1FJ2A 2AG5A 1VLBA 2NVUA 3WA7A 1B6RA 1U45A 5BV8A 3IN5A 2FMHA 3BK1A 3WGYA 1PNQA 2VC2B 1CUSA 3BH7A 5FPPA 1MDBA 5TMDA 3PGLA 3ETCA 1LW7A 3G0GA 1S2NA 4AKIA 2PFSA 4QRHA 3RUEA 4BNJA 3F98A 3FTPA 1BTOA 2WE7A 5HBGA 4BVHA 2C8VA 1U0FA 1X80B 3RUFA 4NJMA 4ZI3A 1ZRMA 4ZK2A 5JROA 4EHNA 4GI3A 1AKUA 2XT6A 3SVLA 4NBWA 3V34A 1Z0UA 1Z4PX 2C2KA 3HPOA 1D1PA 5DF1A 4C4YA 1Z5NA 1NUQA 4U7HA 4DQ0A 4LHVA 2AX4A 5HHHA 1EUDB 2YV4A 5KFEA 5DULA 1IQ0A 3HO8A 1TKDA 3BXEA 3G8YA 3JR3A 4P35A 2KW5A 5KSPA 1QHSA 2HLPA 1OZHA 4LJ9A 5EKXA 3P5BA 3R76A 5KHAA 4BFSA 2XAUA 5ESDA 3AL0B 1JV2B 2JFHA 3ZI0A 3JS5A 4TMYA 4HL6A 3HJRA 4GC7A 3DCJA 1Q17A 1UMDA 4TYMA 3CRNA 4HRAA 5BWLA 1LRJA 1DEOA 3SWWA 2WW8A 4TURA 2JLXA 2OFOA 3UW1A 4MULA 2ROQA 2YY6A 1V9LA 2VCYA 1C1DA 3F3SA 3OPYA 4HBGA 4MW4A 2JARA 5HQ3B 2C9BA 5KYYA 5HDQA 2PXHA 3AY6A 1U1DA 2A4KA 3O21A 4YP6A 3VYUB 1JAYA 3H9EO 3U3ZA 4YMMA 2GK7A 4IRKA 2JI7A 4ZO9A 1HSZA 2HIMA 1NG1A 1ENZA 4EZEA 4YRAA 2QBYA 1OE0A 1IXYA 2Y92A 4JMUA 3Q3VA 5JJLA 5CU7A 2CXYA 3VX3A 4D44A 4UXIA 4XZ3A 4NEQA 2QHXA 3KQNA 3UMYA 2VTBA 2YHIB 1WB6A 2EP7A 2BFEB 4US1R 4WT7A 2ORWA 4AWXA 5BW5A 1LVHA 1T3SA 1XA4A 3PZBA 4LTDA 2LBPA 4Y1EA 1JNYA 3ZEAA 4CL0A 4FN4A 1H23A 3EYZA 5IXSA 3UM9A 5KWEA 1KDTA 1FLDA 3E58A 3FUTA 3KZKA 4UBCA 1UC4B 4JASB 3EGOA 5E9QA 5AKGA 3PITA 1OJ7A 2K4MA 3D0OA 4TUSA 2I7VA 3AR4A 2XF2A 2W6JD 5FUWA 4MJ7A 2BBWA 5CX1A 3AF4A 2B36A 3E81A 4ZQIA 1ZGGA 2QD4A 4AJ4A 1O94A 3JQ8A 4FDAA 1M5RA 2Z6QA 1EESA 1PV2A 5TSDA 1OIWA 1ZQQA 5JS8A 2PT7A 1DJMA 3WGZA 4G9EA 4DR4B 3NM5A 4ONEA 1QGYA 5IAOA 1H1LB 3EEQA 4PG8A 1DI0A 4R65A 3ECAA 1MF7A 3G59A 3FB1A 5J0OA 4II3A 4M0CA 4J9PA 4RVDA 5F2OA 4JJFA 5T5QA 3TW4A 4AUEA 4R2HA 4WY5A 3V4ZA 1PZXA 2WR8A 4FP9A 1RYYA 1RQPA 3B53X 5CRIA 1NI4B 3ROTA 5J0SA 1JDZA 5G0VA 1U8ZA 1CRZA 1L4HA 1MOPA 1TQ4A 3CA8A 3LZDA 4QJ5A 3C4VA 4CGYA 2YWXA 3IP6A 1NHWA 4P4MA 2ON6A 1ILEA 1GFWA 3MMPA 2PFNA 1IBMB 4IZIA 5DB9A 1IRIA 1GG8A 4M9ZA 3STUA 1CB7A 1BWQA 1E79D 1RZTA 1EFPA 2HKIA 4OK3A 1KC1A 2ZSDA 1UQUA 4DS5A 3NJRA 4G56A 3VVCA 1KIAA 7AT1A 1AE1A 3C8ZA 1I7PA 2FUEA 2PL3A 1Y98A 1H8ED 3DO8A 2JNWA 1NKCA 3JAWB 3QFFA 4YRTA 2GS9A 4YP9A 2REOA 4FINA 3BQ9A 2BCSA 1XP8A 1F8XA 4P31A 3WJ7A 1P1KA 3ZWWA 5BPCA 3WZMA 2MMGA 2WF5A 4BNXA 2A19A 4G36A 1UBUS 2C2MA 2NTVA 2XMZA 3FETA 2VHTA 4WK6A 3M8KA 1X7ZB 3PC8C 4IUBS 1U3CA 2Q62A 2B3TA 4QZIA 1AKMA 1W5FA 1YE8A 2VOEA 2Y9PB 3PRYA 4N1AA 4KG7A 2AK3A 5ECWA 4TRNA 5HOQA 5JVDF 3HVIA 2UZ1B 3TGLA 3MFHA 5F98A 1GGFA 2LE0A 1T3ZA 3QNWA 2BH9A 4EF4A 1HR0B 3ADPA 3AY3A 4IQ8A 1E8NA 1W4BA 1Z4KA 2F17A 4KTTE 4MS3B 5HKOA 1L7VC 3T3NA 3KLPX 4DF8A 3WDKA 1EDDA 2TECE 1D6MA 2JJ2A 2QIPA 2JFQA 4WXYB 2NT3A 1RWNA 2IXGA 4QOSA 5KHLB 2QRZA 3B12A 4GXNA 1Q1EA 5HZMA 1CYEA 6GPBA 2EG5A 4KBFA 4TLLB 5KO2A 5IJXA 3JYPA 1CT9A 2R1ZA 3TBHA 5EINA 3F49S 1S2LA 2W93A 3KYIB 2FSVA 3ZNNA 1LQTA 4X3PA 2HEGA 4HSGA 2R6DA 1S96A 5IILA 3UMSA 5GJVC 2I5PO 3O90A 4C0LA 13PKA 3SENA 2FQYA 4ZHQA 1M7HA 2VHUA 3ZY6A 1NSFA 1O54A 2E8PA 2EHJA 3VYRB 2KM1A 2ZUFA 4PTLA 4OREX 3LSYA 3ZQ6A 1QE5A 1MA0A 4XQ0A 2WUFA 2DERA 4J9KA 1Q0SA 4XSVA 3DMPA 5A05A 4ZDKA 4L08A 1XWIA 1H6CA 1WUTA 2BTQB 1YBVA 1AUVA 5KYTA 1EVIA 1RPLA 1IMOA 4BZQA 3OJWA 4NCAA 3CONA 4PPYA 3ZZMA 4JC0A 1Q46A 1I7QB 5LD2B 4N82A 3MGKA 2H2HA 3DG9A 3VKFA 5SV2A 1LS6A 1X19A 1Q12A 4J8PA 1ZCBA 1WUHS 2BE7A 3I2YX 1ULAA 4OQZA 8ICUA 4JB8A 4G4SP 4RLQA 3RODA 1FFBA 4AJEA 5HKBA 2HSJA 4JQYA 1E3SA 1NLFA 1QQAA 1KOFA 1E8DA 2ODNA 2CUZA 1ND5A 1TADA 2Q28A 4RENA 4E5NA 2BGTA 5C7LO 1EBUA 2PPLA 1DTWB 3UGKA 1NC3A 3KXLA 3W4IA 5JQGA 5FADA 1YQXA 2PSHA 3KE8A 1M72A 3P2YA 4K9DA 4B6SA 4CVNA 4Q5IA 5DGTA 3GV8B 1WMDA 2ZUWA 4YRBA 2OGSA 1D9XA 3TKLA 2WEKA 3RVOA 1W7AA 1BD3A 2Z2JA 3OSNA 3EGVA 4G4IA 4IDHA 3DYBA 4MWEA 2IELA 4UEOA 4V02A 1UDCA 3K5HA 2OZPA 2P6MA 4JDPA 1S97A 1HUQA 1PJ4A 2DHQA 1IB6A 2RH8A 2UYOA 4KOAA 8GPBA 1C8BA 1P45A 2CWDA 3WK9A 3IODA 4LSMA 4OGFA 2QUHA 4HDRA 1WS6A 2FPGA 3GLUA 1ZGJA 4KHZA 4YRJA 1CY1A 7MHTA 4LE2A 2BUCA 3AK4A 4QXPA 5DTIA 3NDBB 2AJTA 1A5BB 5T3UA 3KJIA 5DRTA 2KNJA 5ER9A 3H0KA 5EEGA 3LCVB 1DIBA 1TIPA 1PBTA 2R65A 3MAGA 3HKDA 4RIIA 4ZCSA 4ES6A 5FF9A 2BN4A 3SGLA 2GBCA 4R98A 2ESEA 2WSSD 1H5QA 2YHBA 1JHPA 2NLOA 3W1WA 3ZWAA 1WOMA 4MGIR 4E1BA 5IZCA 2JAHA 1K4YA 1OTYA 3BMCB 4G5GA 3I1IA 1Q0RA 4QULA 3BXZA 2NPFA 3D3WA 5DWQA 2DX7A 3M1LA 5HKLA 3UMCA 4JBNA 4Q48A 5FWXA 5KKAA 1KIMA 4K9MA 1GRCA 2HLDD 4Q15A 4AJIA 4BQIA 4EGAA 3FHLA 1TKCA 3R6TA 3UWKA 3B13B 3N2KB 4RACA 5EVCA 4TTTS 1ADYA 4B3TB 4U2GA 1LQUA 2OP0A 4WOBA 3ANTA 4CT4B 5AVWA 1HOXA 3IHLA 4E0BA 3IAHA 4TN1A 2EW1A 5GV7A 4I2DA 5C31A 5EZYF 3VR2D 3HA7A 3KAJA 3KTAA 3D6NB 2YNMC 3HVUA 2JI4A 1WLYA 4ZCMA 1B93A 4WK2B 3ICQB 2I4MA 2C7RA 1L7MA 5AVVA 3P9RA 4P7JA 5TMBA 5LQUA 5GIPE 3Q8SB 4PPFA 2IDKA 1U98A 2ZT8A 4DYHA 2W2TA 1T9GS 4RQ0A 3AQEA 2CGEA 1UPTA 3ICCA 1MA7A 1CUZA 2OBBA 4RL4A 5ILQA 3UB3A 3PHBE 1J2YA 5LSAA 2BGWA 3MWLA 1FTWA 2Q5EA 4FMPA 4YXJA 1LPNA 1J8FA 1YHNA 1U80A 2JAQA 3PUIA 4NQRA 4RS3A 3OZAA 3SLGA 3L40A 4IIVA 1VJ0A 2OZEA 5KWSA 4QYSA 5J58A 3PA6A 5ALSA 1M8PA 1FX1A 2GZ1A 3NX4A 2EJVA 3DC2A 3QELB 4HXYA 4K7JA 1O6GA 2EWWA 3AG6A 3HZZA 1AZLA 4HY3A 3CEJA 4A0HA 3WXMA 2GJ8A 3QKUA 2B3DA 2VAVA 4DMLA 1JFFB 2V7VA 1FSZA 3CX6A 4M0LA 7ICOA 4WGFA 2V9ZA 3MJDA 4YRSA 4P32A 5CB0A 5CDYA 1RZ3A 3KLBA 3ZW9A 1N7HA 4DS3A 3NYQA 3Q8MA 4FCTA 1ECLA 4EO4A 3T3IA 4EG8A 3LF2A 2X5JO 1OVMA 3ISBA 2X13A 2BKXA 621PA 2XB2A 3ZIAD 4WKOA 1FXWF 1T9GR 3OPQA 2ILVA 4I1YA 4YK7A 1U7ZA 1OW5A 2VHZA 5CGZA 2BMFA 1ITZA 2QJFA 2GA8A 1Z37A 3T5GA 2I71A 2LWIA 3GRPA 3LTEA 2F8TA 1E92A 1XJCA 3CEMA 1XR3A 3BMNB 1Z8NA 4CR8A 2WJ6A 3NASA 1Y5RA 3BAZA 3IXLA 4CKYA 2O2YA 4G67A 2Y67A 1HORA 4P7BA 5C18A 4JI2B 1NX9A 1XEFA 4IRCA 1ESMA 3RHFA 2GPWA 2BHSA 2D06A 1YOVB 4XOIA 4KLNA 3K92A 1YJ5A 4CPDA 5K4GA 3GP8A 1XPJA 2ODPA 1NYRA 3H0CA 2M32A 1BE1A 2X40A 3KTQA 1RKXA 3B52X 3D6UA 4JITA 4UM5A 3AR3A 5EP4A 2W6PA 1B6TA 2FK7A 2GFHA 3COYA 4RKFA 1M34A 3WMRA 1M67A 3IVGA 4DSFA 3BXFA 3DMTA 5I9NA 1AKEA 1YGPA 1XLWA 4QTTB 1JFSA 2RHRA 2PUFA 4EA7A 3FOCA 1EKXA 1GNLA 1AS3A 5IMBA 3ZWBA 2XTMA 4BTVA 5JZOA 5DISB 3GR6A 4G0QA 7YASA 3Q2OA 3ZV7A 3ZLTA 2P6PA 5CHEA 2W55A 3PSTA 2VJKA 1TK9A 3BPSA 4BATA 3NBXX 2GWRA 2QZ9A 3B9QA 4FCCA 3KB8A 3QLUA 3NW9A 1KMIY 2G71A 5K8VA 3ZWKA 2ZTDA 4OMCA 2Z1NA 1T2NA 3C7KA 1X7WA 2ZSKA 5AW7A 1ZOPA 2AI2A 2EKPA 2R8IA 5A5FA 2P9HA 3F2IA 1Z9BA 3H4TA 1IZ7A 1T2EA 1A3CA 1E5TA 5L1IA 1OYWA 2Y1KA 1RVV1 3DDSA 4WQMA 5K4HA 4C0JA 4G5SA 1WHSA 2OWOA 4B73A 5AW5A 1DKNA 4PIPA 3LY7A 4YA6A 2YH2A 4IY1A 3UZUA 1ST2A 3IB3A 1K06A 4X65B 5D49A 3N2KA 1ZWKA 2IPNA 2QDKA 4B7CA 4C80A 2J6BA 3NIWA 4E33A 4NE9A 1EFKA 4MITA 5PNTA 3GROA 4XJVA 1SHUX 4OIMA 1Q7RA 4PV7A 4CMEC 2CT8A 1O1YA 3N2EA 4L9WA 2A7XA 3FZQA 4CM8B 2O3RA 4V39A 3OQ1A 3SZGA 1JDTA 1PJBA 1W0KA 4KB5A 2IEGA 2QRVA 3LA6A 5JD3A 4Z4IA 5JE8A 1W6UA 2JHPA 1XXHE 1ZCFA 4FGWA 4ZJYA 2R8JA 1QOQB 1BKDR 3FUXA 4UDYX 1RWWA 2BM9A 3VRHA 1SXJE 1EG2A 5A0LA 1YVEI 3VTKA 4A8JA 4G0VA 2AR0A 1P5HA 2NSHA 2R6R1 1KS9A 4G85A 1N36B 1E59A 2G36A 4QW8A 3G2HA 3IUJA 3PNCA 3GARA 2FN3A 4RKQA 1YAHA 5AVUA 2ZETA 2HCFA 2FPGB 1EA7A 4ZYVA 2EAMA 1N0IA 2YXEA 2Z43A 1NVFA 2E5WA 2OXEA 5B5SA 1IVNA 2ZYTX 1SUIA 4XX0A 2A5JA 4DS4A 1ENOA 4D25A 4AULA 1D0SA 1QO7A 2HNKA 1S76D 3GMDA 1BGXT 1E3WB 3AYZB 3N0RA 1CY6A 4Q24A 4DF4A 3QOWA 4URHA 1WMBA 1LV5A 4B6QA 1T2CA 2QG4A 5JSFA 2PS3A 3V3TA 2VJQA 5BOSA 1AKYA 5D86A 3RADC 5LMZA 3OZIA 4FYWA 1LB2B 1PKEA 3W9BA 1OLUB 1MGPA 5JQGB 1G7RA 3FG9A 4KO4S 3ZWOA 5BWMA 1PR5A 4YV7A 5GZ3A 5DYIA 2IW3A 5FO0A 1S1MA 4BVJA 3UT6A 5TF0A 2CFOA 3D02A 3QJGA 7ICPA 3GFTA 4DMMA 4ZRMA 3AU2A 1X9HA 4KXUA 3G13A 4MS1A 1WQ3A 2ONKA 4L9SA 4UC0A 4HRYA 3S4YA 3JVEA 4UEQA 4CL8A 4RTQA 4PLHA 4D9FA 1B1CA 2AF4C 4ERXA 5JU6A 4G4JA 1VBMA 5ICFA 1EINA 1EGQA 1G5PA 1RJ9B 1VKRA 5HHIA 4DSIA 4BCDA 4D0NA 2ZSJA 4O2BF 2ID9A 2ZXHA 4F06A 2HHUA 2CLMB 3RE1A 4IIBA 4KOEC 2KK0A 4Y1RA 4ICIA 5T41A 4B5LA 3NOXA 4JT9A 4L15A 4EA6A 2QLFA 2HU5A 1SEPA 2J5QA 4ZHQB 4FB5A 5DB6A 2WB1F 2R97A 3RS7A 2J4CA 3OQJA 3IVXA 4TMZA 3AM9A 2CLEB 3GRVA 4DLWA 4C4RA 1WNTA 4KWTA 2JEGA 4HYEA 4JA0A 2TYSB 4Q4DA 1A6SA 4XIIA 4RPJA 5E4JA 5AYVA 4H1TA 5K8LA 4QZFA 2WILA 2ZBUA 5IJZA 5G0TA 1WYGA 1CJVC 1E61A 3E8XA 4KE7A 4B82A 2WKQA 5TPZD 3DP9A 4TKLA 4EAQA 3JD0A 1IIBA 2XGQA 1B00A 1DIGA 4J9NA 1U0HC 1L4YA 3LK7A 3UK6A 4AXBA 1HTBA 2O54A 1T9ZA 2GBLC 3V8BA 2ZVJA 3WICA 1KJZA 3BQ2A 1CK4A 2DECA 4DIKA 4F4KA 1WVIA 2P2CA 1LV7A 3D7MA 3G0HA 4MEAA 7ICIA 1E4VA 1VOTA 1Z17A 2Z4SA 2I4IA 3AR5A 3IILA 1TIKA 1BNCA 4GR4A 4LZJA 4DMFA 3U3DA 3AJ8A 1X7ZA 3LPMA 5F12A 9ICQA 2I8LA 4OJ5A 5DG8A 2HBMA 1FUEA 1HC7A 2AN9A 2VJ5A 4FYHA 1JKJA 4UARA 1ATIA 1D4FA 3I1FA 1V35A 4TLMB 4X8LA 5FNVF 3UGQA 3WLHA 3ZKAA 3K70B 1FYDA 3ABIA 1QE0A 4C07A 5A0VA 3VPXA 3L3FX 1UZAA 2C57A 3DH0A 4TV9B 2DUMA 3IUEA 1RC8A 1YS7A 3RYCB 5AK5A 1G3UA 1I4DD 1RI2A 2E0IA 2JANA 3HRHA 4GT1A 4OSOA 4B6FA 2NXEA 3CLRD 1TZ2A 2ZYAA 4GKBA 4TVOA 4YDRA 1HGXA 4U2CA 1GUBA 5B4VA 1SN7A 3BBLA 2YJ4A 2O8FA 1O6BA 4UUMA 2QSJA 2D00A 4QT4A 3OQIA 2A57A 1EA5A 4MKHA 1WZUA 1HFJA 2X4LA 4OJQA 3WX0A 4K6MA 3DAHA 5L9AA 1FSFA 4LDQA 5T4FA 2AMJA 2YN0A 3QXCA 4X44A 1NZJA 4WWHA 3SYMA 3W9YA 2OZLA 2CE7A 4G6ZA 5DSTA 1XU4A 4GPIB 3W2IA 5DLFA 3E1SA 1S8FA 1AXRA 2C04A 3AXTA 1W4RA 4REOA 1E62A 4C4XA 4HB0A 4K9KA 3O75A 3GVIA 4TMVA 1IK4A 3BMOB 2Q1WA 2ISPA 3EOAI 2GLEA 4NU0A 3WNCA 2PQ2A 1GGNA 4TXHA 4MQFA 1E66A 4EVRA 5ITSA 3LWLA 2VO1A 4AG6A 4BMSA 1NJZA 4MXDA 3FHJA 5I3CA 1RT9A 1XP5A 5CH5A 4MS4A 1NDQA 3FZGA 2IP2A 1BCRA 3MS4A 3OM8A 3AEKA 4OBXA 4ROSA 2DBRA 5GJWC 5AQ1A 5FOXA 4D4MA 5BSKA 1VDMA 3DQPA 4MEYA 5ICMA 2X7JA 3LDGA 4CHTA 3U56A 4UZEA 1Z2CA 3O9VA 2UVWA 1V1JA 2BFEA 2DUUA 4F9TA 1II8A 2C7OA 2XWJI 1NV9A 2C03A 1T5TA 3M49A 5EYPA 4NBUA 5K3DA 5FWYA 5ESRA 4W7HA 5KNCA 4RK6A 2XX3A 2HHSA 1R8XA 3A10A 3E3AA 4LHSA 2AHRA 1JLHA 3PDIA 4C29A 1ZGBA 4EEXA 1YR9A 1RE0A 3PX0A 3HRIA 4J7XA 4TMFA 3HBNA 4V1CI 5C8YA 3ORQA 4ZCLA 2VJDA 2XNDD 4BP9A 1A9RA 2OUIA 4F8EA 2ZB4A 5BSFA 1TM5E 4ZAXA 1QLNA 2HZ7A 2VNKA 3LL7A 4LSWA 4MW9A 5IBRA 1W88A 3GLGA 5GWXA 1A2OA 1NK7A 2QUKA 3B8HA 1WL8A 5CXSA 1TK0A 1OWOA 1CUGA 1YJAA 4EP1A 3ILYA 1MX5A 5H83A 1N92A 3TEFA 3RRNA 4ND6A 4UKDA 3DVAA 1QFJA 5DHFA 5K2MA 4KR9A 2LHTA 2GZ3A 2X0RA 3QEMB 3TCXB 4NI5A 1FS6A 5HUQA 3GEBA 5KOYA 4B80A 3CH6A 1FA9A 1W85A 4BCCA 3SYKA 5AW9A 4F4IA 4GE0A 1AGXA 1MV8A 1YNSA 5LQDA 4JQSA 5IKEA 3NTLA 3PLRA 3V6JA 4TRJA 1U5AA 4DYDA 3KKQA 3GCZA 4H4DA 1CUVA 4UCQA 3UXNA 3ROKA 2JGRA 3LA8A 1FOEB 3ALRA 2OGTA 2FSSA 5EY5B 3OQNA 5J63A 3EYWA 2XUOA 5J2TB 3DBHB 1UK8A 2G63A 2G1PA 1SVLA 4UAGA 4LX8A 3PYMA 5PGMA 2GKOA 3WK5A 2ZCJA 3NT4A 1D6SA 3TTWA 1Z5ZA 1WCLA 1NJSA 2CB9A 2Z3VA 1HX7A 5CTAA 5L1LA 3EXEB 3T7DA 3BSFA 2IEBA 1RQRA 1FSPA 2YQZA 2CNLA 1BFKA 2XB8A 4X7RA 3U61B 1VMAA 5J47A 4QOJA 3HR4A 1KDVA 4R1PA 4UE6A 2EZZA 3AUOA 3GFOA 1F17A 3X3HA 3A4NA 4KQJA 2QE7D 1VKHA 3WLPA 2JIZD 9ICRA 5KTTA 4ECSA 1SVNA 2B5VA 4KPFC 5C7IO 2WOOA 1I3LA 3QF4A 2NT4A 3T38A 4GQIA 2ALJA 3AHJA 4OOEA 1JMYA 4AYTA 1Q1AA 2UVRA 5J0PA 2W2OA 4LJ5A 1XHLA 1J0CA 3HRDD 4RHFA 4BWFB 1B8OA 1NNI1 2QLJA 2RCNA 3MAAC 5ALDA 2O14A 4QFMA 3A2KA 3RJIA 4OI2A 1T3TA 5LKAA 4NV1A 1MN8A 4XPIB 4QGSA 2H5IA 4O29A 1QM5A 1EDEA 3U80A 4JR2A 3W3AH 5SZJA 3DULA 1Y8QA 4MGKR 5AW4A 2VOJA 3PNPA 2KKVA 4NYMR 3T3DA 3RTBA 3UT5A 1FS4A 2DQSA 3RJMA 4D02A 2RBGA 2IHKA 3AGQA 2O52A 5DHQA 4CDRA 4U6SA 1E9VA 4R9SA 1Y8ZA 3GJ7A 1CS4C 3C3AA 3OWXA 4W5HA 5IJWA 4Y0AA 1MZPA 2JEFA 1BDMA 1GOTA 1EU1A 2O50A 2ONZA 5ENZA 2EDAA 2QSYA 4UB8U 1GRQA 2N1BA 5A0TA 2WINI 4QQFA 2J6TA 1RABA 3GP5A 3Q5EA 3HP1A 4B87A 3U1VA 4KRXA 3UXMA 3H17A 3HVKA 4PH5A 4H0NA 2GHQA 1QRUA 2EAOA 1CUJA 4BQSA 2KBFA 4UREA 1KQFA 1OH6A 5JASA 4NQZA 3Q3GE 4GPZA 3RM3A 4MUAA 4NC9A 3IUQA 3V6KA 1ABFA 2V6BA 4U5QA 3RCBA 3W8FA 1JQ5A 5AJHA 1A9SA 2IEZA 3JQAB 1X6JA 4BNKA 2OCDA 1VBFA 4KMMA 4ZVPA 3U3XA 1ZLXA 3ZX5A 4I6EA 2QX8A 1MOSA 2C2YA 4DL6A 2GXUA 1KZ4A 2N47A 4Y3UA 4O02B 1T4DA 3TLKA 5KTYA 4G0XA 5FAKA 5KWVA 2KSOA 5KFTA 2X41A 3L7MA 3IP3A 3KFUF 3I6QA 4L0DA 4MI6A 2DJ5A 4RJJA 5EQFA 2ODAA 5HRCA 3WRVA 4FBTA 1RWMA 5BQXA 4FGZA 4J9OA 2FSUA 4U7CA 2G82A 1FDTA 2ZAIA 5JDIC 4O0MA 3AC0A 5IIKA 1JDPA 1XZLA 1XZNA 2GPYA 2DLCX 4E5YA 3SQXA 3GNSA 5TQVA 2ACEA 2BZ0A 3QA3E 4ZAZA 2C7PA 3IMCA 2OMEA 4JODA 2Q41A 5HZGA 4BKQA 5ECGC 2OGZA 1KYZA 1TA0A 1IU9A 2I99A 3NH6A 1XUOA 3QU7A 3H0EA 1VMKA 1ZSNA 3AOEC 5LOVB 1SXJB 3D4IA 3L7IA 2YW9A 1YQEA 3MB5A 4TV9F 1KSPA 3VR6D 1PZNA 3KOYA 3GIJA 1NXQA 4M38A 4PVCA 4ED1A 2RDIA 4REQA 2PT9A 2RC5A 4AJJA 1XJ0A 1QHNA 2VDNB 5JCPA 2ZVPX 3LOPA 4YRNA 4O3QA 3OM9A 4IFIA 2PRIA 3KB6A 3DOIA 3IJEB 2CW5A 1I1HA 1QAOA 4L51A 3FNEA 5EZYB 1N6RA 2OKCA 3ICWA 4RV4A 3G6VA 1B7GO 1DHTA 5DIZA 2ZB8A 1AUPA 3B9PA 3F6BX 3JQ7A 4DXAA 4N8SA 5JAQA 2JH3A 2UZIR 4LGMA 2XH8A 1S3GA 1YQDA 4HB4A 5FWAA 4ZCTA 1I0IA 1A4UA 3OFSA 1YF3A 3Q6NA 2RHHA 3UT0A 1WSWA 4B3BA 1UCFA 5CJJA 2A33A 3NHBA 1QONA 4ED9A 3NVYA 2VDMB 1ZMTA 3BC1A 1A8UA 4QLBA 4ZV4A 4GMXA 1YBHA 4G4GA 4F50A 7ICSA 1QFSA 2HPHA 2ZRKA 3I6IA 3NLLA 2AEEA 4EEKA 4KWIA 3H5NA 5GONA 1R16A 2XMCA 3FGZA 4OXIA 4LJKA 3T9AA 3EVGA 3OKAA 4WDRA 1FTNA 4Q1BA 2QLTA 2FYTA 5EA2A 3IC5A 2UYQA 3F2BA 4HZIA 1L7AA 4TSRA 4ZHQF 1SUSA 3GBVA 1E9AA 1P5ZB 5AOAA 4M1TA 2D62A 4LNHA 4DLGA 2OHHA 3WLKX 1LBQA 3EMVA 4LI3X 4KPYA 3H5LA 4IOMA 3T61A 4RPYA 2J1LA 2JGLA 2ZR0A 1O4VA 3R6DA 1N1DA 1BWPA 5HBRA 2I2WA 3T7JA 3UHPA 4CKBB 1VHQA 2PRKA 4HN9A 4IMRA 1NIPA 2OCBA 3PXBA 1HE2A 1Y3AA 4E51A 2OWEA 2RONA 3WGGA 3WHIA 1V41E 1H4TA 2PMZC 2AYYA 1CE8B 1OYVA 1G4AE 1WV1A 2G9QA 1SL2A 3KPYA 2NZ8A 2RAUA 4GNKA 4QECA 4R1LA 4QWWA 3LBFA 3GJTA 3CQ9A 4Z8XA 2ZUTA 2ATLA 2ZUCA 4WUTA 3LV8A 3ZWNA 1NUHA 1SUEA 5EE9A 1S0NA 3ONVA 5DH9A 3W1VA 1XTKA 1KFTA 1CERA 2PMBA 4JSTA 4Q4HA 2FF5A 3OMWA 4KLGA 1R2QA 5CLHA 5EKUA 1YL5A 2EWVA 2VNAA 4R1TA 4EKEA 4RZ3A 2EQAA 4O3MA 4TQRA 4M9HA 2C5HA 1RCFA 4I9GA 2GAIA 5AT1A 4DSZA 5GINE 3GA7A 3LVFO 3I61A 2RIRA 3MGBA 1BYUA 2KFZA 1AGNA 4RELA 1ZD8A 2E6KA 4BBZA 2P27A 1PK1B 3M9WA 2G4CA 2VPZA 4KH1A 2QM0A 1YZQA 3R8XA 2C5SA 3Q9SA 4OB8A 4H4CA 1ORIA 2I65A 4BUGA 4LXHA 4OGWA 5DO9A 4D42A 3P0JA 2I54A 4M2LA 3T9BA 2PMZF 2WTEA 3M1AA 5IBCA 2WM8A 2G0TA 5IXYA 2W4IA 4ZQHA 2O0LA 3C97A 5A9TA 1K5HA 2C9YA 2PGDA 3L7JA 4FE7A 2CLOB 2K4IA 1SOAA 3PNYA 4I3FA 4DKXA 1LQ2A 4FHCA 4IHJA 4PHCA 5J2GA 4O4IF 1I51A 4WCDA 4LK3A 3ADBA 1FJHA 1SWWA 1B8UA 1OXKB 5H59A 3ZE2B 4FNAA 4LZDA 1J42A 4NH0A 2V1UA 3C6BA 2GESA 2BPOA 2J9YB 2WWWA 4FPXA 1QKIA 1TUEA 1UKZA 2BKLA 4DM7A 2ZU6A 4URVR 2IYNA 3HYSA 1JFVA 4AM8A 3Q7TA 3TNYA 3U9LA 4JROA 4M76B 1LZKA 5JYBA 2PZAA 2LKYA 4TROA 2WJWA 1COOA 2FWJA 4FFOA 1S0VA 2XNDA 3IAM6 1RWXA 3FUUA 2BEKA 3HCRA 3RWBA 3U4CA 3V4LA 1JJIA 2AT1A 3UCXA 3O91A 1PVQA 3C24A 5C52B 3WR5A 2LYHA 4M6WA 3FSGA 2J30A 4LRWA 1MCZA 5JANA 3MQ4A 4RY9A 4AY2A 2P8JA 3KLOA 1F5SA 2EP8A 2Z2KA 4AECA 2WE8A 1QHXA 2R1TB 3IAAA 4MVCA 2YZNA 4F6LA 1J8VA 4KBGA 3TIFA 1MIOA 3UT5B 3OUTA 4KNYA 4NVRA 1ULZA 3KDPA 3U4MA 1ZQGA 4ELVA 2W48A 1ZGHA 4ALKA 5MGBA 1OZFA 4JLAA 5BR8B 3AVXA 4DN6A 4GSKA 1O03A 1KTIA 1I2AA 5EGSA 5LR6A 4L76A 2CXQA 3WMWA 5IPFA 3OX4A 4ALJA 5EWGA 1CY4A 4C6SA 3K09C 5D84A 1HPLA 2R25B 4HKTA 3CTPA 3P8ZA 5DHUA 4F4CA 1L8AA 1ZQOA 7ICVA 2VRCA 4H7EA 4PR3A 4DYVA 1I2CA 3BBPA 5KTSA 4TZ0A 5CRXA 3QW2A 2OCAA 2PXIA 1ZRHA 1GSIA 4QYMA 2G0AA 4F5QA 2V7WA 4UD2A 5HCNA 1EX1A 4NOKA 3ILHA 3RS0A 3FMIA 1XN4A 2AYXA 2IFTA 4M9QA 3RUDA 4D9CA 1EFCA 2IV3A 2W0MA 4JMLA 4P93A 5FBKA 1QIHA 2BFBA 3GN2A 3TBFA 1HDCA 3DP7A 3OO1A 4L8VA 5FL3A 2C4MA 2FNAA 3D2CA 3HY4A 3KVVA 3IQIX 4NMWA 2FH5B 4Q45A 3PNKA 1U0EA 1ZYQA 1BJKA 3IQFA 2C97A 1G5TA 4A6PA 1H1DA 3IUMA 2O2HA 3OCUA 4ARUA 3THVA 4C6TA 4N3NA 3RAJA 1G1AA 1O2DA 1IPEA 1E79A 2D1SA 1LNQA 3VUEA 4DANA 2Q5OA 1LB1B 4KQ6A 2ZTLA 4FK8A 2FFBA 2HHTA 1VIAA 2YRWA 3AEYA 3QYJA 4ZKEA 1SU8A 1VP3A 3FNBA 3ABRB 3LG2A 2ZJZA 1SG9A 3H5TA 4J4BA 5J0TA 5F7XA 2NIPA 3ONWA 4QDJA 4ZP1A 3SBXA 5DQIA 3IBYA 4R6WA 3EPIA 2A5LA 2BI7A 1OY1A 1SXGA 1XBTA 3GN1A 2W9CA 5G41A 1S10A 3J81j 1DGQA 3IBFA 1H3EA 1XEXA 2YZGA 2P35A 1ECPA 4LCJA 3VV2A 4IHJB 3NEJA 4F4DA 4EHLA 1EFHA 3LWMA 4Q8EA 4IS7A 2YQEA 1RC0A 1GPKA 1U9IC 1UWKA 2CUNA 5FH9A 5DOVA 4R63A 4Q8FA 1U1FA 5EUMA 1FVFA 1SRRA 3C1OA 3RU9A 5LWQA 4RPZA 3T0FA 5H4HA 2JLAA 1V26A 2YNMD 1RNLA 1KYYA 4J1TC 2WKSA 3R0XA 4E03A 1SCAA 3VHRA 4S1TA 2PI5A 4DOAA 4LFCB 4B81A 3P1JA 4D56A 1AK1A 4ZDJA 5BOMA 5E95A 5LYJB 3TTXA 2J7PA 5C4GB 1THGA 3NH9A 5FI0B 4CQJA 1C1YA 2Q4BA 2WV9A 2HWXA 4B3HA 4LISA 1A8HA 1T8SA 3HSYA 2OQ2A 2JL1A 4MUNA 1XRJA 4MFCA 3S29A 4BFUA 4UB4A 2EGHA 1MC5A 3EASA 3QNUA 1FFWA 3KL4A 4WA8A 2CVOA 1L5HA 3BDAA 1P73A 4Y6LA 1A8IA 3MLBA 4FJ2A 3JPRA 4HNSA 5A7GA 4CM1A 5HNKA 4N0MA 3T41A 2ICAA 2G9VA 4GX0A 4P3YA 1AT1A 1MIOB 3Q40A 3UH0A 2QRNA 1GL6A 1XZBA 1G55A 2SICE 1SELA 1VHDA 3AKCA 3GZJA 4EHAA 4URXR 4KGZA 4LFAB 3VYWA 2G1UA 3LHSA 4Y2VA 4ZDIA 5CHGA 1NPTO 2IHZA 1JQEA 2OCKA 4KJXA 3EFHA 1QOPB 2EG9A 1NUAA 1TKBA 4UAUA 1A9TA 2OCGA 2PCJA 3CRMA 2ZJ1A 3G68A 3MT8A 2HU8A 2HDWA 1KK0A 3A7EA 3G6WA 3LRXA 1KOLA 3GL9A 3LCRA 1Y8RA 4BMNA 2G1JA 2DKZA 2UYYA 4ZI7B 4C7ZA 2XI4A 3AB3A 4KU4A 4OY3A 4QW9A 2NYRA 2Q46A 1NBIA 2AD1A 1ETUA 1HIWA 1P74A 4KRFA 1GTJ1 1YS6A 2HU7A 4QKQA 4GDMA 3MD0A 3UPTA 5ALZA 1C1HA 1YONA 4OJKA 1G3MA 4V0NA 1DB3A 3SAFA 3RT9A 4XWYA 1QCDA 1RLOA 2W6IA 2FZEA 3MMXA 4F3YA 4LF6B 2BEVB 2IXEA 2P0AA 4WZBE 2B8TA 2X0KA 2GAJA 3AVVA 3KQPA 1REQB 4Y2XA 1JS1X 1JW9B 3EIHA 4IEIA 1VL8A 4G5FA 4LV8B 2BQRA 3I4LA 4JJ7A 1LLCA 3B1XA 2VSOA 1WD7A 1VI5A 1L1RA 1SMKA 2CEAA 4Y2SA 2PS0A 3PP8A 4W6ZA 1H5NA 2XOKD 3DLPX 3SC2B 1GDHA 3RTDA 4UMDA 2XDQA 1T0BA 3IPYA 1ZDMA 1VSUA 3QF7A 3UWMA 4BX8A 3U2QA 2RGDA 3GGDA 2LI6A 4NEGA 4KO8A 1RYDA 2IYOA 2TRSB 2WWVD 1R9MA 2Z6UA 1EDBA 3SFVA 1NI3A 4FDMA 5I7UA 3NS1A 2J3MA 2QR5A 3JX9A 4IZOA 1QNFA 2TS1A 2ZZKA 3QWFA 1H65A 3EQ6A 5JQGF 2F1HA 4JJ8A 3V2IA 4DUYB 3ZCPA 2EYQA 4GXJA 5JT1A 5LUAA 1XSLA 1J8MF 1GR0A 1UMBA 1PX0A 2HX1A 1FNMA 4DHEA 4KLRA 1GZHB 1Y5IA 4X60A 4UM9B 1NW3A 1JHZA 1XMOB 4C2TA 1Z08A 1A9XB 2VNIA 2WT9A 2WNSA 4Z99A 1KYWA 3V42A 4C14A 4O4HB 1HNXB 2MSWA 3JQCA 1RQXA 1DKLA 3GX1A 4L6CA 3TLGB 5DI3B 4D9EA 3AIMA 1TF5A 4PYNA 4EG6A 1KEWA 3M2PA 4LQ4A 1UQRA 3VDQA 3VFDA 2NPIA 2OOKA 2B37A 3DV2A 1OTXA 3WIDA 9ICSA 2W6MA 1PR4A 2CL7X 3LZ6A 2O6HA 4W7IA 3KHKA 1HYGA 4ND4A 2VJCA 1GUAA 5BR1A 4M86A 4BX9C 4YUVA 2AJCA 4C8KA 4LXYA 3AIKA 3PNMA 1ID1A 5FI5A 5ARCA 1C3VA 2I29A 2KE5A 3EPPA 2A67A 3NBAA 4Z54A 4BBJA 3I30X 5JHGB 1UBJS 4DGQA 1U0SY 3EVTA 2XT9A 5DHSA 3GCXA 3F6CA 1KFSA 5FL7D 3WLAA 4QELA 1VA4A 1N77A 2X2FA 4UB2A 1UOEA 1AC5A 4FEEA 3VI4B 4LRUA 4WOKA 1KQQA 3UA3A 1Z73A 4GF5A 1HKUA 1OIVA 4HAWA 1R5OA 2ZITA 4JI6B 1K88A 1V38A 2GGSA 1N5RA 2WK1A 4G5HA 2W3SA 2SCUB 4EUEA 4MWOA 1M76A 1G20E 1ZM9A 4IWXA 1M8KA 3KQQA 4B4OA 4AAYA 2X42A 4LJAA 5HG0A 5ULLA 1XKLA 4N01A 5FNVA 5DM60 1Y8QB 4CLRA 2O2XA 1PR3A 4H27A 1KJIA 3V1UA 5KG4A 2P68A 3KAKA 1Z26A 1GL9B 1OBFO 1VJCA 2WOJA 1E3TA 5KMGB 5AXDA 3CT4A 1T2FA 3EF1A 1UWCA 2JH8A 3MGAA 4HGYA 3RQIA 3L4JA 4ZMBA 2EARA 1KYTA 3L7OA 4AMVA 4PINA 4PG7A 4I4TB 4C78A 1TNDA 1SZHA 1Q2UA 4HQRA 3SYTA 2EZUA 3MUFA 4G01B 4X7MA 4GECA 3V55A 4DNFA 1XTSA 3OJUA 4HWPA 3S68A 2PD4A 2QM7A 1T10A 4H16A 1MU0A 5LMNB 5MHTA 3B6IA 3OZUA 3BRWD 4M9NA 1XDDA 2FDRA 3ZJTA 2NSYA 1BS1A 2KJ8A 1D03A 3C5GA 1GLGA 4EPTA 2P9JA 3OZBA 1T2VA 3LC7O 4I50A 2I6XA 4JIGA 3O4JA 5HF9A 3TK1A 2QGZA 4YAEA 2Z9BA 4OQYA 4C8MA 2HBZA 2KSOB 2Q6LA 3B1ZA 1QS0B 1ZZGA 1BMFD 5AD1A 3DZKA 4YMSA 1CIJA 2P5SA 2ZBQA 4QQ8A 2YFYA 3CLSD 1Y33E 2HOQA 3NTOA 4MO9A 5F5NA 5KB3A 1GQSA 1JPUA 2VP5A 4O5AA 3HHEA 3BCHA 1LV8A 3PXEA 4NOLA 1J8QA 4MUXA 2D3TA 4U9IS 4KLFA 1V6AA 1UC8A 1TGVA 3FHCB 5K3SA 3DL4A 1SBYA 2PSFA 2XSZA 4ARVA 2GCOB 1DAHA 1MO6A 3DE7X 2J48A 4LDRA 1L5NA 2LYBA 2A5GA 2DT5A 3UOWA 3M6ZA 4ZI2A 1KEVA 2OMKA 5TX7A 4GPAA 4RQAA 1X7YB 3GO4A 4RD3A 4Z86A 4V2UA 5IULC 3T1NA 1E5QA 3PUJA 3VAZA 5CBKA 4BFWA 2EFCB 2WWXA 3OZWA 4TM8A 2C95A 3ZCXA 3DZJA 5EKDA 3I32A 5KFQA 5ED4A 4R1NA 1G6Q1 2ZSBA 2BYTA 5EAIA 5FL7A 3SYLA 5EJ8A 4J16C 2H3ZA 1EZ4A 1W59A 3F8TA 4IIDA 4EFDA 3D5EA 1Z00A 1NMQA 4OHVA 4WBNF 1KK2A 3UA4A 3N8KA 1CJUC 3S3TA 1PDVA 3M4NA 5J4HA 2ZIWB 4L85A 3JQGB 3UCEA 2OE2A 3U44A 1H2EA 4NFLA 3D6AA 3M6KA 5J0XA 2X9QA 3H5IA 2WHEA 4IH4A 1UM9A 2HCTA 4KPGA 4MPDA 1MXFA 4MV3A 4E94A 2XB6A 2DKXA 4ZVOA 2I7TA 1HE4A 2CJWB 3IOCA 4MTLA 2OQVA 4QASA 3PICA 3TARA 5FX2A 9ICWA 4NE7A 1U9LA 2J3JA 4F93B 2OK7A 3F5DA 1TT7A 1LY1A 3LCCA 3P0RA 1PD1A 4RHUA 2PO5A 3W7BA 1UXIA 1WUDA 2Q7XA 3V6MA 5KFSA 4WXEA 3TRJA 2NQ2C 4CIDA 3LBYA 1UK6A 3Q15C 1QFXA 1XVUA 2CK3A 1DXOA 1GP2A 1RYBA 3EZGA 3ZV3A 1N34B 3RB8A 2KEYA 1SGWA 3LLUA 1WTCA 4AZVA 3SD7A 4EJ0A 4EUSA 2HO4A 4C01A 5GVRA 2R8BA 1G38A 1FU4A 4UE3S 3ESRA 1ZH4A 4ZAYA 4A16A 3OSUA 4MQFB 4Q1AA 2ZJFA 2GA9A 2HCRA 3A6HA 5AKEA 3BL5A 3QHPA 4ZI5A 4W1SA 4GC6A 3U7EB 1U81A 3LM8A 2J3HA 9ABPA 2G7MC 2Q2QA 1B0PA 4KQHA 3MBIA 2FW0A 3U26A 3QGMA 1ZJZA 1D9FA 3DLCA 1BQ4A 4FHZA 2PFGA 4DY4A 1CHNA 5I7VA 2HA3A 2IVFA 3IIEA 5K03A 1IZ8A 1CY8A 4IILA 4BMVA 5E7JA 1YTUA 3FOZA 4AQ7A 1NJ2A 2XE6A 1HH4A 3CRRA 1KP9A 3CNLA 3N2GB 3CNHA 2QRJA 4M1WA 1MPTA 4CKWA 4Q3LA 3F5SA 3S1LA 2EZYA 3DV0B 4A27A 1NBOA 4YR7A 4IRMA 1E6KA 2W2KB 4YR9A 2FR8C 4ON9A 3TNFA 1MJFA 4X90A 4ETMA 2O5VA 5AW6A 3R5HA 1XDZA 2I87A 4OU5A 4CF5A 4F60A 5HSGA 1IG6A 3WSTA 4BS9A 5JWOA 4AZWA 4Q9DA 3GLGE 3U17A 1DP4A 3ZWVA 2HJWA 3WO1A 5JEDA 4TV9A 1J7JA 1GNSA 1XNQB 2PH1A 3KPWA 4OGKA 1U6KA 4RX1A 2FN8A 4J9QA 2EEZA 1CUWA 1MIHA 3C4JA 1BEZA 3LKVA 5DLEA 3MWEB 2PNFA 3SVTA 3M8SA 1ZISA 2PRYA 1P4RA 3GVPA 4J0IA 1P4SA 4D74A 3VYTB 1L5FA 2XQGA 4HAIA 1G7CA 2O23A 2Q5LA 4IICA 5EJMA 2D2IA 5F1PA 4KI7A 4GEGA 4KN6A 2AGVA 1OXUA 3L1HA 1F0YA 5K0JA 5FUVA 1C0EA 4YMIA 3R74A 3S1SA 3TRKA 1Y6GA 3K0BA 5DGXA 3N8DA 1E0KA 3QBVA 1W5EA 1VRCA 4BP3A 2P6UA 4ASUA 1URJA 4PC6A 1BZYA 2H2FA 3ZU3A 4CKEA 3AEKB 3GLVA 5ENDA 5EIWA 4XUDA 1LFAA 3NHSA 2Z5GA 2FPSA 1G4HA 4ECQA 2BDPA 2I78A 2YTZA 1J24A 1FX0A 4AJ2A 5B58C 5E1MA 4OQFA 4XYLA 3HR7A 1T0IA 2D7DA 3RVMA 5BW4A 4INZA 3JQPA 4DADA 4H9GA 2DMRA 3KR1A 1M83A 4NLLA 5CVCA 4KGDA 2Q45A 2ZBEA 1A04A 3OE7D 1PV1A 2IPXA 2VUTA 2DFNA 4HC4A 4P7GA 2PR7A 3SF8A 4CKCB 2FE9A 2P1DA 3ZDBA 2VWGA 1U0JA 1MB9A 4YMUA 5A4AA 3MT0A 1LJLA 3THSA 1IJEA 2QTWB 1IC6A 4XIYA 3L79A 3N2NA 1C4WA 2HMXA 1SZCA 2R4TA 3BTSA 4OL9A 4RGBA 4LBWA 2Q4TA 1RJ9A 2V59A 1TU0A 3RC2A 2J33A 5I7HA 4DG8A 2H1OA 1DX6A 1UXGA 1NUUA 3BFJA 2FMPA 4ED7A 1HQCA 4WOJA 2YYYA 2JEZA 2VPXA 4R1SA 4BLUA 2A58A 4JAVC 2QP4A 1UJ2A 3PIIA 5CFOA 4NWIA 4RVCA 4DPMA 1H2ZA 1AHPA 3MA0A 1ZAKA 1NGSA 5DN6A 5ALTA 3E9EA 3KSDO 4KR6A 1BXGB 2JJ1D 1QR6A 1R9JA 4WNIA 1ZHHA 2QB0B 3GF4A 4I66A 4TVKA 1OX5A 4B2LA 2XGGA 3AJAA 3RAPR 3OZFA 1QQBA 3HJTA 3QLVC 1ID8A 4AYXA 1WV0A 3ZTYA 3IPAA 1V4NA 2OCXA 3MBKA 2XVXA 1S3IA 3ITKA 4S1VA 2ADFA 5IWAB 2R7MA 3IO3A 5M5BA 3D8RA 3GV0A 3C1ZA 1DZ3A 4RYDA 1EFVB 4WPGA 4F4FA 4YRZA 3S8EA 3GT3A 1T3LA 2DKOA 2PV0A 2HWKA 3ETGA 5LB4A 5JCZA 4C5AA 2HA0A 3DMHA 3B5IA 4QBFA 1L5GB 1RZVA 2G1AA 3FMGA 1AXGA 3U7QB 5FPTA 3I23A 4YCJA 2H51A 4G09A 3NTVA 2XIDA 3SLRA 3C3MA 5KFOA 1UPXA 2WZDA 1FL9A 4QPZA 4ZD6A 1PLKA 5FWDA 4AMZA 2CXTA 4KE8A 3SZ2A 4RF2A 1OHHA 1I94B 2XZLA 1QIJA 1SZPA 3HV0A 2IDZA 1BPDA 1AKVA 1FUYB 2Y1EA 4OB7A 2FPMA 5ELMA 3RK0A 3VSEA 3A0UA 1R6TA 1NW6A 2Y1LA 2L82A 4R84A 2BI8A 2O3QA 2NUTB 1UIRA 4FQ7A 4M9GA 1M33A 4PSVA 4QJBA 4B44A 2V4RA 3QUTA 1NZBA 3CUWA 4DL4A 4PW0A 5T4BA 5LP6B 3F9IA 4O4HF 4Y1RB 3C1AA 4KFSA 1XF9A 1M54A 2HDNB 4JUCA 1P7WA 2JAXA 3ZHZA 4I4IA 1JIIA 1TAUA 1BNPA 2FZGA 2I2DA 2ECFA 5CH8A 1BOOA 3ZIUA 1NVKA 2C4UA 4O1MA 4W7SA 3EWAA 1VE9A 2WJJA 4HDNA 4P82A 5A4IS 4LOLA 2R1UA 2ZLBA 4FJ0A 1NZFA 1ZIXA 1Z2OX 3RB6A 2XYQA 3N39C 1ZNXA 2PX4A 4CCYA 2VF7A 4BJ6A 5B12A 5CT9A 3LDAA 5LNK6 5EHGA 2KHVA 8ICJA 3QVXA 2BPGA 4PF1A 3E61A 3GYBA 3OJ0A 4ALMA 4N7RA 4TRMA 3AB8A 4H1VA 1LDBA 1TF7A 3A25A 4NESA 5DCWA 4BVBA 3H65A 1DOZA 4YG2A 4K6GA 5I9LA 1GCUA 2EL7A 1EWVA 4I1PA 3HPQA 1PVVA 4ANFA 4A5OA 5FJJA 5D1HA 2QDXA 1SGGA 1OLUA 2YJZA 4UCFA 1ISPA 1RKVA 2G8NA 2G08A 5AI4A 5ECDA 2V7PA 2F1KA 2JGIA 4LVSA 3WYBA 5AOVA 3ZK7A 4BPBA 2HTFA 5IIIA 3PQ6A 1NI4A 3RIEA 3SSAA 2WHRA 1QVVA 4BLPA 2H2GA 4CU2A 2Y0BA 2BEUA 5GY7A 1NRWA 4LJ4A 5E6UA 4CEJB 1DC7A 2VDKB 3WIEA 3L1JA 4GPTA 2YMPA 3HJEA 1IOLA 2CHEA 3PXCX 3UN1A 1AHIA 1POXA 3I9JA 1Z5GA 4ZEOA 5KVSA 3T52A 4MHTA 5L3QB 1X2EA 2QD5A 2PTGA 3A4LA 5CUQA 5DTMA 4YLEA 2CB0A 3KQLA 3EXAA 1SUWA 4WXRA 1F8GA 2CN1A 3U60B 1PR2A 1K6MA 3SI8A 1CXZA 3QOFA 5TIIA 3UQYS 3PD7A 5D7NA 3AHDA 1FVXA 2O2IA 521PA 4GSYA 3TNJA 2Z58A 1Q0LA 3T5JA 2W7PA 3QMPA 5J4KA 1Z07A 2ZXEA 3D8TA 3ZQKA 1RXIA 2JZNA 4GZ3A 1GPLA 2H4FA 1O94C 5CFNA 2PZKA 4JH0A 4W6QA 3BA1A 4P2GA 1P2VA 3WAJA 1K1QA 1PFYA 4Z4FA 1J06A 4DG5A 3PX4A 1RM5A 4S3MA 4C87A 1QRRA 4IP0A 4DC1A 5K7SA 3HKBB 2AN5A 5ALYA 1T9AA 4XGNA 3ZY5A 3KEGA 5TB5A 3MRVA 1NKBA 1X8JA 2JK0A 4KVGA 2XXAA 1W25A 1PJLA 3A3OA 2YR0A 1UKAA 2O3TA 2YW2A 5B66U 1JLSA 2DFLA 2I1QA 1WHSB 2I6UA 3I6YA 2A1AA 1Z5PA 4X5OA 3WJAA 4N76A 2J3LA 2ZJ0A 3CMCO 1HQDA 2KI5A 3HMQA 4PHGA 4COOA 4EZBA 1SEVA 1HEYA 2VR1A 1N8KA 2Q5QA 2YJTD 1OKKA 1ZQEA 1YR6A 2COUA 3H1BA 2DSTA 3PWTA 1Y9AA 3GT4A 1XLTA 4LJYA 3GNTA 4XFDA 3SJBA 1CF4A 4E6EA 5IVPA 2FP4B 1F60A 3AFMA 1BD4A 2CYCA 1S3SA 3INNA 5BV1A 3W2EA 5G5HA 1ADFA 3WQSB 4LBYA 5EXDA 5K8JB 4CUJA 3BZWA 3GRCA 2O0MA 4L4YA 1E1QA 3AONB 3IIMA 1O0SA 1Y81A 1ZVMA 2VJMB 3ETJA 3S44A 1TUGA 3WL8A 3IO5A 3M34A 4EPVA 4CEIA 3QYPA 1Z0DA 2XVMA 4BLRA 4DHWA 5FOSA 1W30A 2REQA 4TGLA 3UMRA 4AMYA 3RANA 3KQMA 4GVXA 4PYRA 2PXXA 3E2MA 3E2IA 3R3VA 3FPEA 1P3DA 3REOA 4TTSA 3KJEA 1MQ9A 3CZ5A 1XU7A 5CLLA 1TQ6A 3CRQA 3QVTA 4YJKA 3UXHA 2PUCA 5BR7A 5JWHA 4WVLA 1QDUA 2ZS9A 5EZ6B 4DWWA 1T94A 1QDEA 3BQNB 3LHIA 1CF2O 1PIWA 3L18A 1WU7A 2LD4A 3MUOA 2HHAA 5DNCA 1JR4A 1QS0A 4ED6A 3B7GA 4U6NA 5BPHA 2CL5A 1X7DA 4GSLA 5ECYA 3TDMA 4ZFNA 2KD1A 1PG5A 1E6UA 2COEA 3BMCA 4EKDA 2YXLA 3WP0A 4ACBA 4USAA 3I83A 2WVHA 3WB2A 3WNZA 4EHKA 1C7RA 3BD9A 2OD9A 3MJTA 5FPKA 2ADMA 2GCGA 3MTQA 2F48A 2QUZA 1X42A 2HBYA 4ZOAA 4BHTA 1Y7IA 4NIMA 5KJ6A 2BV3A 1URPA 1XZMA 3QZ7A 2XQVA 3C7DB 1UJNA 1UM9B 2JVIA 3CLTD 4TT8A 5DB7A 1TCAA 5TNXA 5AESA 4IPTA 5A7FA 1SIUA 1QTMA 4MV1A 5ALPA 1CQJB 1V3UA 2VHEA 2VQDA 1ESCA 3ZCVA 1U7UA 4F4YA 4XWGA 5HMLA 5E6UB 1L7EA 3OSZA 2GI4A 2C88A 4BECA 5AVOA 1I7LA 3SQDA 3NYRA 3TEMA 1DS6A 4DO9A 1DJNA 4EY3A 1M3SA 3GEEA 1GNTA 3RRJA 5LD2C 4YAUA 4P3PA 7ICLA 1DOQA 2YV3A 3BCRA 4XGQA 3UUFA 3H6GA 1XSEA 5JJCA 3GJ4A 2Q07A 4JV0A 1DTWA 1TW2A 1E9BA 1EEXB 1OT5A 2AA3A 4S04A 6REQB 3U7GA 1O9HA 2GN4A 1TM4E 4DL5A 421PA 4F6RB 3T1YB 4IS3A 4JC8A 2QN7A 4YO8A 3TFOA 1Z68A 2ZYDA 3G7UA 4QL3A 1P6UA 5JDCA 4UMEA 5B64A 2NVWA 1UH5A 1NJXA 3B2EA 2ARKA 1XGKA 4ITVA 4RF4A 4O3SA 1NTRA 4XUEA 5DKFA 2GSDA 3Q8QB 4BRWA 1UDAA 2J07A 3OQ6A 1O6ZA 1VGRA 3RDPA 3P9CA 5LWHA 3GT7A 3TTUA 3UXPA 5BN3B 4EGFA 3BFPA 3FZYA 1Q1QA 2C8KA 2H8KA 2XRMA 1TKRA 1UK9A 2RARA 4ZT7A 5FWNA 3W06A 1JVNA 2FR1A 2OT3B 1VLZA 2QNIA 4MPRA 4PO1A 1FFEA 1KE1A 1KF0A 1GTZA 2VDUE 4TTRA 3D8BA 4EH1A 3L7AA 1M6VA 3BXHA 4II7A 4L5IA 5HIKA 3L6CA 4JJAA 1QGAA 2QMZA 2YVQA 4IIFA 3RD5A 4ED8A 4WIAA 4GYYA 3FWKA 5GM1A 4RE6A 3SPXA 3FBWA 4CEHB 4MV0A 1FUIA 4XB1A 1DX9A 3OKCA 3T3MB 1D0VA 4JB2A 3A31A 3TTTA 4L72A 2Q3LA 3C6XA 1SG0A 1KJ8A 1W34A 1MGOA 1SXHA 4M1OA 1MB4A 3BG5A 3K4PA 4J3NA 2G28A 2Q21A 3E9QA 5IIMA 2J5KA 5IKOA 2HI0A 3TQSA 2UXCB 4AUMA 5BRNA 1E7WA 3NIFB 4R8SA 3WWDA 2ZE8A 2J9FA 4IVPA 3PUHA 4DFPA 2QOEA 4AO6A 5KMGA 4IIGA 1KY5A 1PUJA 3KELA 4EO7A 1S8OA 4OIFA 1OJLA 2CCJA 3VZCA 5JHHB 3U4GA 4L5BA 4O3OA 5A4FS 5ALIA 4HAVA 4UJ5A 5JAOA 5KPDA 5C53B 5BNIA 1QK3A 2PZLA 3SC2A 3R9XA 3R0QA 4KRYA 3R4CA 1HRKA 3TFQA 3FXAA 1RYHA 1WDKA 3JCZA 3ZDDA 4MAMA 1FRZA 3FM9A 3RS2A 3RJJA 1K08A 4GBMA 1BA2A 2Q4DA 1KFEB 3TL3A 1TOAA 1ZUNB 1N2OA 2G6TA 7ICMA 3PCTA 1SIOA 3OIDA 2PFOA <