1LAJA

The structure of tomato aspermy virus by x-ray crystallography
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
NIASSSAPSLQHPTFIASKKCRAGYTYTSLDVRPTRTEKDKSFGQRLIIPVPVSEYPKKKVSCVQVRLNPSPKFNSTIWVSLRRLDETTLLTSENVFKLFTDGLAVLIYQHVPTGIQPNNKITFDMSNVGAEIGDMGKYALIVYSKDDVLEADEMVIHIDIEHQRIPSASTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*A)-3'
publication title The Structure of Tomato Aspermy Virus by X-Ray Crystallography
pubmed doi rcsb
molecule tags Virus/rna
total genus 29
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00760 Cucumo_coat Cucumovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.530 Mainly Beta Sandwich Jelly Rolls Cucumovirus coat protein, subunit A 1lajA00
1F15A 1LAJA
chains in the Genus database with same CATH superfamily
1IGOA 3FBYA 4WVWA 1DQ5A 1AX0A 4QM8A 1HB3A 2RM23 2UYBA 1I9RA 1BYHA 2ES3A 4UF0A 5IYYA 2Y64A 4RGAA 3H1WA 3RZMA 1GSLA 4URTA 2OW4A 1YFYA 5FYUA 3MIFA 4HK9A 1HB4A 1WCDJ 2HEWF 3ZYBA 4LK7A 1K5MB 1A6CA 1XYNA 1ACCA 2BRTA 1UMZA 1VAVA 5BXXA 1ND3B 3ZFFA 2ZEZA 1JYTA 5D8AC 5J09A 4COWA 4QGNA 3OPTA 3VLBB 4EV0A 4ZXKA 3BYWA 4BLIA 5I91A 5JI9A 1UY1A 5K9YA 2IXHA 1AR73 4JGZC 4Y1XA 4CCLA 3UV9A 4RR3C 4YGBA 2R072 3PMEA 1FXZA 5FZMA 3EB7A 2BDRA 2XB6C 5IVJA 5FZGA 1IKPA 4NPMA 1PZ8A 1L7QA 2CY6A 3U75A 2WZ8A 1VIWB 2BUKA 5EYXA 1BJQA 3Q8CA 2CGPA 2RS53 4DOUA 2C26A 3VBUA 4COVA 2CDPA 4LORA 1HQNA 1V9U3 3SKJE 1S1AA 2E26A 2JD4A 3ETQA 3EJKA 4G3YC 4CUBA 2QQIA 5KBFA 1IOAA 1W2AX 3I49A 3AJZA 5CFCC 1F2NA 2W87A 3ITQA 4KL1A 4LO7A 3WUDA 3ZSKA 3VHPA 1BBT3 4I01A 4A3XA 1ND2A 3MV11 1RUE1 2YU1A 3OUJA 1GU3A 1U0AA 2D6MA 3AVSA 5LB6A 4FXGB 5L9BA 2DV9A 1CJDA 2PHXA 3NWKA 4H2AA 4FXKB 3W9AA 4AGGA 5K0UC 2DUOA 1GUIA 3WF0A 4BISA 4C90A 5E6HA 3SXWA 3R4UA 4IV3A 4QMAA 2YXSA 4EWEA 4MADA 5LY2A 1NT0A 1HXS3 1GWMA 4RL7A 1P8JA 4YW7A 3HT2A 3J9SA 4NJ4A 3AYDA 2YMZA 3EQEA 2LS6A 2VVFA 4N9HA 1K5MC 3BTYA 1FT9A 2J1AA 5JPMB 1KITA 2BWAA 1ND3C 4NWWA 1OA3A 4KG8A 4LKFA 4Q8LA 4R4XA 4A2UA 4D8MA 2BGCA 5IVEA 2ZEYA 5JCTA 2DWRA 1CZTA 1JMUB 2HBTA 4P5YA 5F5AA 3H3ZA 2EA7A 5I93A 5C4WB 5FUIA 1FPN1 1BEV3 2PHUA 2Y6GA 4P02B 1QQP2 2R0HA 3AM2A 4LUMA 5FKBA 3FLRA 2X5IB 3FN9A 3G7DA 4JKKA 4HN1A 4NPLA 1UXXX 3NL1A 1PVC1 3WEZA 3LF7A 4MX3A 1T6BX 1EYBA 2DYCA 4UOJA 3TN93 2WKKA 4W50A 3S7IA 4CYDA 2WQ8A 4KGGA 5FO7B 1NXMA 1MEC3 2O0OA 3NSTA 3UJOA 1VBB1 2VUCA 3I2DA 4XF1A 1W2TA 2W47A 4YGDA 4Z8BA 5HPOA 1DZRA 5HXVA 4IEQA 3JQXA 4P14A 3MFCA 4MUVA 1DQ4A 4O7XA 2RM22 1GZWA 4H7LA 5A3OA 4XUQA 2LUWA 3C7EA 1PZ7A 1O4TA 1NXD1 1PM7A 4YW5A 3ZMOA 3PVNA 3HEIA 1X7NA 1AR81 4PLMA 5F3CA 2W39A 2W1QA 5FO8B 1H30A 5F6LB 1XB9A 1CIYA 4Q4V3 1CAXA 2QQNA 3LE0A 4NPRA 5FZIA 2QQOA 3T3YA 4BJ0A 4AVCA 5HCBA 5D8AA 2J1VA 5T3NA 1OKOA 1ENQA 4NHKA 4GA9A 1AR72 1C8M1 2PHTA 3DPRB 3VGIA 2XJPA 3X29B 2D3RA 3NNJA 4W6XA 5J96B 4LBMA 2QQMA 2ARBA 2QDNA 3WDYA 4RR3A 4XTPA 3I7DA 1KS4A 2BBAA 2WN2A 1DFQA 5EZWA 1WA4A 4UFMA 2RJ2A 4A45A 4CTEA 1FMD3 3H9AA 1BXHA 5IVYA 5C4WC 2QTWB 3TEZA 5CBLA 1F9KA 2RS52 2VVEA 2VW1A 1XSQA 2D5FA 2W9XA 4UXAA 1CAWA 4H14A 2SLIA 2X5IC 1GQPA 1V9U2 1NX9A 2W94A 4FI9A 5GLZA 3TRSB 1NE6A 3KF5A 4CDXB 3LPFA 4YW2A 3HAGA 2ZGMA 4Q1PA 4QWNA 4IESA 1BBT2 1WW6A 2TEPA 4AW7A 5CFCA 4LBQD 5GZFA 2A6WA 2A1XA 5C8CB 2XBO1 1G6NA 4UW6A 1C5HA 1ENSA 3N36A 5ACA1 1S0BA 1LKNA 4GKYA 2B9VA 2HWF3 4UYBA 5DAPA 1OMIA 1WW4A 5K0UA 3GDBA 1OUSA 3MW3A 3RYKA 4CP0A 3U1XA 1FX5A 3GCXA 4D7TA 4HSLA 3O7OA 4OZXA 3U14A 1AXKA 4YW3A 1HN0A 5IVBA 4B4QA 5DUWA 5T5JA 3C8XA 1UU6A 2X53S 2YB7A 3AZZA 3KB5A 2VW2A 4X8PA 5FP3A 2VNRA 4R9AA 2FMYA 1K5MA 1POV1 3H1YA 2GC1A 4PI0A 5A3TA 1EY2A 1ND3A 2VXRA 5DG2A 5E1RA 2YBKA 4QDSA 3PUIA 5J7MA 4NIIA 3NJYA 3DPRC 4QGLA 4Y26A 5DAQA 4AEDB 3CJXA 1NUKA 1RMU3 1BEV2 2YFUA 5A7NA 4QQHA 4I2OA 2Z2SB 1OQDA 1YIPA 4D7SA 4CXWA 1HKDA 1G9DA 1WCKA 2BVBA 3I54A 1O4ZA 4FPGA 1XE0A 2OZJA 3TN92 2EXKA 3T4VA 5KR7A 1JUIA 3POFA 3S0MA 2BGPA 1V0AA 2WZR3 3I4IA 1W3XA 2RS31 2J1EA 3KVBA 5CB7A 1OSGA 5F3IA 1MEC2 2ZOEB 1QJFA 4CDXC 4A42A 3E6CC 2DCKA 2CL2A 3NKTA 1OI6A 3I2GA 4BWOA 2B5HA 5AVAA 1UL9A 5LATA 1VRH1 2DCZA 2LM3A 5FYSA 4D3WA 1QXPA 5LA2A 2J1RA 5C8CC 1JZ5A 2YPJA 4XCAA 2XQRA 2OVUA 4XE9A 2XVKA 4QGMA 2XJQA 1LR5A 1J1LA 2R1BA 2Y60A 4JV4A 4AFCA 4E4SA 4PF1A 5M0TA 1NA1B 4EWAA 3PJYA 4Q4V2 3I3EA 3E5UA 2Y34A 5H9RA 3J4UH 5FY5A 5JXGA 5FO9B 1SHWB 2CTVA 2DURA 4RGGA 1FV3A 4C0BA 1QEXA 1D2SA 5CG9A 5FYCA 3O5SA 1C5IA 2B39A 3O12A 4MGIE 4I3PA 1MS1A 3HN1A 1H4HA 3FWEA 3NNFA 4MV2A 3UETA 1FMD2 2FZ2A 5E8AA 2KR2A 5FRAA 3WDTA 1YXWA 2VPVA 4LXLA 5CFDB 5A6XA 2QDRA 3JBG3 3NNLA 5C4WA 3KLSA 2ZGLA 1UPSA 1PO13 1M4WA 2AR6A 1PGL2 1ZBA3 4BH9A 4B7KA 4E8CA 2X5IA 5J98B 1S55A 3ES1A 3OJBA 2JIJA 4HXCA 3ES4A 1QJY1 4YARA 3KD4A 1W2NA 3H3UA 5C70A 2GP5A 3L2HA 3OBTA 5FXXA 3H8UA 1WD4A 2LTNA 3LFMA 3HD8B 3DF0A 3MLKA 1TE1B 3RJ2X 3ZSLA 2ARXA 2FHRA 2XUEA 4Q2FA 5KC6A 1XNDA 2JG8B 1ENXA 3KM5A 2VZPA 2HWF2 5CADA 3N9QA 3C3VA 4G4FA 4KMQA 1VBC1 1AL21 3BPZA 4Y4RA 3UGHA 3T0BA 1BVP1 1EV13 3MUY1 3ZXEA 3J7NA 5FYMA 1NCQB 2YZ4A 2ZBJA 3AYEA 4DXTA 2WFPA 5C3PA 3RRDA 3J7HA 1ULCA 1YJLA 4XQDA 5CVRA 1NA1C 2VBBA 4FSJA 1TNRA 2NM1A 2PHDA 4FTEA 3IBMA 4K40A 2OT7A 2G19A 2BWCA 2D6LX 4LOTA 3ST7A 1RMU2 1SFNA 2ZA9A 2KA3A 2VQUA 3DPRA 4XDQA 5IFPA 4LIUA 3CF6E 4LBLA 2AENA 4A6OA 4DB5A 4S2FA 3CLPA 3HR9A 4ES9A 1W90A 3FLTA 3CJIB 2B42B 1IG3A 4QDQA 1JTZX 4NHYA 5A3PA 5CFDC 4XFCA 2WZR2 1B09A 2D43A 3R4SA 1E5IA 1QWRA 1UMIA 1Z78A 5FYTA 1W8NA 5JMOA 3OG2A 3IDCB 1DGLA 2NQYA 3POYA 5FQ0A 2XG3A 3FLPA 4Z82A 3WZ1A 4P08A 3AMPA 4LNVA 1J3PA 2WO3A 2XL7A 2HYXA 4YW6A 4GQ7A 2JB8A 3R4DB 4CDXA 5GZCA 4FTBA 1ULOA 4FPKA 4AAPA 4TTGA 4JVAA 2CWMA 1UY2A 1GR3A 3I97A 3N7MA 5GLWA 5FZ9A 3M2MA 5FPAA 2J1SA 4DXSA 4Q4Y1 4HPKA 3OD4A 3V56A 2JG8C 3JU9A 4KU8A 4LMFA 2Q8OA 1OHFA 1IS3A 4BQYA 3U4XA 3I2OA 1TMF1 1E5HA 3RQ0A 3K48A 3I2HA 2UWCA 3RVHA 5J36A 4IV1A 1ULEA 1NCQC 3BALA 3MBWA 1FOD2 2ZHKA 2EXHA 1N1SA 4QT6A 4MGTA 1H4GA 1E5RA 2ZAAA 2A6YA 3FUOA 4U2AA 3RMXA 3LCPA 1UX7A 4CUGA 5LW9A 5GZEA 4YGEA 2WINB 2K46A 1VBA3 2MEV1 1LENA 1RVF1 1H2MA 1QJX2 1VAKA 3AKSA 4NAMA 2ZGKA 3V0AB 1OFNA 4BDVB 2WDBA 4I0BA 4QQOA 5FJKA 1POQA 5HXMA 3JBG2 1PO23 1DQ1A 1YUDA 1PO12 2VTXA 2WLPA 2ZEXA 4AEDA 1OPOA 1ULPA 1ZBA2 3ZKYA 3D6EA 3WSOA 1W99A 1HV1A 1UZVA 3WQ7A 1GLHA 3RGBA 3CJIC 2MNGA 2GN7A 3LDRA 4EN8B 3UESA 3FE5A 3WW4A 3AL6A 2WBKA 4CCOA 4ZU4A 1OPMA 2IC1A 1W6OB 3MUZ1 1CIWA 2P3YA 2E63A 1KD7A 1A8DA 1RXGA 3LSEA 5DAWA 3LFIA 1W39A 4A41A 2AH2A 3VD9A 3CO2A 4UFJA 1EV12 1Q5OA 1MPXA 1W2UA 1W6PA 3OYWB 5GLTA 3FL7A 4AE2A 4AQ6A 3OUHA 1IS5A 2WO7A 4FPHA 4LIVA 3KHCA 2W52A 3ILRA 4XFHA 2P5BA 5KHIA 5FY4A 4W8JA 1F5JA 2OUHA 3VUOA 3RZHA 5IAXA 4OVEA 5BNPB 3OGSA 5I0TA 4D7YA 1V00A 3B01A 1NA1A 3PIJA 3O1PA 1IS4A 4MSVA 5B4XA 4KH9A 4B4RA 1GP5A 4MGSA 2JD9A 1V6OA 4XJZA 4H55A 1OLQA 4AFBA 1JYXA 1VBE1 2OIIA 3PNAA 3VBFB 4FOYA 5IFTA 3CDZB 1QMJA 1R081 3OGGA 3UL2A 1UYPA 1X8MA 1H8TB 4XXPA 2R49A 4R8HA 3D4KA 3GBGA 2D40A 3P3NA 1C8NA 1X33A 5FOBB 3POWA 4R9BA 1W8TA 3IWZA 3LWCA 2JECA 5JPNB 3I3DA 1PZ9A 5CFDA 2E6VA 5L19A 4QB2A 1ZRDA 1UY4A 1A3KA 1C1FA 1OUXA 4IEXA 4IEZA 2W91A 3NNMA 2YC4A 2WFF3 5IJRA 3V0BB 2V72A 2VCBA 5LBFA 4LBQA 1D2QA 4FTSA 4A3ZA 1VR3A 3W21A 4OZOA 1GOHA 2V4AA 4NHMA 3T4HB 2ZZJA 3ZSMA 1FI2A 4JQRA 4Y20B 1C1LA 1WKYA 3BOPA 2OUJA 1NYWA 2VZSA 2XHKA 4NMIA 3KWVA 5KXEA 3U10A 5GKAC 1HQWA 1IZ3A 4YG6A 4COUA 4AHYA 4QPYA 3S5QA 4KWUA 5CYYA 3U11A 1NCQA 3B7MA 2PLV3 1D7PM 5LY1A 3B94A 4OI0A 2ZGRA 4X8NA 4DUVA 5BNPC 5C3OA 5JSPA 1GV9A 1VBA2 2VULA 2VZQA 2NN8A 2Y26A 3UK9A 3URFA 4BQ4A 2OYZA 1Y9GA 4O61A 1W0PA 2BGOA 3A0NA 5T55A 2FBEA 1IPJA 3RZGA 4ZU7A 3VBFC 2GNDA 2HEVF 5F5CA 2GMEA 1WGPA 1PO22 4Q26A 4S2HA 2GP3A 3KV5A 4Q4W1 1H8TC 5A1AA 3BVCA 3CKHA 5FY9A 3PMSA 1OKQA 1O6UA 1XNCA 1G7YA 4ATEA 2VMIA 3CJIA 3I2FA 3M70A 2K0GA 2LW8A 2QCSB 3THCA 2YHJA 2XGXA 1AUYA 4LEJA 4ASLA 4EYUA 1FNZA 5EXOA 1RUNA 2A7AA 4Z07A 4PI2A 2GNTA 2F6BA 2C4XA 1R093 3SCFA 1LGNA 1H6YA 4L8QA 3AL5A 1TME1 1JZ6A 3B93A 4KU7A 3PDQA 3TYJA 3U37A 4DQAA 3CZJA 4V1PA 3DECA 3NV3A 5CKMA 3WNMA 1N3OA 1G9FA 2AZ5A 3QLQA 3ZYIB 5EWSA 5IUQA 4RQPA 5C3RA 1DDLA 3BUCA 4AGRA 1DQ0A 3ZMNA 5JXHA 2XPJA 1MS5A 2OPWA 2JDAA 1MS4A 2VXJA 1RB8G 4XHBA 3AKTA 4N8MA 5FZ1A 1PMIA 3N4MA 3N7KA 1QH6A 5JOYA 1WMFA 2V09A 3H42B 5FWJA 5I0DA 2RHPA 3UJQA 4DINB 4G9SB 2ETEA 1FAYA 1QQP1 1SLCA 3V0AA 1WW7A 2Y6JA 2DFCA 4D6QA 4XUNA 2HWC3 1TG7A 2OX0A 1SBFA 4HKLA 5H9PA 5K7PA 4JCKA 2WFF2 4IEOA 2WJSA 1YQ5A 1VBD3 3ZXFA 4MXWB 3B5LB 4AZZA 5FIXA 2VO5A 1FATA 4HSJA 1JYIA 2WLQA 4GMP3 4AK3A 4BXFA 1W6OA 2D6NA 1LEDA 1HB1A 1LGBA 1UU5A 2RM21 1PGSA 5LEJA 2XDVA 3NAPB 1VJ2A 1Y43B 2R32A 3LAGA 3T2PA 1JI6A 1D4M3 2XVLA 4IETA 1EAH1 5JLVA 2PLV2 4BA6A 5KXCA 1J1TA 4GWIA 4IE0A 4B1MA 1LCLA 2JEMA 4YFZA 1DYKA 5F2WA 5FY8A 3IT8A 4ZPIA 1JBCA 2ZAHA 5BNPA 5A80A 3VBSB 3DCQA 5JIUA 5C9AB 4K1YA 3T2TA 4LPLA 2O8OA 2YUEA 1CESA 3PUAA 3RZKA 3ILNA 5F8PA 3ZXDA 3VBFA 1AR61 2ZPXA 1OQ1A 1TQ5A 2PAEA 1OC1A 3M1HA 2GDFA 3SH3A 2RS51 4M3CF 1AJKA 5LBCA 4Y33A 2D6OX 4TSVA 3GGLA 5F7UA 4J1WA 3WV6A 1WMDA 2JDNA 3GXUA 4LLOA 4LLFA 4NR1A 1MS3A 2UWBA 4K9SA 1DGRA 1CX1A 2DTWA 5BNNB 1GQHA 2E33A 4GB33 1BBT1 1GOFA 4Y22A 3WDUA 1R092 3ILFA 4DO0A 3JB8A 4WZFA 1NCRB 3ZLIA 5IVVA 4YLZA 4Y3OA 3WG1A 3MDPA 2FZ1A 3K3NA 2WZPP 5BNOB 1GWKA 5A3NA 1YI7A 1APNA 2Q4SA 3TEWA 3GJAA 3PURA 4Y20A 3H0OA 1BVVA 1NLQA 3OPZA 4GD4A 4I30A 3NAPC 1AYN3 1O91A 4GWMA 4R52A 3T0DA 1HXS1 5DZFA 1Y9QA 4XILA 4O9GA 5KHJA 5J37A 1GP6A 2I45A 3D0SA 1QOTA 4AXOA 4BZ4A 5IK5A 4ZHNA 4MXVA 1W06A 2PHFA 4ZS2A 3T09A 5GLUA 4PBOA 4FPEA 3DV8A 1QJU2 4CCDA 4Q1RA 1R1A3 1UKRA 2NMOA 3OGRA 1F8VA 3VBSC 2BW8A 2VGDA 4PHZA 1AYM2 4XQ4A 5C9AC 1CGPA 5APAA 4B1LA 5AFEA 1BEV1 4BHPA 2L9LA 3ZM8A 4BXSV 1COV1 4EJRA 1SBEA 3OD0A 4YZ5A 2LROA 2G1MA 4YPJA 1L7LA 2HWC2 2A73B 2DBIA 1R64A 4FVVA 1ZNPA 3KZ4C 3WXPA 2V5YA 4Y1ZA 5BNQA 1RUF3 5FTTC 1VBD2 1BLZA 4N90A 4QKDA 3UGGA 2WS91 2YDEA 2VBPA 3SH4A 5IHRA 1JZ4A 4YVSB 4FPCA 3WNLA 5BNNC 3AX4A 2ZJCA 4AI8A 2ENRA 5FUPA 4E27A 2W46A 3J8F1 2R16A 1IS6A 4NHLA 1NCRC 2VBDA 5HCFA 2Q5TA 1JU4A 5FDBA 1JZ2A 1D4M2 4NIDA 5BNOC 5FYHA 4MHRA 4UWDA 3WHTA 5IW0A 4XTMA 5BV6A 2GC0A 4RGKA 1YLLA 4A7KA 3WUCA 3UKVA 4OUMA 2PHLA 1RUH3 2F4LA 1ASJ3 3TEYA 2CHHA 4R9DA 1UNBA 4O9EA 1GQGA 2I74A 1OF3A 4L11A 2HKXA 2R30A 3VKLA 5LZ6A 2P3JA 3VBRB 1F4HA 2VOKA 2WIIB 4ZXEA 3ZVXA 4COZA 3OCPA 4M0HA 1HW5A 2GN3A 4QU1A 4YZ2A 1JOJA 1O8SA 1OT5A 3ENRA 5L9RA 5C6CA 5F3GA 1I5ZA 2JDHA 1LOFA 4PIZA 1YRZA 3ZXAC 3CQOA 5FP8A 2XUMA 3D8CA 3PTYA 1YEWA 2BBVA 1C3HA 1EUUA 1PK6B 1UMHA 3AK0A 4RSUA 2G4IA 4W6YA 2YYOA 3QCWA 1UX6A 2JE9A 3VZMA 1CAUB 4TWTA 4ASMB 4MG2A 2GU9A 3VZJA 4AQSA 2EVXA 2WWJA 3A7QA 1YQ2A 2CU5A 3AZXA 4GB32 4AHWA 1ZYBA 3LA7A 4CE8A 2BP6A 1JYNA 1ZRFA 1LOCA 2WNUB 3VHRA 3C7HA 4FPLA 5HCAA 2WABA 1POV0 2VOXA 4YYOA 1XYOA 2ZACA 3H7JA 3LIHA 4YVSC 3SITA 3MHZA 4MXWA 2RDNA 4XHXA 1ST8A 2CAVA 4DMIA 1DIWA 3F95A 3C7FA 3EMRA 2A3WA 1MZEA 3WR0A 2RMU1 4DEVA 1AYN2 3VZLA 4CU9A 1EPZA 1H6XA 1PNFA 4QB6A 3NAPA 3KV6A 4XMIA 4NE9A 5EIYB 1W8WA 5F2SA 4BK5A 4XACA 1WMEA 1HLCA 5D21A 1DQ6A 2P6HA 2P34A 3LDBA 4N53B 2RG4A 1R1A2 5LEKA 4E2GA 4XIOA 5A1FA 5J3UA 2ZKLA 3IDAA 4CP9B 1D0GA 5A1LA 1HRI1 2WR9A 3VBHC 1GFF2 3VBSA 3W59A 3TOJA 5C9AA 3VBRC 3AP7A 4ZZ8A 3ZOIA 4FFFA 5JWPA 4ZU5A 1VLNA 2D7FA 3FFZA 1URXA 1RITA 1WD3A 3OB8A 4S2DA 1LRHA 1MZFA 4Z1VA 1SCRA 1VB4A 1RUJ3 4OHWA 4CDQB 5HBAA 3H1MA 4XCBA 2VM9A 3A23A 1RUF2 1UY0A 1PVXA 2WZR1 2FDKA 1PK6C 2Y8KA 1SPPB 4OULA 3QBQA 1GNZA 2W1WA 5DN2A 3SC7X 4OYUA 4PJYA 1W0NA 4LBOA 5DZGA 3WD5A 4AVSA 1CJPA 1X50A 3L2YA 2CYFA 3P1IA 4N43B 4MGZE 3WG3A 3ZR5A 5BNNA 1WZXA 3ZPYA 2WNUC 3HWJA 4TZDA 1RHI1 2PN5A 1UD1A 2NYYA 3VKFC 1NCRA 1UYZA 2QUOA 5ANNA 3W5NA 2QBXA 3DKQA 2ZHMA 1KS5A 4XFIA 2HEYF 2VY0A 3IIAA 4KI5M 1W8OA 1WCSA 1SZBA 3I59B 3ZFGB 5JMCA 2BTVC 4KG0A 4LKDA 3OGJA 5JUVA 4NO4A 4JGZA 1JYCA 1RUH2 1ASJ2 4P9LA 3IMNA 3JD71 1QIQA 2RS11 3N7LA 2ZXQA 4HVRA 3B3QE 2YG0A 2DU0A 3WNPA 4C91A 5JSRA 3WVJA 2UYAA 1RUI1 3HJRA 4N53C 5F5QA 5DPNA 4IL7A 4N9IA 4IE4A 5EQUA 1CPNA 1US2A 3ACIA 4HLTA 4IW3A 3HPNA 3WW1A 4FP3A 5K8SA 1CR7A 4D69A 4XVHA 3WT3A 2A6VA 2J1TA 3BODA 4WVMA 2VC9A 2CGNA 2O1QA 3LEIA 2WA3A 5FPZA 1AF9A 2PQSA 2XJVA 3OY8B 3EHKA 4IUGA 4CDQC 2HJIA 5CZKA 2RJLA 4AHXA 1JOPA 3OGVA 4P9IA 2CWSA 2WO1A 4AFMA 2VAUA 1XE7A 3ZXKA 1H1IA 4COYA 3O1MA 2WN3A 3O1TA 4Z92B 2NMNA 1RUE3 3THPA 3ZDVA 5FMOS 5FZDA 2Q1ZB 4N43C 4QHBA 4YVSA 5LASA 1PGW2 1HJGA 1U5XA 1DF0A 2XLAA 4XFAA 5F32A 3S30A 5E89A 4EE2A 3A4UA 1GNYA 1C28A 1NY72 1V6LA 3T1MA 2VMGA 5FZOB 3INAA 3VV1A 2TBVA 3DGTA 3KCCA 3Q8FA 1KDMA 2VR4A 1ONAA 2FCVA 3ZFGC 1OH4A 3CNAA 4JDOA 3WCRA 5KWRA 4U36A 2VOWA 1MR5A 2F4PA 4HONA 1RUG1 2JDMA 2ORZA 4Q4X3 3VN4A 3OTFA 4RHV1 5FPLA 4AI9A 2EXJA 1KQRA 3FFQA 3G6JB 4CEWB 5FWEA 2XLFA 3O1RA 5FKCA 1Y9MA 4C8DA 2A3XA 3ZXGA 3VBRA 4JGYB 4XDPA 3N9PA 3RI8A 1FPN3 4MHUA 4XUTA 2OXBA 4WV8A 5FCCA 1RUJ2 4NIHA 1O3SA 1PVC3 2BJSA 3BTZA 1C57A 1ZZ7A 3AYCA 3I3QA 5A3LA 2JX9A 1HQLA 2PQQA 5F1RA 1PK6A 2NP0A 3AKPA 1CAUA 3HQRA 3D3AA 1O3QA 1SBDA 1SFPA 4WVVA 2VZ3A 1IQDC 1CPMA 2X29A 4R9CA 4BQ3A 1S2EA 3IMMA 5JZGB 3HQXA 2WNUA 1IPKA 4Q29A 4B7EA 1FOD3 5GJ6A 5A7WB 1XRUA 2WT1A 3M3EA 2PELA 4QX1A 3ZPOA 3JZVA 1LJ7A 2WYFA 1JOBA 1NG0A 3GZUC 5T5LA 1AR83 2VNVA 3E6BA 4HT1T 3V65A 1O8PA 1I1EA 3AP4A 2VOTA 2QVSB 2R061 5AVPA 5L7OB 1QJX3 3ETPA 2I2SA 3WNNA 2QQLA 1ZA7A 1UOBA 1H9PA 1I6XA 4CP2A 4CP1A 2IXIA 2CDOA 3QD6A 1AX2A 1RUD1 2DVDA 3S57A 2VECA 1C8M3 4BYYA 1HIXA 4AI3A 1UN1A 2RE9A 4N53A 3A0KA 5EJ3A 5JOXA 3MV01 1ZRIA 3MO4A 4CEWC 2DVGA 4OHYA 5J48A 1GICA 1QH7A 2QQJA 2OQ6A 1A78A 2A6XA 4J1XA 4CP9A 4IEPA 1PO21 2XVGA 2J7MA 1ZRCA 1BMV1 1RJ8A 3MFAA 4JGYC 1WW5A 3RYRA 3ZO0B 2VNGA 1Z7S1 2VMCA 4HK8A 4R4ZA 2Z4FA 4LHSA 5FY0A 4XIKA 3GF6A 1QU0A 1EUTA 2GC3A 2IZWA 4D6RA 2Q30A 4CDQA 4NUBA 4FT8A 3T1LA 3LA2A 1OVPA 4XAEA 1SPPA 2D44A 4I0AA 1LOAA 3THTA 1RUE2 3OBZA 3FJSA 4IGPA 3VDDB 2XBO3 5FZAA 5CA6A 2VZVA 3JQWA 3RZLA 4AYUA 3ZN4A 5FP7A 2Y38A 2ET1A 3GJBA 4SBVA 5H9SA 5JZGC 4WVZA 5SV5A 1DYPA 2IXJA 5FK8A 2IXLA 5CISA 1LHNA 1U5YA 2VUJA 4FFIA 5LRRA 3WF2A 2R7EB 4XPVA 2JE8A 4CU6A 5L9VA 2ZGQA 3WW3A 3ZFGA 2W1UA 3APBA 1DGWX 2XJTA 3I59A 4KBZA 4Q4X2 4UAPA 4XOGA 5DQ0A 5FZ0A 2WC2A 5L7OC 4YNIA 3GALA 4AVBA 4LJHA 4XUOA 2ZKNA 1H1AA 3GBWA 1ODMA 4LHLA 1OLRA 3ZN6B 2LRPA 1AL0G 1OVSA 1FPN2 2BEOA 5I8YA 1AXYA 3KT7A 1PVC2 2J1UA 4UFKA 3Q8BA 3ZSEA 3K4AA 4IEVA 1UO9A 1Y7BA 5IK4A 2QQPA 4CCEA 1MS9A 2RS33 1QY4A 3AB0A 5C8CA 2PYTA 3B9CA 3OY8A 3VDBA 3WP5A 4HVQA 3NRUA 2JG9C 4NN0A 4CCNA 1AX1A 1VBB2 3AMNA 4YWAA 2IUWA 5DDJ1 1SG3A 4MGQA 2O8QA 4UBHA 1BCXA 4AFDA 2YU2A 1JXNA 3AYAA 4AG4A 2DCTA 1JH5A 3O0XA 4LO8A 3RI9A 2XH6A 1YO8A 2YROA 1KFUL 1UXZA 3VDDC 3T2OA 1OFSA 1W28A 3ZFEB 1AR82 2BPA2 1WMXA 1BK0A 3NW4A 1QJEA 1UYYA 3NJVA 3ON7A 3B00A 3MEPA 3MIEA 3OOXA 2G9ZA 5J1XA 4QAWA 3C7OA 5FZOA 1UU4A 3WP4A 1XXNA 3VD5A 4CUCA 2QZ2A 4IEUA 4Y1VA 4PIXA 1T6GC 1CN1A 2PMWB 2ZMNA 1Z0HA 1X36A 3H8OA 1C8M2 2VTFA 2WSUA 3NV1A 2C1FA 2XKOA 5DMYA 3KT4A 2GH8A 3WOGA 2DU1A 3O1SA 2D98A 2QJVA 4I02A 2G9FA 4CDWB 4JRAA 4CEWA 3I3MA 4OUEA 4FOVA 1X82A 4PF5A 4CCCA 1STMA 2GMMA 2QFEA 4IERA 3GM8A 1UWWA 2B45X 4QDRA 2RV9A 2D6KA 4JGYA 1UW8A 4DY3A 3AZYA 1S0FA 4X6QB 5IWFA 1GP4A 3N9MA 4PQ9A 5FZ3A 4DNYA 1I5PA 2P3KA 2W3JA 2CGOA 3O0VA 2JDPA 3IDBB 2B4KA 1BHGA 4UBGA 3BI3A 1AR91 1R091 4QPIB 1OQEA 2XBO2 3AKQA 5A7OA 1H1MA 5ACA2 1JU3A 3ASIA 1FV2A 5FYBA 3BIEA 1RUOA 4OI4A 2PHRA 4QKFA 2HWD1 3TB0A 1CWPA 2E7TA 1VBC3 3LDKA 1RUC3 1Q8OA 5JZGA 1ZA4A 3VL9A 4F7ZA 2HWB1 5ABJB 1LECA 2OA2A 2VCMA 2JDZA 4IE7A 2JDKA 3VZOA 5A7WA 2WAOA 3O0WA 4AWDA 3S6PA 5I8SA 3ZFEC 5GALA 2GZWA 1RJ7A 3O1UA 2D97A 2KM2A 4DRRA 1JS9A 1ALYA 5GZDA 1QDCA 1PIV1 1GANA 1TVGA 2R6QA 4FFHA 4RN5A 4NOTA 4XDOA 1DHKB 2IVJA 3WNOA 3D0JA 1JYWA 3VBOB 5L7OA 4JX0A 3SLIA 4XABA 4DS0A 4MVTA 4C0HA 2Z79A 3HNYM 3FC0A 3U78A 4K7JA 4F8AA 3DN7A 1M06G 4AQ2A 4CDWC 3T30A 4D6SA 3VD7A 3DXUA 3PUHA 1X8EA 3AMMA 5LBBA 1H0BA 4OHZA 1OOPB 3WF3A 5FBJA 2VJXA 3ACHA 3RWKX 3WCSA 4A6SA 2VZRA 1G9CA 3PVOA 1O5LA 5FZCA 2RS32 2Q8EA 3TAYA 3KF3A 1G8WA 2GNBA 1VBD1 1OF4A 4LA2A 1GZ9A 4QX7A 2JG8A 1UPIA 2AGSA 3PHMA 3AP9A 1KXGA 1QOOA 3NV4A 3LOIA 3AC0A 1LOGA 4F3JA 4QPIC 3BGAA 4LULA 1HRV3 3PLQA 3UYJA 1ZVFA 4Q4Y3 5C33A 4LKEA 1N47A 2VNOA 3VDDA 1JODA 2RDRA 3OBAA 1U5IA 1W9FA 1W9YA 3ACGA 1TMF3 5I0RA 1LHUA 2XXZA 4GJZA 5ABJC 4LBKA 2R071 1V6NA 4PDWB 5FY7A 2W5FA 2E31A 4YGCA 4GXLA 1OLME 1PNGA 4CCMA 1W9TA 1KRIA 2MEV3 2DVAA 4YRDA 1DBNA 3VBOC 1RVF3 3NJZA 3VHOA 4XUPA 1S0GA 4YM2A 1Q3EA 2W08A 3CL1A 3MF9A 1BK1A 1Q8SA 1W6MB 2ET7A 4AHZA 4CRQA 1V6MA 3ZN6A 4IEYA 1LU2A 2ILMA 2ZX0A 1YNAA 3MW2A 1KGYA 3PJQA 4LO4B 1WUVA 1B35B 3USUB 4E2SA 5HV4A 5KHGA 3NKGA 5ISLA 3U4SA 1X9PA 3MIHA 4PIYA 3BU0A 4XBQA 3IPVB 4FBFA 1Q43A 2AEYA 2P6CA 1OOPC 2RR13 1YWKA 3OF1A 3W58A 2VOVA 4AQTA 4CCKA 3ZIXA 1VAMA 5FMCA 2N7GA 2VQAA 3WX5A 2QQVA 3I8TA 1W6NB 2ID4A 3KT1A 4YM0A 4ITCA 1OA2A 4Q0VA 2NZ9A 4OQ8A 3KV9A 1QOSA 3DYMA 1MQTB 1VBC2 3OEAA 1RUC2 3LA3A 5KXBA 1C4RA 3R0RA 1SLBA 1GKBA 3UT0A 5LK5A 1QJZA 1F15A 4YW1A 2OPKA 5KXDA 1AYN1 1LNSA 2B46X 3ROUA 4AVTA 1CVNA 1QJU3 4XYXA 4NHXA 4DZGA 4NIGA 5DG1A 4QB1A 3AMQA 3ZFEA 1AYM3 2UWAA 1WA6X 1AHSA 4EZHA 4PDWC 2ZGOA 4OMDA 4XBNA 1SMVA 4KBBA 4WM7B 1N3QA 1VBE3 4QQPA 3EYPA 4LBNA 1LULA 1LHVA 3VD4A 3WG2A 3JXSA 4RS5B 1NAEA 3JUUA 2JJ6A 4ATFA 4AL9A 1W03A 3K4DA 3IN9A 4CDWA 4DXRA 2D5HA 4Q27A 4WM8C 1XJAA 2IVIB 3V64A 2EIEA 3DXTA 3Q9OA 3BCWA 4NIAA 4YG0A 1DLCA 2Y33A 4CA9A 1B35C 2D3SA 1UOGA 2X10A 4XZPA 2BU9A 4IXLA 4HL0A 3PUSA 1ND2B 5EYYA 1IG0A 1BKZA 4W6WA 4CZSA 1YYNA 2WNVB 3NO8A 2YBPA 5A7PA 4OHVA 3OYWA 4GJYA 1G86A 4YZ1A 1HRV2 1HN1A 3HQUA 2VZUA 3N9OA 4Q4Y2 3ZYFA 4QPIA 4DFSA 5AC93 4K8FA 1NLRA 1MQTC 3VB9A 4Q0UA 5FZ8A 3LB9A 2AYHA 4XURA 1TMF2 1E5SA 1PM4A 1AR71 1O59A 3VKOA 4QX5A 3AMHA 1XNBA 5ABJA 4AEMA 1RUH1 2HLEA 3BKZA 1ASJ1 4ISRA 4MOAA 2P17A 1XNAA 5FUNA 5F37A 3S7EA 1H2LA 1O7FA 1H8TA 2EF6A 2YC0A 5EPAA 2E7QA 2MEV2 1RC6A 2XLGA 3PIGA 1RVF2 1YCIA 2D93A 3B02A 4PBPA 4YZ4A 4ONUA 4JHZA 1NZIA 1V9U1 1GNHA 4WM7C 3ZXJA 5A6ZA 2WQ4A 2FDHA 4RS5C 5FZHA 3RSJA 3ZSJA 4Q4W3 4HZFA 2XQXA 3QACA 4Q5OA 3NVCA 2X09A 1ZZCA 2JENA 2RR12 3V0BA 1W9WA 5EJ1B 1OOPA 4XF9A 2A75A 4K3UA 3KS7A 3T2QA 1W8UA 4TLFA 1ND2C 2OZ6A 3FHAA 3POIA 3RMYA 4Q8KA 2ZMLA 1IQAA 4UFHA 3QH6A 4XJAA 4Y1UA 3ZYGA 4Z2WA 2WNVC 3SCHA 5DUUA 1DG6A 1NOVA 3LZZA 3PVBB 1UOJA 1REDA 1TME3 2BOJA 1GYKA 3MYXA 1S4CA 1Q8VA 2K2SA 1NY71 4IV3C 4DRVA 3NNGA 3HOBA 3BIWE 4CXYA 4P9YA 2VZOA 1PMHX 1REEA 3EO6A 3N7JA 3QOPA 1WCQA 5DAVA 3I2IA 1RINA 5DZEA 5FBZA 4EN9B 3RPQA 4E8DA 1V70A 3OSDA 1J83A 3ZX7A 4URAA 4HVOA 1ZRRA 4M01A 1YQ8A 5FK7A 4L0PA 1VBE2 2GAUA 3C2UA 3OUIA 4Y1YA 1OD3A 1R082 2VZTA 3ATGA 4BPZA 3TN91 4PCRA 2HH9A 3ZYRA 1NE4A 4ZKTB 4H7MA 1AJOA 1LEMA 2C9KA 3ZN5A 1KEXA 1MEC1 1PX4A 5BPXA 3BOWA 1W6MA 4P5HA 4JDNA 4YSFA 2O14A 3WDXA 5D1IA 4EN6B 1H9WA 3USUA 4MGYE 4EZ4A 2YC2A 1B35A 5C3QA 3AFGA 4EWDA 5C5TA 4HKWA 5T5PA 1UAIA 4HANA 3IPVA 3P6BA 3IB3A 4CVUA 3IAPA 4PT6A 2YFZA 2EAKA 2P3IA 4M00A 1JN2P 1LOEA 4Q4V1 5ANQA 4XQWA 1W6NA 5AC92 1XSRA 5JOZA 2UY8A 1MVEA 5LWBA 5FY1A 4DPNA 3TBDA 1MQTA 3LPGA 1DQ2A 1TNFA 1LU1A 1ZX5A 3VBHB 4AFAA 1GZTA 4P9WA 1JZ3A 4E4DX 1EAH3 4LQRA 3GNEA 5C7GA 1SLTA 4QX0A 2FQPA 3R05A 4XJ9A 2VCAA 4X6RB 1FMD1 5T54A 4B29A 2PAKA 4OCTA 5I0UA 1K5JA 3SEPA 3RZJA 2QQUA 4KNCA 1LODA 3KGLA 2CV6A 2WSVA 1PMJX 3U0ZA 1RGSA 2C24A 2FCUA 2ZTNA 3H50A 2XHNA 3E6DA 3FUQA 1WLDA 1PGL1 5A32B 3T0AA 3WP3A 1A34A 2Y0IA 4WM7A 5FYIA 4Q4W2 1CZSA 3NQHA 1AR63 1W9SA 4BIFA 3GZAA 4QX3A 4RS5A 4IE6A 4BQXA 1YI9A 3J7LA 4ZONA 2F17A 2VE1A 3LIGA 4ASKA 3WG4A 1CAVB 4MZUA 3KHBA 1X9TA 4FPOB 1S2BA 2R043 1SLIA 4W65A 1PHMA 2JKBA 4Z2AA 2HWF1 3M4FA 3RS6A 4NRMA 1SFYA 2DVBA 3J26N 4CDUB 2RJKA 4E2QA 2VMDA 4AVAA 1ZBE3 4FCAA 2VMHA 3J7MA 3MIBA 3QH7A 2WNVA 3FX3A 1W8FA 1MVQA 1TME2 3E5XA 5FPXA 4LT5A 1VB2A 5H9QA 5A7SA 3MPPG 5EHDA 4LITA 1VRBA 2EIBA 4IQPA 5CU1A 4JTNA 2GH2A 2J42A 5DABA 5F39A 3DEMA 4CPBD 3K75B 2HWE3 1EPWA 1RMU1 2BERA 2Y6LA 4JQTA 4N7UA 1QNWA 2OQ7A 1VMJA 5TSWA 3POEA 4Q4X1 1BZWA 1WLTA 1XBFA 3P5BA 5FZ7A 2ZX1A 3RFRA 5CG8A 4L9BA 4QX2A 3D5OA 4META 5CIRA 3RDIA 2JDYA 3MW4A 4GWJA 5FZKA 5CAZA 3M3QA 3B9IA 4P00B 2HBUA 1LTEA 1XOYA 2EALA 1OH3A 1Y4WA 4CEYB 5C71A 5I8TA 4BCUA 2ZGUA 1COV3 4M0NA 4UT5A 3SHRA 3TEXA 4A4AA 3HBKA 3ECQA 4I09A 5A70A 1LB2A 1VMFA 2BQPA 4K21A 1T2XA 3AP6A 4L97A 2C5DA 4LBJA 3RNSA 3WW2A 4AI0A 1CQ9A 4AI2A 1W6QB 2WS93 2BFUL 2ZHNA 3E1F1 4OI1A 3LOBA 4CDUC 1O5UA 3U07A 4K20A 4WZCA 3OPWA 4HKOA 5BNOA 1O3TA 2CNAA 2FMDA 4D94A 3E5QA 2JKXA 2ZCWA 3T08A 1Q8QA 1FOD1 2AUYA 3J8F3 4K1ZA 3LQCA 4KQ7A 3K77A 2PTMA 4MO3M 4XJUA 1MS0A 5FXZA 2VG9A 5DAXA 3W20A 4LA3A 4Q0QA 4XF3A 5JSOA 3ACLA 2AC1A 1S0EA 4AGVA 2BV4A 3O14A 4E4HA 1EAH2 1UY3A 4LO5B 5CEHA 1UIJA 1QJX1 2GALA 3Q8EA 2D6PA 3I2JA 3HBZA 4E4ZA 2Z69A 1XYPA 1YQ6A 3JBG1 3PL0A 1K42A 1PO11 4BE3A 3W5MA 1H2KA 1XNTA 5JAXA 3DKWA 1W8HA 1OBNA 1VE0A 1SEFA 4RFRB 1ZBA1 3LEGA 1MZ6A 4A7YA 1O3RA 1K45A 5DUVA 4YG3A 3VZNA 5A3UA 4MGKE 1AR62 1AXZA 1R1ZA 2Y6FA 3AJYA 3WF4A 4CEYC 2RVAA 4DXZA 3LD8A 2WYSA 2ARAA 3JB4C 3JCIA 2R042 4LTAA 3WQ1A 5FQ0B 3VZKA 5FOJB 1MS8A 4RFT0 2QNKA 2W92A 2XJUA 3KMHA 1EV11 2W68A 5IAVA 1ZBE2 2B7YA 4MH0E 2A5ZA 3AP5A 5IK8A 3MZHA 4HPKB 4HOOA 3WDVA 3POJA 4CSWA 4LKSA 5A6YA 3NJXA 4FPJA 4IV1B 4Y24A 2RMU3 2WRAA 4CXXA 4JHTA 5JI7A 2H6CA 2YV8A 1HXS2 2HWE2 4YW4A 3RJRA 1V6JA 1GMMA 3VDAA 4QXKA 3VBHA 4BK4A 4UW5A 2B9UA 3GZEA 3N9NA 4M4RA 1KDKA 5BYNA 4NRPA 4NROA 3N35A 1HRI3 1FNYA 4XEZA 1COV2 2W0XA 1XU1A 3VKNA 3UKNA 2B8MA 5EFUA 5A32A 2C9AA 3KVAA 1L3JA 1SCSA 2OS2A 5E16A 5LCWL 1VBB3 1DGRN 3SCGA 4CU8A 1UOFA 5FLHA 2IWGB 1NQJA 2VUDA 3FMGA 4XJ8A 1CAVA 2WS92 4LHNA 5A3MA 4QM9A 3HIFA 2UU8A 3TNPB 2DCYA 1SDDB 3KV4A 4E9KA 2WQZC 2Z5WA 1W6PB 3SEEA 4CDUA 5AFBA 2A71A 2BVVA 5FXVA 3J8F2 3DUIA 2KXLA 2CSGA 2C0ZA 5K4LA 4DUWA 1RHI3 1VPHA 3K46A 1WBFA 4GIQA 3BPSA 2JXAA 5DXDA 1G9AA 1VBA1 1XE8A 3RWNA 2XKPA 4IV1C 4CU7A 3VD3A 2BZDA 1YFWA 4GH4B 4ZZ5A 1FYUA 2W95A 1HB2A 4OLLA 3SH5A 3SKVA 3HNMA 3JD73 2RS13 4HBNA 2VZ1A 4ISQA 3ACFA 1NZCA 1QXRA 4LUKA 4UW3A 4BQWA 2P37A 2CAUA 3M3IA 1RUI3 3NMBA 5KHHA 5KHKA 5I0SA 1UZZA 2IXKA 2ZZQA 2LALA 2DCJA 2P1BA 3BU7A 1MACA 4QPWA 4YFWA 5FZEA 3RYPA 2JG9B 5HV0A 3HN3A 4FOWA 1K3IA 2JB4A 4AEDC 4CEYA 5LBEA 1F5FA 2GSYA 4QHZA 4AI1A 2DTYA 3AXDA 4LBQB 4OI2A 5ACA3 4N43A 2WT0A 1I3HA 3VDCA 2EIGA 2ZS6B 2Y6HA 4S2GA 3H8RA 4FAGA 3GZTB 2QKDA 5IK7A 4IGOA 1RIRA 2QQWA 1W6QA 1HX6A 2FCTA 3AZVA 3DYOA 2EXIA 4L2NA 3DYPA 2VMEA 2DUPA 1RUC1 4SLIA 2DF7A 4FP2A 2JICA 2RMU2 4CUAA 4AAXA 3TWIA 3ABZA 2TUNA 4IE5A 4RYDA 1POV3 2ZEWA 3POSA 2AACA 4XMAA 1QNYA 1J58A 4HN0A 2VW0A 2X8KA 5GLVA 1LHWA 3GBFA 3CZUA 4GH4C 4LHKA 3MICA 2V73A 2BNNA 3ZKUA 1RUG3 3M3CA 3MIGA 4RHV3 5FZ6A 3CIHA 4V2WA 3VL8A 5FZBA 4C1XA 4FO9A 4PQQA 4FOQA 3UKTA 1HRI2 3ELNA 1JZ8A 3N9LA 4GMP0 5FXWA 2X05A 4QKNA 1UYXA 2WFF1 3PU8A 1KJLA 3ZDSA 1MZ5A 1NQDA 4QQLA 1DZTA 3CU7A 4MYEA 1V6IA 4TYSA 5JR2A 3BN6A 4BQ2A 1QHDA 2DUQA 2V4VA 5EV7A 1WCUA 5FYVA 5L73A 4B3NA 1VRH3 3RG0A 3GCWA 1CD3G 2HYKA 3EBRA 5FZ4A 2Y6KA 3EXUA 1H8VA 5FPBA 2Q1FA 3WINE 1S0IA 5FPUA 2WA4A 4FQ4A 4QQ2A 3VHNA 4KWLA 2P2KA 4BMEA 1S0JA 2ZGPA 1ULFA 2ERFA 5FFOC 5GM0A 4Y5SA 1RHI2 2PLV1 1SLAA 1HRV1 1AVBA 1OXCA 5FMBA 4LR4A 3O1VA 3L9JT 2XONA 3NV2A 2Q1MA 2ZGTA 4RQPB 4IGQA 1F4AA 4CPBA 2DDUA 4Y4YA 5EJZB 3AVRA 3ALQA 2VL4A 1GZCA 4XFFA 2E51A 1U12A 2FDGA 4XF4A 5T5OA 5FMOL 2R063 3JD72 1LHOA 2RS12 3DL3A 3GYDA 1EP0A 4QU2A 1DZQA 5E88A 4I3GA 4PLOA 1RUI2 3IDEA 1RUD3 3A21A 4GAZA 2MPFA 3WY6A 5A33B 2YY1A 4J6GA 4QPGB 3PUQA 1F35A 4Y5TA 3C7GA 2PHWA 1QJY3 4Y5Z0 3WNXA 5CKNA 1DLLA 2XR4A 4HMZA 2ZGSA 4YZ3A 3H3LA 1CONA 2RR11 1Z7S3 2ZX4A 2IFWA 3PU3A 1OD5A 3O1OA 1AZDA 3IKWA 3MGUA 3FBMA 2BNOA 4XBLA 1VP6A 3M8LA 5D2AA 3ZXLA 2SBAA 1AL23 5JDBA 3FZ3A 1G9BA 2VTXJ 1NKGA 5C5UA 5FV3A 2WNOA 2FDIA 1UZYA 3KQRA 2DVFA 5IVFA 2ZGNA 4LK6A 4P9JA 2EICA 2UY9A 4XW3A 4RD7A 5JXIA 1N1VA 4HG6B 4NWVA 4QX8A 1IKQA 1YJKA 1L7RA 4UFLA 1RL3A 1SQ4A 1V6KA 2H6BA 1XNKA 3POGA 2Y0OA 4FQZA 1QJU1 1TZOA 4LE4A 4MLOA 2XWJB 4QHOA 1WWYA 2VVDA 1DGWA 2G9GA 3WNKA 4RQPC 3ORJA 1US3A 1AYM1 1QDOA 1XU2A 1BQPA 2E32A 3WDWA 3D82A 1RUG2 4RHV2 4GH4A 4YVWB 3PTRB 1XPWA 1J59A 2HWC1 5EP9A 5FR3A 5FP9A 2VMFA 1S2KA 2EAAA 2J22A 3KSCA 4J25A 4QPGC 1OURA 3SISA 4BLJA 5JOWA 3H8XA 3LGRA 4B4PA 4UFIA 2WWUA 4QXCA 4ES8A 2EIDA 1OA4A 4ET7A 2JG9A 1Q56A 2RDSA 4Q0SA 1PX3A 4GMP1 1VRH2 4QKBA 4B8EA 1QGLA 3POBA 1S0DA 4GZ9A 3MLLA 1J84A 4Y22B 4XXAA 5LRSA 1DU3D 4M3CB 5JR7B 5FJHA 3R6SA 4L99A 3HT1A 1XC6A 4DEQA 2V5DA 2ZX3A 1A8MA 1D4M1 5F6KA 5FZLA 4LE3A 1ZM1A 1RTVA 4P9XA 5DDJ3 1ZREA 3B69A 5A6QA 5AC91 1ZZ8A 1XQNA 2QE3A 2XWBB 1U5ZA 1H2NA 2WNEA 4GALA 3LEMA 1ZZBA 3Q8AA 5F9TA 3ME2A 2VQ0A 1W0OA 1YFXA 2R1DA 4TXWA 3LSDA 3RZZA 4KWKA 1D0HA 1DP0A 4CCJA 2ZX2A 4LO6B 2R062 3GHMA 3BTAA 2E53A 4WM8B 2KD7A 3HVDA 1OLMA 4F83A 1RUD2 2WZEA 4BIOA 4EQVA 2IXCA 3HNBM 3ZYJB 3KCXA 1YQCA 5FREA 3WF1A 3ZR6A 4YVWC 4HETA 3MPBA 1WLWA 5FP4A 5FYZA 3SNMA 3ZIWA 1YIFA 3WQ0A 1W8ZA 1QJY2 2WUHA 4ORFA 3WP6A 4ARXA 5DUXA 5BY5A 2RDQA 2Q0AA 2VH9A 1BMV2 5LA0A 4GB31 4JTOA 2YPDA 4JKLA 4BU2A 4UW4A 4YM3A 4LOSA 5FAXA 5FPVA 1Z7S2 1NLSA 2UURA 3AFKA 4C1WA 4UF0B 3I3BA 4N7IA 2ZMKA 2Q8CA 1N1TA 2ARCA 1AL22 4DY5A 2FDJA 1DYOA 3MF6A 4JC1A 4D0QA 2K9ZA 2A6ZA 1UQXA 3BTXA 3K2OA 1VALA 3ZFFB 3OEBA 4KGQA 1LGCA 1HDKA 1ODNA 1AR93 1REFA 1W04A 4EROA 5FYYA 4A44A 2JDUA 4OFGA 2HWD3 4BB3A 4JAAA 4H3WA 1LAJA 1KFXL 3FHQA 1R1A1 2HWB3 2A3YA 3IZOA 2PFWA 2AREA 3VKMA 2BNMA 3F2ZA 1S0CA 4JKMA 4ARYA 4K6BA 4BM8A 4BOWA 4DIQA 4AOCA 1R083 2DBNA 4IDZA 3N3HA 1QF3A 4NRQA 3UGFA 2ORXA 2E7AA 2ADDA 2W2IA 4BMBA 1PIV3 1W3VA 3CBNA 5CKQA 3VBUB 4JRLA 4XJWA 5C8WA 1YFUA 4GULA 3H7YA 5L36A 4HFSA 4XFGA 2W1SA 4P9GA 1RUF1 3UNPA 2JE7A 1KJRA 5A33A 5SV8A 2WO2A 4QPGA 2C6SA 4XZUG 4RA0A 1RYYA 1N1YA 4M4PA 2XJRA 1UF2C 4V2VA 1VMHA 2GMPA 4AEKA 2QQKA 3KCYA 2YBSA 1UZWA 4A7ZA 4IV3B 3KQ4B 3IIIA 4EN0A 1F31A 4AEJA 1UZ0A 4FFGA 5T52A 3S5AA 1JZ7A 4OHXA 4IEWA 5DDJ2 3TNQA 4OQ9A 4Q0PA 4BQ5A 2I07B 4JZRA 5A3WA 3LEKA 3ZFFC 3IM0A 1JUHA 2E9QA 1SLLA 1W2OA 1JHJA 5LA9A 5IVCA 1YHFA 3E97A 3KGZA 3HMYA 5BUVA 2PA7A 3WQBA 4GWNA 4AF9A 3CHXA 4AR2A 1Y3TA 4XFBA 2H0VA 5FZFA 5FLIA 1LOBA 1UIKA 1YC61 2NPIA 2TNFA 3OBRA 4L92A 5IATA 2R073 4UI9L 3VBOA 2GC2A 3THDA 1SACA 4I0WB 3CMGA 2NLRA 4AVVA 1DCSA 2FD8A 2FDFA 4FPYA 1J3QA 3ZYHA 3BB6A 2JIGA 3M7AA 4TLGA 5G05L 2WWSA 1GBGA 1K12A 1WBLA 5F3EA 3VBUC 3WHUA 2ZABA 1QKQA 1W05A 2YGLA 3MIDA 4YVWA 3P3PA 5FLJA 4NVPA 4OMCA 2Q8DA 1RXFA 5B4NA 3M3OA 3K4ZA 3LKJA 4FPFA 3CEWA 2BFUS 1LOFC 1ULDA 2PXJA 1E57A 2VUAA 4GKXA 2PAMA 2WAAA 4K8RB 2AEZA 2R0FA 4XF0A 5JVVA 5B2GB 2OKXA 4XAAA 1GZWB 2R041 4FAHA 5C3SA 1O4YA 5HCHA 4M3CE 3I2KA 2JWPA 2XOMA 3FHIB 1PGW1 4ZS3A 1ULGA 2A70A 2YGMA 3MLJA 4INDA 3SMHA 5T50A 4OUSA 1CAXB 1JW6A 1ZBE1 2VCCA 4KWJA 4DUXA 1AR92 2BYVE 3PVEA 4M3CA 1GOGA 1J3RA 2WT2A 4NAOA 1ENRA 1Q8PA 2XL9A 3USSA 1IHMA 5D8AB 4XETA 5IT6A 2XMLA 2HWD2 1JYVA 1CZVA 2MHFA 5A7QA 4EN7B 3MI8A 2XJSA 4JDMA 3ZYPA 2D3PA 4JGZB 2HWB2 4RR3B 5JXJA 4PDWA 1ZZ9A 2QZ3A 5LK7B 2HWE1 2ZHLA 5F5IA 4YM1A 3AKRA 1HJFA 2DFBA 4QXBA 3SQOA 4TN7A 5G04L 4XC9A 4W4ZA 1JHNA 1PIV2 5KC5A 1CAWB 5GZGA 4QD2A 3GHNA 2P4EA 4WBBA 1QQP3 2ADEA 1RUJ1 2IFRA 3WLUA 2ATFA 3K3OA 3K51A 4WM8A 2BOIA 5LA1A 2VD7A 4WVMB 2WL1A 1D4VB 5FMDA 3AXEA 1GWLA 2H0BA 3IAQA 2GNMA 3A22A 4QXHA 5CFCB 1LESA 5CNAA 5JIAA 2Z42A 4PLNA 4ZY9A 4BQ1A 1TEIA 2VQTA 1UCXA 1CX4A 1IPSA 1WLCA 4O65A 1HV0A 1ZZ6A 5HI0A 1QXJA 1UKGA 5ERLA 5K0UB 1SDWA 2VU9A 1N3PA 3AZWA
chains in the Genus database with same CATH topology
1F15A 1LAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F15 A;  1LAJ A; 
#chains in the Genus database with same CATH topology
 1IGO A;  3FBY A;  4WVW A;  1DQ5 A;  1AX0 A;  4QM8 A;  1HB3 A;  2RM2 3;  2UYB A;  1I9R A;  1BYH A;  2ES3 A;  4UF0 A;  5IYY A;  2Y64 A;  4RGA A;  3H1W A;  3RZM A;  1GSL A;  4URT A;  2OW4 A;  1YFY A;  5FYU A;  3MIF A;  4HK9 A;  1HB4 A;  1WCD J;  2HEW F;  3ZYB A;  4LK7 A;  1K5M B;  1A6C A;  1XYN A;  1ACC A;  2BRT A;  1UMZ A;  1VAV A;  5BXX A;  1ND3 B;  3ZFF A;  2ZEZ A;  1JYT A;  5D8A C;  5J09 A;  4COW A;  4QGN A;  3OPT A;  3VLB B;  4EV0 A;  4ZXK A;  3BYW A;  4BLI A;  5I91 A;  5JI9 A;  1UY1 A;  5K9Y A;  2IXH A;  1AR7 3;  4JGZ C;  4Y1X A;  4CCL A;  3UV9 A;  4RR3 C;  4YGB A;  2R07 2;  3PME A;  1FXZ A;  5FZM A;  3EB7 A;  2BDR A;  2XB6 C;  5IVJ A;  5FZG A;  1IKP A;  4NPM A;  1PZ8 A;  1L7Q A;  2CY6 A;  3U75 A;  2WZ8 A;  1VIW B;  2BUK A;  5EYX A;  1BJQ A;  3Q8C A;  2CGP A;  2RS5 3;  4DOU A;  2C26 A;  3VBU A;  4COV A;  2CDP A;  4LOR A;  1HQN A;  1V9U 3;  3SKJ E;  1S1A A;  2E26 A;  2JD4 A;  3ETQ A;  3EJK A;  4G3Y C;  4CUB A;  2QQI A;  5KBF A;  1IOA A;  1W2A X;  3I49 A;  3AJZ A;  5CFC C;  1F2N A;  2W87 A;  3ITQ A;  4KL1 A;  4LO7 A;  3WUD A;  3ZSK A;  3VHP A;  1BBT 3;  4I01 A;  4A3X A;  1ND2 A;  3MV1 1;  1RUE 1;  2YU1 A;  3OUJ A;  1GU3 A;  1U0A A;  2D6M A;  3AVS A;  5LB6 A;  4FXG B;  5L9B A;  2DV9 A;  1CJD A;  2PHX A;  3NWK A;  4H2A A;  4FXK B;  3W9A A;  4AGG A;  5K0U C;  2DUO A;  1GUI A;  3WF0 A;  4BIS A;  4C90 A;  5E6H A;  3SXW A;  3R4U A;  4IV3 A;  4QMA A;  2YXS A;  4EWE A;  4MAD A;  5LY2 A;  1NT0 A;  1HXS 3;  1GWM A;  4RL7 A;  1P8J A;  4YW7 A;  3HT2 A;  3J9S A;  4NJ4 A;  3AYD A;  2YMZ A;  3EQE A;  2LS6 A;  2VVF A;  4N9H A;  1K5M C;  3BTY A;  1FT9 A;  2J1A A;  5JPM B;  1KIT A;  2BWA A;  1ND3 C;  4NWW A;  1OA3 A;  4KG8 A;  4LKF A;  4Q8L A;  4R4X A;  4A2U A;  4D8M A;  2BGC A;  5IVE A;  2ZEY A;  5JCT A;  2DWR A;  1CZT A;  1JMU B;  2HBT A;  4P5Y A;  5F5A A;  3H3Z A;  2EA7 A;  5I93 A;  5C4W B;  5FUI A;  1FPN 1;  1BEV 3;  2PHU A;  2Y6G A;  4P02 B;  1QQP 2;  2R0H A;  3AM2 A;  4LUM A;  5FKB A;  3FLR A;  2X5I B;  3FN9 A;  3G7D A;  4JKK A;  4HN1 A;  4NPL A;  1UXX X;  3NL1 A;  1PVC 1;  3WEZ A;  3LF7 A;  4MX3 A;  1T6B X;  1EYB A;  2DYC A;  4UOJ A;  3TN9 3;  2WKK A;  4W50 A;  3S7I A;  4CYD A;  2WQ8 A;  4KGG A;  5FO7 B;  1NXM A;  1MEC 3;  2O0O A;  3NST A;  3UJO A;  1VBB 1;  2VUC A;  3I2D A;  4XF1 A;  1W2T A;  2W47 A;  4YGD A;  4Z8B A;  5HPO A;  1DZR A;  5HXV A;  4IEQ A;  3JQX A;  4P14 A;  3MFC A;  4MUV A;  1DQ4 A;  4O7X A;  2RM2 2;  1GZW A;  4H7L A;  5A3O A;  4XUQ A;  2LUW A;  3C7E A;  1PZ7 A;  1O4T A;  1NXD 1;  1PM7 A;  4YW5 A;  3ZMO A;  3PVN A;  3HEI A;  1X7N A;  1AR8 1;  4PLM A;  5F3C A;  2W39 A;  2W1Q A;  5FO8 B;  1H30 A;  5F6L B;  1XB9 A;  1CIY A;  4Q4V 3;  1CAX A;  2QQN A;  3LE0 A;  4NPR A;  5FZI A;  2QQO A;  3T3Y A;  4BJ0 A;  4AVC A;  5HCB A;  5D8A A;  2J1V A;  5T3N A;  1OKO A;  1ENQ A;  4NHK A;  4GA9 A;  1AR7 2;  1C8M 1;  2PHT A;  3DPR B;  3VGI A;  2XJP A;  3X29 B;  2D3R A;  3NNJ A;  4W6X A;  5J96 B;  4LBM A;  2QQM A;  2ARB A;  2QDN A;  3WDY A;  4RR3 A;  4XTP A;  3I7D A;  1KS4 A;  2BBA A;  2WN2 A;  1DFQ A;  5EZW A;  1WA4 A;  4UFM A;  2RJ2 A;  4A45 A;  4CTE A;  1FMD 3;  3H9A A;  1BXH A;  5IVY A;  5C4W C;  2QTW B;  3TEZ A;  5CBL A;  1F9K A;  2RS5 2;  2VVE A;  2VW1 A;  1XSQ A;  2D5F A;  2W9X A;  4UXA A;  1CAW A;  4H14 A;  2SLI A;  2X5I C;  1GQP A;  1V9U 2;  1NX9 A;  2W94 A;  4FI9 A;  5GLZ A;  3TRS B;  1NE6 A;  3KF5 A;  4CDX B;  3LPF A;  4YW2 A;  3HAG A;  2ZGM A;  4Q1P A;  4QWN A;  4IES A;  1BBT 2;  1WW6 A;  2TEP A;  4AW7 A;  5CFC A;  4LBQ D;  5GZF A;  2A6W A;  2A1X A;  5C8C B;  2XBO 1;  1G6N A;  4UW6 A;  1C5H A;  1ENS A;  3N36 A;  5ACA 1;  1S0B A;  1LKN A;  4GKY A;  2B9V A;  2HWF 3;  4UYB A;  5DAP A;  1OMI A;  1WW4 A;  5K0U A;  3GDB A;  1OUS A;  3MW3 A;  3RYK A;  4CP0 A;  3U1X A;  1FX5 A;  3GCX A;  4D7T A;  4HSL A;  3O7O A;  4OZX A;  3U14 A;  1AXK A;  4YW3 A;  1HN0 A;  5IVB A;  4B4Q A;  5DUW A;  5T5J A;  3C8X A;  1UU6 A;  2X53 S;  2YB7 A;  3AZZ A;  3KB5 A;  2VW2 A;  4X8P A;  5FP3 A;  2VNR A;  4R9A A;  2FMY A;  1K5M A;  1POV 1;  3H1Y A;  2GC1 A;  4PI0 A;  5A3T A;  1EY2 A;  1ND3 A;  2VXR A;  5DG2 A;  5E1R A;  2YBK A;  4QDS A;  3PUI A;  5J7M A;  4NII A;  3NJY A;  3DPR C;  4QGL A;  4Y26 A;  5DAQ A;  4AED B;  3CJX A;  1NUK A;  1RMU 3;  1BEV 2;  2YFU A;  5A7N A;  4QQH A;  4I2O A;  2Z2S B;  1OQD A;  1YIP A;  4D7S A;  4CXW A;  1HKD A;  1G9D A;  1WCK A;  2BVB A;  3I54 A;  1O4Z A;  4FPG A;  1XE0 A;  2OZJ A;  3TN9 2;  2EXK A;  3T4V A;  5KR7 A;  1JUI A;  3POF A;  3S0M A;  2BGP A;  1V0A A;  2WZR 3;  3I4I A;  1W3X A;  2RS3 1;  2J1E A;  3KVB A;  5CB7 A;  1OSG A;  5F3I A;  1MEC 2;  2ZOE B;  1QJF A;  4CDX C;  4A42 A;  3E6C C;  2DCK A;  2CL2 A;  3NKT A;  1OI6 A;  3I2G A;  4BWO A;  2B5H A;  5AVA A;  1UL9 A;  5LAT A;  1VRH 1;  2DCZ A;  2LM3 A;  5FYS A;  4D3W A;  1QXP A;  5LA2 A;  2J1R A;  5C8C C;  1JZ5 A;  2YPJ A;  4XCA A;  2XQR A;  2OVU A;  4XE9 A;  2XVK A;  4QGM A;  2XJQ A;  1LR5 A;  1J1L A;  2R1B A;  2Y60 A;  4JV4 A;  4AFC A;  4E4S A;  4PF1 A;  5M0T A;  1NA1 B;  4EWA A;  3PJY A;  4Q4V 2;  3I3E A;  3E5U A;  2Y34 A;  5H9R A;  3J4U H;  5FY5 A;  5JXG A;  5FO9 B;  1SHW B;  2CTV A;  2DUR A;  4RGG A;  1FV3 A;  4C0B A;  1QEX A;  1D2S A;  5CG9 A;  5FYC A;  3O5S A;  1C5I A;  2B39 A;  3O12 A;  4MGI E;  4I3P A;  1MS1 A;  3HN1 A;  1H4H A;  3FWE A;  3NNF A;  4MV2 A;  3UET A;  1FMD 2;  2FZ2 A;  5E8A A;  2KR2 A;  5FRA A;  3WDT A;  1YXW A;  2VPV A;  4LXL A;  5CFD B;  5A6X A;  2QDR A;  3JBG 3;  3NNL A;  5C4W A;  3KLS A;  2ZGL A;  1UPS A;  1PO1 3;  1M4W A;  2AR6 A;  1PGL 2;  1ZBA 3;  4BH9 A;  4B7K A;  4E8C A;  2X5I A;  5J98 B;  1S55 A;  3ES1 A;  3OJB A;  2JIJ A;  4HXC A;  3ES4 A;  1QJY 1;  4YAR A;  3KD4 A;  1W2N A;  3H3U A;  5C70 A;  2GP5 A;  3L2H A;  3OBT A;  5FXX A;  3H8U A;  1WD4 A;  2LTN A;  3LFM A;  3HD8 B;  3DF0 A;  3MLK A;  1TE1 B;  3RJ2 X;  3ZSL A;  2ARX A;  2FHR A;  2XUE A;  4Q2F A;  5KC6 A;  1XND A;  2JG8 B;  1ENX A;  3KM5 A;  2VZP A;  2HWF 2;  5CAD A;  3N9Q A;  3C3V A;  4G4F A;  4KMQ A;  1VBC 1;  1AL2 1;  3BPZ A;  4Y4R A;  3UGH A;  3T0B A;  1BVP 1;  1EV1 3;  3MUY 1;  3ZXE A;  3J7N A;  5FYM A;  1NCQ B;  2YZ4 A;  2ZBJ A;  3AYE A;  4DXT A;  2WFP A;  5C3P A;  3RRD A;  3J7H A;  1ULC A;  1YJL A;  4XQD A;  5CVR A;  1NA1 C;  2VBB A;  4FSJ A;  1TNR A;  2NM1 A;  2PHD A;  4FTE A;  3IBM A;  4K40 A;  2OT7 A;  2G19 A;  2BWC A;  2D6L X;  4LOT A;  3ST7 A;  1RMU 2;  1SFN A;  2ZA9 A;  2KA3 A;  2VQU A;  3DPR A;  4XDQ A;  5IFP A;  4LIU A;  3CF6 E;  4LBL A;  2AEN A;  4A6O A;  4DB5 A;  4S2F A;  3CLP A;  3HR9 A;  4ES9 A;  1W90 A;  3FLT A;  3CJI B;  2B42 B;  1IG3 A;  4QDQ A;  1JTZ X;  4NHY A;  5A3P A;  5CFD C;  4XFC A;  2WZR 2;  1B09 A;  2D43 A;  3R4S A;  1E5I A;  1QWR A;  1UMI A;  1Z78 A;  5FYT A;  1W8N A;  5JMO A;  3OG2 A;  3IDC B;  1DGL A;  2NQY A;  3POY A;  5FQ0 A;  2XG3 A;  3FLP A;  4Z82 A;  3WZ1 A;  4P08 A;  3AMP A;  4LNV A;  1J3P A;  2WO3 A;  2XL7 A;  2HYX A;  4YW6 A;  4GQ7 A;  2JB8 A;  3R4D B;  4CDX A;  5GZC A;  4FTB A;  1ULO A;  4FPK A;  4AAP A;  4TTG A;  4JVA A;  2CWM A;  1UY2 A;  1GR3 A;  3I97 A;  3N7M A;  5GLW A;  5FZ9 A;  3M2M A;  5FPA A;  2J1S A;  4DXS A;  4Q4Y 1;  4HPK A;  3OD4 A;  3V56 A;  2JG8 C;  3JU9 A;  4KU8 A;  4LMF A;  2Q8O A;  1OHF A;  1IS3 A;  4BQY A;  3U4X A;  3I2O A;  1TMF 1;  1E5H A;  3RQ0 A;  3K48 A;  3I2H A;  2UWC A;  3RVH A;  5J36 A;  4IV1 A;  1ULE A;  1NCQ C;  3BAL A;  3MBW A;  1FOD 2;  2ZHK A;  2EXH A;  1N1S A;  4QT6 A;  4MGT A;  1H4G A;  1E5R A;  2ZAA A;  2A6Y A;  3FUO A;  4U2A A;  3RMX A;  3LCP A;  1UX7 A;  4CUG A;  5LW9 A;  5GZE A;  4YGE A;  2WIN B;  2K46 A;  1VBA 3;  2MEV 1;  1LEN A;  1RVF 1;  1H2M A;  1QJX 2;  1VAK A;  3AKS A;  4NAM A;  2ZGK A;  3V0A B;  1OFN A;  4BDV B;  2WDB A;  4I0B A;  4QQO A;  5FJK A;  1POQ A;  5HXM A;  3JBG 2;  1PO2 3;  1DQ1 A;  1YUD A;  1PO1 2;  2VTX A;  2WLP A;  2ZEX A;  4AED A;  1OPO A;  1ULP A;  1ZBA 2;  3ZKY A;  3D6E A;  3WSO A;  1W99 A;  1HV1 A;  1UZV A;  3WQ7 A;  1GLH A;  3RGB A;  3CJI C;  2MNG A;  2GN7 A;  3LDR A;  4EN8 B;  3UES A;  3FE5 A;  3WW4 A;  3AL6 A;  2WBK A;  4CCO A;  4ZU4 A;  1OPM A;  2IC1 A;  1W6O B;  3MUZ 1;  1CIW A;  2P3Y A;  2E63 A;  1KD7 A;  1A8D A;  1RXG A;  3LSE A;  5DAW A;  3LFI A;  1W39 A;  4A41 A;  2AH2 A;  3VD9 A;  3CO2 A;  4UFJ A;  1EV1 2;  1Q5O A;  1MPX A;  1W2U A;  1W6P A;  3OYW B;  5GLT A;  3FL7 A;  4AE2 A;  4AQ6 A;  3OUH A;  1IS5 A;  2WO7 A;  4FPH A;  4LIV A;  3KHC A;  2W52 A;  3ILR A;  4XFH A;  2P5B A;  5KHI A;  5FY4 A;  4W8J A;  1F5J A;  2OUH A;  3VUO A;  3RZH A;  5IAX A;  4OVE A;  5BNP B;  3OGS A;  5I0T A;  4D7Y A;  1V00 A;  3B01 A;  1NA1 A;  3PIJ A;  3O1P A;  1IS4 A;  4MSV A;  5B4X A;  4KH9 A;  4B4R A;  1GP5 A;  4MGS A;  2JD9 A;  1V6O A;  4XJZ A;  4H55 A;  1OLQ A;  4AFB A;  1JYX A;  1VBE 1;  2OII A;  3PNA A;  3VBF B;  4FOY A;  5IFT A;  3CDZ B;  1QMJ A;  1R08 1;  3OGG A;  3UL2 A;  1UYP A;  1X8M A;  1H8T B;  4XXP A;  2R49 A;  4R8H A;  3D4K A;  3GBG A;  2D40 A;  3P3N A;  1C8N A;  1X33 A;  5FOB B;  3POW A;  4R9B A;  1W8T A;  3IWZ A;  3LWC A;  2JEC A;  5JPN B;  3I3D A;  1PZ9 A;  5CFD A;  2E6V A;  5L19 A;  4QB2 A;  1ZRD A;  1UY4 A;  1A3K A;  1C1F A;  1OUX A;  4IEX A;  4IEZ A;  2W91 A;  3NNM A;  2YC4 A;  2WFF 3;  5IJR A;  3V0B B;  2V72 A;  2VCB A;  5LBF A;  4LBQ A;  1D2Q A;  4FTS A;  4A3Z A;  1VR3 A;  3W21 A;  4OZO A;  1GOH A;  2V4A A;  4NHM A;  3T4H B;  2ZZJ A;  3ZSM A;  1FI2 A;  4JQR A;  4Y20 B;  1C1L A;  1WKY A;  3BOP A;  2OUJ A;  1NYW A;  2VZS A;  2XHK A;  4NMI A;  3KWV A;  5KXE A;  3U10 A;  5GKA C;  1HQW A;  1IZ3 A;  4YG6 A;  4COU A;  4AHY A;  4QPY A;  3S5Q A;  4KWU A;  5CYY A;  3U11 A;  1NCQ A;  3B7M A;  2PLV 3;  1D7P M;  5LY1 A;  3B94 A;  4OI0 A;  2ZGR A;  4X8N A;  4DUV A;  5BNP C;  5C3O A;  5JSP A;  1GV9 A;  1VBA 2;  2VUL A;  2VZQ A;  2NN8 A;  2Y26 A;  3UK9 A;  3URF A;  4BQ4 A;  2OYZ A;  1Y9G A;  4O61 A;  1W0P A;  2BGO A;  3A0N A;  5T55 A;  2FBE A;  1IPJ A;  3RZG A;  4ZU7 A;  3VBF C;  2GND A;  2HEV F;  5F5C A;  2GME A;  1WGP A;  1PO2 2;  4Q26 A;  4S2H A;  2GP3 A;  3KV5 A;  4Q4W 1;  1H8T C;  5A1A A;  3BVC A;  3CKH A;  5FY9 A;  3PMS A;  1OKQ A;  1O6U A;  1XNC A;  1G7Y A;  4ATE A;  2VMI A;  3CJI A;  3I2F A;  3M70 A;  2K0G A;  2LW8 A;  2QCS B;  3THC A;  2YHJ A;  2XGX A;  1AUY A;  4LEJ A;  4ASL A;  4EYU A;  1FNZ A;  5EXO A;  1RUN A;  2A7A A;  4Z07 A;  4PI2 A;  2GNT A;  2F6B A;  2C4X A;  1R09 3;  3SCF A;  1LGN A;  1H6Y A;  4L8Q A;  3AL5 A;  1TME 1;  1JZ6 A;  3B93 A;  4KU7 A;  3PDQ A;  3TYJ A;  3U37 A;  4DQA A;  3CZJ A;  4V1P A;  3DEC A;  3NV3 A;  5CKM A;  3WNM A;  1N3O A;  1G9F A;  2AZ5 A;  3QLQ A;  3ZYI B;  5EWS A;  5IUQ A;  4RQP A;  5C3R A;  1DDL A;  3BUC A;  4AGR A;  1DQ0 A;  3ZMN A;  5JXH A;  2XPJ A;  1MS5 A;  2OPW A;  2JDA A;  1MS4 A;  2VXJ A;  1RB8 G;  4XHB A;  3AKT A;  4N8M A;  5FZ1 A;  1PMI A;  3N4M A;  3N7K A;  1QH6 A;  5JOY A;  1WMF A;  2V09 A;  3H42 B;  5FWJ A;  5I0D A;  2RHP A;  3UJQ A;  4DIN B;  4G9S B;  2ETE A;  1FAY A;  1QQP 1;  1SLC A;  3V0A A;  1WW7 A;  2Y6J A;  2DFC A;  4D6Q A;  4XUN A;  2HWC 3;  1TG7 A;  2OX0 A;  1SBF A;  4HKL A;  5H9P A;  5K7P A;  4JCK A;  2WFF 2;  4IEO A;  2WJS A;  1YQ5 A;  1VBD 3;  3ZXF A;  4MXW B;  3B5L B;  4AZZ A;  5FIX A;  2VO5 A;  1FAT A;  4HSJ A;  1JYI A;  2WLQ A;  4GMP 3;  4AK3 A;  4BXF A;  1W6O A;  2D6N A;  1LED A;  1HB1 A;  1LGB A;  1UU5 A;  2RM2 1;  1PGS A;  5LEJ A;  2XDV A;  3NAP B;  1VJ2 A;  1Y43 B;  2R32 A;  3LAG A;  3T2P A;  1JI6 A;  1D4M 3;  2XVL A;  4IET A;  1EAH 1;  5JLV A;  2PLV 2;  4BA6 A;  5KXC A;  1J1T A;  4GWI A;  4IE0 A;  4B1M A;  1LCL A;  2JEM A;  4YFZ A;  1DYK A;  5F2W A;  5FY8 A;  3IT8 A;  4ZPI A;  1JBC A;  2ZAH A;  5BNP A;  5A80 A;  3VBS B;  3DCQ A;  5JIU A;  5C9A B;  4K1Y A;  3T2T A;  4LPL A;  2O8O A;  2YUE A;  1CES A;  3PUA A;  3RZK A;  3ILN A;  5F8P A;  3ZXD A;  3VBF A;  1AR6 1;  2ZPX A;  1OQ1 A;  1TQ5 A;  2PAE A;  1OC1 A;  3M1H A;  2GDF A;  3SH3 A;  2RS5 1;  4M3C F;  1AJK A;  5LBC A;  4Y33 A;  2D6O X;  4TSV A;  3GGL A;  5F7U A;  4J1W A;  3WV6 A;  1WMD A;  2JDN A;  3GXU A;  4LLO A;  4LLF A;  4NR1 A;  1MS3 A;  2UWB A;  4K9S A;  1DGR A;  1CX1 A;  2DTW A;  5BNN B;  1GQH A;  2E33 A;  4GB3 3;  1BBT 1;  1GOF A;  4Y22 A;  3WDU A;  1R09 2;  3ILF A;  4DO0 A;  3JB8 A;  4WZF A;  1NCR B;  3ZLI A;  5IVV A;  4YLZ A;  4Y3O A;  3WG1 A;  3MDP A;  2FZ1 A;  3K3N A;  2WZP P;  5BNO B;  1GWK A;  5A3N A;  1YI7 A;  1APN A;  2Q4S A;  3TEW A;  3GJA A;  3PUR A;  4Y20 A;  3H0O A;  1BVV A;  1NLQ A;  3OPZ A;  4GD4 A;  4I30 A;  3NAP C;  1AYN 3;  1O91 A;  4GWM A;  4R52 A;  3T0D A;  1HXS 1;  5DZF A;  1Y9Q A;  4XIL A;  4O9G A;  5KHJ A;  5J37 A;  1GP6 A;  2I45 A;  3D0S A;  1QOT A;  4AXO A;  4BZ4 A;  5IK5 A;  4ZHN A;  4MXV A;  1W06 A;  2PHF A;  4ZS2 A;  3T09 A;  5GLU A;  4PBO A;  4FPE A;  3DV8 A;  1QJU 2;  4CCD A;  4Q1R A;  1R1A 3;  1UKR A;  2NMO A;  3OGR A;  1F8V A;  3VBS C;  2BW8 A;  2VGD A;  4PHZ A;  1AYM 2;  4XQ4 A;  5C9A C;  1CGP A;  5APA A;  4B1L A;  5AFE A;  1BEV 1;  4BHP A;  2L9L A;  3ZM8 A;  4BXS V;  1COV 1;  4EJR A;  1SBE A;  3OD0 A;  4YZ5 A;  2LRO A;  2G1M A;  4YPJ A;  1L7L A;  2HWC 2;  2A73 B;  2DBI A;  1R64 A;  4FVV A;  1ZNP A;  3KZ4 C;  3WXP A;  2V5Y A;  4Y1Z A;  5BNQ A;  1RUF 3;  5FTT C;  1VBD 2;  1BLZ A;  4N90 A;  4QKD A;  3UGG A;  2WS9 1;  2YDE A;  2VBP A;  3SH4 A;  5IHR A;  1JZ4 A;  4YVS B;  4FPC A;  3WNL A;  5BNN C;  3AX4 A;  2ZJC A;  4AI8 A;  2ENR A;  5FUP A;  4E27 A;  2W46 A;  3J8F 1;  2R16 A;  1IS6 A;  4NHL A;  1NCR C;  2VBD A;  5HCF A;  2Q5T A;  1JU4 A;  5FDB A;  1JZ2 A;  1D4M 2;  4NID A;  5BNO C;  5FYH A;  4MHR A;  4UWD A;  3WHT A;  5IW0 A;  4XTM A;  5BV6 A;  2GC0 A;  4RGK A;  1YLL A;  4A7K A;  3WUC A;  3UKV A;  4OUM A;  2PHL A;  1RUH 3;  2F4L A;  1ASJ 3;  3TEY A;  2CHH A;  4R9D A;  1UNB A;  4O9E A;  1GQG A;  2I74 A;  1OF3 A;  4L11 A;  2HKX A;  2R30 A;  3VKL A;  5LZ6 A;  2P3J A;  3VBR B;  1F4H A;  2VOK A;  2WII B;  4ZXE A;  3ZVX A;  4COZ A;  3OCP A;  4M0H A;  1HW5 A;  2GN3 A;  4QU1 A;  4YZ2 A;  1JOJ A;  1O8S A;  1OT5 A;  3ENR A;  5L9R A;  5C6C A;  5F3G A;  1I5Z A;  2JDH A;  1LOF A;  4PIZ A;  1YRZ A;  3ZXA C;  3CQO A;  5FP8 A;  2XUM A;  3D8C A;  3PTY A;  1YEW A;  2BBV A;  1C3H A;  1EUU A;  1PK6 B;  1UMH A;  3AK0 A;  4RSU A;  2G4I A;  4W6Y A;  2YYO A;  3QCW A;  1UX6 A;  2JE9 A;  3VZM A;  1CAU B;  4TWT A;  4ASM B;  4MG2 A;  2GU9 A;  3VZJ A;  4AQS A;  2EVX A;  2WWJ A;  3A7Q A;  1YQ2 A;  2CU5 A;  3AZX A;  4GB3 2;  4AHW A;  1ZYB A;  3LA7 A;  4CE8 A;  2BP6 A;  1JYN A;  1ZRF A;  1LOC A;  2WNU B;  3VHR A;  3C7H A;  4FPL A;  5HCA A;  2WAB A;  1POV 0;  2VOX A;  4YYO A;  1XYO A;  2ZAC A;  3H7J A;  3LIH A;  4YVS C;  3SIT A;  3MHZ A;  4MXW A;  2RDN A;  4XHX A;  1ST8 A;  2CAV A;  4DMI A;  1DIW A;  3F95 A;  3C7F A;  3EMR A;  2A3W A;  1MZE A;  3WR0 A;  2RMU 1;  4DEV A;  1AYN 2;  3VZL A;  4CU9 A;  1EPZ A;  1H6X A;  1PNF A;  4QB6 A;  3NAP A;  3KV6 A;  4XMI A;  4NE9 A;  5EIY B;  1W8W A;  5F2S A;  4BK5 A;  4XAC A;  1WME A;  1HLC A;  5D21 A;  1DQ6 A;  2P6H A;  2P34 A;  3LDB A;  4N53 B;  2RG4 A;  1R1A 2;  5LEK A;  4E2G A;  4XIO A;  5A1F A;  5J3U A;  2ZKL A;  3IDA A;  4CP9 B;  1D0G A;  5A1L A;  1HRI 1;  2WR9 A;  3VBH C;  1GFF 2;  3VBS A;  3W59 A;  3TOJ A;  5C9A A;  3VBR C;  3AP7 A;  4ZZ8 A;  3ZOI A;  4FFF A;  5JWP A;  4ZU5 A;  1VLN A;  2D7F A;  3FFZ A;  1URX A;  1RIT A;  1WD3 A;  3OB8 A;  4S2D A;  1LRH A;  1MZF A;  4Z1V A;  1SCR A;  1VB4 A;  1RUJ 3;  4OHW A;  4CDQ B;  5HBA A;  3H1M A;  4XCB A;  2VM9 A;  3A23 A;  1RUF 2;  1UY0 A;  1PVX A;  2WZR 1;  2FDK A;  1PK6 C;  2Y8K A;  1SPP B;  4OUL A;  3QBQ A;  1GNZ A;  2W1W A;  5DN2 A;  3SC7 X;  4OYU A;  4PJY A;  1W0N A;  4LBO A;  5DZG A;  3WD5 A;  4AVS A;  1CJP A;  1X50 A;  3L2Y A;  2CYF A;  3P1I A;  4N43 B;  4MGZ E;  3WG3 A;  3ZR5 A;  5BNN A;  1WZX A;  3ZPY A;  2WNU C;  3HWJ A;  4TZD A;  1RHI 1;  2PN5 A;  1UD1 A;  2NYY A;  3VKF C;  1NCR A;  1UYZ A;  2QUO A;  5ANN A;  3W5N A;  2QBX A;  3DKQ A;  2ZHM A;  1KS5 A;  4XFI A;  2HEY F;  2VY0 A;  3IIA A;  4KI5 M;  1W8O A;  1WCS A;  1SZB A;  3I59 B;  3ZFG B;  5JMC A;  2BTV C;  4KG0 A;  4LKD A;  3OGJ A;  5JUV A;  4NO4 A;  4JGZ A;  1JYC A;  1RUH 2;  1ASJ 2;  4P9L A;  3IMN A;  3JD7 1;  1QIQ A;  2RS1 1;  3N7L A;  2ZXQ A;  4HVR A;  3B3Q E;  2YG0 A;  2DU0 A;  3WNP A;  4C91 A;  5JSR A;  3WVJ A;  2UYA A;  1RUI 1;  3HJR A;  4N53 C;  5F5Q A;  5DPN A;  4IL7 A;  4N9I A;  4IE4 A;  5EQU A;  1CPN A;  1US2 A;  3ACI A;  4HLT A;  4IW3 A;  3HPN A;  3WW1 A;  4FP3 A;  5K8S A;  1CR7 A;  4D69 A;  4XVH A;  3WT3 A;  2A6V A;  2J1T A;  3BOD A;  4WVM A;  2VC9 A;  2CGN A;  2O1Q A;  3LEI A;  2WA3 A;  5FPZ A;  1AF9 A;  2PQS A;  2XJV A;  3OY8 B;  3EHK A;  4IUG A;  4CDQ C;  2HJI A;  5CZK A;  2RJL A;  4AHX A;  1JOP A;  3OGV A;  4P9I A;  2CWS A;  2WO1 A;  4AFM A;  2VAU A;  1XE7 A;  3ZXK A;  1H1I A;  4COY A;  3O1M A;  2WN3 A;  3O1T A;  4Z92 B;  2NMN A;  1RUE 3;  3THP A;  3ZDV A;  5FMO S;  5FZD A;  2Q1Z B;  4N43 C;  4QHB A;  4YVS A;  5LAS A;  1PGW 2;  1HJG A;  1U5X A;  1DF0 A;  2XLA A;  4XFA A;  5F32 A;  3S30 A;  5E89 A;  4EE2 A;  3A4U A;  1GNY A;  1C28 A;  1NY7 2;  1V6L A;  3T1M A;  2VMG A;  5FZO B;  3INA A;  3VV1 A;  2TBV A;  3DGT A;  3KCC A;  3Q8F A;  1KDM A;  2VR4 A;  1ONA A;  2FCV A;  3ZFG C;  1OH4 A;  3CNA A;  4JDO A;  3WCR A;  5KWR A;  4U36 A;  2VOW A;  1MR5 A;  2F4P A;  4HON A;  1RUG 1;  2JDM A;  2ORZ A;  4Q4X 3;  3VN4 A;  3OTF A;  4RHV 1;  5FPL A;  4AI9 A;  2EXJ A;  1KQR A;  3FFQ A;  3G6J B;  4CEW B;  5FWE A;  2XLF A;  3O1R A;  5FKC A;  1Y9M A;  4C8D A;  2A3X A;  3ZXG A;  3VBR A;  4JGY B;  4XDP A;  3N9P A;  3RI8 A;  1FPN 3;  4MHU A;  4XUT A;  2OXB A;  4WV8 A;  5FCC A;  1RUJ 2;  4NIH A;  1O3S A;  1PVC 3;  2BJS A;  3BTZ A;  1C57 A;  1ZZ7 A;  3AYC A;  3I3Q A;  5A3L A;  2JX9 A;  1HQL A;  2PQQ A;  5F1R A;  1PK6 A;  2NP0 A;  3AKP A;  1CAU A;  3HQR A;  3D3A A;  1O3Q A;  1SBD A;  1SFP A;  4WVV A;  2VZ3 A;  1IQD C;  1CPM A;  2X29 A;  4R9C A;  4BQ3 A;  1S2E A;  3IMM A;  5JZG B;  3HQX A;  2WNU A;  1IPK A;  4Q29 A;  4B7E A;  1FOD 3;  5GJ6 A;  5A7W B;  1XRU A;  2WT1 A;  3M3E A;  2PEL A;  4QX1 A;  3ZPO A;  3JZV A;  1LJ7 A;  2WYF A;  1JOB A;  1NG0 A;  3GZU C;  5T5L A;  1AR8 3;  2VNV A;  3E6B A;  4HT1 T;  3V65 A;  1O8P A;  1I1E A;  3AP4 A;  2VOT A;  2QVS B;  2R06 1;  5AVP A;  5L7O B;  1QJX 3;  3ETP A;  2I2S A;  3WNN A;  2QQL A;  1ZA7 A;  1UOB A;  1H9P A;  1I6X A;  4CP2 A;  4CP1 A;  2IXI A;  2CDO A;  3QD6 A;  1AX2 A;  1RUD 1;  2DVD A;  3S57 A;  2VEC A;  1C8M 3;  4BYY A;  1HIX A;  4AI3 A;  1UN1 A;  2RE9 A;  4N53 A;  3A0K A;  5EJ3 A;  5JOX A;  3MV0 1;  1ZRI A;  3MO4 A;  4CEW C;  2DVG A;  4OHY A;  5J48 A;  1GIC A;  1QH7 A;  2QQJ A;  2OQ6 A;  1A78 A;  2A6X A;  4J1X A;  4CP9 A;  4IEP A;  1PO2 1;  2XVG A;  2J7M A;  1ZRC A;  1BMV 1;  1RJ8 A;  3MFA A;  4JGY C;  1WW5 A;  3RYR A;  3ZO0 B;  2VNG A;  1Z7S 1;  2VMC A;  4HK8 A;  4R4Z A;  2Z4F A;  4LHS A;  5FY0 A;  4XIK A;  3GF6 A;  1QU0 A;  1EUT A;  2GC3 A;  2IZW A;  4D6R A;  2Q30 A;  4CDQ A;  4NUB A;  4FT8 A;  3T1L A;  3LA2 A;  1OVP A;  4XAE A;  1SPP A;  2D44 A;  4I0A A;  1LOA A;  3THT A;  1RUE 2;  3OBZ A;  3FJS A;  4IGP A;  3VDD B;  2XBO 3;  5FZA A;  5CA6 A;  2VZV A;  3JQW A;  3RZL A;  4AYU A;  3ZN4 A;  5FP7 A;  2Y38 A;  2ET1 A;  3GJB A;  4SBV A;  5H9S A;  5JZG C;  4WVZ A;  5SV5 A;  1DYP A;  2IXJ A;  5FK8 A;  2IXL A;  5CIS A;  1LHN A;  1U5Y A;  2VUJ A;  4FFI A;  5LRR A;  3WF2 A;  2R7E B;  4XPV A;  2JE8 A;  4CU6 A;  5L9V A;  2ZGQ A;  3WW3 A;  3ZFG A;  2W1U A;  3APB A;  1DGW X;  2XJT A;  3I59 A;  4KBZ A;  4Q4X 2;  4UAP A;  4XOG A;  5DQ0 A;  5FZ0 A;  2WC2 A;  5L7O C;  4YNI A;  3GAL A;  4AVB A;  4LJH A;  4XUO A;  2ZKN A;  1H1A A;  3GBW A;  1ODM A;  4LHL A;  1OLR A;  3ZN6 B;  2LRP A;  1AL0 G;  1OVS A;  1FPN 2;  2BEO A;  5I8Y A;  1AXY A;  3KT7 A;  1PVC 2;  2J1U A;  4UFK A;  3Q8B A;  3ZSE A;  3K4A A;  4IEV A;  1UO9 A;  1Y7B A;  5IK4 A;  2QQP A;  4CCE A;  1MS9 A;  2RS3 3;  1QY4 A;  3AB0 A;  5C8C A;  2PYT A;  3B9C A;  3OY8 A;  3VDB A;  3WP5 A;  4HVQ A;  3NRU A;  2JG9 C;  4NN0 A;  4CCN A;  1AX1 A;  1VBB 2;  3AMN A;  4YWA A;  2IUW A;  5DDJ 1;  1SG3 A;  4MGQ A;  2O8Q A;  4UBH A;  1BCX A;  4AFD A;  2YU2 A;  1JXN A;  3AYA A;  4AG4 A;  2DCT A;  1JH5 A;  3O0X A;  4LO8 A;  3RI9 A;  2XH6 A;  1YO8 A;  2YRO A;  1KFU L;  1UXZ A;  3VDD C;  3T2O A;  1OFS A;  1W28 A;  3ZFE B;  1AR8 2;  2BPA 2;  1WMX A;  1BK0 A;  3NW4 A;  1QJE A;  1UYY A;  3NJV A;  3ON7 A;  3B00 A;  3MEP A;  3MIE A;  3OOX A;  2G9Z A;  5J1X A;  4QAW A;  3C7O A;  5FZO A;  1UU4 A;  3WP4 A;  1XXN A;  3VD5 A;  4CUC A;  2QZ2 A;  4IEU A;  4Y1V A;  4PIX A;  1T6G C;  1CN1 A;  2PMW B;  2ZMN A;  1Z0H A;  1X36 A;  3H8O A;  1C8M 2;  2VTF A;  2WSU A;  3NV1 A;  2C1F A;  2XKO A;  5DMY A;  3KT4 A;  2GH8 A;  3WOG A;  2DU1 A;  3O1S A;  2D98 A;  2QJV A;  4I02 A;  2G9F A;  4CDW B;  4JRA A;  4CEW A;  3I3M A;  4OUE A;  4FOV A;  1X82 A;  4PF5 A;  4CCC A;  1STM A;  2GMM A;  2QFE A;  4IER A;  3GM8 A;  1UWW A;  2B45 X;  4QDR A;  2RV9 A;  2D6K A;  4JGY A;  1UW8 A;  4DY3 A;  3AZY A;  1S0F A;  4X6Q B;  5IWF A;  1GP4 A;  3N9M A;  4PQ9 A;  5FZ3 A;  4DNY A;  1I5P A;  2P3K A;  2W3J A;  2CGO A;  3O0V A;  2JDP A;  3IDB B;  2B4K A;  1BHG A;  4UBG A;  3BI3 A;  1AR9 1;  1R09 1;  4QPI B;  1OQE A;  2XBO 2;  3AKQ A;  5A7O A;  1H1M A;  5ACA 2;  1JU3 A;  3ASI A;  1FV2 A;  5FYB A;  3BIE A;  1RUO A;  4OI4 A;  2PHR A;  4QKF A;  2HWD 1;  3TB0 A;  1CWP A;  2E7T A;  1VBC 3;  3LDK A;  1RUC 3;  1Q8O A;  5JZG A;  1ZA4 A;  3VL9 A;  4F7Z A;  2HWB 1;  5ABJ B;  1LEC A;  2OA2 A;  2VCM A;  2JDZ A;  4IE7 A;  2JDK A;  3VZO A;  5A7W A;  2WAO A;  3O0W A;  4AWD A;  3S6P A;  5I8S A;  3ZFE C;  5GAL A;  2GZW A;  1RJ7 A;  3O1U A;  2D97 A;  2KM2 A;  4DRR A;  1JS9 A;  1ALY A;  5GZD A;  1QDC A;  1PIV 1;  1GAN A;  1TVG A;  2R6Q A;  4FFH A;  4RN5 A;  4NOT A;  4XDO A;  1DHK B;  2IVJ A;  3WNO A;  3D0J A;  1JYW A;  3VBO B;  5L7O A;  4JX0 A;  3SLI A;  4XAB A;  4DS0 A;  4MVT A;  4C0H A;  2Z79 A;  3HNY M;  3FC0 A;  3U78 A;  4K7J A;  4F8A A;  3DN7 A;  1M06 G;  4AQ2 A;  4CDW C;  3T30 A;  4D6S A;  3VD7 A;  3DXU A;  3PUH A;  1X8E A;  3AMM A;  5LBB A;  1H0B A;  4OHZ A;  1OOP B;  3WF3 A;  5FBJ A;  2VJX A;  3ACH A;  3RWK X;  3WCS A;  4A6S A;  2VZR A;  1G9C A;  3PVO A;  1O5L A;  5FZC A;  2RS3 2;  2Q8E A;  3TAY A;  3KF3 A;  1G8W A;  2GNB A;  1VBD 1;  1OF4 A;  4LA2 A;  1GZ9 A;  4QX7 A;  2JG8 A;  1UPI A;  2AGS A;  3PHM A;  3AP9 A;  1KXG A;  1QOO A;  3NV4 A;  3LOI A;  3AC0 A;  1LOG A;  4F3J A;  4QPI C;  3BGA A;  4LUL A;  1HRV 3;  3PLQ A;  3UYJ A;  1ZVF A;  4Q4Y 3;  5C33 A;  4LKE A;  1N47 A;  2VNO A;  3VDD A;  1JOD A;  2RDR A;  3OBA A;  1U5I A;  1W9F A;  1W9Y A;  3ACG A;  1TMF 3;  5I0R A;  1LHU A;  2XXZ A;  4GJZ A;  5ABJ C;  4LBK A;  2R07 1;  1V6N A;  4PDW B;  5FY7 A;  2W5F A;  2E31 A;  4YGC A;  4GXL A;  1OLM E;  1PNG A;  4CCM A;  1W9T A;  1KRI A;  2MEV 3;  2DVA A;  4YRD A;  1DBN A;  3VBO C;  1RVF 3;  3NJZ A;  3VHO A;  4XUP A;  1S0G A;  4YM2 A;  1Q3E A;  2W08 A;  3CL1 A;  3MF9 A;  1BK1 A;  1Q8S A;  1W6M B;  2ET7 A;  4AHZ A;  4CRQ A;  1V6M A;  3ZN6 A;  4IEY A;  1LU2 A;  2ILM A;  2ZX0 A;  1YNA A;  3MW2 A;  1KGY A;  3PJQ A;  4LO4 B;  1WUV A;  1B35 B;  3USU B;  4E2S A;  5HV4 A;  5KHG A;  3NKG A;  5ISL A;  3U4S A;  1X9P A;  3MIH A;  4PIY A;  3BU0 A;  4XBQ A;  3IPV B;  4FBF A;  1Q43 A;  2AEY A;  2P6C A;  1OOP C;  2RR1 3;  1YWK A;  3OF1 A;  3W58 A;  2VOV A;  4AQT A;  4CCK A;  3ZIX A;  1VAM A;  5FMC A;  2N7G A;  2VQA A;  3WX5 A;  2QQV A;  3I8T A;  1W6N B;  2ID4 A;  3KT1 A;  4YM0 A;  4ITC A;  1OA2 A;  4Q0V A;  2NZ9 A;  4OQ8 A;  3KV9 A;  1QOS A;  3DYM A;  1MQT B;  1VBC 2;  3OEA A;  1RUC 2;  3LA3 A;  5KXB A;  1C4R A;  3R0R A;  1SLB A;  1GKB A;  3UT0 A;  5LK5 A;  1QJZ A;  1F15 A;  4YW1 A;  2OPK A;  5KXD A;  1AYN 1;  1LNS A;  2B46 X;  3ROU A;  4AVT A;  1CVN A;  1QJU 3;  4XYX A;  4NHX A;  4DZG A;  4NIG A;  5DG1 A;  4QB1 A;  3AMQ A;  3ZFE A;  1AYM 3;  2UWA A;  1WA6 X;  1AHS A;  4EZH A;  4PDW C;  2ZGO A;  4OMD A;  4XBN A;  1SMV A;  4KBB A;  4WM7 B;  1N3Q A;  1VBE 3;  4QQP A;  3EYP A;  4LBN A;  1LUL A;  1LHV A;  3VD4 A;  3WG2 A;  3JXS A;  4RS5 B;  1NAE A;  3JUU A;  2JJ6 A;  4ATF A;  4AL9 A;  1W03 A;  3K4D A;  3IN9 A;  4CDW A;  4DXR A;  2D5H A;  4Q27 A;  4WM8 C;  1XJA A;  2IVI B;  3V64 A;  2EIE A;  3DXT A;  3Q9O A;  3BCW A;  4NIA A;  4YG0 A;  1DLC A;  2Y33 A;  4CA9 A;  1B35 C;  2D3S A;  1UOG A;  2X10 A;  4XZP A;  2BU9 A;  4IXL A;  4HL0 A;  3PUS A;  1ND2 B;  5EYY A;  1IG0 A;  1BKZ A;  4W6W A;  4CZS A;  1YYN A;  2WNV B;  3NO8 A;  2YBP A;  5A7P A;  4OHV A;  3OYW A;  4GJY A;  1G86 A;  4YZ1 A;  1HRV 2;  1HN1 A;  3HQU A;  2VZU A;  3N9O A;  4Q4Y 2;  3ZYF A;  4QPI A;  4DFS A;  5AC9 3;  4K8F A;  1NLR A;  1MQT C;  3VB9 A;  4Q0U A;  5FZ8 A;  3LB9 A;  2AYH A;  4XUR A;  1TMF 2;  1E5S A;  1PM4 A;  1AR7 1;  1O59 A;  3VKO A;  4QX5 A;  3AMH A;  1XNB A;  5ABJ A;  4AEM A;  1RUH 1;  2HLE A;  3BKZ A;  1ASJ 1;  4ISR A;  4MOA A;  2P17 A;  1XNA A;  5FUN A;  5F37 A;  3S7E A;  1H2L A;  1O7F A;  1H8T A;  2EF6 A;  2YC0 A;  5EPA A;  2E7Q A;  2MEV 2;  1RC6 A;  2XLG A;  3PIG A;  1RVF 2;  1YCI A;  2D93 A;  3B02 A;  4PBP A;  4YZ4 A;  4ONU A;  4JHZ A;  1NZI A;  1V9U 1;  1GNH A;  4WM7 C;  3ZXJ A;  5A6Z A;  2WQ4 A;  2FDH A;  4RS5 C;  5FZH A;  3RSJ A;  3ZSJ A;  4Q4W 3;  4HZF A;  2XQX A;  3QAC A;  4Q5O A;  3NVC A;  2X09 A;  1ZZC A;  2JEN A;  2RR1 2;  3V0B A;  1W9W A;  5EJ1 B;  1OOP A;  4XF9 A;  2A75 A;  4K3U A;  3KS7 A;  3T2Q A;  1W8U A;  4TLF A;  1ND2 C;  2OZ6 A;  3FHA A;  3POI A;  3RMY A;  4Q8K A;  2ZML A;  1IQA A;  4UFH A;  3QH6 A;  4XJA A;  4Y1U A;  3ZYG A;  4Z2W A;  2WNV C;  3SCH A;  5DUU A;  1DG6 A;  1NOV A;  3LZZ A;  3PVB B;  1UOJ A;  1RED A;  1TME 3;  2BOJ A;  1GYK A;  3MYX A;  1S4C A;  1Q8V A;  2K2S A;  1NY7 1;  4IV3 C;  4DRV A;  3NNG A;  3HOB A;  3BIW E;  4CXY A;  4P9Y A;  2VZO A;  1PMH X;  1REE A;  3EO6 A;  3N7J A;  3QOP A;  1WCQ A;  5DAV A;  3I2I A;  1RIN A;  5DZE A;  5FBZ A;  4EN9 B;  3RPQ A;  4E8D A;  1V70 A;  3OSD A;  1J83 A;  3ZX7 A;  4URA A;  4HVO A;  1ZRR A;  4M01 A;  1YQ8 A;  5FK7 A;  4L0P A;  1VBE 2;  2GAU A;  3C2U A;  3OUI A;  4Y1Y A;  1OD3 A;  1R08 2;  2VZT A;  3ATG A;  4BPZ A;  3TN9 1;  4PCR A;  2HH9 A;  3ZYR A;  1NE4 A;  4ZKT B;  4H7M A;  1AJO A;  1LEM A;  2C9K A;  3ZN5 A;  1KEX A;  1MEC 1;  1PX4 A;  5BPX A;  3BOW A;  1W6M A;  4P5H A;  4JDN A;  4YSF A;  2O14 A;  3WDX A;  5D1I A;  4EN6 B;  1H9W A;  3USU A;  4MGY E;  4EZ4 A;  2YC2 A;  1B35 A;  5C3Q A;  3AFG A;  4EWD A;  5C5T A;  4HKW A;  5T5P A;  1UAI A;  4HAN A;  3IPV A;  3P6B A;  3IB3 A;  4CVU A;  3IAP A;  4PT6 A;  2YFZ A;  2EAK A;  2P3I A;  4M00 A;  1JN2 P;  1LOE A;  4Q4V 1;  5ANQ A;  4XQW A;  1W6N A;  5AC9 2;  1XSR A;  5JOZ A;  2UY8 A;  1MVE A;  5LWB A;  5FY1 A;  4DPN A;  3TBD A;  1MQT A;  3LPG A;  1DQ2 A;  1TNF A;  1LU1 A;  1ZX5 A;  3VBH B;  4AFA A;  1GZT A;  4P9W A;  1JZ3 A;  4E4D X;  1EAH 3;  4LQR A;  3GNE A;  5C7G A;  1SLT A;  4QX0 A;  2FQP A;  3R05 A;  4XJ9 A;  2VCA A;  4X6R B;  1FMD 1;  5T54 A;  4B29 A;  2PAK A;  4OCT A;  5I0U A;  1K5J A;  3SEP A;  3RZJ A;  2QQU A;  4KNC A;  1LOD A;  3KGL A;  2CV6 A;  2WSV A;  1PMJ X;  3U0Z A;  1RGS A;  2C24 A;  2FCU A;  2ZTN A;  3H50 A;  2XHN A;  3E6D A;  3FUQ A;  1WLD A;  1PGL 1;  5A32 B;  3T0A A;  3WP3 A;  1A34 A;  2Y0I A;  4WM7 A;  5FYI A;  4Q4W 2;  1CZS A;  3NQH A;  1AR6 3;  1W9S A;  4BIF A;  3GZA A;  4QX3 A;  4RS5 A;  4IE6 A;  4BQX A;  1YI9 A;  3J7L A;  4ZON A;  2F17 A;  2VE1 A;  3LIG A;  4ASK A;  3WG4 A;  1CAV B;  4MZU A;  3KHB A;  1X9T A;  4FPO B;  1S2B A;  2R04 3;  1SLI A;  4W65 A;  1PHM A;  2JKB A;  4Z2A A;  2HWF 1;  3M4F A;  3RS6 A;  4NRM A;  1SFY A;  2DVB A;  3J26 N;  4CDU B;  2RJK A;  4E2Q A;  2VMD A;  4AVA A;  1ZBE 3;  4FCA A;  2VMH A;  3J7M A;  3MIB A;  3QH7 A;  2WNV A;  3FX3 A;  1W8F A;  1MVQ A;  1TME 2;  3E5X A;  5FPX A;  4LT5 A;  1VB2 A;  5H9Q A;  5A7S A;  3MPP G;  5EHD A;  4LIT A;  1VRB A;  2EIB A;  4IQP A;  5CU1 A;  4JTN A;  2GH2 A;  2J42 A;  5DAB A;  5F39 A;  3DEM A;  4CPB D;  3K75 B;  2HWE 3;  1EPW A;  1RMU 1;  2BER A;  2Y6L A;  4JQT A;  4N7U A;  1QNW A;  2OQ7 A;  1VMJ A;  5TSW A;  3POE A;  4Q4X 1;  1BZW A;  1WLT A;  1XBF A;  3P5B A;  5FZ7 A;  2ZX1 A;  3RFR A;  5CG8 A;  4L9B A;  4QX2 A;  3D5O A;  4MET A;  5CIR A;  3RDI A;  2JDY A;  3MW4 A;  4GWJ A;  5FZK A;  5CAZ A;  3M3Q A;  3B9I A;  4P00 B;  2HBU A;  1LTE A;  1XOY A;  2EAL A;  1OH3 A;  1Y4W A;  4CEY B;  5C71 A;  5I8T A;  4BCU A;  2ZGU A;  1COV 3;  4M0N A;  4UT5 A;  3SHR A;  3TEX A;  4A4A A;  3HBK A;  3ECQ A;  4I09 A;  5A70 A;  1LB2 A;  1VMF A;  2BQP A;  4K21 A;  1T2X A;  3AP6 A;  4L97 A;  2C5D A;  4LBJ A;  3RNS A;  3WW2 A;  4AI0 A;  1CQ9 A;  4AI2 A;  1W6Q B;  2WS9 3;  2BFU L;  2ZHN A;  3E1F 1;  4OI1 A;  3LOB A;  4CDU C;  1O5U A;  3U07 A;  4K20 A;  4WZC A;  3OPW A;  4HKO A;  5BNO A;  1O3T A;  2CNA A;  2FMD A;  4D94 A;  3E5Q A;  2JKX A;  2ZCW A;  3T08 A;  1Q8Q A;  1FOD 1;  2AUY A;  3J8F 3;  4K1Z A;  3LQC A;  4KQ7 A;  3K77 A;  2PTM A;  4MO3 M;  4XJU A;  1MS0 A;  5FXZ A;  2VG9 A;  5DAX A;  3W20 A;  4LA3 A;  4Q0Q A;  4XF3 A;  5JSO A;  3ACL A;  2AC1 A;  1S0E A;  4AGV A;  2BV4 A;  3O14 A;  4E4H A;  1EAH 2;  1UY3 A;  4LO5 B;  5CEH A;  1UIJ A;  1QJX 1;  2GAL A;  3Q8E A;  2D6P A;  3I2J A;  3HBZ A;  4E4Z A;  2Z69 A;  1XYP A;  1YQ6 A;  3JBG 1;  3PL0 A;  1K42 A;  1PO1 1;  4BE3 A;  3W5M A;  1H2K A;  1XNT A;  5JAX A;  3DKW A;  1W8H A;  1OBN A;  1VE0 A;  1SEF A;  4RFR B;  1ZBA 1;  3LEG A;  1MZ6 A;  4A7Y A;  1O3R A;  1K45 A;  5DUV A;  4YG3 A;  3VZN A;  5A3U A;  4MGK E;  1AR6 2;  1AXZ A;  1R1Z A;  2Y6F A;  3AJY A;  3WF4 A;  4CEY C;  2RVA A;  4DXZ A;  3LD8 A;  2WYS A;  2ARA A;  3JB4 C;  3JCI A;  2R04 2;  4LTA A;  3WQ1 A;  5FQ0 B;  3VZK A;  5FOJ B;  1MS8 A;  4RFT 0;  2QNK A;  2W92 A;  2XJU A;  3KMH A;  1EV1 1;  2W68 A;  5IAV A;  1ZBE 2;  2B7Y A;  4MH0 E;  2A5Z A;  3AP5 A;  5IK8 A;  3MZH A;  4HPK B;  4HOO A;  3WDV A;  3POJ A;  4CSW A;  4LKS A;  5A6Y A;  3NJX A;  4FPJ A;  4IV1 B;  4Y24 A;  2RMU 3;  2WRA A;  4CXX A;  4JHT A;  5JI7 A;  2H6C A;  2YV8 A;  1HXS 2;  2HWE 2;  4YW4 A;  3RJR A;  1V6J A;  1GMM A;  3VDA A;  4QXK A;  3VBH A;  4BK4 A;  4UW5 A;  2B9U A;  3GZE A;  3N9N A;  4M4R A;  1KDK A;  5BYN A;  4NRP A;  4NRO A;  3N35 A;  1HRI 3;  1FNY A;  4XEZ A;  1COV 2;  2W0X A;  1XU1 A;  3VKN A;  3UKN A;  2B8M A;  5EFU A;  5A32 A;  2C9A A;  3KVA A;  1L3J A;  1SCS A;  2OS2 A;  5E16 A;  5LCW L;  1VBB 3;  1DGR N;  3SCG A;  4CU8 A;  1UOF A;  5FLH A;  2IWG B;  1NQJ A;  2VUD A;  3FMG A;  4XJ8 A;  1CAV A;  2WS9 2;  4LHN A;  5A3M A;  4QM9 A;  3HIF A;  2UU8 A;  3TNP B;  2DCY A;  1SDD B;  3KV4 A;  4E9K A;  2WQZ C;  2Z5W A;  1W6P B;  3SEE A;  4CDU A;  5AFB A;  2A71 A;  2BVV A;  5FXV A;  3J8F 2;  3DUI A;  2KXL A;  2CSG A;  2C0Z A;  5K4L A;  4DUW A;  1RHI 3;  1VPH A;  3K46 A;  1WBF A;  4GIQ A;  3BPS A;  2JXA A;  5DXD A;  1G9A A;  1VBA 1;  1XE8 A;  3RWN A;  2XKP A;  4IV1 C;  4CU7 A;  3VD3 A;  2BZD A;  1YFW A;  4GH4 B;  4ZZ5 A;  1FYU A;  2W95 A;  1HB2 A;  4OLL A;  3SH5 A;  3SKV A;  3HNM A;  3JD7 3;  2RS1 3;  4HBN A;  2VZ1 A;  4ISQ A;  3ACF A;  1NZC A;  1QXR A;  4LUK A;  4UW3 A;  4BQW A;  2P37 A;  2CAU A;  3M3I A;  1RUI 3;  3NMB A;  5KHH A;  5KHK A;  5I0S A;  1UZZ A;  2IXK A;  2ZZQ A;  2LAL A;  2DCJ A;  2P1B A;  3BU7 A;  1MAC A;  4QPW A;  4YFW A;  5FZE A;  3RYP A;  2JG9 B;  5HV0 A;  3HN3 A;  4FOW A;  1K3I A;  2JB4 A;  4AED C;  4CEY A;  5LBE A;  1F5F A;  2GSY A;  4QHZ A;  4AI1 A;  2DTY A;  3AXD A;  4LBQ B;  4OI2 A;  5ACA 3;  4N43 A;  2WT0 A;  1I3H A;  3VDC A;  2EIG A;  2ZS6 B;  2Y6H A;  4S2G A;  3H8R A;  4FAG A;  3GZT B;  2QKD A;  5IK7 A;  4IGO A;  1RIR A;  2QQW A;  1W6Q A;  1HX6 A;  2FCT A;  3AZV A;  3DYO A;  2EXI A;  4L2N A;  3DYP A;  2VME A;  2DUP A;  1RUC 1;  4SLI A;  2DF7 A;  4FP2 A;  2JIC A;  2RMU 2;  4CUA A;  4AAX A;  3TWI A;  3ABZ A;  2TUN A;  4IE5 A;  4RYD A;  1POV 3;  2ZEW A;  3POS A;  2AAC A;  4XMA A;  1QNY A;  1J58 A;  4HN0 A;  2VW0 A;  2X8K A;  5GLV A;  1LHW A;  3GBF A;  3CZU A;  4GH4 C;  4LHK A;  3MIC A;  2V73 A;  2BNN A;  3ZKU A;  1RUG 3;  3M3C A;  3MIG A;  4RHV 3;  5FZ6 A;  3CIH A;  4V2W A;  3VL8 A;  5FZB A;  4C1X A;  4FO9 A;  4PQQ A;  4FOQ A;  3UKT A;  1HRI 2;  3ELN A;  1JZ8 A;  3N9L A;  4GMP 0;  5FXW A;  2X05 A;  4QKN A;  1UYX A;  2WFF 1;  3PU8 A;  1KJL A;  3ZDS A;  1MZ5 A;  1NQD A;  4QQL A;  1DZT A;  3CU7 A;  4MYE A;  1V6I A;  4TYS A;  5JR2 A;  3BN6 A;  4BQ2 A;  1QHD A;  2DUQ A;  2V4V A;  5EV7 A;  1WCU A;  5FYV A;  5L73 A;  4B3N A;  1VRH 3;  3RG0 A;  3GCW A;  1CD3 G;  2HYK A;  3EBR A;  5FZ4 A;  2Y6K A;  3EXU A;  1H8V A;  5FPB A;  2Q1F A;  3WIN E;  1S0I A;  5FPU A;  2WA4 A;  4FQ4 A;  4QQ2 A;  3VHN A;  4KWL A;  2P2K A;  4BME A;  1S0J A;  2ZGP A;  1ULF A;  2ERF A;  5FFO C;  5GM0 A;  4Y5S A;  1RHI 2;  2PLV 1;  1SLA A;  1HRV 1;  1AVB A;  1OXC A;  5FMB A;  4LR4 A;  3O1V A;  3L9J T;  2XON A;  3NV2 A;  2Q1M A;  2ZGT A;  4RQP B;  4IGQ A;  1F4A A;  4CPB A;  2DDU A;  4Y4Y A;  5EJZ B;  3AVR A;  3ALQ A;  2VL4 A;  1GZC A;  4XFF A;  2E51 A;  1U12 A;  2FDG A;  4XF4 A;  5T5O A;  5FMO L;  2R06 3;  3JD7 2;  1LHO A;  2RS1 2;  3DL3 A;  3GYD A;  1EP0 A;  4QU2 A;  1DZQ A;  5E88 A;  4I3G A;  4PLO A;  1RUI 2;  3IDE A;  1RUD 3;  3A21 A;  4GAZ A;  2MPF A;  3WY6 A;  5A33 B;  2YY1 A;  4J6G A;  4QPG B;  3PUQ A;  1F35 A;  4Y5T A;  3C7G A;  2PHW A;  1QJY 3;  4Y5Z 0;  3WNX A;  5CKN A;  1DLL A;  2XR4 A;  4HMZ A;  2ZGS A;  4YZ3 A;  3H3L A;  1CON A;  2RR1 1;  1Z7S 3;  2ZX4 A;  2IFW A;  3PU3 A;  1OD5 A;  3O1O A;  1AZD A;  3IKW A;  3MGU A;  3FBM A;  2BNO A;  4XBL A;  1VP6 A;  3M8L A;  5D2A A;  3ZXL A;  2SBA A;  1AL2 3;  5JDB A;  3FZ3 A;  1G9B A;  2VTX J;  1NKG A;  5C5U A;  5FV3 A;  2WNO A;  2FDI A;  1UZY A;  3KQR A;  2DVF A;  5IVF A;  2ZGN A;  4LK6 A;  4P9J A;  2EIC A;  2UY9 A;  4XW3 A;  4RD7 A;  5JXI A;  1N1V A;  4HG6 B;  4NWV A;  4QX8 A;  1IKQ A;  1YJK A;  1L7R A;  4UFL A;  1RL3 A;  1SQ4 A;  1V6K A;  2H6B A;  1XNK A;  3POG A;  2Y0O A;  4FQZ A;  1QJU 1;  1TZO A;  4LE4 A;  4MLO A;  2XWJ B;  4QHO A;  1WWY A;  2VVD A;  1DGW A;  2G9G A;  3WNK A;  4RQP C;  3ORJ A;  1US3 A;  1AYM 1;  1QDO A;  1XU2 A;  1BQP A;  2E32 A;  3WDW A;  3D82 A;  1RUG 2;  4RHV 2;  4GH4 A;  4YVW B;  3PTR B;  1XPW A;  1J59 A;  2HWC 1;  5EP9 A;  5FR3 A;  5FP9 A;  2VMF A;  1S2K A;  2EAA A;  2J22 A;  3KSC A;  4J25 A;  4QPG C;  1OUR A;  3SIS A;  4BLJ A;  5JOW A;  3H8X A;  3LGR A;  4B4P A;  4UFI A;  2WWU A;  4QXC A;  4ES8 A;  2EID A;  1OA4 A;  4ET7 A;  2JG9 A;  1Q56 A;  2RDS A;  4Q0S A;  1PX3 A;  4GMP 1;  1VRH 2;  4QKB A;  4B8E A;  1QGL A;  3POB A;  1S0D A;  4GZ9 A;  3MLL A;  1J84 A;  4Y22 B;  4XXA A;  5LRS A;  1DU3 D;  4M3C B;  5JR7 B;  5FJH A;  3R6S A;  4L99 A;  3HT1 A;  1XC6 A;  4DEQ A;  2V5D A;  2ZX3 A;  1A8M A;  1D4M 1;  5F6K A;  5FZL A;  4LE3 A;  1ZM1 A;  1RTV A;  4P9X A;  5DDJ 3;  1ZRE A;  3B69 A;  5A6Q A;  5AC9 1;  1ZZ8 A;  1XQN A;  2QE3 A;  2XWB B;  1U5Z A;  1H2N A;  2WNE A;  4GAL A;  3LEM A;  1ZZB A;  3Q8A A;  5F9T A;  3ME2 A;  2VQ0 A;  1W0O A;  1YFX A;  2R1D A;  4TXW A;  3LSD A;  3RZZ A;  4KWK A;  1D0H A;  1DP0 A;  4CCJ A;  2ZX2 A;  4LO6 B;  2R06 2;  3GHM A;  3BTA A;  2E53 A;  4WM8 B;  2KD7 A;  3HVD A;  1OLM A;  4F83 A;  1RUD 2;  2WZE A;  4BIO A;  4EQV A;  2IXC A;  3HNB M;  3ZYJ B;  3KCX A;  1YQC A;  5FRE A;  3WF1 A;  3ZR6 A;  4YVW C;  4HET A;  3MPB A;  1WLW A;  5FP4 A;  5FYZ A;  3SNM A;  3ZIW A;  1YIF A;  3WQ0 A;  1W8Z A;  1QJY 2;  2WUH A;  4ORF A;  3WP6 A;  4ARX A;  5DUX A;  5BY5 A;  2RDQ A;  2Q0A A;  2VH9 A;  1BMV 2;  5LA0 A;  4GB3 1;  4JTO A;  2YPD A;  4JKL A;  4BU2 A;  4UW4 A;  4YM3 A;  4LOS A;  5FAX A;  5FPV A;  1Z7S 2;  1NLS A;  2UUR A;  3AFK A;  4C1W A;  4UF0 B;  3I3B A;  4N7I A;  2ZMK A;  2Q8C A;  1N1T A;  2ARC A;  1AL2 2;  4DY5 A;  2FDJ A;  1DYO A;  3MF6 A;  4JC1 A;  4D0Q A;  2K9Z A;  2A6Z A;  1UQX A;  3BTX A;  3K2O A;  1VAL A;  3ZFF B;  3OEB A;  4KGQ A;  1LGC A;  1HDK A;  1ODN A;  1AR9 3;  1REF A;  1W04 A;  4ERO A;  5FYY A;  4A44 A;  2JDU A;  4OFG A;  2HWD 3;  4BB3 A;  4JAA A;  4H3W A;  1LAJ A;  1KFX L;  3FHQ A;  1R1A 1;  2HWB 3;  2A3Y A;  3IZO A;  2PFW A;  2ARE A;  3VKM A;  2BNM A;  3F2Z A;  1S0C A;  4JKM A;  4ARY A;  4K6B A;  4BM8 A;  4BOW A;  4DIQ A;  4AOC A;  1R08 3;  2DBN A;  4IDZ A;  3N3H A;  1QF3 A;  4NRQ A;  3UGF A;  2ORX A;  2E7A A;  2ADD A;  2W2I A;  4BMB A;  1PIV 3;  1W3V A;  3CBN A;  5CKQ A;  3VBU B;  4JRL A;  4XJW A;  5C8W A;  1YFU A;  4GUL A;  3H7Y A;  5L36 A;  4HFS A;  4XFG A;  2W1S A;  4P9G A;  1RUF 1;  3UNP A;  2JE7 A;  1KJR A;  5A33 A;  5SV8 A;  2WO2 A;  4QPG A;  2C6S A;  4XZU G;  4RA0 A;  1RYY A;  1N1Y A;  4M4P A;  2XJR A;  1UF2 C;  4V2V A;  1VMH A;  2GMP A;  4AEK A;  2QQK A;  3KCY A;  2YBS A;  1UZW A;  4A7Z A;  4IV3 B;  3KQ4 B;  3III A;  4EN0 A;  1F31 A;  4AEJ A;  1UZ0 A;  4FFG A;  5T52 A;  3S5A A;  1JZ7 A;  4OHX A;  4IEW A;  5DDJ 2;  3TNQ A;  4OQ9 A;  4Q0P A;  4BQ5 A;  2I07 B;  4JZR A;  5A3W A;  3LEK A;  3ZFF C;  3IM0 A;  1JUH A;  2E9Q A;  1SLL A;  1W2O A;  1JHJ A;  5LA9 A;  5IVC A;  1YHF A;  3E97 A;  3KGZ A;  3HMY A;  5BUV A;  2PA7 A;  3WQB A;  4GWN A;  4AF9 A;  3CHX A;  4AR2 A;  1Y3T A;  4XFB A;  2H0V A;  5FZF A;  5FLI A;  1LOB A;  1UIK A;  1YC6 1;  2NPI A;  2TNF A;  3OBR A;  4L92 A;  5IAT A;  2R07 3;  4UI9 L;  3VBO A;  2GC2 A;  3THD A;  1SAC A;  4I0W B;  3CMG A;  2NLR A;  4AVV A;  1DCS A;  2FD8 A;  2FDF A;  4FPY A;  1J3Q A;  3ZYH A;  3BB6 A;  2JIG A;  3M7A A;  4TLG A;  5G05 L;  2WWS A;  1GBG A;  1K12 A;  1WBL A;  5F3E A;  3VBU C;  3WHU A;  2ZAB A;  1QKQ A;  1W05 A;  2YGL A;  3MID A;  4YVW A;  3P3P A;  5FLJ A;  4NVP A;  4OMC A;  2Q8D A;  1RXF A;  5B4N A;  3M3O A;  3K4Z A;  3LKJ A;  4FPF A;  3CEW A;  2BFU S;  1LOF C;  1ULD A;  2PXJ A;  1E57 A;  2VUA A;  4GKX A;  2PAM A;  2WAA A;  4K8R B;  2AEZ A;  2R0F A;  4XF0 A;  5JVV A;  5B2G B;  2OKX A;  4XAA A;  1GZW B;  2R04 1;  4FAH A;  5C3S A;  1O4Y A;  5HCH A;  4M3C E;  3I2K A;  2JWP A;  2XOM A;  3FHI B;  1PGW 1;  4ZS3 A;  1ULG A;  2A70 A;  2YGM A;  3MLJ A;  4IND A;  3SMH A;  5T50 A;  4OUS A;  1CAX B;  1JW6 A;  1ZBE 1;  2VCC A;  4KWJ A;  4DUX A;  1AR9 2;  2BYV E;  3PVE A;  4M3C A;  1GOG A;  1J3R A;  2WT2 A;  4NAO A;  1ENR A;  1Q8P A;  2XL9 A;  3USS A;  1IHM A;  5D8A B;  4XET A;  5IT6 A;  2XML A;  2HWD 2;  1JYV A;  1CZV A;  2MHF A;  5A7Q A;  4EN7 B;  3MI8 A;  2XJS A;  4JDM A;  3ZYP A;  2D3P A;  4JGZ B;  2HWB 2;  4RR3 B;  5JXJ A;  4PDW A;  1ZZ9 A;  2QZ3 A;  5LK7 B;  2HWE 1;  2ZHL A;  5F5I A;  4YM1 A;  3AKR A;  1HJF A;  2DFB A;  4QXB A;  3SQO A;  4TN7 A;  5G04 L;  4XC9 A;  4W4Z A;  1JHN A;  1PIV 2;  5KC5 A;  1CAW B;  5GZG A;  4QD2 A;  3GHN A;  2P4E A;  4WBB A;  1QQP 3;  2ADE A;  1RUJ 1;  2IFR A;  3WLU A;  2ATF A;  3K3O A;  3K51 A;  4WM8 A;  2BOI A;  5LA1 A;  2VD7 A;  4WVM B;  2WL1 A;  1D4V B;  5FMD A;  3AXE A;  1GWL A;  2H0B A;  3IAQ A;  2GNM A;  3A22 A;  4QXH A;  5CFC B;  1LES A;  5CNA A;  5JIA A;  2Z42 A;  4PLN A;  4ZY9 A;  4BQ1 A;  1TEI A;  2VQT A;  1UCX A;  1CX4 A;  1IPS A;  1WLC A;  4O65 A;  1HV0 A;  1ZZ6 A;  5HI0 A;  1QXJ A;  1UKG A;  5ERL A;  5K0U B;  1SDW A;  2VU9 A;  1N3P A;  3AZW A; 
#chains in the Genus database with same CATH homology
 1F15 A;  1LAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...