1LAFE

Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Structural basis for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino acid transport
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lafE01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lafE02
3G3JA 4DIGA 3I5OA 2R9JA 4NF4B 3CG3A 1JW1A 1MM7A 3TTRA 4YICA 2DS9A 4GD5A 4L17A 2P2AA 3PD9A 2V3UA 1B5IA 1NNKA 1OIBA 4OFLA 4BDMA 2OBGA 4IGRA 1QKAA 4GQOA 5KZTA 5CBRA 2NWJA 1EZPA 3PUWE 2OCUA 2ALUA 3MP6A 2REJA 4XIGQ 3T9VA 4NF8A 4GF8A 1OMPA 1MM6A 5BWJA 3ZKKA 1ZU0A 4MLVA 3MP8A 1SBPA 3O2AA 1FQFA 1N3XA 3L6GA 1FQDA 2Z8DA 2HCAA 3K6XA 5TP9B 1B58A 1H3DA 3O6IA 3ONMA 4R73A 5I56B 1MY1A 3QUJA 4TLMB 5CMCA 3T93B 2RC9A 4FATA 2Y7KA 5HM4B 3IO6A 1QW0A 4RNSA 3OEKA 2I3WA 3PPQA 2X7PA 3RPWA 3HV1A 3SDFA 3TYHA 1B1HA 2O7UA 2OZZA 1MQIA 1QUIA 4KYSA 4JWOA 4ZZEA 3K00A 2FA7A 2O1LA 4KHZE 3VVEA 1LBBA 5BUUA 3FUZA 3ECRA 2F6GA 3H6VA 3P7IA 4JWYA 3UORA 1JETA 3A3CA 4OEUA 4F2QA 5I2KB 4MLQA 4IB2A 1M5CA 2XXWA 3I3VA 3LUYA 5L9OA 5DVFA 2A5TB 4QFOA 1XC1A 2F36A 5H8QB 3BFTA 5ICQA 3S9LC 4F29A 4DXBA 4QF9A 2UYFA 5H8HA 2GFEA 3IJOB 1LB9A 3RGYA 1PB7A 3LSLA 4N6PA 5KDTA 3CSGA 5CRYA 4ZEKA 4LVQA 4M4GA 3FJ7A 3IJXB 1I6AA 1UTHA 1FQCA 1ZIUA 1NMUA 3K1NA 3QAXA 3Q29A 4MF3A 2XD2A 4QFNA 3W15C 1FTOA 3HO7A 3QXMA 2V93A 2F8DA 1H45A 3G7WA 1LLSA 4H65A 4YMBA 2Z8FA 4R72A 1ZJLA 2VP1A 1MXZA 4AB6A 2DWJA 4H1XA 4OMBA 4OQOA 3TQWA 1B32A 3PUVE 3C32A 3O28A 1USYH 2H25A 2RC7A 1NH7A 2VOZA 2B3BA 3KSXA 1F9BA 1AL3A 1SI1A 4ELRA 4BDNA 2RCAA 2Z23A 1B9JA 3TELA 4ZEFA 3WAEA 1Y9UA 4C0RA 4OEVA 3IX1A 1EH3A 1NH8A 2HFBA 3M3KA 2HAVA 1A8EA 3G3FA 3OO7A 1CB6A 2RKMA 2H5YA 3K1MA 1YAEA 3DP6A 2VHAA 4UA8A 4Q5TA 1Y1ZA 4R6HA 2Z8EA 3N6TA 1Y4TA 4OTEA 3TCGA 4XTCQ 2RCBA 2YJPA 4LATA 4KPTA 3C31A 2I48A 2V84A 4YKPA 4EF2A 1B0LA 1O64A 2R71A 3TPAA 3K0VA 2Q88A 3CIJA 2LAOA 4QFPA 1H43A 1WDNA 4GIZA 4OXVA 3M8UA 2E0SA 1PDAA 3KG2A 4YKIA 1EZOA 4IO3A 3FATA 2I0BA 4LQ5A 1IQ7A 3QYTA 5H8FA 3CG1A 2FNCA 1GVCA 2DVZA 2Q2CA 3MUQA 2AYSA 2O7IA 4PQJA 1MY3A 5AA4B 2O6AA 3RT8A 1MXVA 2ESNA 2ZYOA 3OMBA 3VXBA 3HCQA 4AQ4A 1R1NA 2XX7A 3Q27A 3U94A 5TU0A 1N84A 4P0GA 1MY2A 1UIUA 4PE5B 2F7CA 2CZLA 1TT1A 4X9TA 1N0TA 3B7DA 3FXRA 3TTKA 1WODA 4R2FA 3CVGA 2REGA 2QS1A 1NFTA 4Q8RA 2F78A 3PPRA 4LZ7A 3KBRA 1GV8A 3H6TA 3K6UA 1SW1A 4XKPA 4OHNA 1BP5A 4GFRA 5M2VA 4DCYA 4YB6A 2XD3A 2I0CA 3N94A 5EYFA 2AL4A 4RXLA 2RINA 5JTYB 1DPEA 3DP8A 1I6QA 4GL0A 3TTLA 4KR5A 2PMSA 1YTVA 4E0WA 4JWXA 5K2YA 3CFXA 4KI0E 1LFHA 1VFEA 1S9TA 2Y7WA 5A5XB 2ZYMA 2NVUB 1JQFA 4IO7A 2ZMBA 3IB1A 1SVXB 5AA2A 2ONSA 3PPOA 2QPQA 2QS3A 3IOTA 3N5LA 3S9NC 2IA4A 4QRZA 1LBCA 1T0KA 1JEVA 3MPKA 5AA3A 3B6WA 1Y3NA 3B6TA 1R9QA 3K1PA 4NEDA 3ILUB 4MFIA 1TWYA 1M5BA 4YU0A 3C4MA 3FASA 3KGCA 1O63A 4R2BA 3PMXA 3FD3A 3QUFA 1ZLQA 2D5WA 1P1UA 4NF4A 3OENA 1O7TA 4P11A 4JSDA 2VGQA 1IEJA 4ECFA 2Y7IA 4LONB 2DYXA 2XHDA 4GLIA 1PBPA 1SW2A 3LSXA 4WEDA 5I58B 1MQDA 1MDP1 1B05A 2QRYA 4RYAA 4E0XA 2H98A 3ZSFA 2XXVA 1OQHA 1SW4A 3PPNA 4QSDA 3LR1A 4YKKA 2B65A 2UVHA 4LZ8A 3SESA 4BLAA 4GVOA 3MBPA 3WAFA 1D4NA 3K6VA 4TQUQ 2OWSA 4IGTA 4FJPA 1US4A 4R75A 2V3TA 1MXXA 2XXQA 4QHQA 1MPCA 1R6ZA 1DMBA 2H9BA 5EHSA 3Q28A 4ZEDA 4U4XA 1B40A 1ELJA 3K01A 3PUZE 3SEVA 2XXUA 3T22A 2GHBA 5TP9A 4GXSB 4I8CA 5I56A 4DCXA 4OWDA 4FORA 2XXXA 3KOTA 2R6GE 1HSEA 3FJMA 2OLBA 2Q8JA 3PMVA 4NF5B 3IOUA 3CSBA 3ODBA 4R6KA 3TTNA 2ONKE 1LAFE 1R9LA 3MZBA 1A7LA 3OOAA 4OVJA 4THIA 3UN6A 2GH9A 2NUVA 4EF1A 3IB0A 4F22A 4H8JA 1LAHE 4RK2A 4OENA 3CFLA 2Y7PA 4ZDMA 1AIVA 5I2KA 1OQGA 2XXIA 1B7UA 5J1DA 1DOTA 4RA1A 5I84A 2F34A 2PBWA 2ZNTA 4UACA 1BKAA 3RY3A 2DE3A 1LCFA 1B7ZA 3MJNA 4BDOA 1MS7A 1IITA 1P1OA 3CI8A 1N7WA 3S9MC 4KCCA 1FCKA 3T96B 2DXRA 3O6HA 1HSJA 3VLVA 2A5SA 2O51A 3EHTA 3IO4A 3VLWA 4KD5A 4G68B 2F6PA 3R7XA 5F1QA 2M8CA 1Y3PA 3E4RA 3KN7A 3IOVA 3Q26A 2Q2AA 1RKMA 1OLAA 4WKMA 2OK2A 3W9VA 4HCWA 1URDA 2FYIA 1II5A 5KCJB 3KJ7A 4NMYA 4F1UA 1D9YA 5DEXB 4JXIA 1Y20A 1B3LA 2DVCA 1QULA 3SEUA 4LA9A 2QMXA 2ZXTA 3CFZA 2XX8A 1A99A 2KLFA 4R9GA 3H7MA 4ZS9A 2I49A 1IIWA 4EXLA 2XXYA 1JW4A 3GZGA 1SQYA 3JYRA 1ZKBA 4EQ9A 3ZKLA 4ONYA 4H5FA 5AA1A 1ZTYA 5H8NB 2PX1A 2P0SA 4G68C 5K2XA 4OYVA 4DLDA 3CRBA 1A55A 3S4UA 2P1SA 2PYYA 3LSWA 4NF6B 4G8MA 1MH4A 3QSLA 4X1DA 2DP8A 2I58A 3T66A 3A3UA 3DELB 3FJGA 2DWIA 2AL5A 4DDDA 2UVIA 3IB2A 1XHYA 4ZE8A 2YPNA 3UA8A 3RUMA 4DXCA 3U1OA 1XVYA 1MPBA 5FTIA 3F11A 1JVXA 1US5A 4H67A 4G4PA 4G2ZA 5CMMA 1M5EA 3MPLA 1BTJA 1Q1KA 1MPDA 1I6BA 5CI5A 1LSTA 1USYE 3E3KA 1B3GA 2VD2A 4FE8A 4ND9A 3VV5A 2H4IA 4JSOA 3V89B 1PC3A 3M3FA 4OESA 2PVUA 3UGWA 2Q9TA 3K02A 3FZVA 3U8QA 1P1NA 5CMBA 2XXTA 5ITOA 4ESWA 3CR9A 4F3PA 5I57A 3ILTB 4F31B 3FGSA 3EHUA 3VVDA 3IORA 2HAUA 3TKDA 4BDQA 5AA4A 3PGFA 3BBRA 4IO6A 5HBCA 3OO6A 1IXIA 3GXAA 4HCYA 3MWBA 1SD3A 1AH5A 4YB7A 1IXCA 3MP1A 3LC8A 3EHSA 4EXKA 3USDA 1IUDA 1POY1 2DWHA 3UK4A 1P1WA 1B46A 2I4BA 2E1SA 2QMWA 4N13A 3QIMA 3THIA 5HPQA 2OWTA 2O84X 4OZ9A 3H6UA 1GR2A 3FXUA 2DSFA 3D4CA 3C36A 4IY5A 1Q35A 3FIRA 5H8SA 3H06B 4FEDA 4GRKA 1H76A 4AB5A 5TPAB 1Y1MA 2I6EA 3H6WA 4YB5A 3IOWA 4IO2A 4JBZA 3O97A 3N26A 1A54A 4ZEIA 3IAZA 2ANJA 4ISUA 3DM0A 3TTMA 3V8XB 5JTYA 4EQBA 1B2HA 4DZ1A 3HPIA 2O68A 4JB7A 4IO5A 4PP0A 1N7XA 1D3KA 2QS2A 1IXGA 4O3AA 3FVGA 1S7YA 5CC2A 1XT8A 3UP9A 2B3FA 5A5XA 4U1ZA 4PFWA 1GTKA 5I2NB 1HSLA 3G3KA 4NWDA 2W7YA 2UYEA 3PPPA 1SI0A 4GL8A 1MXWA 3JV9A 4XXUA 4EDPA 1MXYA 1B4HA 4K3FA 3BFUA 1RYOA 1SYIA 4JDFA 3N6UA 4NWCA 3V83A 3MVXA 4YKJA 5CBSA 3H03A 2O69A 4H6DA 2ZYNA 3TODA 3R26A 1B7HA 2DXYA 1B4ZA 5LOMA 2NXOA 2YLNA 4F1VA 1UTBB 3EF7A 1NKXA 1SW5A 3S2VA 1I69A 3G3GA 1UIVA 1P1QA 2G93A 4Q0CA 2XXRA 3TEPA 4GXAA 5I59B 4IO4A 1B3EA 3RLFE 2G29A 1FQAA 1ANFA 3GLBA 3KJTA 5B70A 3G3HA 3SERA 3RT6B 1JVYA 1OVBA 3GBAA 5I58A 5DTBA 4Z0IA 2HXWA 4YZZA 4N07A 1B52A 4ELPA 1RYXA 1URGA 4XKRA 4XKQA 3PUYE 2IEEA 4U22A 3VVFA 2QL3A 3OSQA 4QSEA 2V3QA 1Y4CA 3RTWB 2I4CA 5DYHA 2I3VA 4FIMA 4R74A 4U2RA 1UQWA 2DE4A 4R9FA 1N3WA 3OO8A 4NF8B 4YAHX 3SETA 1ZBMA 2D3IA 3FXQA 5JEIA 4O3CA 2OJTA 4R6YA 1CE2A 1YCJA 1B3HA 2HQ0A 4C1UA 2DWAA 1VE4A 1DSNA 4BDLA 1B5HA 4F18A 5FHOA 2WKYA 3PV0E 4NF5A 5B7DA 3PUXE 3FVKA 1OVTA 4F3BA 3HHFA 1FTMA 3MQ9A 4RPNA 2DQVA 1VR5A 3D4GA 3SEYA 5DT6A 1TXFA 3SEWA 4ZECA 4KCDA 1IZ1A 2RC8A 1PEBA 4HW8A 3SEXA 4U4SA 3FV2A 3FVNA 5L8DA 4POWA 1Z7ME 3TCHA 3KN8A 2A5TA 1QKBA 3MVYA 3OEMA 3G3IA 3RTFB 5H8QA 3BKIB 2THIA 3RN8A 1B5JA 3VXCA 4QFLA 2HEUA 1M5DA 3OD7A 4PFYA 3AXFA 3LBSA 2F7AA 1YPNA 1FTKA 4G68A 4C1TA 5H8HB 3DLNA 3V5AA 1FW0A 2D21A 3UIFA 5KDTB 1MRPA 2V25A 2PT1A 1P99A 1PB9A 3IK6B 3ZS6A 4ELOA 1LFIA 1MY4A 4P0IA 4PFUA 4H5GA 4KQPA 5KCJA 2GRVA 1UTHB 3SKPA 1B6HA 1MG1A 3E13X 1XVXA 5DEXA 1A8FA 1MY0A 1OLCA 5FTHA 4TLLB 2QSXA 1AOVA 3RQTA 3MAMA 4RK9A 1QUKA 1JEUA 3C33A 4QFKA 1MQJA 4WEPA 1MQHA 2DOJA 3R6UA 1LAGE 4ESXA 1L5TA 2UVJA 3RNNA 3W9WA 3HHGA 3TCFA 3O9PA 1QJMA 2RF1A 3E9XA 4O3BA 3T9UA 2Q89A 4GWOA 5H8NA 4FECA 4FEBA 3O6GA 4F3GA 3QK6A 2QS4A 1GGGA 2F5XA 1LAXA 3IR1A 3VE1B 3C35A 1NNFA 5ISUA 2F97A 4NF6A 3O66A 5FHMA 3IL1B 1DPPA 2NOOA 3HSTA 3TAJA 2Y84A 1BLFA 1N04A 2HZKA 4F19A 1FTJA 2XXPA 3MW0A 5IKBA 4U21A 2F7BA 1LCTA 4U23A 4EUOA 1PB8A 3DP4A 4GOTA 3MZ9A 3PMWA 5L9SA 1WVJA 1EZ9A 2F35A 3B6QA 1ATGA 2ZYKA 4KFQA 1POTA 2X26A 4HS7A 4Q30B 2ONRA 2X7QA 3U72A 1NNPA 2UXAA 1XOCA 1KWHA 4DE8A 2VD3A 5ITPA 1Z7NE 4LUBA 3H4ZA 4G8NA 4TOZA 3TUSA 4QSCA 3GBBA 2UVGA 3OSRA 4KYEA 1PBQA 3S9EA 4RJZA 3KFMA 4MBPA 4DXUA 4LZ5A 4HTGA 1SYHA 3VFJA 4BDRA 3OELA 4FAJA 3TFLA 3U92A 4F39A 1VFDA 3T9HB 5I57B 3Q25A 4M1VA 5CM6A 1FQEA 4Z7EA 4G8HA 4H8IA 4X48A 3I6VA 3TDJA 5H8FB 3K6WA 4ZEBA 1LGBC 3KSJA 1NL5A 3FV1A 2DE2A 5L9MA 4YMAA 2ZNSA 3TQLA 1NNTA 1A40A 4NTLA 1J1NA 5ELVA 5DVIA 4OERA 4I1DA 3O29A 4ZE9A 5EHMA 3MVWA 3VDFA 4I9DA 4PETA 4POXA 3KZGA 1MDQA 2HZLA 1B3FA 4IY6A 4ELQA 5TPAA 3TZAA 3K4UA 2BJJX 4ZZAA 3EPEA 1Y3QA 5FHNA 1BIYA 4PFTA 2XXHA 3TMGA 4KYDA 3EN3A 1QVSA 3KN3A 3M3LA 2PT2A 5F7VA 4OFJA 3H3GA 3C34A 4MH5A 4LQ2A 3KOSA 4OETA 1TFDA 3MZ1A 1H44A 1B51A 1DTZA 5ICTA 3T9XB 4U1OA 4LP2B 1MQGA 3EQ1A 1SDXA 4WXJA 3OO9A 1LFGA 4NE4A 1B1XA 3MC2A 4XKNA 1XS5A 1MXUA 1TFAA 2H99A 2Y7RA 4EQ7A 4RY1A 1EU8A 3U93A 4G77A 1MH3A 3C9HA 2QJEA 3MVZA 2CMOA 2XX9A 1D9VA 5I2NA 1JW5A 3FVOA 4H0WA 1FTLA 4OFOA 1DTGA 1AMFA 3PD8A 5JK4A 1S50A 1QUJA 4RPOA 3PU5A 2ABHA 2O1MA 2Z22A 1LB8A 2AIXA 4F2OA 3KEIA 5AE4A 2ZNUA 5AA2B 1FQBA 1VSOA 3OXNA 5CMKA 4X1BA 2GHAA 1M5FA 3JZJA 3VLUA 3L6HA 5DVJA 1UTBA 4I62A 3HN0A 3K2DA 1URSA 1B0HA 1ZMGA 5IAIA 5AA2D 5I59A 1JNFA 4F1YA 1N76A 3LSFB 1IXHA 3A09A 4F3SA
chains in the Genus database with same CATH superfamily
3G3JA 4N8YA 4DIGA 3I5OA 2R9JA 4NF4B 3CG3A 1JW1A 1MM7A 3TTRA 4YICA 2DS9A 2OWZA 4GD5A 4L17A 2P2AA 3PD9A 2V3UA 1B5IA 1NNKA 1OIBA 4OFLA 4BDMA 2OBGA 4IGRA 1QKAA 4GQOA 5KZTA 1IMEA 5CBRA 2NWJA 1EZPA 1KA1A 3PUWE 4OANA 2OCUA 2ALUA 2PFZA 3MP6A 4PDHA 4MNPA 2REJA 4XIGQ 3T9VA 4P3LA 4NF8A 4GF8A 3CHGA 1OMPA 1MM6A 2CZHA 5BWJA 3ZKKA 1ZU0A 4MLVA 3MP8A 2XWOA 1SBPA 3O2AA 3KBZA 1FQFA 1N3XA 3L6GA 1FQDA 2Z8DA 2HCAA 3K6XA 5TP9B 1B58A 1H3DA 3O6IA 3ONMA 4PAIA 4R73A 5I56B 1LEVA 1MY1A 4P56A 3QUJA 4TLMB 5CMCA 1FBDA 3T93B 2RC9A 4FATA 2Y7KA 5HM4B 3IO6A 1IMFA 1QW0A 4RNSA 3OEKA 4DI4B 2I3WA 3PPQA 2X7PA 3RPWA 4NG7A 3HV1A 3SDFA 3TYHA 1B1HA 2O7UA 2OZZA 1MQIA 1QUIA 2VT5A 5ET5A 4KYSA 4FBPA 4MIJA 1SPIA 4JWOA 4ZZEA 3K00A 2P3VA 4NHBA 2FA7A 2O1LA 4KHZE 3VVEA 1LBBA 1FPBA 2B4MA 5BUUA 3FUZA 3ECRA 2F6GA 3H6VA 1FPEA 3P7IA 4JWYA 2QFLA 3UORA 1JETA 3A3CA 4OEUA 4F2QA 5I2KB 4MLQA 4IB2A 1M5CA 2XXWA 4I3YA 3I3VA 3LUYA 5L9OA 2R8TA 5DVFA 2A5TB 2CZKA 4QFOA 1XC1A 2V4CA 2F36A 1FJ9A 5H8QB 3BFTA 4X8RA 5ICQA 3S9LC 4F29A 4DXBA 1VDWA 4QF9A 5J16A 2UYFA 5H8HA 2GFEA 3IJOB 5F24A 1LB9A 3RGYA 1PB7A 3LSLA 4N6PA 5KDTA 3CSGA 5CRYA 4ZEKA 4LVQA 1NV3A 4M4GA 3FJ7A 3IJXB 1I6AA 1UTHA 1FQCA 1ZIUA 1NMUA 3K1NA 3QAXA 3Q29A 4MF3A 2XD2A 1RDYA 4QFNA 3W15C 1FTOA 3HO7A 3QXMA 2V93A 5A5LA 2F8DA 1H45A 3G7WA 1LLSA 4P9KA 4H65A 1NV4A 4YMBA 4HE0A 2Z8FA 4GBVA 4R72A 1ZJLA 2VP1A 1MXZA 4AB6A 4PC9A 2DWJA 4H1XA 4OMBA 4OQOA 4PFRA 3TQWA 1B32A 3PUVE 3C32A 3O28A 1USYH 2H25A 2RC7A 3EKIA 1NH7A 2VOZA 2B3BA 3KSXA 1F9BA 1AL3A 1SI1A 4ELRA 4BDNA 2RCAA 2Z23A 1B9JA 3TELA 4PAKA 4H46A 4ZEFA 3WAEA 1Y9UA 4C0RA 4OEVA 3IX1A 1EH3A 1NH8A 2HFBA 3M3KA 2HAVA 1A8EA 3G3FA 3OO7A 1CB6A 2RKMA 2H5YA 3K1MA 2ZZVA 2XA5A 1YAEA 3DP6A 4MNCA 2VHAA 4UA8A 4Q5TA 1Y1ZA 4R6HA 2Z8EA 3N6TA 1Y4TA 4OTEA 3TCGA 4XTCQ 2RCBA 2YJPA 4LATA 4KPTA 3C31A 2I48A 4PGPA 1Q9DA 2V84A 4YKPA 4EF2A 1B0LA 1O64A 4XEQA 2R71A 4HE2A 3TPAA 1DBZA 3K0VA 2Q88A 3CIJA 2LAOA 4QFPA 1H43A 1INPA 1WDNA 4GIZA 4OXVA 3M8UA 2E0SA 1PDAA 3KG2A 4YKIA 5I7IA 1EZOA 4IO3A 5EQ7A 3FATA 5ET7A 2I0BA 4LQ5A 1IQ7A 3QYTA 5H8FA 3CG1A 2FNCA 1GVCA 2DVZA 2Q2CA 3MUQA 2AYSA 2L5VA 2O7IA 4PQJA 1MY3A 5AA4B 4MHFA 4P1LA 2O6AA 3RT8A 3U65A 3IFCA 1MXVA 5IZ3A 2ESNA 2ZYOA 3OMBA 1NUWA 3VXBA 3HCQA 4AQ4A 1R1NA 2XX7A 3Q27A 3U94A 5TU0A 1N84A 2KR0A 4P0GA 2FVZA 1MY2A 1UIUA 1LBXA 4PE5B 4MCOA 2F7CA 4N6KA 2CZLA 1TT1A 4X9TA 1N0TA 3B7DA 3FXRA 3TTKA 1WODA 4R2FA 3CVGA 2REGA 2QS1A 1NFTA 4N6DA 4Q8RA 2F78A 3B8BA 3PPRA 4LZ7A 3D1RA 3KBRA 3ROJA 1GV8A 3H6TA 3K6UA 4N4UA 1SW1A 4XKPA 4OHNA 1BP5A 4GFRA 2KQZA 5M2VA 4DCYA 4YB6A 2XD3A 2I0CA 3N94A 5EYFA 2AL4A 4RXLA 2RINA 5JTYB 1DPEA 3DP8A 1I6QA 4GL0A 3TTLA 1YYZA 2WBBA 4NGUA 4KR5A 2PMSA 1YTVA 4E0WA 4JWXA 5K2YA 2Y5KA 3RPLA 3CFXA 4KI0E 1LFHA 1VFEA 1S9TA 2Y7WA 1NV0A 5A5XB 2Q74A 2ZYMA 2NVUB 1JQFA 4IO7A 2ZMBA 3IB1A 1SVXB 5AA2A 2ONSA 2XXKA 3PPOA 2QPQA 2QS3A 3IOTA 3N5LA 3S9NC 2IA4A 4QRZA 1LBCA 1T0KA 1JEVA 3MPKA 1DCUA 5AA3A 3B6WA 4LN5A 1Y3NA 3B6TA 1R9QA 3ISPA 2WX9A 3K1PA 4NEDA 3ILUB 4MFIA 1TWYA 1M5BA 4GX3A 4YU0A 3C4MA 3FASA 3KGCA 1O63A 4R2BA 3PMXA 3FD3A 3QUFA 1ZLQA 2D5WA 2DDKA 1P1UA 4NF4A 3OENA 1O7TA 4P11A 2QVRA 3E79A 3FBPA 4JSDA 4O94A 2VGQA 1IEJA 4HXVA 4ECFA 5T3JA 2Y7IA 4LONB 2DYXA 2XHDA 4GLIA 1PBPA 1SW2A 5ET8A 3LSXA 4WEDA 5I58B 1MQDA 4GWUA 1MDP1 1B05A 2QRYA 4P8BA 4RYAA 4E0XA 2QVVA 2H98A 4PDDA 3ZSFA 2XXVA 1OQHA 1SW4A 3PPNA 4QSDA 3LR1A 4YKKA 2B65A 2UVHA 4LZ8A 3SESA 4BLAA 4GVOA 3MBPA 3WAFA 1D4NA 3K6VA 4TQUQ 2OWSA 4IGTA 4FJPA 1US4A 4R75A 3HFUA 3PTYA 1NV1A 2V3TA 1MXXA 2XXQA 4QHQA 1MPCA 1R6ZA 1DMBA 2H9BA 5EHSA 3Q28A 4ZEDA 4U4XA 1B40A 1ELJA 3K01A 3PUZE 1LBZA 3SEVA 2XXUA 3T22A 2GHBA 5TP9A 4GXSB 4I8CA 5I56A 4DCXA 4OWDA 4FORA 2XXXA 2ZZXA 3KOTA 2R6GE 1HSEA 3B50A 4O8MA 3FJMA 1FTAA 1QGXA 2OLBA 2Q8JA 3PMVA 4NF5B 3IOUA 3CSBA 3ODBA 4R6KA 3TTNA 2ONKE 1LAFE 1R9LA 3MZBA 1A7LA 2PFYA 3OOAA 4OVJA 4THIA 4NX1A 3UN6A 2GH9A 2NUVA 4OVSA 4EF1A 3IB0A 2VPNA 4F22A 4H8JA 1LAHE 4RK2A 4OENA 3CFLA 4KXPA 2Y7PA 4ZDMA 1AIVA 4PBQA 3RYDA 4I3EA 2FIEA 5I2KA 1OQGA 1FRPA 2XXIA 1B7UA 5J1DA 2HXRA 1DOTA 4RA1A 5I84A 2F34A 4UACA 2PBWA 2ZNTA 1BKAA 4N81A 3RY3A 2DE3A 1LCFA 1B7ZA 3MJNA 2CEXA 2CEYA 4BDOA 1MS7A 1EYKA 1NI9A 1IITA 2XWIA 4OA4A 1P1OA 3CI8A 4PF8A 1N7WA 3S9MC 5EYGA 4KCCA 1FCKA 3T96B 2DXRA 3O6HA 1HSJA 2WYKA 2MKZA 1KZ8A 3VLVA 2A5SA 2O51A 3EHTA 3IO4A 3VLWA 4KD5A 4G68B 2F6PA 3R7XA 5F1QA 2M8CA 1Y3PA 3E4RA 3KN7A 4OVQA 3IOVA 3Q26A 2Q2AA 1RKMA 1OLAA 2F3BA 4WKMA 2OK2A 1NUYA 3W9VA 4HCWA 1URDA 5IZZA 2FYIA 2F3DA 1II5A 5KCJB 3KJ7A 1NV5A 4NMYA 4F1UA 1D9YA 5DEXB 4JXIA 1Y20A 4PF6A 1B3LA 2DVCA 1QULA 3SEUA 4GX4A 4LA9A 2QMXA 2ZXTA 3CFZA 2XX8A 1A99A 2KLFA 4R9GA 3H7MA 4ZS9A 2I49A 1IIWA 4EXLA 2XXYA 1JW4A 5IM2A 3GZGA 1SQYA 5I5PA 4QBAA 3JYRA 1ZKBA 4EQ9A 3ZKLA 4ONYA 4H5FA 5AA1A 1ZTYA 4GWXA 5H8NB 2PX1A 2P0SA 1YZ0A 1LBYA 4G68C 5K2XA 4OYVA 4DLDA 1RDXA 4PGNA 3CRBA 1A55A 3S4UA 2P1SA 2PYYA 3LSWA 4GWSA 3E78A 4NF6B 4G8MA 4O7IA 1MH4A 3QSLA 4X1DA 2DP8A 2I58A 4H45A 3T66A 4JVCA 3A3UA 3DELB 3FJGA 1G0HA 2DWIA 2AL5A 4DDDA 2UVIA 3IB2A 1XHYA 4ZE8A 2YPNA 3UA8A 3RUMA 4DXCA 3U1OA 1XVYA 4N15A 1MPBA 5FTIA 3F11A 4PBHA 1JVXA 1US5A 4H67A 2QVUA 4G4PA 4G2ZA 5CMMA 1M5EA 4PFIA 1EYJA 3MPLA 4HE1A 1BTJA 1Q1KA 1MPDA 1I6BA 2XWVA 5CI5A 4JVDA 1LSTA 4G61A 1BK4A 1USYE 3E3KA 1B3GA 2VD2A 4FE8A 4ND9A 3VV5A 2H4IA 4JSOA 3V89B 1PC3A 3M3FA 4MEVA 2PVUA 4OESA 3UGWA 2JJKA 2Q9TA 3K02A 3FZVA 3U8QA 1P1NA 5CMBA 2XXTA 5ITOA 4ESWA 3CR9A 4F3PA 5I57A 3ILTB 4F31B 3FGSA 3EHUA 3VVDA 4AS5A 5EQ9A 4P47A 1YXIA 2B4LA 3IORA 2HAUA 3TKDA 4BDQA 5AA4A 3BIHA 3PGFA 3BBRA 4IO6A 3QMFA 5HBCA 3OO6A 1IXIA 3GXAA 4HCYA 3MWBA 1SD3A 1AH5A 4YB7A 1IXCA 3MP1A 3LC8A 3EHSA 4EXKA 3USDA 1IUDA 1POY1 2DWHA 3UK4A 1P1WA 1B46A 2I4BA 2E1SA 4JVIA 2QMWA 3SZPA 4N13A 3QIMA 3THIA 5HPQA 2OWTA 3FXBA 2O84X 4OZ9A 3H6UA 1GR2A 1JP4A 3FXUA 2DSFA 3D4CA 4X04A 3C36A 3LUZA 4IY5A 1Q35A 3FIRA 5H8SA 3H06B 4FEDA 4GRKA 1H76A 4AB5A 4GWYA 5TPAB 1Y1MA 5EQ8A 3KC1A 2I6EA 3H6WA 4YB5A 5IGAA 3IOWA 4MMPA 4IO2A 4JBZA 3O97A 3N26A 1A54A 4ZEIA 3IAZA 4NF0A 2ANJA 4ISUA 3DM0A 3TTMA 3V8XB 5JTYA 4EQBA 1B2HA 4DZ1A 3HPIA 3BIGA 2O68A 4JB7A 4IO5A 3KC0A 4PP0A 1N7XA 4N17A 1D3KA 2QS2A 1IXGA 4O3AA 3MSTA 1DK4A 3FVGA 4O7MA 1S7YA 4PCDA 1FPDA 5CC2A 1XT8A 3UP9A 5EYHA 2B3FA 5A5XA 1D9QA 3T1BA 4U1ZA 5LDZA 4PFWA 1GTKA 5I2NB 1HSLA 3G3KA 4NWDA 1FPFA 2W7YA 3RPLB 2XWKA 2UYEA 3PPPA 1RDZA 1SI0A 1FSAA 4GL8A 1MXWA 3JV9A 4XXUA 4EDPA 1MXYA 4OVTA 1B4HA 4K3FA 3BFUA 1RYOA 1SYIA 4JDFA 1IMDA 3N6UA 4NWCA 4OVPA 3V83A 3MVXA 4YKJA 5CBSA 3H03A 3IFAA 4GWZA 2O69A 4H6DA 2ZYNA 3TODA 3R26A 1B7HA 2DXYA 1B4ZA 5LOMA 2NXOA 2YLNA 4F1VA 1UTBB 3EF7A 1G0IA 1NKXA 1SW5A 3S2VA 1I69A 3G3GA 1UIVA 1P1QA 2G93A 4Q0CA 2XXRA 3TEPA 2OX3A 4GXAA 5I59B 4IO4A 1B3EA 3RLFE 2G29A 1FQAA 1ANFA 3GLBA 3KJTA 5B70A 2VPOA 3G3HA 3SERA 3RT6B 1JVYA 1OVBA 3GBAA 5I58A 5DTBA 4Z0IA 2HXWA 4YZZA 4N07A 1B52A 4ELPA 1RYXA 1URGA 4XKRA 4XKQA 1FPGA 4AS4A 3PUYE 2IEEA 4U22A 4MNIA 3VVFA 4MJOA 2QL3A 3OSQA 4QSEA 2V3QA 1Y4CA 3RTWB 2I4CA 5DYHA 1FBPA 2I3VA 4FIMA 4U2RA 4R74A 1K9ZA 1NV6A 1UQWA 2DE4A 4R9FA 1N3WA 3OO8A 4NF8B 4YAHX 3SETA 1ZBMA 2D3IA 3FXQA 5JEIA 4O3CA 2OJTA 4R6YA 1CE2A 1YCJA 1B3HA 1FBFA 2HQ0A 4C1UA 2DWAA 1VE4A 1DSNA 4BDLA 4P1EA 1B5HA 4F18A 5FHOA 2WKYA 3PV0E 4NF5A 5B7DA 5FBPA 3PUXE 1NV2A 1AWBA 1OVTA 3FVKA 4F3BA 3HHFA 1FTMA 3MQ9A 4RPNA 2DQVA 1IMBA 1VR5A 3D4GA 4PFBA 3SEYA 5DT6A 1TXFA 3SEWA 4ZECA 4KCDA 1IZ1A 2RC8A 1PEBA 4HW8A 4NAPA 4OVRA 3SEXA 4U4SA 3FV2A 3FVNA 5L8DA 4POWA 1Z7ME 3KN8A 3TCHA 2A5TA 1QKBA 3MVYA 3OEMA 3G3IA 1NV7A 3RTFB 5H8QA 4NQ8A 3BKIB 2THIA 3RN8A 1FPLA 1B5JA 3VXCA 4QFLA 2ZZWA 2HEUA 1M5DA 3OD7A 4PFYA 3AXFA 3LBSA 2F7AA 1K9YA 1YPNA 4N8GA 1FTKA 4G68A 4C1TA 5H8HB 3DLNA 3V5AA 1FW0A 2D21A 3UIFA 1NUXA 5KDTB 1MRPA 2HHMA 2V25A 2PT1A 1P99A 1PB9A 3IK6B 3ZS6A 4ELOA 1LFIA 4GX6A 5I3SA 1MY4A 4P0IA 4PFUA 4H5GA 4KQPA 5KCJA 2GRVA 1UTHB 4UABA 3SKPA 1B6HA 1MG1A 3E13X 3NOHA 1XVXA 5DEXA 1A8FA 1MY0A 1OLCA 5FTHA 4TLLB 2FIXA 2QSXA 4GBWA 1AOVA 3RQTA 3MAMA 4RK9A 1QUKA 4PAFA 1JEUA 3C33A 4QFKA 1MQJA 4WEPA 5ET6A 1MQHA 2DOJA 3R6UA 5IZ1A 1LAGE 4XF5A 4ESXA 1L5TA 2UVJA 3RNNA 5LTCA 3W9WA 3HHGA 3TCFA 3O9PA 1QJMA 2RF1A 3E9XA 4O3BA 3T9UA 2Q89A 4GWOA 2PCRA 5H8NA 4FECA 4FEBA 3O6GA 4F3GA 5ESYA 3QK6A 2QS4A 1GGGA 2F5XA 1LAXA 1KA0A 3IR1A 3VE1B 3C35A 1NNFA 5ISUA 2F97A 1FPKA 4NF6A 3O66A 5FHMA 3IL1B 1DPPA 2NOOA 3HSTA 3TAJA 2Y84A 2CZIA 1BLFA 3GYYA 1N04A 2HZKA 4F19A 1FTJA 2XXPA 3MW0A 5IKBA 4U21A 2F7BA 1LCTA 4U23A 4EUOA 1PB8A 1FBHA 1EYIA 1XI6A 3DP4A 4GOTA 3MZ9A 3PMWA 5L9SA 1WVJA 1EZ9A 2F35A 3B6QA 1ATGA 2ZYKA 4KFQA 1POTA 2X26A 4HS7A 1FBGA 4Q30B 2ONRA 4DI3D 2X7QA 3U72A 1NNPA 2UXAA 3LV0A 1XOCA 1KWHA 4DE8A 2VD3A 5ITPA 1Z7NE 4LUBA 1IMAA 3H4ZA 4G8NA 4TOZA 3TUSA 4QSCA 3GBBA 2UVGA 3OSRA 4KYEA 1PBQA 3S9EA 4RJZA 3KFMA 4MBPA 4DXUA 4LZ5A 4HTGA 1SYHA 3VFJA 4BDRA 4MAGA 4I40A 3OELA 4FAJA 2BJIA 2WBDA 3TFLA 3U92A 4F39A 1VFDA 5DW8A 3T9HB 5I57B 5EQAA 3Q25A 4M1VA 5CM6A 1FQEA 4Z7EA 4G8HA 4H8IA 4X48A 1FPJA 3I6VA 2P3NA 3TDJA 5H8FB 3K6WA 4ZEBA 1LGBC 3KSJA 1NL5A 3FV1A 2DE2A 5L9MA 4YMAA 2ZNSA 3TQLA 1NNTA 1LBWA 1A40A 2Q8MA 4NTLA 1J1NA 5IZ3B 1FBEA 5ELVA 5DVIA 4OERA 4I1DA 3O29A 4ZE9A 5EHMA 3MVWA 1FBCA 3VDFA 4I9DA 4PETA 4GWWA 3MYUA 4QXDA 4POXA 3KZGA 1MDQA 2HZLA 1B3FA 2GQ1A 4IY6A 5TPAA 4ELQA 3TZAA 3K4UA 2BJJX 4ZZAA 3EPEA 1Y3QA 2HPGA 5FHNA 1BIYA 4PFTA 2XXHA 3TMGA 4KYDA 3EN3A 1QVSA 3KN3A 3M3LA 2FBPA 2PT2A 5F7VA 4OFJA 3H3GA 3C34A 2WYPA 4MH5A 4LQ2A 3KOSA 4OETA 1TFDA 3MZ1A 1H44A 1B51A 1DTZA 5ICTA 3T9XB 1NUZA 4U1OA 4LP2B 4PE3A 1MQGA 3EQ1A 1SDXA 3T0JA 4WXJA 3OO9A 1IMCA 1LFGA 4NE4A 1B1XA 3MC2A 4XKNA 4PTKA 1XS5A 1MXUA 1TFAA 2H99A 2Y7RA 4RY1A 4EQ7A 1EU8A 3U93A 4G77A 1MH3A 3C9HA 2QJEA 3MVZA 2CMOA 2XX9A 1D9VA 4NN3A 5I2NA 1JW5A 2WEFA 3FVOA 4H0WA 1FTLA 4OFOA 1DTGA 1AMFA 3PD8A 5JK4A 2Y5LA 1S50A 1QUJA 4IR8A 4MX6A 4RPOA 3PU5A 3A29A 2ABHA 2O1MA 2Z22A 4N91A 1LB8A 2AIXA 4F2OA 3KEIA 5AE4A 2ZNUA 5AA2B 1FQBA 1VSOA 3OXNA 5CMKA 4X1BA 2GHAA 1M5FA 3JZJA 3VLUA 3L6HA 5DVJA 1UTBA 2FHYA 4I62A 1LBVA 3HN0A 3K2DA 1URSA 1B0HA 1ZMGA 5IAIA 5AA2D 5I59A 1JNFA 4F1YA 1CNQA 1N76A 3LSFB 1IXHA 4XFEA 1FPIA 3A09A 4F3SA 1FJ6A
chains in the Genus database with same CATH topology
3G3JA 4DIGA 3I5OA 2R9JA 4NF4B 3CG3A 1JW1A 1MM7A 3TTRA 4YICA 2DS9A 4GD5A 4L17A 2P2AA 3PD9A 2V3UA 1B5IA 1NNKA 1OIBA 4OFLA 4BDMA 2OBGA 4IGRA 1QKAA 4GQOA 5KZTA 5CBRA 2NWJA 1EZPA 3PUWE 2OCUA 2ALUA 3MP6A 2REJA 4XIGQ 3T9VA 4NF8A 4GF8A 1OMPA 1MM6A 5BWJA 3ZKKA 1ZU0A 4MLVA 3MP8A 1SBPA 3O2AA 1FQFA 1N3XA 3L6GA 1FQDA 2Z8DA 2HCAA 3K6XA 5TP9B 1B58A 1H3DA 3O6IA 3ONMA 4R73A 5I56B 1MY1A 3QUJA 4TLMB 5CMCA 3T93B 2RC9A 4FATA 2Y7KA 5HM4B 3IO6A 1QW0A 4RNSA 3OEKA 2I3WA 3PPQA 2X7PA 3RPWA 3HV1A 3SDFA 3TYHA 1B1HA 2O7UA 2OZZA 1MQIA 1QUIA 4KYSA 4JWOA 4ZZEA 3K00A 2FA7A 2O1LA 4KHZE 3VVEA 1LBBA 5BUUA 3FUZA 3ECRA 2F6GA 3H6VA 3P7IA 4JWYA 3UORA 1JETA 3A3CA 4OEUA 4F2QA 5I2KB 4MLQA 4IB2A 1M5CA 2XXWA 3I3VA 3LUYA 5L9OA 5DVFA 2A5TB 4QFOA 1XC1A 2F36A 5H8QB 3BFTA 5ICQA 3S9LC 4F29A 4DXBA 4QF9A 2UYFA 5H8HA 2GFEA 3IJOB 1LB9A 3RGYA 1PB7A 3LSLA 4N6PA 5KDTA 3CSGA 5CRYA 4ZEKA 4LVQA 4M4GA 3FJ7A 3IJXB 1I6AA 1UTHA 1FQCA 1ZIUA 1NMUA 3K1NA 3QAXA 3Q29A 4MF3A 2XD2A 4QFNA 3W15C 1FTOA 3HO7A 3QXMA 2V93A 2F8DA 1H45A 3G7WA 1LLSA 4H65A 4YMBA 2Z8FA 4R72A 1ZJLA 2VP1A 1MXZA 4AB6A 2DWJA 4H1XA 4OMBA 4OQOA 3TQWA 1B32A 3PUVE 3C32A 3O28A 1USYH 2H25A 2RC7A 1NH7A 2VOZA 2B3BA 3KSXA 1F9BA 1AL3A 1SI1A 4ELRA 4BDNA 2RCAA 2Z23A 1B9JA 3TELA 4ZEFA 3WAEA 1Y9UA 4C0RA 4OEVA 3IX1A 1EH3A 1NH8A 2HFBA 3M3KA 2HAVA 1A8EA 3G3FA 3OO7A 1CB6A 2RKMA 2H5YA 3K1MA 1YAEA 3DP6A 2VHAA 4UA8A 4Q5TA 1Y1ZA 4R6HA 2Z8EA 3N6TA 1Y4TA 4OTEA 3TCGA 4XTCQ 2RCBA 2YJPA 4LATA 4KPTA 3C31A 2I48A 2V84A 4YKPA 4EF2A 1B0LA 1O64A 2R71A 3TPAA 3K0VA 2Q88A 3CIJA 2LAOA 4QFPA 1H43A 1WDNA 4GIZA 4OXVA 3M8UA 2E0SA 1PDAA 3KG2A 4YKIA 1EZOA 4IO3A 3FATA 2I0BA 4LQ5A 1IQ7A 3QYTA 5H8FA 3CG1A 2FNCA 1GVCA 2DVZA 2Q2CA 3MUQA 2AYSA 2O7IA 4PQJA 1MY3A 5AA4B 2O6AA 3RT8A 1MXVA 2ESNA 2ZYOA 3OMBA 3VXBA 3HCQA 4AQ4A 1R1NA 2XX7A 3Q27A 3U94A 5TU0A 1N84A 4P0GA 1MY2A 1UIUA 4PE5B 2F7CA 2CZLA 1TT1A 4X9TA 1N0TA 3B7DA 3FXRA 3TTKA 1WODA 4R2FA 3CVGA 2REGA 2QS1A 1NFTA 4Q8RA 2F78A 3PPRA 4LZ7A 3KBRA 1GV8A 3H6TA 3K6UA 1SW1A 4XKPA 4OHNA 1BP5A 4GFRA 5M2VA 4DCYA 4YB6A 2XD3A 2I0CA 3N94A 5EYFA 2AL4A 4RXLA 2RINA 5JTYB 1DPEA 3DP8A 1I6QA 4GL0A 3TTLA 4KR5A 2PMSA 1YTVA 4E0WA 4JWXA 5K2YA 3CFXA 4KI0E 1LFHA 1VFEA 1S9TA 2Y7WA 5A5XB 2ZYMA 2NVUB 1JQFA 4IO7A 2ZMBA 3IB1A 1SVXB 5AA2A 2ONSA 3PPOA 2QPQA 2QS3A 3IOTA 3N5LA 3S9NC 2IA4A 4QRZA 1LBCA 1T0KA 1JEVA 3MPKA 5AA3A 3B6WA 1Y3NA 3B6TA 1R9QA 3K1PA 4NEDA 3ILUB 4MFIA 1TWYA 1M5BA 4YU0A 3C4MA 3FASA 3KGCA 1O63A 4R2BA 3PMXA 3FD3A 3QUFA 1ZLQA 2D5WA 1P1UA 4NF4A 3OENA 1O7TA 4P11A 4JSDA 2VGQA 1IEJA 4ECFA 2Y7IA 4LONB 2DYXA 2XHDA 4GLIA 1PBPA 1SW2A 3LSXA 4WEDA 5I58B 1MQDA 1MDP1 1B05A 2QRYA 4RYAA 4E0XA 2H98A 3ZSFA 2XXVA 1OQHA 1SW4A 3PPNA 4QSDA 3LR1A 4YKKA 2B65A 2UVHA 4LZ8A 3SESA 4BLAA 4GVOA 3MBPA 3WAFA 1D4NA 3K6VA 4TQUQ 2OWSA 4IGTA 4FJPA 1US4A 4R75A 2V3TA 1MXXA 2XXQA 4QHQA 1MPCA 1R6ZA 1DMBA 2H9BA 5EHSA 3Q28A 4ZEDA 4U4XA 1B40A 1ELJA 3K01A 3PUZE 3SEVA 2XXUA 3T22A 2GHBA 5TP9A 4GXSB 4I8CA 5I56A 4DCXA 4OWDA 4FORA 2XXXA 3KOTA 2R6GE 1HSEA 3FJMA 2OLBA 2Q8JA 3PMVA 4NF5B 3IOUA 3CSBA 3ODBA 4R6KA 3TTNA 2ONKE 1LAFE 1R9LA 3MZBA 1A7LA 3OOAA 4OVJA 4THIA 3UN6A 2GH9A 2NUVA 4EF1A 3IB0A 4F22A 4H8JA 1LAHE 4RK2A 4OENA 3CFLA 2Y7PA 4ZDMA 1AIVA 5I2KA 1OQGA 2XXIA 1B7UA 5J1DA 1DOTA 4RA1A 5I84A 2F34A 2PBWA 2ZNTA 4UACA 1BKAA 3RY3A 2DE3A 1LCFA 1B7ZA 3MJNA 4BDOA 1MS7A 1IITA 1P1OA 3CI8A 1N7WA 3S9MC 4KCCA 1FCKA 3T96B 2DXRA 3O6HA 1HSJA 3VLVA 2A5SA 2O51A 3EHTA 3IO4A 3VLWA 4KD5A 4G68B 2F6PA 3R7XA 5F1QA 2M8CA 1Y3PA 3E4RA 3KN7A 3IOVA 3Q26A 2Q2AA 1RKMA 1OLAA 4WKMA 2OK2A 3W9VA 4HCWA 1URDA 2FYIA 1II5A 5KCJB 3KJ7A 4NMYA 4F1UA 1D9YA 5DEXB 4JXIA 1Y20A 1B3LA 2DVCA 1QULA 3SEUA 4LA9A 2QMXA 2ZXTA 3CFZA 2XX8A 1A99A 2KLFA 4R9GA 3H7MA 4ZS9A 2I49A 1IIWA 4EXLA 2XXYA 1JW4A 3GZGA 1SQYA 3JYRA 1ZKBA 4EQ9A 3ZKLA 4ONYA 4H5FA 5AA1A 1ZTYA 5H8NB 2PX1A 2P0SA 4G68C 5K2XA 4OYVA 4DLDA 3CRBA 1A55A 3S4UA 2P1SA 2PYYA 3LSWA 4NF6B 4G8MA 1MH4A 3QSLA 4X1DA 2DP8A 2I58A 3T66A 3A3UA 3DELB 3FJGA 2DWIA 2AL5A 4DDDA 2UVIA 3IB2A 1XHYA 4ZE8A 2YPNA 3UA8A 3RUMA 4DXCA 3U1OA 1XVYA 1MPBA 5FTIA 3F11A 1JVXA 1US5A 4H67A 4G4PA 4G2ZA 5CMMA 1M5EA 3MPLA 1BTJA 1Q1KA 1MPDA 1I6BA 5CI5A 1LSTA 1USYE 3E3KA 1B3GA 2VD2A 4FE8A 4ND9A 3VV5A 2H4IA 4JSOA 3V89B 1PC3A 3M3FA 4OESA 2PVUA 3UGWA 2Q9TA 3K02A 3FZVA 3U8QA 1P1NA 5CMBA 2XXTA 5ITOA 4ESWA 3CR9A 4F3PA 5I57A 3ILTB 4F31B 3FGSA 3EHUA 3VVDA 3IORA 2HAUA 3TKDA 4BDQA 5AA4A 3PGFA 3BBRA 4IO6A 5HBCA 3OO6A 1IXIA 3GXAA 4HCYA 3MWBA 1SD3A 1AH5A 4YB7A 1IXCA 3MP1A 3LC8A 3EHSA 4EXKA 3USDA 1IUDA 1POY1 2DWHA 3UK4A 1P1WA 1B46A 2I4BA 2E1SA 2QMWA 4N13A 3QIMA 3THIA 5HPQA 2OWTA 2O84X 4OZ9A 3H6UA 1GR2A 3FXUA 2DSFA 3D4CA 3C36A 4IY5A 1Q35A 3FIRA 5H8SA 3H06B 4FEDA 4GRKA 1H76A 4AB5A 5TPAB 1Y1MA 2I6EA 3H6WA 4YB5A 3IOWA 4IO2A 4JBZA 3O97A 3N26A 1A54A 4ZEIA 3IAZA 2ANJA 4ISUA 3DM0A 3TTMA 3V8XB 5JTYA 4EQBA 1B2HA 4DZ1A 3HPIA 2O68A 4JB7A 4IO5A 4PP0A 1N7XA 1D3KA 2QS2A 1IXGA 4O3AA 3FVGA 1S7YA 5CC2A 1XT8A 3UP9A 2B3FA 5A5XA 4U1ZA 4PFWA 1GTKA 5I2NB 1HSLA 3G3KA 4NWDA 2W7YA 2UYEA 3PPPA 1SI0A 4GL8A 1MXWA 3JV9A 4XXUA 4EDPA 1MXYA 1B4HA 4K3FA 3BFUA 1RYOA 1SYIA 4JDFA 3N6UA 4NWCA 3V83A 3MVXA 4YKJA 5CBSA 3H03A 2O69A 4H6DA 2ZYNA 3TODA 3R26A 1B7HA 2DXYA 1B4ZA 5LOMA 2NXOA 2YLNA 4F1VA 1UTBB 3EF7A 1NKXA 1SW5A 3S2VA 1I69A 3G3GA 1UIVA 1P1QA 2G93A 4Q0CA 2XXRA 3TEPA 4GXAA 5I59B 4IO4A 1B3EA 3RLFE 2G29A 1FQAA 1ANFA 3GLBA 3KJTA 5B70A 3G3HA 3SERA 3RT6B 1JVYA 1OVBA 3GBAA 5I58A 5DTBA 4Z0IA 2HXWA 4YZZA 4N07A 1B52A 4ELPA 1RYXA 1URGA 4XKRA 4XKQA 3PUYE 2IEEA 4U22A 3VVFA 2QL3A 3OSQA 4QSEA 2V3QA 1Y4CA 3RTWB 2I4CA 5DYHA 2I3VA 4FIMA 4R74A 4U2RA 1UQWA 2DE4A 4R9FA 1N3WA 3OO8A 4NF8B 4YAHX 3SETA 1ZBMA 2D3IA 3FXQA 5JEIA 4O3CA 2OJTA 4R6YA 1CE2A 1YCJA 1B3HA 2HQ0A 4C1UA 2DWAA 1VE4A 1DSNA 4BDLA 1B5HA 4F18A 5FHOA 2WKYA 3PV0E 4NF5A 5B7DA 3PUXE 3FVKA 1OVTA 4F3BA 3HHFA 1FTMA 3MQ9A 4RPNA 2DQVA 1VR5A 3D4GA 3SEYA 5DT6A 1TXFA 3SEWA 4ZECA 4KCDA 1IZ1A 2RC8A 1PEBA 4HW8A 3SEXA 4U4SA 3FV2A 3FVNA 5L8DA 4POWA 1Z7ME 3TCHA 3KN8A 2A5TA 1QKBA 3MVYA 3OEMA 3G3IA 3RTFB 5H8QA 3BKIB 2THIA 3RN8A 1B5JA 3VXCA 4QFLA 2HEUA 1M5DA 3OD7A 4PFYA 3AXFA 3LBSA 2F7AA 1YPNA 1FTKA 4G68A 4C1TA 5H8HB 3DLNA 3V5AA 1FW0A 2D21A 3UIFA 5KDTB 1MRPA 2V25A 2PT1A 1P99A 1PB9A 3IK6B 3ZS6A 4ELOA 1LFIA 1MY4A 4P0IA 4PFUA 4H5GA 4KQPA 5KCJA 2GRVA 1UTHB 3SKPA 1B6HA 1MG1A 3E13X 1XVXA 5DEXA 1A8FA 1MY0A 1OLCA 5FTHA 4TLLB 2QSXA 1AOVA 3RQTA 3MAMA 4RK9A 1QUKA 1JEUA 3C33A 4QFKA 1MQJA 4WEPA 1MQHA 2DOJA 3R6UA 1LAGE 4ESXA 1L5TA 2UVJA 3RNNA 3W9WA 3HHGA 3TCFA 3O9PA 1QJMA 2RF1A 3E9XA 4O3BA 3T9UA 2Q89A 4GWOA 5H8NA 4FECA 4FEBA 3O6GA 4F3GA 3QK6A 2QS4A 1GGGA 2F5XA 1LAXA 3IR1A 3VE1B 3C35A 1NNFA 5ISUA 2F97A 4NF6A 3O66A 5FHMA 3IL1B 1DPPA 2NOOA 3HSTA 3TAJA 2Y84A 1BLFA 1N04A 2HZKA 4F19A 1FTJA 2XXPA 3MW0A 5IKBA 4U21A 2F7BA 1LCTA 4U23A 4EUOA 1PB8A 3DP4A 4GOTA 3MZ9A 3PMWA 5L9SA 1WVJA 1EZ9A 2F35A 3B6QA 1ATGA 2ZYKA 4KFQA 1POTA 2X26A 4HS7A 4Q30B 2ONRA 2X7QA 3U72A 1NNPA 2UXAA 1XOCA 1KWHA 4DE8A 2VD3A 5ITPA 1Z7NE 4LUBA 3H4ZA 4G8NA 4TOZA 3TUSA 4QSCA 3GBBA 2UVGA 3OSRA 4KYEA 1PBQA 3S9EA 4RJZA 3KFMA 4MBPA 4DXUA 4LZ5A 4HTGA 1SYHA 3VFJA 4BDRA 3OELA 4FAJA 3TFLA 3U92A 4F39A 1VFDA 3T9HB 5I57B 3Q25A 4M1VA 5CM6A 1FQEA 4Z7EA 4G8HA 4H8IA 4X48A 3I6VA 3TDJA 5H8FB 3K6WA 4ZEBA 1LGBC 3KSJA 1NL5A 3FV1A 2DE2A 5L9MA 4YMAA 2ZNSA 3TQLA 1NNTA 1A40A 4NTLA 1J1NA 5ELVA 5DVIA 4OERA 4I1DA 3O29A 4ZE9A 5EHMA 3MVWA 3VDFA 4I9DA 4PETA 4POXA 3KZGA 1MDQA 2HZLA 1B3FA 4IY6A 4ELQA 5TPAA 3TZAA 3K4UA 2BJJX 4ZZAA 3EPEA 1Y3QA 5FHNA 1BIYA 4PFTA 2XXHA 3TMGA 4KYDA 3EN3A 1QVSA 3KN3A 3M3LA 2PT2A 5F7VA 4OFJA 3H3GA 3C34A 4MH5A 4LQ2A 3KOSA 4OETA 1TFDA 3MZ1A 1H44A 1B51A 1DTZA 5ICTA 3T9XB 4U1OA 4LP2B 1MQGA 3EQ1A 1SDXA 4WXJA 3OO9A 1LFGA 4NE4A 1B1XA 3MC2A 4XKNA 1XS5A 1MXUA 1TFAA 2H99A 2Y7RA 4EQ7A 4RY1A 1EU8A 3U93A 4G77A 1MH3A 3C9HA 2QJEA 3MVZA 2CMOA 2XX9A 1D9VA 5I2NA 1JW5A 3FVOA 4H0WA 1FTLA 4OFOA 1DTGA 1AMFA 3PD8A 5JK4A 1S50A 1QUJA 4RPOA 3PU5A 2ABHA 2O1MA 2Z22A 1LB8A 2AIXA 4F2OA 3KEIA 5AE4A 2ZNUA 5AA2B 1FQBA 1VSOA 3OXNA 5CMKA 4X1BA 2GHAA 1M5FA 3JZJA 3VLUA 3L6HA 5DVJA 1UTBA 4I62A 3HN0A 3K2DA 1URSA 1B0HA 1ZMGA 5IAIA 5AA2D 5I59A 1JNFA 4F1YA 1N76A 3LSFB 1IXHA 3A09A 4F3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3J A;  4DIG A;  3I5O A;  2R9J A;  4NF4 B;  3CG3 A;  1JW1 A;  1MM7 A;  3TTR A;  4YIC A;  2DS9 A;  4GD5 A;  4L17 A;  2P2A A;  3PD9 A;  2V3U A;  1B5I A;  1NNK A;  1OIB A;  4OFL A;  4BDM A;  2OBG A;  4IGR A;  1QKA A;  4GQO A;  5KZT A;  5CBR A;  2NWJ A;  1EZP A;  3PUW E;  2OCU A;  2ALU A;  3MP6 A;  2REJ A;  4XIG Q;  3T9V A;  4NF8 A;  4GF8 A;  1OMP A;  1MM6 A;  5BWJ A;  3ZKK A;  1ZU0 A;  4MLV A;  3MP8 A;  1SBP A;  3O2A A;  1FQF A;  1N3X A;  3L6G A;  1FQD A;  2Z8D A;  2HCA A;  3K6X A;  5TP9 B;  1B58 A;  1H3D A;  3O6I A;  3ONM A;  4R73 A;  5I56 B;  1MY1 A;  3QUJ A;  4TLM B;  5CMC A;  3T93 B;  2RC9 A;  4FAT A;  2Y7K A;  5HM4 B;  3IO6 A;  1QW0 A;  4RNS A;  3OEK A;  2I3W A;  3PPQ A;  2X7P A;  3RPW A;  3HV1 A;  3SDF A;  3TYH A;  1B1H A;  2O7U A;  2OZZ A;  1MQI A;  1QUI A;  4KYS A;  4JWO A;  4ZZE A;  3K00 A;  2FA7 A;  2O1L A;  4KHZ E;  3VVE A;  1LBB A;  5BUU A;  3FUZ A;  3ECR A;  2F6G A;  3H6V A;  3P7I A;  4JWY A;  3UOR A;  1JET A;  3A3C A;  4OEU A;  4F2Q A;  5I2K B;  4MLQ A;  4IB2 A;  1M5C A;  2XXW A;  3I3V A;  3LUY A;  5L9O A;  5DVF A;  2A5T B;  4QFO A;  1XC1 A;  2F36 A;  5H8Q B;  3BFT A;  5ICQ A;  3S9L C;  4F29 A;  4DXB A;  4QF9 A;  2UYF A;  5H8H A;  2GFE A;  3IJO B;  1LB9 A;  3RGY A;  1PB7 A;  3LSL A;  4N6P A;  5KDT A;  3CSG A;  5CRY A;  4ZEK A;  4LVQ A;  4M4G A;  3FJ7 A;  3IJX B;  1I6A A;  1UTH A;  1FQC A;  1ZIU A;  1NMU A;  3K1N A;  3QAX A;  3Q29 A;  4MF3 A;  2XD2 A;  4QFN A;  3W15 C;  1FTO A;  3HO7 A;  3QXM A;  2V93 A;  2F8D A;  1H45 A;  3G7W A;  1LLS A;  4H65 A;  4YMB A;  2Z8F A;  4R72 A;  1ZJL A;  2VP1 A;  1MXZ A;  4AB6 A;  2DWJ A;  4H1X A;  4OMB A;  4OQO A;  3TQW A;  1B32 A;  3PUV E;  3C32 A;  3O28 A;  1USY H;  2H25 A;  2RC7 A;  1NH7 A;  2VOZ A;  2B3B A;  3KSX A;  1F9B A;  1AL3 A;  1SI1 A;  4ELR A;  4BDN A;  2RCA A;  2Z23 A;  1B9J A;  3TEL A;  4ZEF A;  3WAE A;  1Y9U A;  4C0R A;  4OEV A;  3IX1 A;  1EH3 A;  1NH8 A;  2HFB A;  3M3K A;  2HAV A;  1A8E A;  3G3F A;  3OO7 A;  1CB6 A;  2RKM A;  2H5Y A;  3K1M A;  1YAE A;  3DP6 A;  2VHA A;  4UA8 A;  4Q5T A;  1Y1Z A;  4R6H A;  2Z8E A;  3N6T A;  1Y4T A;  4OTE A;  3TCG A;  4XTC Q;  2RCB A;  2YJP A;  4LAT A;  4KPT A;  3C31 A;  2I48 A;  2V84 A;  4YKP A;  4EF2 A;  1B0L A;  1O64 A;  2R71 A;  3TPA A;  3K0V A;  2Q88 A;  3CIJ A;  2LAO A;  4QFP A;  1H43 A;  1WDN A;  4GIZ A;  4OXV A;  3M8U A;  2E0S A;  1PDA A;  3KG2 A;  4YKI A;  1EZO A;  4IO3 A;  3FAT A;  2I0B A;  4LQ5 A;  1IQ7 A;  3QYT A;  5H8F A;  3CG1 A;  2FNC A;  1GVC A;  2DVZ A;  2Q2C A;  3MUQ A;  2AYS A;  2O7I A;  4PQJ A;  1MY3 A;  5AA4 B;  2O6A A;  3RT8 A;  1MXV A;  2ESN A;  2ZYO A;  3OMB A;  3VXB A;  3HCQ A;  4AQ4 A;  1R1N A;  2XX7 A;  3Q27 A;  3U94 A;  5TU0 A;  1N84 A;  4P0G A;  1MY2 A;  1UIU A;  4PE5 B;  2F7C A;  2CZL A;  1TT1 A;  4X9T A;  1N0T A;  3B7D A;  3FXR A;  3TTK A;  1WOD A;  4R2F A;  3CVG A;  2REG A;  2QS1 A;  1NFT A;  4Q8R A;  2F78 A;  3PPR A;  4LZ7 A;  3KBR A;  1GV8 A;  3H6T A;  3K6U A;  1SW1 A;  4XKP A;  4OHN A;  1BP5 A;  4GFR A;  5M2V A;  4DCY A;  4YB6 A;  2XD3 A;  2I0C A;  3N94 A;  5EYF A;  2AL4 A;  4RXL A;  2RIN A;  5JTY B;  1DPE A;  3DP8 A;  1I6Q A;  4GL0 A;  3TTL A;  4KR5 A;  2PMS A;  1YTV A;  4E0W A;  4JWX A;  5K2Y A;  3CFX A;  4KI0 E;  1LFH A;  1VFE A;  1S9T A;  2Y7W A;  5A5X B;  2ZYM A;  2NVU B;  1JQF A;  4IO7 A;  2ZMB A;  3IB1 A;  1SVX B;  5AA2 A;  2ONS A;  3PPO A;  2QPQ A;  2QS3 A;  3IOT A;  3N5L A;  3S9N C;  2IA4 A;  4QRZ A;  1LBC A;  1T0K A;  1JEV A;  3MPK A;  5AA3 A;  3B6W A;  1Y3N A;  3B6T A;  1R9Q A;  3K1P A;  4NED A;  3ILU B;  4MFI A;  1TWY A;  1M5B A;  4YU0 A;  3C4M A;  3FAS A;  3KGC A;  1O63 A;  4R2B A;  3PMX A;  3FD3 A;  3QUF A;  1ZLQ A;  2D5W A;  1P1U A;  4NF4 A;  3OEN A;  1O7T A;  4P11 A;  4JSD A;  2VGQ A;  1IEJ A;  4ECF A;  2Y7I A;  4LON B;  2DYX A;  2XHD A;  4GLI A;  1PBP A;  1SW2 A;  3LSX A;  4WED A;  5I58 B;  1MQD A;  1MDP 1;  1B05 A;  2QRY A;  4RYA A;  4E0X A;  2H98 A;  3ZSF A;  2XXV A;  1OQH A;  1SW4 A;  3PPN A;  4QSD A;  3LR1 A;  4YKK A;  2B65 A;  2UVH A;  4LZ8 A;  3SES A;  4BLA A;  4GVO A;  3MBP A;  3WAF A;  1D4N A;  3K6V A;  4TQU Q;  2OWS A;  4IGT A;  4FJP A;  1US4 A;  4R75 A;  2V3T A;  1MXX A;  2XXQ A;  4QHQ A;  1MPC A;  1R6Z A;  1DMB A;  2H9B A;  5EHS A;  3Q28 A;  4ZED A;  4U4X A;  1B40 A;  1ELJ A;  3K01 A;  3PUZ E;  3SEV A;  2XXU A;  3T22 A;  2GHB A;  5TP9 A;  4GXS B;  4I8C A;  5I56 A;  4DCX A;  4OWD A;  4FOR A;  2XXX A;  3KOT A;  2R6G E;  1HSE A;  3FJM A;  2OLB A;  2Q8J A;  3PMV A;  4NF5 B;  3IOU A;  3CSB A;  3ODB A;  4R6K A;  3TTN A;  2ONK E;  1LAF E;  1R9L A;  3MZB A;  1A7L A;  3OOA A;  4OVJ A;  4THI A;  3UN6 A;  2GH9 A;  2NUV A;  4EF1 A;  3IB0 A;  4F22 A;  4H8J A;  1LAH E;  4RK2 A;  4OEN A;  3CFL A;  2Y7P A;  4ZDM A;  1AIV A;  5I2K A;  1OQG A;  2XXI A;  1B7U A;  5J1D A;  1DOT A;  4RA1 A;  5I84 A;  2F34 A;  2PBW A;  2ZNT A;  4UAC A;  1BKA A;  3RY3 A;  2DE3 A;  1LCF A;  1B7Z A;  3MJN A;  4BDO A;  1MS7 A;  1IIT A;  1P1O A;  3CI8 A;  1N7W A;  3S9M C;  4KCC A;  1FCK A;  3T96 B;  2DXR A;  3O6H A;  1HSJ A;  3VLV A;  2A5S A;  2O51 A;  3EHT A;  3IO4 A;  3VLW A;  4KD5 A;  4G68 B;  2F6P A;  3R7X A;  5F1Q A;  2M8C A;  1Y3P A;  3E4R A;  3KN7 A;  3IOV A;  3Q26 A;  2Q2A A;  1RKM A;  1OLA A;  4WKM A;  2OK2 A;  3W9V A;  4HCW A;  1URD A;  2FYI A;  1II5 A;  5KCJ B;  3KJ7 A;  4NMY A;  4F1U A;  1D9Y A;  5DEX B;  4JXI A;  1Y20 A;  1B3L A;  2DVC A;  1QUL A;  3SEU A;  4LA9 A;  2QMX A;  2ZXT A;  3CFZ A;  2XX8 A;  1A99 A;  2KLF A;  4R9G A;  3H7M A;  4ZS9 A;  2I49 A;  1IIW A;  4EXL A;  2XXY A;  1JW4 A;  3GZG A;  1SQY A;  3JYR A;  1ZKB A;  4EQ9 A;  3ZKL A;  4ONY A;  4H5F A;  5AA1 A;  1ZTY A;  5H8N B;  2PX1 A;  2P0S A;  4G68 C;  5K2X A;  4OYV A;  4DLD A;  3CRB A;  1A55 A;  3S4U A;  2P1S A;  2PYY A;  3LSW A;  4NF6 B;  4G8M A;  1MH4 A;  3QSL A;  4X1D A;  2DP8 A;  2I58 A;  3T66 A;  3A3U A;  3DEL B;  3FJG A;  2DWI A;  2AL5 A;  4DDD A;  2UVI A;  3IB2 A;  1XHY A;  4ZE8 A;  2YPN A;  3UA8 A;  3RUM A;  4DXC A;  3U1O A;  1XVY A;  1MPB A;  5FTI A;  3F11 A;  1JVX A;  1US5 A;  4H67 A;  4G4P A;  4G2Z A;  5CMM A;  1M5E A;  3MPL A;  1BTJ A;  1Q1K A;  1MPD A;  1I6B A;  5CI5 A;  1LST A;  1USY E;  3E3K A;  1B3G A;  2VD2 A;  4FE8 A;  4ND9 A;  3VV5 A;  2H4I A;  4JSO A;  3V89 B;  1PC3 A;  3M3F A;  4OES A;  2PVU A;  3UGW A;  2Q9T A;  3K02 A;  3FZV A;  3U8Q A;  1P1N A;  5CMB A;  2XXT A;  5ITO A;  4ESW A;  3CR9 A;  4F3P A;  5I57 A;  3ILT B;  4F31 B;  3FGS A;  3EHU A;  3VVD A;  3IOR A;  2HAU A;  3TKD A;  4BDQ A;  5AA4 A;  3PGF A;  3BBR A;  4IO6 A;  5HBC A;  3OO6 A;  1IXI A;  3GXA A;  4HCY A;  3MWB A;  1SD3 A;  1AH5 A;  4YB7 A;  1IXC A;  3MP1 A;  3LC8 A;  3EHS A;  4EXK A;  3USD A;  1IUD A;  1POY 1;  2DWH A;  3UK4 A;  1P1W A;  1B46 A;  2I4B A;  2E1S A;  2QMW A;  4N13 A;  3QIM A;  3THI A;  5HPQ A;  2OWT A;  2O84 X;  4OZ9 A;  3H6U A;  1GR2 A;  3FXU A;  2DSF A;  3D4C A;  3C36 A;  4IY5 A;  1Q35 A;  3FIR A;  5H8S A;  3H06 B;  4FED A;  4GRK A;  1H76 A;  4AB5 A;  5TPA B;  1Y1M A;  2I6E A;  3H6W A;  4YB5 A;  3IOW A;  4IO2 A;  4JBZ A;  3O97 A;  3N26 A;  1A54 A;  4ZEI A;  3IAZ A;  2ANJ A;  4ISU A;  3DM0 A;  3TTM A;  3V8X B;  5JTY A;  4EQB A;  1B2H A;  4DZ1 A;  3HPI A;  2O68 A;  4JB7 A;  4IO5 A;  4PP0 A;  1N7X A;  1D3K A;  2QS2 A;  1IXG A;  4O3A A;  3FVG A;  1S7Y A;  5CC2 A;  1XT8 A;  3UP9 A;  2B3F A;  5A5X A;  4U1Z A;  4PFW A;  1GTK A;  5I2N B;  1HSL A;  3G3K A;  4NWD A;  2W7Y A;  2UYE A;  3PPP A;  1SI0 A;  4GL8 A;  1MXW A;  3JV9 A;  4XXU A;  4EDP A;  1MXY A;  1B4H A;  4K3F A;  3BFU A;  1RYO A;  1SYI A;  4JDF A;  3N6U A;  4NWC A;  3V83 A;  3MVX A;  4YKJ A;  5CBS A;  3H03 A;  2O69 A;  4H6D A;  2ZYN A;  3TOD A;  3R26 A;  1B7H A;  2DXY A;  1B4Z A;  5LOM A;  2NXO A;  2YLN A;  4F1V A;  1UTB B;  3EF7 A;  1NKX A;  1SW5 A;  3S2V A;  1I69 A;  3G3G A;  1UIV A;  1P1Q A;  2G93 A;  4Q0C A;  2XXR A;  3TEP A;  4GXA A;  5I59 B;  4IO4 A;  1B3E A;  3RLF E;  2G29 A;  1FQA A;  1ANF A;  3GLB A;  3KJT A;  5B70 A;  3G3H A;  3SER A;  3RT6 B;  1JVY A;  1OVB A;  3GBA A;  5I58 A;  5DTB A;  4Z0I A;  2HXW A;  4YZZ A;  4N07 A;  1B52 A;  4ELP A;  1RYX A;  1URG A;  4XKR A;  4XKQ A;  3PUY E;  2IEE A;  4U22 A;  3VVF A;  2QL3 A;  3OSQ A;  4QSE A;  2V3Q A;  1Y4C A;  3RTW B;  2I4C A;  5DYH A;  2I3V A;  4FIM A;  4R74 A;  4U2R A;  1UQW A;  2DE4 A;  4R9F A;  1N3W A;  3OO8 A;  4NF8 B;  4YAH X;  3SET A;  1ZBM A;  2D3I A;  3FXQ A;  5JEI A;  4O3C A;  2OJT A;  4R6Y A;  1CE2 A;  1YCJ A;  1B3H A;  2HQ0 A;  4C1U A;  2DWA A;  1VE4 A;  1DSN A;  4BDL A;  1B5H A;  4F18 A;  5FHO A;  2WKY A;  3PV0 E;  4NF5 A;  5B7D A;  3PUX E;  3FVK A;  1OVT A;  4F3B A;  3HHF A;  1FTM A;  3MQ9 A;  4RPN A;  2DQV A;  1VR5 A;  3D4G A;  3SEY A;  5DT6 A;  1TXF A;  3SEW A;  4ZEC A;  4KCD A;  1IZ1 A;  2RC8 A;  1PEB A;  4HW8 A;  3SEX A;  4U4S A;  3FV2 A;  3FVN A;  5L8D A;  4POW A;  1Z7M E;  3TCH A;  3KN8 A;  2A5T A;  1QKB A;  3MVY A;  3OEM A;  3G3I A;  3RTF B;  5H8Q A;  3BKI B;  2THI A;  3RN8 A;  1B5J A;  3VXC A;  4QFL A;  2HEU A;  1M5D A;  3OD7 A;  4PFY A;  3AXF A;  3LBS A;  2F7A A;  1YPN A;  1FTK A;  4G68 A;  4C1T A;  5H8H B;  3DLN A;  3V5A A;  1FW0 A;  2D21 A;  3UIF A;  5KDT B;  1MRP A;  2V25 A;  2PT1 A;  1P99 A;  1PB9 A;  3IK6 B;  3ZS6 A;  4ELO A;  1LFI A;  1MY4 A;  4P0I A;  4PFU A;  4H5G A;  4KQP A;  5KCJ A;  2GRV A;  1UTH B;  3SKP A;  1B6H A;  1MG1 A;  3E13 X;  1XVX A;  5DEX A;  1A8F A;  1MY0 A;  1OLC A;  5FTH A;  4TLL B;  2QSX A;  1AOV A;  3RQT A;  3MAM A;  4RK9 A;  1QUK A;  1JEU A;  3C33 A;  4QFK A;  1MQJ A;  4WEP A;  1MQH A;  2DOJ A;  3R6U A;  1LAG E;  4ESX A;  1L5T A;  2UVJ A;  3RNN A;  3W9W A;  3HHG A;  3TCF A;  3O9P A;  1QJM A;  2RF1 A;  3E9X A;  4O3B A;  3T9U A;  2Q89 A;  4GWO A;  5H8N A;  4FEC A;  4FEB A;  3O6G A;  4F3G A;  3QK6 A;  2QS4 A;  1GGG A;  2F5X A;  1LAX A;  3IR1 A;  3VE1 B;  3C35 A;  1NNF A;  5ISU A;  2F97 A;  4NF6 A;  3O66 A;  5FHM A;  3IL1 B;  1DPP A;  2NOO A;  3HST A;  3TAJ A;  2Y84 A;  1BLF A;  1N04 A;  2HZK A;  4F19 A;  1FTJ A;  2XXP A;  3MW0 A;  5IKB A;  4U21 A;  2F7B A;  1LCT A;  4U23 A;  4EUO A;  1PB8 A;  3DP4 A;  4GOT A;  3MZ9 A;  3PMW A;  5L9S A;  1WVJ A;  1EZ9 A;  2F35 A;  3B6Q A;  1ATG A;  2ZYK A;  4KFQ A;  1POT A;  2X26 A;  4HS7 A;  4Q30 B;  2ONR A;  2X7Q A;  3U72 A;  1NNP A;  2UXA A;  1XOC A;  1KWH A;  4DE8 A;  2VD3 A;  5ITP A;  1Z7N E;  4LUB A;  3H4Z A;  4G8N A;  4TOZ A;  3TUS A;  4QSC A;  3GBB A;  2UVG A;  3OSR A;  4KYE A;  1PBQ A;  3S9E A;  4RJZ A;  3KFM A;  4MBP A;  4DXU A;  4LZ5 A;  4HTG A;  1SYH A;  3VFJ A;  4BDR A;  3OEL A;  4FAJ A;  3TFL A;  3U92 A;  4F39 A;  1VFD A;  3T9H B;  5I57 B;  3Q25 A;  4M1V A;  5CM6 A;  1FQE A;  4Z7E A;  4G8H A;  4H8I A;  4X48 A;  3I6V A;  3TDJ A;  5H8F B;  3K6W A;  4ZEB A;  1LGB C;  3KSJ A;  1NL5 A;  3FV1 A;  2DE2 A;  5L9M A;  4YMA A;  2ZNS A;  3TQL A;  1NNT A;  1A40 A;  4NTL A;  1J1N A;  5ELV A;  5DVI A;  4OER A;  4I1D A;  3O29 A;  4ZE9 A;  5EHM A;  3MVW A;  3VDF A;  4I9D A;  4PET A;  4POX A;  3KZG A;  1MDQ A;  2HZL A;  1B3F A;  4IY6 A;  4ELQ A;  5TPA A;  3TZA A;  3K4U A;  2BJJ X;  4ZZA A;  3EPE A;  1Y3Q A;  5FHN A;  1BIY A;  4PFT A;  2XXH A;  3TMG A;  4KYD A;  3EN3 A;  1QVS A;  3KN3 A;  3M3L A;  2PT2 A;  5F7V A;  4OFJ A;  3H3G A;  3C34 A;  4MH5 A;  4LQ2 A;  3KOS A;  4OET A;  1TFD A;  3MZ1 A;  1H44 A;  1B51 A;  1DTZ A;  5ICT A;  3T9X B;  4U1O A;  4LP2 B;  1MQG A;  3EQ1 A;  1SDX A;  4WXJ A;  3OO9 A;  1LFG A;  4NE4 A;  1B1X A;  3MC2 A;  4XKN A;  1XS5 A;  1MXU A;  1TFA A;  2H99 A;  2Y7R A;  4EQ7 A;  4RY1 A;  1EU8 A;  3U93 A;  4G77 A;  1MH3 A;  3C9H A;  2QJE A;  3MVZ A;  2CMO A;  2XX9 A;  1D9V A;  5I2N A;  1JW5 A;  3FVO A;  4H0W A;  1FTL A;  4OFO A;  1DTG A;  1AMF A;  3PD8 A;  5JK4 A;  1S50 A;  1QUJ A;  4RPO A;  3PU5 A;  2ABH A;  2O1M A;  2Z22 A;  1LB8 A;  2AIX A;  4F2O A;  3KEI A;  5AE4 A;  2ZNU A;  5AA2 B;  1FQB A;  1VSO A;  3OXN A;  5CMK A;  4X1B A;  2GHA A;  1M5F A;  3JZJ A;  3VLU A;  3L6H A;  5DVJ A;  1UTB A;  4I62 A;  3HN0 A;  3K2D A;  1URS A;  1B0H A;  1ZMG A;  5IAI A;  5AA2 D;  5I59 A;  1JNF A;  4F1Y A;  1N76 A;  3LSF B;  1IXH A;  3A09 A;  4F3S A; 
#chains in the Genus database with same CATH topology
 3G3J A;  4N8Y A;  4DIG A;  3I5O A;  2R9J A;  4NF4 B;  3CG3 A;  1JW1 A;  1MM7 A;  3TTR A;  4YIC A;  2DS9 A;  2OWZ A;  4GD5 A;  4L17 A;  2P2A A;  3PD9 A;  2V3U A;  1B5I A;  1NNK A;  1OIB A;  4OFL A;  4BDM A;  2OBG A;  4IGR A;  1QKA A;  4GQO A;  5KZT A;  1IME A;  5CBR A;  2NWJ A;  1EZP A;  1KA1 A;  3PUW E;  4OAN A;  2OCU A;  2ALU A;  2PFZ A;  3MP6 A;  4PDH A;  4MNP A;  2REJ A;  4XIG Q;  3T9V A;  4P3L A;  4NF8 A;  4GF8 A;  3CHG A;  1OMP A;  1MM6 A;  2CZH A;  5BWJ A;  3ZKK A;  1ZU0 A;  4MLV A;  3MP8 A;  2XWO A;  1SBP A;  3O2A A;  3KBZ A;  1FQF A;  1N3X A;  3L6G A;  1FQD A;  2Z8D A;  2HCA A;  3K6X A;  5TP9 B;  1B58 A;  1H3D A;  3O6I A;  3ONM A;  4PAI A;  4R73 A;  5I56 B;  1LEV A;  1MY1 A;  4P56 A;  3QUJ A;  4TLM B;  5CMC A;  1FBD A;  3T93 B;  2RC9 A;  4FAT A;  2Y7K A;  5HM4 B;  3IO6 A;  1IMF A;  1QW0 A;  4RNS A;  3OEK A;  4DI4 B;  2I3W A;  3PPQ A;  2X7P A;  3RPW A;  4NG7 A;  3HV1 A;  3SDF A;  3TYH A;  1B1H A;  2O7U A;  2OZZ A;  1MQI A;  1QUI A;  2VT5 A;  5ET5 A;  4KYS A;  4FBP A;  4MIJ A;  1SPI A;  4JWO A;  4ZZE A;  3K00 A;  2P3V A;  4NHB A;  2FA7 A;  2O1L A;  4KHZ E;  3VVE A;  1LBB A;  1FPB A;  2B4M A;  5BUU A;  3FUZ A;  3ECR A;  2F6G A;  3H6V A;  1FPE A;  3P7I A;  4JWY A;  2QFL A;  3UOR A;  1JET A;  3A3C A;  4OEU A;  4F2Q A;  5I2K B;  4MLQ A;  4IB2 A;  1M5C A;  2XXW A;  4I3Y A;  3I3V A;  3LUY A;  5L9O A;  2R8T A;  5DVF A;  2A5T B;  2CZK A;  4QFO A;  1XC1 A;  2V4C A;  2F36 A;  1FJ9 A;  5H8Q B;  3BFT A;  4X8R A;  5ICQ A;  3S9L C;  4F29 A;  4DXB A;  1VDW A;  4QF9 A;  5J16 A;  2UYF A;  5H8H A;  2GFE A;  3IJO B;  5F24 A;  1LB9 A;  3RGY A;  1PB7 A;  3LSL A;  4N6P A;  5KDT A;  3CSG A;  5CRY A;  4ZEK A;  4LVQ A;  1NV3 A;  4M4G A;  3FJ7 A;  3IJX B;  1I6A A;  1UTH A;  1FQC A;  1ZIU A;  1NMU A;  3K1N A;  3QAX A;  3Q29 A;  4MF3 A;  2XD2 A;  1RDY A;  4QFN A;  3W15 C;  1FTO A;  3HO7 A;  3QXM A;  2V93 A;  5A5L A;  2F8D A;  1H45 A;  3G7W A;  1LLS A;  4P9K A;  4H65 A;  1NV4 A;  4YMB A;  4HE0 A;  2Z8F A;  4GBV A;  4R72 A;  1ZJL A;  2VP1 A;  1MXZ A;  4AB6 A;  4PC9 A;  2DWJ A;  4H1X A;  4OMB A;  4OQO A;  4PFR A;  3TQW A;  1B32 A;  3PUV E;  3C32 A;  3O28 A;  1USY H;  2H25 A;  2RC7 A;  3EKI A;  1NH7 A;  2VOZ A;  2B3B A;  3KSX A;  1F9B A;  1AL3 A;  1SI1 A;  4ELR A;  4BDN A;  2RCA A;  2Z23 A;  1B9J A;  3TEL A;  4PAK A;  4H46 A;  4ZEF A;  3WAE A;  1Y9U A;  4C0R A;  4OEV A;  3IX1 A;  1EH3 A;  1NH8 A;  2HFB A;  3M3K A;  2HAV A;  1A8E A;  3G3F A;  3OO7 A;  1CB6 A;  2RKM A;  2H5Y A;  3K1M A;  2ZZV A;  2XA5 A;  1YAE A;  3DP6 A;  4MNC A;  2VHA A;  4UA8 A;  4Q5T A;  1Y1Z A;  4R6H A;  2Z8E A;  3N6T A;  1Y4T A;  4OTE A;  3TCG A;  4XTC Q;  2RCB A;  2YJP A;  4LAT A;  4KPT A;  3C31 A;  2I48 A;  4PGP A;  1Q9D A;  2V84 A;  4YKP A;  4EF2 A;  1B0L A;  1O64 A;  4XEQ A;  2R71 A;  4HE2 A;  3TPA A;  1DBZ A;  3K0V A;  2Q88 A;  3CIJ A;  2LAO A;  4QFP A;  1H43 A;  1INP A;  1WDN A;  4GIZ A;  4OXV A;  3M8U A;  2E0S A;  1PDA A;  3KG2 A;  4YKI A;  5I7I A;  1EZO A;  4IO3 A;  5EQ7 A;  3FAT A;  5ET7 A;  2I0B A;  4LQ5 A;  1IQ7 A;  3QYT A;  5H8F A;  3CG1 A;  2FNC A;  1GVC A;  2DVZ A;  2Q2C A;  3MUQ A;  2AYS A;  2L5V A;  2O7I A;  4PQJ A;  1MY3 A;  5AA4 B;  4MHF A;  4P1L A;  2O6A A;  3RT8 A;  3U65 A;  3IFC A;  1MXV A;  5IZ3 A;  2ESN A;  2ZYO A;  3OMB A;  1NUW A;  3VXB A;  3HCQ A;  4AQ4 A;  1R1N A;  2XX7 A;  3Q27 A;  3U94 A;  5TU0 A;  1N84 A;  2KR0 A;  4P0G A;  2FVZ A;  1MY2 A;  1UIU A;  1LBX A;  4PE5 B;  4MCO A;  2F7C A;  4N6K A;  2CZL A;  1TT1 A;  4X9T A;  1N0T A;  3B7D A;  3FXR A;  3TTK A;  1WOD A;  4R2F A;  3CVG A;  2REG A;  2QS1 A;  1NFT A;  4N6D A;  4Q8R A;  2F78 A;  3B8B A;  3PPR A;  4LZ7 A;  3D1R A;  3KBR A;  3ROJ A;  1GV8 A;  3H6T A;  3K6U A;  4N4U A;  1SW1 A;  4XKP A;  4OHN A;  1BP5 A;  4GFR A;  2KQZ A;  5M2V A;  4DCY A;  4YB6 A;  2XD3 A;  2I0C A;  3N94 A;  5EYF A;  2AL4 A;  4RXL A;  2RIN A;  5JTY B;  1DPE A;  3DP8 A;  1I6Q A;  4GL0 A;  3TTL A;  1YYZ A;  2WBB A;  4NGU A;  4KR5 A;  2PMS A;  1YTV A;  4E0W A;  4JWX A;  5K2Y A;  2Y5K A;  3RPL A;  3CFX A;  4KI0 E;  1LFH A;  1VFE A;  1S9T A;  2Y7W A;  1NV0 A;  5A5X B;  2Q74 A;  2ZYM A;  2NVU B;  1JQF A;  4IO7 A;  2ZMB A;  3IB1 A;  1SVX B;  5AA2 A;  2ONS A;  2XXK A;  3PPO A;  2QPQ A;  2QS3 A;  3IOT A;  3N5L A;  3S9N C;  2IA4 A;  4QRZ A;  1LBC A;  1T0K A;  1JEV A;  3MPK A;  1DCU A;  5AA3 A;  3B6W A;  4LN5 A;  1Y3N A;  3B6T A;  1R9Q A;  3ISP A;  2WX9 A;  3K1P A;  4NED A;  3ILU B;  4MFI A;  1TWY A;  1M5B A;  4GX3 A;  4YU0 A;  3C4M A;  3FAS A;  3KGC A;  1O63 A;  4R2B A;  3PMX A;  3FD3 A;  3QUF A;  1ZLQ A;  2D5W A;  2DDK A;  1P1U A;  4NF4 A;  3OEN A;  1O7T A;  4P11 A;  2QVR A;  3E79 A;  3FBP A;  4JSD A;  4O94 A;  2VGQ A;  1IEJ A;  4HXV A;  4ECF A;  5T3J A;  2Y7I A;  4LON B;  2DYX A;  2XHD A;  4GLI A;  1PBP A;  1SW2 A;  5ET8 A;  3LSX A;  4WED A;  5I58 B;  1MQD A;  4GWU A;  1MDP 1;  1B05 A;  2QRY A;  4P8B A;  4RYA A;  4E0X A;  2QVV A;  2H98 A;  4PDD A;  3ZSF A;  2XXV A;  1OQH A;  1SW4 A;  3PPN A;  4QSD A;  3LR1 A;  4YKK A;  2B65 A;  2UVH A;  4LZ8 A;  3SES A;  4BLA A;  4GVO A;  3MBP A;  3WAF A;  1D4N A;  3K6V A;  4TQU Q;  2OWS A;  4IGT A;  4FJP A;  1US4 A;  4R75 A;  3HFU A;  3PTY A;  1NV1 A;  2V3T A;  1MXX A;  2XXQ A;  4QHQ A;  1MPC A;  1R6Z A;  1DMB A;  2H9B A;  5EHS A;  3Q28 A;  4ZED A;  4U4X A;  1B40 A;  1ELJ A;  3K01 A;  3PUZ E;  1LBZ A;  3SEV A;  2XXU A;  3T22 A;  2GHB A;  5TP9 A;  4GXS B;  4I8C A;  5I56 A;  4DCX A;  4OWD A;  4FOR A;  2XXX A;  2ZZX A;  3KOT A;  2R6G E;  1HSE A;  3B50 A;  4O8M A;  3FJM A;  1FTA A;  1QGX A;  2OLB A;  2Q8J A;  3PMV A;  4NF5 B;  3IOU A;  3CSB A;  3ODB A;  4R6K A;  3TTN A;  2ONK E;  1LAF E;  1R9L A;  3MZB A;  1A7L A;  2PFY A;  3OOA A;  4OVJ A;  4THI A;  4NX1 A;  3UN6 A;  2GH9 A;  2NUV A;  4OVS A;  4EF1 A;  3IB0 A;  2VPN A;  4F22 A;  4H8J A;  1LAH E;  4RK2 A;  4OEN A;  3CFL A;  4KXP A;  2Y7P A;  4ZDM A;  1AIV A;  4PBQ A;  3RYD A;  4I3E A;  2FIE A;  5I2K A;  1OQG A;  1FRP A;  2XXI A;  1B7U A;  5J1D A;  2HXR A;  1DOT A;  4RA1 A;  5I84 A;  2F34 A;  4UAC A;  2PBW A;  2ZNT A;  1BKA A;  4N81 A;  3RY3 A;  2DE3 A;  1LCF A;  1B7Z A;  3MJN A;  2CEX A;  2CEY A;  4BDO A;  1MS7 A;  1EYK A;  1NI9 A;  1IIT A;  2XWI A;  4OA4 A;  1P1O A;  3CI8 A;  4PF8 A;  1N7W A;  3S9M C;  5EYG A;  4KCC A;  1FCK A;  3T96 B;  2DXR A;  3O6H A;  1HSJ A;  2WYK A;  2MKZ A;  1KZ8 A;  3VLV A;  2A5S A;  2O51 A;  3EHT A;  3IO4 A;  3VLW A;  4KD5 A;  4G68 B;  2F6P A;  3R7X A;  5F1Q A;  2M8C A;  1Y3P A;  3E4R A;  3KN7 A;  4OVQ A;  3IOV A;  3Q26 A;  2Q2A A;  1RKM A;  1OLA A;  2F3B A;  4WKM A;  2OK2 A;  1NUY A;  3W9V A;  4HCW A;  1URD A;  5IZZ A;  2FYI A;  2F3D A;  1II5 A;  5KCJ B;  3KJ7 A;  1NV5 A;  4NMY A;  4F1U A;  1D9Y A;  5DEX B;  4JXI A;  1Y20 A;  4PF6 A;  1B3L A;  2DVC A;  1QUL A;  3SEU A;  4GX4 A;  4LA9 A;  2QMX A;  2ZXT A;  3CFZ A;  2XX8 A;  1A99 A;  2KLF A;  4R9G A;  3H7M A;  4ZS9 A;  2I49 A;  1IIW A;  4EXL A;  2XXY A;  1JW4 A;  5IM2 A;  3GZG A;  1SQY A;  5I5P A;  4QBA A;  3JYR A;  1ZKB A;  4EQ9 A;  3ZKL A;  4ONY A;  4H5F A;  5AA1 A;  1ZTY A;  4GWX A;  5H8N B;  2PX1 A;  2P0S A;  1YZ0 A;  1LBY A;  4G68 C;  5K2X A;  4OYV A;  4DLD A;  1RDX A;  4PGN A;  3CRB A;  1A55 A;  3S4U A;  2P1S A;  2PYY A;  3LSW A;  4GWS A;  3E78 A;  4NF6 B;  4G8M A;  4O7I A;  1MH4 A;  3QSL A;  4X1D A;  2DP8 A;  2I58 A;  4H45 A;  3T66 A;  4JVC A;  3A3U A;  3DEL B;  3FJG A;  1G0H A;  2DWI A;  2AL5 A;  4DDD A;  2UVI A;  3IB2 A;  1XHY A;  4ZE8 A;  2YPN A;  3UA8 A;  3RUM A;  4DXC A;  3U1O A;  1XVY A;  4N15 A;  1MPB A;  5FTI A;  3F11 A;  4PBH A;  1JVX A;  1US5 A;  4H67 A;  2QVU A;  4G4P A;  4G2Z A;  5CMM A;  1M5E A;  4PFI A;  1EYJ A;  3MPL A;  4HE1 A;  1BTJ A;  1Q1K A;  1MPD A;  1I6B A;  2XWV A;  5CI5 A;  4JVD A;  1LST A;  4G61 A;  1BK4 A;  1USY E;  3E3K A;  1B3G A;  2VD2 A;  4FE8 A;  4ND9 A;  3VV5 A;  2H4I A;  4JSO A;  3V89 B;  1PC3 A;  3M3F A;  4MEV A;  2PVU A;  4OES A;  3UGW A;  2JJK A;  2Q9T A;  3K02 A;  3FZV A;  3U8Q A;  1P1N A;  5CMB A;  2XXT A;  5ITO A;  4ESW A;  3CR9 A;  4F3P A;  5I57 A;  3ILT B;  4F31 B;  3FGS A;  3EHU A;  3VVD A;  4AS5 A;  5EQ9 A;  4P47 A;  1YXI A;  2B4L A;  3IOR A;  2HAU A;  3TKD A;  4BDQ A;  5AA4 A;  3BIH A;  3PGF A;  3BBR A;  4IO6 A;  3QMF A;  5HBC A;  3OO6 A;  1IXI A;  3GXA A;  4HCY A;  3MWB A;  1SD3 A;  1AH5 A;  4YB7 A;  1IXC A;  3MP1 A;  3LC8 A;  3EHS A;  4EXK A;  3USD A;  1IUD A;  1POY 1;  2DWH A;  3UK4 A;  1P1W A;  1B46 A;  2I4B A;  2E1S A;  4JVI A;  2QMW A;  3SZP A;  4N13 A;  3QIM A;  3THI A;  5HPQ A;  2OWT A;  3FXB A;  2O84 X;  4OZ9 A;  3H6U A;  1GR2 A;  1JP4 A;  3FXU A;  2DSF A;  3D4C A;  4X04 A;  3C36 A;  3LUZ A;  4IY5 A;  1Q35 A;  3FIR A;  5H8S A;  3H06 B;  4FED A;  4GRK A;  1H76 A;  4AB5 A;  4GWY A;  5TPA B;  1Y1M A;  5EQ8 A;  3KC1 A;  2I6E A;  3H6W A;  4YB5 A;  5IGA A;  3IOW A;  4MMP A;  4IO2 A;  4JBZ A;  3O97 A;  3N26 A;  1A54 A;  4ZEI A;  3IAZ A;  4NF0 A;  2ANJ A;  4ISU A;  3DM0 A;  3TTM A;  3V8X B;  5JTY A;  4EQB A;  1B2H A;  4DZ1 A;  3HPI A;  3BIG A;  2O68 A;  4JB7 A;  4IO5 A;  3KC0 A;  4PP0 A;  1N7X A;  4N17 A;  1D3K A;  2QS2 A;  1IXG A;  4O3A A;  3MST A;  1DK4 A;  3FVG A;  4O7M A;  1S7Y A;  4PCD A;  1FPD A;  5CC2 A;  1XT8 A;  3UP9 A;  5EYH A;  2B3F A;  5A5X A;  1D9Q A;  3T1B A;  4U1Z A;  5LDZ A;  4PFW A;  1GTK A;  5I2N B;  1HSL A;  3G3K A;  4NWD A;  1FPF A;  2W7Y A;  3RPL B;  2XWK A;  2UYE A;  3PPP A;  1RDZ A;  1SI0 A;  1FSA A;  4GL8 A;  1MXW A;  3JV9 A;  4XXU A;  4EDP A;  1MXY A;  4OVT A;  1B4H A;  4K3F A;  3BFU A;  1RYO A;  1SYI A;  4JDF A;  1IMD A;  3N6U A;  4NWC A;  4OVP A;  3V83 A;  3MVX A;  4YKJ A;  5CBS A;  3H03 A;  3IFA A;  4GWZ A;  2O69 A;  4H6D A;  2ZYN A;  3TOD A;  3R26 A;  1B7H A;  2DXY A;  1B4Z A;  5LOM A;  2NXO A;  2YLN A;  4F1V A;  1UTB B;  3EF7 A;  1G0I A;  1NKX A;  1SW5 A;  3S2V A;  1I69 A;  3G3G A;  1UIV A;  1P1Q A;  2G93 A;  4Q0C A;  2XXR A;  3TEP A;  2OX3 A;  4GXA A;  5I59 B;  4IO4 A;  1B3E A;  3RLF E;  2G29 A;  1FQA A;  1ANF A;  3GLB A;  3KJT A;  5B70 A;  2VPO A;  3G3H A;  3SER A;  3RT6 B;  1JVY A;  1OVB A;  3GBA A;  5I58 A;  5DTB A;  4Z0I A;  2HXW A;  4YZZ A;  4N07 A;  1B52 A;  4ELP A;  1RYX A;  1URG A;  4XKR A;  4XKQ A;  1FPG A;  4AS4 A;  3PUY E;  2IEE A;  4U22 A;  4MNI A;  3VVF A;  4MJO A;  2QL3 A;  3OSQ A;  4QSE A;  2V3Q A;  1Y4C A;  3RTW B;  2I4C A;  5DYH A;  1FBP A;  2I3V A;  4FIM A;  4U2R A;  4R74 A;  1K9Z A;  1NV6 A;  1UQW A;  2DE4 A;  4R9F A;  1N3W A;  3OO8 A;  4NF8 B;  4YAH X;  3SET A;  1ZBM A;  2D3I A;  3FXQ A;  5JEI A;  4O3C A;  2OJT A;  4R6Y A;  1CE2 A;  1YCJ A;  1B3H A;  1FBF A;  2HQ0 A;  4C1U A;  2DWA A;  1VE4 A;  1DSN A;  4BDL A;  4P1E A;  1B5H A;  4F18 A;  5FHO A;  2WKY A;  3PV0 E;  4NF5 A;  5B7D A;  5FBP A;  3PUX E;  1NV2 A;  1AWB A;  1OVT A;  3FVK A;  4F3B A;  3HHF A;  1FTM A;  3MQ9 A;  4RPN A;  2DQV A;  1IMB A;  1VR5 A;  3D4G A;  4PFB A;  3SEY A;  5DT6 A;  1TXF A;  3SEW A;  4ZEC A;  4KCD A;  1IZ1 A;  2RC8 A;  1PEB A;  4HW8 A;  4NAP A;  4OVR A;  3SEX A;  4U4S A;  3FV2 A;  3FVN A;  5L8D A;  4POW A;  1Z7M E;  3KN8 A;  3TCH A;  2A5T A;  1QKB A;  3MVY A;  3OEM A;  3G3I A;  1NV7 A;  3RTF B;  5H8Q A;  4NQ8 A;  3BKI B;  2THI A;  3RN8 A;  1FPL A;  1B5J A;  3VXC A;  4QFL A;  2ZZW A;  2HEU A;  1M5D A;  3OD7 A;  4PFY A;  3AXF A;  3LBS A;  2F7A A;  1K9Y A;  1YPN A;  4N8G A;  1FTK A;  4G68 A;  4C1T A;  5H8H B;  3DLN A;  3V5A A;  1FW0 A;  2D21 A;  3UIF A;  1NUX A;  5KDT B;  1MRP A;  2HHM A;  2V25 A;  2PT1 A;  1P99 A;  1PB9 A;  3IK6 B;  3ZS6 A;  4ELO A;  1LFI A;  4GX6 A;  5I3S A;  1MY4 A;  4P0I A;  4PFU A;  4H5G A;  4KQP A;  5KCJ A;  2GRV A;  1UTH B;  4UAB A;  3SKP A;  1B6H A;  1MG1 A;  3E13 X;  3NOH A;  1XVX A;  5DEX A;  1A8F A;  1MY0 A;  1OLC A;  5FTH A;  4TLL B;  2FIX A;  2QSX A;  4GBW A;  1AOV A;  3RQT A;  3MAM A;  4RK9 A;  1QUK A;  4PAF A;  1JEU A;  3C33 A;  4QFK A;  1MQJ A;  4WEP A;  5ET6 A;  1MQH A;  2DOJ A;  3R6U A;  5IZ1 A;  1LAG E;  4XF5 A;  4ESX A;  1L5T A;  2UVJ A;  3RNN A;  5LTC A;  3W9W A;  3HHG A;  3TCF A;  3O9P A;  1QJM A;  2RF1 A;  3E9X A;  4O3B A;  3T9U A;  2Q89 A;  4GWO A;  2PCR A;  5H8N A;  4FEC A;  4FEB A;  3O6G A;  4F3G A;  5ESY A;  3QK6 A;  2QS4 A;  1GGG A;  2F5X A;  1LAX A;  1KA0 A;  3IR1 A;  3VE1 B;  3C35 A;  1NNF A;  5ISU A;  2F97 A;  1FPK A;  4NF6 A;  3O66 A;  5FHM A;  3IL1 B;  1DPP A;  2NOO A;  3HST A;  3TAJ A;  2Y84 A;  2CZI A;  1BLF A;  3GYY A;  1N04 A;  2HZK A;  4F19 A;  1FTJ A;  2XXP A;  3MW0 A;  5IKB A;  4U21 A;  2F7B A;  1LCT A;  4U23 A;  4EUO A;  1PB8 A;  1FBH A;  1EYI A;  1XI6 A;  3DP4 A;  4GOT A;  3MZ9 A;  3PMW A;  5L9S A;  1WVJ A;  1EZ9 A;  2F35 A;  3B6Q A;  1ATG A;  2ZYK A;  4KFQ A;  1POT A;  2X26 A;  4HS7 A;  1FBG A;  4Q30 B;  2ONR A;  4DI3 D;  2X7Q A;  3U72 A;  1NNP A;  2UXA A;  3LV0 A;  1XOC A;  1KWH A;  4DE8 A;  2VD3 A;  5ITP A;  1Z7N E;  4LUB A;  1IMA A;  3H4Z A;  4G8N A;  4TOZ A;  3TUS A;  4QSC A;  3GBB A;  2UVG A;  3OSR A;  4KYE A;  1PBQ A;  3S9E A;  4RJZ A;  3KFM A;  4MBP A;  4DXU A;  4LZ5 A;  4HTG A;  1SYH A;  3VFJ A;  4BDR A;  4MAG A;  4I40 A;  3OEL A;  4FAJ A;  2BJI A;  2WBD A;  3TFL A;  3U92 A;  4F39 A;  1VFD A;  5DW8 A;  3T9H B;  5I57 B;  5EQA A;  3Q25 A;  4M1V A;  5CM6 A;  1FQE A;  4Z7E A;  4G8H A;  4H8I A;  4X48 A;  1FPJ A;  3I6V A;  2P3N A;  3TDJ A;  5H8F B;  3K6W A;  4ZEB A;  1LGB C;  3KSJ A;  1NL5 A;  3FV1 A;  2DE2 A;  5L9M A;  4YMA A;  2ZNS A;  3TQL A;  1NNT A;  1LBW A;  1A40 A;  2Q8M A;  4NTL A;  1J1N A;  5IZ3 B;  1FBE A;  5ELV A;  5DVI A;  4OER A;  4I1D A;  3O29 A;  4ZE9 A;  5EHM A;  3MVW A;  1FBC A;  3VDF A;  4I9D A;  4PET A;  4GWW A;  3MYU A;  4QXD A;  4POX A;  3KZG A;  1MDQ A;  2HZL A;  1B3F A;  2GQ1 A;  4IY6 A;  5TPA A;  4ELQ A;  3TZA A;  3K4U A;  2BJJ X;  4ZZA A;  3EPE A;  1Y3Q A;  2HPG A;  5FHN A;  1BIY A;  4PFT A;  2XXH A;  3TMG A;  4KYD A;  3EN3 A;  1QVS A;  3KN3 A;  3M3L A;  2FBP A;  2PT2 A;  5F7V A;  4OFJ A;  3H3G A;  3C34 A;  2WYP A;  4MH5 A;  4LQ2 A;  3KOS A;  4OET A;  1TFD A;  3MZ1 A;  1H44 A;  1B51 A;  1DTZ A;  5ICT A;  3T9X B;  1NUZ A;  4U1O A;  4LP2 B;  4PE3 A;  1MQG A;  3EQ1 A;  1SDX A;  3T0J A;  4WXJ A;  3OO9 A;  1IMC A;  1LFG A;  4NE4 A;  1B1X A;  3MC2 A;  4XKN A;  4PTK A;  1XS5 A;  1MXU A;  1TFA A;  2H99 A;  2Y7R A;  4RY1 A;  4EQ7 A;  1EU8 A;  3U93 A;  4G77 A;  1MH3 A;  3C9H A;  2QJE A;  3MVZ A;  2CMO A;  2XX9 A;  1D9V A;  4NN3 A;  5I2N A;  1JW5 A;  2WEF A;  3FVO A;  4H0W A;  1FTL A;  4OFO A;  1DTG A;  1AMF A;  3PD8 A;  5JK4 A;  2Y5L A;  1S50 A;  1QUJ A;  4IR8 A;  4MX6 A;  4RPO A;  3PU5 A;  3A29 A;  2ABH A;  2O1M A;  2Z22 A;  4N91 A;  1LB8 A;  2AIX A;  4F2O A;  3KEI A;  5AE4 A;  2ZNU A;  5AA2 B;  1FQB A;  1VSO A;  3OXN A;  5CMK A;  4X1B A;  2GHA A;  1M5F A;  3JZJ A;  3VLU A;  3L6H A;  5DVJ A;  1UTB A;  2FHY A;  4I62 A;  1LBV A;  3HN0 A;  3K2D A;  1URS A;  1B0H A;  1ZMG A;  5IAI A;  5AA2 D;  5I59 A;  1JNF A;  4F1Y A;  1CNQ A;  1N76 A;  3LSF B;  1IXH A;  4XFE A;  1FPI A;  3A09 A;  4F3S A;  1FJ6 A; 
#chains in the Genus database with same CATH homology
 3G3J A;  4DIG A;  3I5O A;  2R9J A;  4NF4 B;  3CG3 A;  1JW1 A;  1MM7 A;  3TTR A;  4YIC A;  2DS9 A;  4GD5 A;  4L17 A;  2P2A A;  3PD9 A;  2V3U A;  1B5I A;  1NNK A;  1OIB A;  4OFL A;  4BDM A;  2OBG A;  4IGR A;  1QKA A;  4GQO A;  5KZT A;  5CBR A;  2NWJ A;  1EZP A;  3PUW E;  2OCU A;  2ALU A;  3MP6 A;  2REJ A;  4XIG Q;  3T9V A;  4NF8 A;  4GF8 A;  1OMP A;  1MM6 A;  5BWJ A;  3ZKK A;  1ZU0 A;  4MLV A;  3MP8 A;  1SBP A;  3O2A A;  1FQF A;  1N3X A;  3L6G A;  1FQD A;  2Z8D A;  2HCA A;  3K6X A;  5TP9 B;  1B58 A;  1H3D A;  3O6I A;  3ONM A;  4R73 A;  5I56 B;  1MY1 A;  3QUJ A;  4TLM B;  5CMC A;  3T93 B;  2RC9 A;  4FAT A;  2Y7K A;  5HM4 B;  3IO6 A;  1QW0 A;  4RNS A;  3OEK A;  2I3W A;  3PPQ A;  2X7P A;  3RPW A;  3HV1 A;  3SDF A;  3TYH A;  1B1H A;  2O7U A;  2OZZ A;  1MQI A;  1QUI A;  4KYS A;  4JWO A;  4ZZE A;  3K00 A;  2FA7 A;  2O1L A;  4KHZ E;  3VVE A;  1LBB A;  5BUU A;  3FUZ A;  3ECR A;  2F6G A;  3H6V A;  3P7I A;  4JWY A;  3UOR A;  1JET A;  3A3C A;  4OEU A;  4F2Q A;  5I2K B;  4MLQ A;  4IB2 A;  1M5C A;  2XXW A;  3I3V A;  3LUY A;  5L9O A;  5DVF A;  2A5T B;  4QFO A;  1XC1 A;  2F36 A;  5H8Q B;  3BFT A;  5ICQ A;  3S9L C;  4F29 A;  4DXB A;  4QF9 A;  2UYF A;  5H8H A;  2GFE A;  3IJO B;  1LB9 A;  3RGY A;  1PB7 A;  3LSL A;  4N6P A;  5KDT A;  3CSG A;  5CRY A;  4ZEK A;  4LVQ A;  4M4G A;  3FJ7 A;  3IJX B;  1I6A A;  1UTH A;  1FQC A;  1ZIU A;  1NMU A;  3K1N A;  3QAX A;  3Q29 A;  4MF3 A;  2XD2 A;  4QFN A;  3W15 C;  1FTO A;  3HO7 A;  3QXM A;  2V93 A;  2F8D A;  1H45 A;  3G7W A;  1LLS A;  4H65 A;  4YMB A;  2Z8F A;  4R72 A;  1ZJL A;  2VP1 A;  1MXZ A;  4AB6 A;  2DWJ A;  4H1X A;  4OMB A;  4OQO A;  3TQW A;  1B32 A;  3PUV E;  3C32 A;  3O28 A;  1USY H;  2H25 A;  2RC7 A;  1NH7 A;  2VOZ A;  2B3B A;  3KSX A;  1F9B A;  1AL3 A;  1SI1 A;  4ELR A;  4BDN A;  2RCA A;  2Z23 A;  1B9J A;  3TEL A;  4ZEF A;  3WAE A;  1Y9U A;  4C0R A;  4OEV A;  3IX1 A;  1EH3 A;  1NH8 A;  2HFB A;  3M3K A;  2HAV A;  1A8E A;  3G3F A;  3OO7 A;  1CB6 A;  2RKM A;  2H5Y A;  3K1M A;  1YAE A;  3DP6 A;  2VHA A;  4UA8 A;  4Q5T A;  1Y1Z A;  4R6H A;  2Z8E A;  3N6T A;  1Y4T A;  4OTE A;  3TCG A;  4XTC Q;  2RCB A;  2YJP A;  4LAT A;  4KPT A;  3C31 A;  2I48 A;  2V84 A;  4YKP A;  4EF2 A;  1B0L A;  1O64 A;  2R71 A;  3TPA A;  3K0V A;  2Q88 A;  3CIJ A;  2LAO A;  4QFP A;  1H43 A;  1WDN A;  4GIZ A;  4OXV A;  3M8U A;  2E0S A;  1PDA A;  3KG2 A;  4YKI A;  1EZO A;  4IO3 A;  3FAT A;  2I0B A;  4LQ5 A;  1IQ7 A;  3QYT A;  5H8F A;  3CG1 A;  2FNC A;  1GVC A;  2DVZ A;  2Q2C A;  3MUQ A;  2AYS A;  2O7I A;  4PQJ A;  1MY3 A;  5AA4 B;  2O6A A;  3RT8 A;  1MXV A;  2ESN A;  2ZYO A;  3OMB A;  3VXB A;  3HCQ A;  4AQ4 A;  1R1N A;  2XX7 A;  3Q27 A;  3U94 A;  5TU0 A;  1N84 A;  4P0G A;  1MY2 A;  1UIU A;  4PE5 B;  2F7C A;  2CZL A;  1TT1 A;  4X9T A;  1N0T A;  3B7D A;  3FXR A;  3TTK A;  1WOD A;  4R2F A;  3CVG A;  2REG A;  2QS1 A;  1NFT A;  4Q8R A;  2F78 A;  3PPR A;  4LZ7 A;  3KBR A;  1GV8 A;  3H6T A;  3K6U A;  1SW1 A;  4XKP A;  4OHN A;  1BP5 A;  4GFR A;  5M2V A;  4DCY A;  4YB6 A;  2XD3 A;  2I0C A;  3N94 A;  5EYF A;  2AL4 A;  4RXL A;  2RIN A;  5JTY B;  1DPE A;  3DP8 A;  1I6Q A;  4GL0 A;  3TTL A;  4KR5 A;  2PMS A;  1YTV A;  4E0W A;  4JWX A;  5K2Y A;  3CFX A;  4KI0 E;  1LFH A;  1VFE A;  1S9T A;  2Y7W A;  5A5X B;  2ZYM A;  2NVU B;  1JQF A;  4IO7 A;  2ZMB A;  3IB1 A;  1SVX B;  5AA2 A;  2ONS A;  3PPO A;  2QPQ A;  2QS3 A;  3IOT A;  3N5L A;  3S9N C;  2IA4 A;  4QRZ A;  1LBC A;  1T0K A;  1JEV A;  3MPK A;  5AA3 A;  3B6W A;  1Y3N A;  3B6T A;  1R9Q A;  3K1P A;  4NED A;  3ILU B;  4MFI A;  1TWY A;  1M5B A;  4YU0 A;  3C4M A;  3FAS A;  3KGC A;  1O63 A;  4R2B A;  3PMX A;  3FD3 A;  3QUF A;  1ZLQ A;  2D5W A;  1P1U A;  4NF4 A;  3OEN A;  1O7T A;  4P11 A;  4JSD A;  2VGQ A;  1IEJ A;  4ECF A;  2Y7I A;  4LON B;  2DYX A;  2XHD A;  4GLI A;  1PBP A;  1SW2 A;  3LSX A;  4WED A;  5I58 B;  1MQD A;  1MDP 1;  1B05 A;  2QRY A;  4RYA A;  4E0X A;  2H98 A;  3ZSF A;  2XXV A;  1OQH A;  1SW4 A;  3PPN A;  4QSD A;  3LR1 A;  4YKK A;  2B65 A;  2UVH A;  4LZ8 A;  3SES A;  4BLA A;  4GVO A;  3MBP A;  3WAF A;  1D4N A;  3K6V A;  4TQU Q;  2OWS A;  4IGT A;  4FJP A;  1US4 A;  4R75 A;  2V3T A;  1MXX A;  2XXQ A;  4QHQ A;  1MPC A;  1R6Z A;  1DMB A;  2H9B A;  5EHS A;  3Q28 A;  4ZED A;  4U4X A;  1B40 A;  1ELJ A;  3K01 A;  3PUZ E;  3SEV A;  2XXU A;  3T22 A;  2GHB A;  5TP9 A;  4GXS B;  4I8C A;  5I56 A;  4DCX A;  4OWD A;  4FOR A;  2XXX A;  3KOT A;  2R6G E;  1HSE A;  3FJM A;  2OLB A;  2Q8J A;  3PMV A;  4NF5 B;  3IOU A;  3CSB A;  3ODB A;  4R6K A;  3TTN A;  2ONK E;  1LAF E;  1R9L A;  3MZB A;  1A7L A;  3OOA A;  4OVJ A;  4THI A;  3UN6 A;  2GH9 A;  2NUV A;  4EF1 A;  3IB0 A;  4F22 A;  4H8J A;  1LAH E;  4RK2 A;  4OEN A;  3CFL A;  2Y7P A;  4ZDM A;  1AIV A;  5I2K A;  1OQG A;  2XXI A;  1B7U A;  5J1D A;  1DOT A;  4RA1 A;  5I84 A;  2F34 A;  2PBW A;  2ZNT A;  4UAC A;  1BKA A;  3RY3 A;  2DE3 A;  1LCF A;  1B7Z A;  3MJN A;  4BDO A;  1MS7 A;  1IIT A;  1P1O A;  3CI8 A;  1N7W A;  3S9M C;  4KCC A;  1FCK A;  3T96 B;  2DXR A;  3O6H A;  1HSJ A;  3VLV A;  2A5S A;  2O51 A;  3EHT A;  3IO4 A;  3VLW A;  4KD5 A;  4G68 B;  2F6P A;  3R7X A;  5F1Q A;  2M8C A;  1Y3P A;  3E4R A;  3KN7 A;  3IOV A;  3Q26 A;  2Q2A A;  1RKM A;  1OLA A;  4WKM A;  2OK2 A;  3W9V A;  4HCW A;  1URD A;  2FYI A;  1II5 A;  5KCJ B;  3KJ7 A;  4NMY A;  4F1U A;  1D9Y A;  5DEX B;  4JXI A;  1Y20 A;  1B3L A;  2DVC A;  1QUL A;  3SEU A;  4LA9 A;  2QMX A;  2ZXT A;  3CFZ A;  2XX8 A;  1A99 A;  2KLF A;  4R9G A;  3H7M A;  4ZS9 A;  2I49 A;  1IIW A;  4EXL A;  2XXY A;  1JW4 A;  3GZG A;  1SQY A;  3JYR A;  1ZKB A;  4EQ9 A;  3ZKL A;  4ONY A;  4H5F A;  5AA1 A;  1ZTY A;  5H8N B;  2PX1 A;  2P0S A;  4G68 C;  5K2X A;  4OYV A;  4DLD A;  3CRB A;  1A55 A;  3S4U A;  2P1S A;  2PYY A;  3LSW A;  4NF6 B;  4G8M A;  1MH4 A;  3QSL A;  4X1D A;  2DP8 A;  2I58 A;  3T66 A;  3A3U A;  3DEL B;  3FJG A;  2DWI A;  2AL5 A;  4DDD A;  2UVI A;  3IB2 A;  1XHY A;  4ZE8 A;  2YPN A;  3UA8 A;  3RUM A;  4DXC A;  3U1O A;  1XVY A;  1MPB A;  5FTI A;  3F11 A;  1JVX A;  1US5 A;  4H67 A;  4G4P A;  4G2Z A;  5CMM A;  1M5E A;  3MPL A;  1BTJ A;  1Q1K A;  1MPD A;  1I6B A;  5CI5 A;  1LST A;  1USY E;  3E3K A;  1B3G A;  2VD2 A;  4FE8 A;  4ND9 A;  3VV5 A;  2H4I A;  4JSO A;  3V89 B;  1PC3 A;  3M3F A;  4OES A;  2PVU A;  3UGW A;  2Q9T A;  3K02 A;  3FZV A;  3U8Q A;  1P1N A;  5CMB A;  2XXT A;  5ITO A;  4ESW A;  3CR9 A;  4F3P A;  5I57 A;  3ILT B;  4F31 B;  3FGS A;  3EHU A;  3VVD A;  3IOR A;  2HAU A;  3TKD A;  4BDQ A;  5AA4 A;  3PGF A;  3BBR A;  4IO6 A;  5HBC A;  3OO6 A;  1IXI A;  3GXA A;  4HCY A;  3MWB A;  1SD3 A;  1AH5 A;  4YB7 A;  1IXC A;  3MP1 A;  3LC8 A;  3EHS A;  4EXK A;  3USD A;  1IUD A;  1POY 1;  2DWH A;  3UK4 A;  1P1W A;  1B46 A;  2I4B A;  2E1S A;  2QMW A;  4N13 A;  3QIM A;  3THI A;  5HPQ A;  2OWT A;  2O84 X;  4OZ9 A;  3H6U A;  1GR2 A;  3FXU A;  2DSF A;  3D4C A;  3C36 A;  4IY5 A;  1Q35 A;  3FIR A;  5H8S A;  3H06 B;  4FED A;  4GRK A;  1H76 A;  4AB5 A;  5TPA B;  1Y1M A;  2I6E A;  3H6W A;  4YB5 A;  3IOW A;  4IO2 A;  4JBZ A;  3O97 A;  3N26 A;  1A54 A;  4ZEI A;  3IAZ A;  2ANJ A;  4ISU A;  3DM0 A;  3TTM A;  3V8X B;  5JTY A;  4EQB A;  1B2H A;  4DZ1 A;  3HPI A;  2O68 A;  4JB7 A;  4IO5 A;  4PP0 A;  1N7X A;  1D3K A;  2QS2 A;  1IXG A;  4O3A A;  3FVG A;  1S7Y A;  5CC2 A;  1XT8 A;  3UP9 A;  2B3F A;  5A5X A;  4U1Z A;  4PFW A;  1GTK A;  5I2N B;  1HSL A;  3G3K A;  4NWD A;  2W7Y A;  2UYE A;  3PPP A;  1SI0 A;  4GL8 A;  1MXW A;  3JV9 A;  4XXU A;  4EDP A;  1MXY A;  1B4H A;  4K3F A;  3BFU A;  1RYO A;  1SYI A;  4JDF A;  3N6U A;  4NWC A;  3V83 A;  3MVX A;  4YKJ A;  5CBS A;  3H03 A;  2O69 A;  4H6D A;  2ZYN A;  3TOD A;  3R26 A;  1B7H A;  2DXY A;  1B4Z A;  5LOM A;  2NXO A;  2YLN A;  4F1V A;  1UTB B;  3EF7 A;  1NKX A;  1SW5 A;  3S2V A;  1I69 A;  3G3G A;  1UIV A;  1P1Q A;  2G93 A;  4Q0C A;  2XXR A;  3TEP A;  4GXA A;  5I59 B;  4IO4 A;  1B3E A;  3RLF E;  2G29 A;  1FQA A;  1ANF A;  3GLB A;  3KJT A;  5B70 A;  3G3H A;  3SER A;  3RT6 B;  1JVY A;  1OVB A;  3GBA A;  5I58 A;  5DTB A;  4Z0I A;  2HXW A;  4YZZ A;  4N07 A;  1B52 A;  4ELP A;  1RYX A;  1URG A;  4XKR A;  4XKQ A;  3PUY E;  2IEE A;  4U22 A;  3VVF A;  2QL3 A;  3OSQ A;  4QSE A;  2V3Q A;  1Y4C A;  3RTW B;  2I4C A;  5DYH A;  2I3V A;  4FIM A;  4R74 A;  4U2R A;  1UQW A;  2DE4 A;  4R9F A;  1N3W A;  3OO8 A;  4NF8 B;  4YAH X;  3SET A;  1ZBM A;  2D3I A;  3FXQ A;  5JEI A;  4O3C A;  2OJT A;  4R6Y A;  1CE2 A;  1YCJ A;  1B3H A;  2HQ0 A;  4C1U A;  2DWA A;  1VE4 A;  1DSN A;  4BDL A;  1B5H A;  4F18 A;  5FHO A;  2WKY A;  3PV0 E;  4NF5 A;  5B7D A;  3PUX E;  3FVK A;  1OVT A;  4F3B A;  3HHF A;  1FTM A;  3MQ9 A;  4RPN A;  2DQV A;  1VR5 A;  3D4G A;  3SEY A;  5DT6 A;  1TXF A;  3SEW A;  4ZEC A;  4KCD A;  1IZ1 A;  2RC8 A;  1PEB A;  4HW8 A;  3SEX A;  4U4S A;  3FV2 A;  3FVN A;  5L8D A;  4POW A;  1Z7M E;  3TCH A;  3KN8 A;  2A5T A;  1QKB A;  3MVY A;  3OEM A;  3G3I A;  3RTF B;  5H8Q A;  3BKI B;  2THI A;  3RN8 A;  1B5J A;  3VXC A;  4QFL A;  2HEU A;  1M5D A;  3OD7 A;  4PFY A;  3AXF A;  3LBS A;  2F7A A;  1YPN A;  1FTK A;  4G68 A;  4C1T A;  5H8H B;  3DLN A;  3V5A A;  1FW0 A;  2D21 A;  3UIF A;  5KDT B;  1MRP A;  2V25 A;  2PT1 A;  1P99 A;  1PB9 A;  3IK6 B;  3ZS6 A;  4ELO A;  1LFI A;  1MY4 A;  4P0I A;  4PFU A;  4H5G A;  4KQP A;  5KCJ A;  2GRV A;  1UTH B;  3SKP A;  1B6H A;  1MG1 A;  3E13 X;  1XVX A;  5DEX A;  1A8F A;  1MY0 A;  1OLC A;  5FTH A;  4TLL B;  2QSX A;  1AOV A;  3RQT A;  3MAM A;  4RK9 A;  1QUK A;  1JEU A;  3C33 A;  4QFK A;  1MQJ A;  4WEP A;  1MQH A;  2DOJ A;  3R6U A;  1LAG E;  4ESX A;  1L5T A;  2UVJ A;  3RNN A;  3W9W A;  3HHG A;  3TCF A;  3O9P A;  1QJM A;  2RF1 A;  3E9X A;  4O3B A;  3T9U A;  2Q89 A;  4GWO A;  5H8N A;  4FEC A;  4FEB A;  3O6G A;  4F3G A;  3QK6 A;  2QS4 A;  1GGG A;  2F5X A;  1LAX A;  3IR1 A;  3VE1 B;  3C35 A;  1NNF A;  5ISU A;  2F97 A;  4NF6 A;  3O66 A;  5FHM A;  3IL1 B;  1DPP A;  2NOO A;  3HST A;  3TAJ A;  2Y84 A;  1BLF A;  1N04 A;  2HZK A;  4F19 A;  1FTJ A;  2XXP A;  3MW0 A;  5IKB A;  4U21 A;  2F7B A;  1LCT A;  4U23 A;  4EUO A;  1PB8 A;  3DP4 A;  4GOT A;  3MZ9 A;  3PMW A;  5L9S A;  1WVJ A;  1EZ9 A;  2F35 A;  3B6Q A;  1ATG A;  2ZYK A;  4KFQ A;  1POT A;  2X26 A;  4HS7 A;  4Q30 B;  2ONR A;  2X7Q A;  3U72 A;  1NNP A;  2UXA A;  1XOC A;  1KWH A;  4DE8 A;  2VD3 A;  5ITP A;  1Z7N E;  4LUB A;  3H4Z A;  4G8N A;  4TOZ A;  3TUS A;  4QSC A;  3GBB A;  2UVG A;  3OSR A;  4KYE A;  1PBQ A;  3S9E A;  4RJZ A;  3KFM A;  4MBP A;  4DXU A;  4LZ5 A;  4HTG A;  1SYH A;  3VFJ A;  4BDR A;  3OEL A;  4FAJ A;  3TFL A;  3U92 A;  4F39 A;  1VFD A;  3T9H B;  5I57 B;  3Q25 A;  4M1V A;  5CM6 A;  1FQE A;  4Z7E A;  4G8H A;  4H8I A;  4X48 A;  3I6V A;  3TDJ A;  5H8F B;  3K6W A;  4ZEB A;  1LGB C;  3KSJ A;  1NL5 A;  3FV1 A;  2DE2 A;  5L9M A;  4YMA A;  2ZNS A;  3TQL A;  1NNT A;  1A40 A;  4NTL A;  1J1N A;  5ELV A;  5DVI A;  4OER A;  4I1D A;  3O29 A;  4ZE9 A;  5EHM A;  3MVW A;  3VDF A;  4I9D A;  4PET A;  4POX A;  3KZG A;  1MDQ A;  2HZL A;  1B3F A;  4IY6 A;  4ELQ A;  5TPA A;  3TZA A;  3K4U A;  2BJJ X;  4ZZA A;  3EPE A;  1Y3Q A;  5FHN A;  1BIY A;  4PFT A;  2XXH A;  3TMG A;  4KYD A;  3EN3 A;  1QVS A;  3KN3 A;  3M3L A;  2PT2 A;  5F7V A;  4OFJ A;  3H3G A;  3C34 A;  4MH5 A;  4LQ2 A;  3KOS A;  4OET A;  1TFD A;  3MZ1 A;  1H44 A;  1B51 A;  1DTZ A;  5ICT A;  3T9X B;  4U1O A;  4LP2 B;  1MQG A;  3EQ1 A;  1SDX A;  4WXJ A;  3OO9 A;  1LFG A;  4NE4 A;  1B1X A;  3MC2 A;  4XKN A;  1XS5 A;  1MXU A;  1TFA A;  2H99 A;  2Y7R A;  4EQ7 A;  4RY1 A;  1EU8 A;  3U93 A;  4G77 A;  1MH3 A;  3C9H A;  2QJE A;  3MVZ A;  2CMO A;  2XX9 A;  1D9V A;  5I2N A;  1JW5 A;  3FVO A;  4H0W A;  1FTL A;  4OFO A;  1DTG A;  1AMF A;  3PD8 A;  5JK4 A;  1S50 A;  1QUJ A;  4RPO A;  3PU5 A;  2ABH A;  2O1M A;  2Z22 A;  1LB8 A;  2AIX A;  4F2O A;  3KEI A;  5AE4 A;  2ZNU A;  5AA2 B;  1FQB A;  1VSO A;  3OXN A;  5CMK A;  4X1B A;  2GHA A;  1M5F A;  3JZJ A;  3VLU A;  3L6H A;  5DVJ A;  1UTB A;  4I62 A;  3HN0 A;  3K2D A;  1URS A;  1B0H A;  1ZMG A;  5IAI A;  5AA2 D;  5I59 A;  1JNF A;  4F1Y A;  1N76 A;  3LSF B;  1IXH A;  3A09 A;  4F3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...