1LAJA

The structure of tomato aspermy virus by x-ray crystallography
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
b'NIASSSAPSLQHPTFIASKKCRAGYTYTSLDVRPTRTEKDKSFGQRLIIPVPVSEYPKKKVSCVQVRLNPSPKFNSTIWVSLRRLDETTLLTSENVFKLFTDGLAVLIYQHVPTGIQPNNKITFDMSNVGAEIGDMGKYALIVYSKDDVLEADEMVIHIDIEHQRIPSASTLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*A)-3'
publication title The Structure of Tomato Aspermy Virus by X-Ray Crystallography
pubmed doi rcsb
molecule tags Virus/rna
total genus 29
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00760 Cucumo_coat Cucumovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.530 Mainly Beta Sandwich Jelly Rolls Cucumovirus coat protein, subunit A 1lajA00
1F15A 1LAJA
chains in the Genus database with same CATH superfamily
4KWJA 4SBVA 3NJYA 3HOBA 4ISRA 1S0DA 5I91A 1OOPB 5CKQA 2RS53 2LM3A 5HCFA 4CZSA 4MHRA 3IIIA 2YFZA 5C4WC 2BOJA 4LBQD 3B02A 5F3GA 2WABA 4IUGA 4B8EA 3KF5A 1QGLA 2WKKA 3KCCA 2O14A 1F4HA 1ND3A 2VMHA 3D4KA 1RYYA 5JOZA 1ASJ3 2ARCA 3JBG1 2HWE3 3WNXA 4CUBA 3AL6A 4UI9L 1OPMA 3M8LA 5LK7B 4MADA 3D6EA 2JB8A 5E16A 3ZN6A 3M3IA 3AL5A 4LTAA 4CUAA 1BMV2 4JCKA 1C5IA 2IFRA 2VCAA 3MI8A 4WV8A 5GZDA 1OXCA 2VPVA 1AUYA 1LKNA 5FLIA 3WF4A 5K9YA 2ZZQA 1QF3A 1GZWB 2GH8A 2FBEA 4NJ4A 1QWRA 1CGPA 1QMJA 1VRH3 2EIDA 4QHOA 2HWF1 2ZGNA 3W59A 5C3PA 3HJRA 1FXZA 3LFMA 3LOIA 2JDPA 2EXIA 1OH4A 2ARAA 3KWVA 2HWB2 4IV3A 1YQ2A 5CKNA 1GUIA 2RJKA 4GXLA 4QKNA 1HDKA 1NE6A 1T2XA 4I0BA 4JTOA 1LHUA 3KS7A 4CDWB 4MGYE 4M4PA 3MV01 2WNVA 3RPQA 4CP9A 4GB32 3LDBA 1SMVA 3LF7A 1NG0A 2CGPA 2HH9A 2UYBA 5F3CA 1BZWA 2G4IA 3THPA 3WF2A 3IPVA 4A3XA 4FTEA 2VNRA 1VBD2 1AF9A 4NHYA 4DUVA 4O65A 5FO9B 1FMD1 1VBC1 1DCSA 2RV9A 4MGZE 3TOJA 4K1ZA 1PZ7A 1AR61 1RUF3 4FPHA 4LKSA 3ZDSA 5E8AA 1DIWA 2D3RA 3VBSA 2JICA 2VH9A 2J1VA 3J8F2 4MV2A 3T4HB 1WLCA 4EZHA 2ZEZA 4UFMA 2XJQA 4UOJA 5A3MA 1XYPA 4BZ4A 4GULA 5LEKA 1DG6A 3O5SA 2ZAHA 4EZ4A 5J7MA 1WLWA 1N1SA 1HRI3 5FYIA 4XJUA 5LB6A 2PLV2 2HWD2 3AVSA 5BYNA 5A6YA 2WWUA 5FPUA 2CAUA 3ZYPA 1T6GC 1QJU3 4QB1A 2CDOA 3IBMA 3VLBB 3ZO0B 1RUH2 1U5XA 2D6PA 4ZS2A 5KXEA 2IXKA 3TEWA 3T0DA 4NPMA 1NKGA 2IUWA 1OMIA 1RL3A 2WAAA 4IEOA 3LSDA 4FO9A 4LOTA 3U1XA 4BOWA 1GWLA 1NCRB 4LHKA 1G7YA 4N7IA 3DF0A 2XUEA 3WXPA 1FI2A 4FOQA 5CYYA 3VL9A 3OYWB 1XPWA 2VZ3A 5B2GB 2ZEWA 1Z78A 3H3ZA 4JGZA 1JXNA 3K4ZA 2WZ8A 3QH6A 2VZTA 5I0UA 5A7WB 1UX7A 1BBT2 4CDQA 2V09A 3KV4A 4JTNA 3EYPA 3M1HA 4D6RA 5BNOC 2BWAA 4Y24A 1EAH3 3OGRA 4A44A 2W87A 2ZX3A 2N7GA 4E2GA 3GALA 2GC3A 3VD7A 4AW7A 5D8AB 3KB5A 4ZZ8A 1WMDA 2P4EA 4OMCA 5JXIA 1PGW1 5FY0A 3MYXA 4L97A 3HQUA 2WN2A 1NLQA 1S55A 1UD1A 4YM1A 1XSQA 1BYHA 1UW8A 3IM0A 3BUCA 3I4IA 3MFAA 4FQZA 4BIFA 3OEBA 2VVDA 4A42A 3J26N 4GIQA 4LLOA 5CFCA 4BM8A 2R1BA 4AG4A 3OJBA 2BDRA 4P9WA 5FXZA 4CDUC 3RJRA 2QDRA 4XJ8A 4TLGA 3D5OA 1LB2A 4XJ9A 2WS93 3S6PA 3MZHA 3MO4A 5DABA 4DXSA 5E88A 2QJVA 3APBA 1D4M2 5AC93 4JQTA 5FDBA 1DHKB 1VAVA 2AEYA 2VUCA 4LBNA 4FSJA 3THTA 1UF2C 5KHJA 4LLFA 1W8TA 4M3CB 3ZM8A 4P9JA 5CB7A 1GR3A 3I2HA 3ZIXA 2XKOA 5E1RA 2LUWA 2JJ6A 3Q9OA 1URXA 5FXWA 3B69A 3K4DA 5F37A 2Y0OA 1BMV1 1GZ9A 5LA2A 4Q1PA 4BXFA 3SQOA 4HOOA 3AYDA 3ILRA 3LD8A 1J1TA 1IKPA 2GU9A 1YC61 4H7LA 1VR3A 4MO3M 4COWA 1XNDA 4CRQA 3ZSMA 3LSEA 1EY2A 3NNFA 3W21A 2Y60A 1S1AA 2Q8OA 5IJRA 2RR11 4HL0A 3VBOC 5LBEA 2DUOA 1RUE3 1GNYA 5H9PA 1DQ1A 3OY8B 4LIVA 2P2KA 2ZAAA 4X8PA 1YEWA 5E89A 3T30A 3HAGA 2A5ZA 4D6QA 5FY8A 3TB0A 2C9KA 5CIRA 3O1MA 2BFUL 1UMHA 5GALA 5EV7A 1AR81 4AR2A 3ZMNA 4JC1A 1QU0A 4FPLA 1SDDB 4GAZA 4NMIA 1DYOA 2XH6A 3ZYFA 4PLOA 5KHGA 2QQKA 2FQPA 2DVDA 3U11A 1LTEA 3TBDA 2LTNA 5L9VA 1VBD1 5BNPA 2JE7A 1QDCA 4O7XA 4YZ3A 5F9TA 4RS5B 2O1QA 3LCPA 3ZOIA 5K7PA 2RVAA 4GZ9A 4XBNA 5IAVA 3WP4A 1W6NA 3OOXA 1VAKA 4MGIE 5LRRA 4AFMA 4FOWA 4XFFA 2FCUA 5EJ3A 3DL3A 3T09A 1QXRA 5JDBA 2XVGA 2CWMA 3J8F1 2WFF3 2NMOA 1QQP3 2VU9A 2GP5A 1U0AA 4YVWC 2ZMKA 5FRAA 4MLOA 3VKLA 1Z0HA 1G6NA 1OFNA 3NNMA 3H9AA 5D1IA 4YM3A 4QPIB 3VGIA 2HWD1 1DZQA 1NLRA 4E27A 3KHCA 3AZYA 3H8UA 4Q29A 1W8ZA 1R64A 2VXJA 4Q0VA 5F5QA 4AYUA 1AR92 4B3NA 3VBRA 5KHIA 1RUH1 4N9HA 5HCBA 4YWAA 2LRPA 1LU2A 4AEKA 1XSRA 1RUOA 4KI5M 3ILNA 3NAPC 1EV13 3GJAA 5J36A 3FC0A 4MVTA 1O5LA 2F6BA 2FHRA 4Q4X2 1H2LA 3TRSB 3VB9A 3DXUA 1HN1A 2KR2A 4QDRA 2PHWA 4IE7A 4FOYA 3HQXA 4E4SA 1UOFA 1UYYA 1ZA4A 3POIA 5A1AA 1UQXA 3HNYM 4YM2A 5L7OC 2E7QA 4P08A 3WDWA 4LO8A 3ZX7A 1HB3A 4TSVA 2GNTA 1NQJA 4DO0A 3WG3A 4XOGA 1XOYA 2DFBA 4K9SA 1YQ5A 2VQAA 4XXPA 2JG9C 1IPSA 1O8SA 4Y1XA 1OD3A 4YG6A 3P3PA 3TEZA 3N9LA 4UFHA 2JG8A 5JI9A 2RS52 3GJBA 4XILA 4OZXA 4N43A 5EXOA 3I97A 4Z2AA 1WCDJ 3I7DA 4BCUA 2Y33A 1DZTA 1GYKA 5EQUA 4EJRA 5CEHA 1AR73 1OC1A 1XB9A 1H1AA 3T2PA 4NIGA 2VZQA 3ETPA 5HCAA 1NZCA 5DZFA 5ERLA 3GBGA 5FZIA 1ASJ2 1XE8A 2R073 2HWE2 4NVPA 1N3QA 1XU1A 2WJSA 3CDZB 2F4PA 5FZEA 1NCQC 1MS3A 1RUI3 1UWWA 3NV4A 3AYEA 3PVEA 1DU3D 3CJIB 1GANA 1V9U3 1JYCA 3AMPA 4M3CF 4RGGA 1M4WA 2BEOA 1MR5A 1KFUL 2W95A 3HVDA 4HBNA 4XBQA 3K3OA 2LROA 3NL1A 1D4M1 2AC1A 2WQ8A 1Y3TA 4YG3A 2Q8DA 2VO5A 4YGDA 1A8DA 4S2FA 3VDBA 4QM8A 1I6XA 1VRH2 1FAYA 3N7LA 2Z4FA 1MQTC 1G9BA 3IB3A 3TN93 3ZFGC 1FNZA 3AMMA 4KG0A 2X09A 4GH4C 4YLZA 3HR9A 4HFSA 4Y1UA 2QCSB 3AFGA 3WNOA 2C6SA 3E1F1 3IMNA 5F2WA 4Q4W3 4IDZA 4N8MA 4DXRA 1MEC3 1I9RA 2VQ0A 3BTZA 5FUPA 1CWPA 4ASLA 1X9PA 2A6ZA 5T54A 3SEPA 5FZHA 1CR7A 4WM7B 4XDQA 5H9RA 3V56A 3VZMA 4K8RB 1LOGA 5KHKA 1UZWA 3NV2A 1O3TA 3MGUA 3WVJA 2YDEA 4W50A 5DUVA 4R9DA 3MLKA 4BLJA 1UMIA 5KC5A 1HJGA 2ZACA 2Z5WA 1IPJA 2HEYF 3WF3A 4BU2A 4LORA 1WW7A 4XMIA 2D7FA 2A6WA 1RUF2 1UMZA 3POBA 2P1BA 4I0AA 1OSGA 1C8M3 5K8SA 2XVKA 4N53C 3I2IA 1DGWX 3T1MA 2A1XA 4ISQA 4UW6A 1K5MA 2YPDA 4WVWA 4MXWB 5JZGB 4XFBA 3KQ4B 4KGGA 3RMXA 5ACA3 4IGOA 2W94A 3PJYA 5APAA 4BMBA 2W1UA 1HRI2 2OPWA 3H8OA 4RR3A 4JX0A 4BA6A 5F6LB 2WINB 3AP4A 4AK3A 4EYUA 5IK8A 1NCRC 1QJU2 2I74A 1X33A 4AEDB 2YB7A 3ZR6A 4D94A 4OHZA 4PIYA 2J1SA 1HV1A 2OA2A 2VW2A 3PJQA 3U4SA 4J1XA 1TE1B 2VNOA 2ZCWA 3FFZA 5FYCA 2VMEA 2R041 2R49A 1MACA 4QU1A 5C4WB 4KWKA 1Z7S3 1QKQA 2JD4A 3HIFA 4Q0PA 1SLTA 2WIIB 5IK7A 1O6UA 4LA2A 5IFPA 3WNPA 3DKQA 2NM1A 2YBKA 1BK1A 4XF0A 2DV9A 1AR91 5GZFA 1JUHA 4IEPA 2RMU1 1JN2P 2B4KA 4TXWA 3VBHC 4AAXA 5FYZA 1EAH2 1JHJA 5C3QA 1QH6A 1NOVA 2R6QA 3OPZA 1NT0A 1SLLA 4PBOA 4YG0A 2JDZA 1SFNA 1PMIA 1SQ4A 1U5IA 1H6YA 3WP3A 4Q4X1 3NQHA 2P3KA 1POV0 3L9JT 5FAXA 5FQ0B 4OCTA 3HNMA 3SISA 1JI6A 2MHFA 3JUUA 2OPKA 5IATA 4QB6A 1LAJA 4OI2A 2HWB3 3DGTA 3EMRA 3DYMA 2YHJA 2R0HA 4AQTA 2PAMA 3BU0A 1PNFA 3P5BA 5CNAA 2OQ6A 1A8MA 4NO4A 3J7LA 4Q4Y1 4XAEA 4JGYC 1S4CA 3PURA 3LWCA 1AX2A 5A7PA 1JTZX 1QJX3 1IQAA 3THCA 1ZZ7A 2UWAA 1R083 1VBB1 2XJVA 2ES3A 3ZFFB 2ZGRA 2E6VA 5FP4A 3D0JA 2PXJA 2WN3A 1HRV3 2WS92 2EAKA 1RINA 2P6HA 4GWJA 3U07A 1PHMA 4EN9B 3WP5A 2DVGA 2W2IA 2F4LA 2JIJA 1H8TA 4HLTA 5BUVA 5FUNA 5AC92 4LO6B 2BW8A 1VALA 2VXRA 3DXTA 4IV3B 4PT6A 5EYYA 4AHZA 4HONA 1REEA 1CAVB 5CKMA 1IG0A 1PMHX 5A32A 5CAZA 5C7GA 1J1LA 5BY5A 5F5IA 3RS6A 5DZEA 5A6QA 3UKVA 1ASJ1 2B42B 2P5BA 5FZ0A 4OHVA 5FOJB 2Y8KA 5H9SA 1SHWB 2V4AA 2XVLA 2TEPA 3ASIA 5FY7A 3GZEA 4BDVB 3ABZA 4P9IA 2PMWB 2XB6C 1H9WA 4NR1A 4X6RB 3PUHA 4OI4A 1QY4A 1BEV3 3TNPB 4ARYA 3DPRA 3BKZA 1AYM3 2D3SA 2UURA 3MICA 1GSLA 3LQCA 4S2DA 4GWNA 4O9EA 1EUUA 1UYXA 3A21A 4E2SA 4NIDA 2K0GA 4DRVA 1ODMA 1PX3A 1VRH1 3J7HA 4MXVA 4WVMA 3ZKUA 3GGLA 1JU4A 4NIHA 4I3GA 4MG2A 3ETQA 1RUE2 2IVJA 4XE9A 3ZSKA 4GMP0 4IEXA 1SBFA 2GALA 3IDEA 1XNTA 4BQWA 3WQBA 1C4RA 1PIV3 1VRBA 3ACGA 3Q8EA 5T5JA 4XUOA 4AFBA 2VVFA 2VOTA 4J1WA 1HB1A 3JD73 5GJ6A 5GKAC 5IK4A 1HW5A 2VM9A 1MS1A 1ALYA 4MGSA 4J25A 3NJXA 4QWNA 4BIOA 1LHNA 2IXJA 1CAXA 2GC2A 4AFAA 5BNOB 1OUXA 1E5RA 3LA7A 3VDDB 3UESA 5A3LA 1UKRA 2QE3A 3PL0A 1YQ6A 1IKQA 1QXJA 3C8XA 1UYPA 1XE0A 2ZMLA 1RUF1 3WW1A 4NROA 2OUHA 1VPHA 5BV6A 5C70A 1ZZ8A 1J3QA 2I2SA 4GD4A 2GAUA 4I09A 2WFF2 1N3OA 1QQP2 4Z82A 4AQ6A 5FYYA 1GMMA 3AC0A 4V2WA 5DAQA 3RZMA 3LEGA 3NV1A 4CCEA 2MNGA 4IEUA 3V0BA 2Y6FA 1RUNA 3N7JA 3UGFA 1HRI1 3LPFA 4FP3A 5FY4A 4OHYA 4FI9A 1DYPA 2VNGA 5SV5A 3RZKA 2BGOA 2ZGTA 3O0WA 5HBAA 2E51A 4K1YA 4CDUB 5IVCA 2LS6A 3RQ0A 1EV12 2QQNA 3RZJA 5CG9A 1SEFA 3I2GA 5KC6A 2ZPXA 4PBPA 5FWEA 3IZOA 3RWNA 1VP6A 3ZYRA 5GZGA 1HB4A 1C3HA 1W6OA 1Q8SA 2VBPA 2HBUA 2ZX2A 3B94A 2EXHA 3ZXFA 5M0TA 3ZXLA 1NYWA 4DY5A 1A3KA 1G8WA 1NXMA 1W6MB 2UYAA 3VKMA 5JSPA 2J1TA 3HQRA 1ZRDA 3OGSA 5FPBA 3AZWA 1U12A 3IKWA 1AZDA 1WA4A 2XQXA 3EQEA 3VN4A 5EWSA 4IGPA 3VBFA 1JUIA 1KITA 1OHFA 1W9SA 3SXWA 1RHI3 3K46A 4KMQA 4ZONA 5BXXA 1AHSA 2ZMNA 3KV6A 1XNAA 3C7OA 4XIOA 5LW9A 5IAXA 1OA4A 4LKFA 1W8WA 1AXZA 1HXS3 4BB3A 2PHLA 4P9LA 1S0JA 4FFFA 3WINE 2DVAA 1UU4A 2DVBA 2JDKA 2ZGQA 1ULOA 1WCUA 2Y6HA 1GQGA 1UY2A 5BPXA 5LCWL 1AR72 3H3LA 3KLSA 3VBOB 4M0NA 1PNGA 4OHWA 1FV2A 2W46A 3VD4A 1UOGA 3WR0A 5C9AC 2ZX1A 3CJIC 2X10A 4E2QA 4ASMB 2YBSA 1QJY1 2VG9A 3ATGA 4KU8A 2R072 3FWEA 1GU3A 5LY2A 4P9XA 4LOSA 3LGRA 1RUI2 2BV4A 3MIDA 4XETA 2C4XA 5T50A 2OYZA 3WQ7A 4AEMA 1V9U2 2WS91 3CU7A 2OS2A 2ARXA 1COV3 4YZ5A 5AC91 4YW7A 4K3UA 3POSA 3MIFA 1V0AA 2E7AA 3ZYBA 5IVJA 1CPMA 4RFRB 1CX1A 3VD5A 2OQ7A 4JKLA 2JE9A 2WUHA 3WF0A 1Y9QA 2QZ3A 1Y9GA 3TN92 3ZMOA 1DQ2A 3ZSLA 1DBNA 1PO23 4HT1T 5JPMB 1EPZA 2YGLA 1BKZA 1W2TA 2VVEA 3ECQA 4LUKA 4YVWB 4CDXC 1AL21 1F5JA 4FFIA 3KSCA 4Q4W2 1LGCA 1MEC2 2DVFA 2NQYA 3DN7A 3OG2A 2V4VA 4LBLA 4ARXA 4B7KA 5A3OA 3RMYA 2HLEA 3VZOA 2GNDA 4N9IA 4ES9A 1QJZA 2BFUS 3PVNA 4V1PA 1HB2A 5FMOL 1SBEA 4CXXA 2CY6A 3ES4A 2DYCA 1C1LA 1GV9A 2GDFA 4NIIA 3RVHA 1NLSA 1SBDA 3NAPB 4OUSA 1LRHA 5FZ9A 3INAA 1C8M2 4QHBA 2IVIB 3DYPA 4FCAA 5A3WA 3RYKA 4BH9A 3POWA 2XJSA 2BP6A 3PMSA 3V65A 1SG3A 3ZN4A 4G9SB 4IV1A 4ONUA 1OF4A 4QB2A 4D6SA 5I0TA 3AMQA 5ACA2 2VW0A 3A23A 1W06A 3FUQA 1SCRA 5FZ6A 3T0AA 1C1FA 5CFDC 1J58A 1HJFA 2RHPA 5A6ZA 3C7HA 3BCWA 3WNMA 3WHTA 4IE6A 3ZFEA 1RVF2 2OKXA 1SLIA 2ORXA 4WM8A 1DQ5A 2JG9B 4C90A 1UAIA 4QXCA 1JZ2A 1L7QA 2YU2A 4HZFA 1QQP1 3HT1A 4ZU4A 2O8QA 4A3ZA 1OUSA 1ZNPA 1KXGA 1WUVA 1TG7A 4CEWA 5C71A 2VMIA 1Z7S2 2TUNA 3RI9A 2D6LX 4OQ9A 4RQPA 5I93A 1X36A 4KU7A 4P02B 2VZ1A 5JXGA 3JCIA 1HLCA 2VQUA 1MVEA 1JOJA 2XBO3 3URFA 1ND2A 3B5LB 2VZUA 1Y43B 3C7EA 3UGHA 1JBCA 1ND3C 1NCQB 3D0SA 4XZPA 2WYSA 5DDJ3 1EV11 1CZVA 2EICA 1UY4A 2ATFA 2EIBA 2WLQA 5FZAA 2EAAA 4R8HA 4D7YA 1CONA 2AYHA 2GNBA 5JOXA 2DCJA 4BQ3A 3SLIA 3AZVA 2ZKNA 1V70A 1B35A 3L2YA 3R0RA 1R093 1X9TA 3D82A 5IW0A 1LNSA 4H2AA 1OQEA 1W0PA 3E6CC 4E4ZA 5DAXA 2VUDA 1S0GA 4ATEA 3JXSA 1MQTB 2EIEA 2VW1A 2BGPA 3ZFGB 2QKDA 2HKXA 3ZFFC 4GH4B 5FPAA 4AEJA 2PHFA 4XHXA 3CZJA 1LULA 4YSFA 1ZYBA 4M3CE 1QJX2 2IXCA 4C0BA 2CGOA 3WD5A 3O1RA 1R082 1REFA 4YW4A 1RUJ2 1OKOA 4IV3C 1CIYA 4RGKA 5K0UA 1HRV2 1ZX5A 2JKXA 3K75B 1CD3G 2VOWA 1CAWA 1H2NA 2GMMA 3PU3A 2OX0A 2Z2SB 2AUYA 5A1LA 2G1MA 2WNVC 1BVP1 3KCYA 1AR71 3KZ4C 1XBFA 4IQPA 3S30A 1CAUB 1GFF2 1LGNA 3VHPA 4F3JA 1E5HA 1JH5A 3DCQA 5FP3A 5JLVA 4ATFA 2E9QA 4B7EA 4HN1A 1RUC3 3CLPA 4QQPA 4CU8A 1MS0A 3C7GA 4Y20A 4LKEA 2GMEA 4N53B 4AVTA 1RUI1 2VL4A 2GC0A 4M0HA 3RZGA 1V9U1 1PK6A 3DYOA 3VBSC 1E57A 2YU1A 1BEV2 3H7JA 4LK6A 5C3RA 3RFRA 1AYM2 4HPKB 1RIRA 2WBKA 3VBUA 4QU2A 3NJVA 1W6QB 4PDWA 1Q8OA 2P37A 2DCTA 3S7EA 1VMHA 1ZRFA 1J84A 4LQRA 4YYOA 2OVUA 5A80A 1NA1A 4AHXA 3TN91 3EO6A 2QQPA 4Q26A 1UNBA 4M4RA 5FXVA 3AB0A 1W9YA 2ENRA 3ES1A 1A78A 2E63A 1SLBA 5FP7A 2QQLA 1JODA 4Q4W1 1PIV2 1VIWB 2MPFA 4N90A 4EE2A 4TZDA 1MEC1 1CVNA 1OA2A 4Q0UA 1XNCA 2ET1A 3BODA 3JD72 4YW6A 3VDDC 2BQPA 1YFWA 4DFSA 2YYOA 2W92A 4Y22A 1G9CA 2MEV3 4P9YA 3GXUA 2C26A 5FTTC 4XFIA 1IOAA 3EHKA 1YJKA 3VBHB 1C8NA 3MHZA 4OHXA 4CDQC 4EWEA 5FWJA 4XTMA 1VMFA 4Y5Z0 3UJQA 2X05A 3I3QA 3AX4A 1C8M1 4CEYA 1Q3EA 3FLRA 1EP0A 2B46X 2XUMA 2XOMA 4WVVA 5LA9A 4I3PA 2YGMA 5J09A 3RRDA 2VZOA 4JAAA 4FXGB 4CP0A 4XUTA 1TNRA 1X8EA 3OD0A 5ACA1 1O3RA 2O0OA 4Q0SA 1KS5A 1XJAA 3ACHA 3WCSA 2XMLA 2VZPA 1S0IA 1J59A 3SCHA 3T2QA 1N1YA 2A70A 4JGYB 3WV6A 1RXGA 4LJHA 4PI0A 3VZLA 1WBLA 5F1RA 2ID4A 5CFCC 4YW1A 4NPRA 5JI7A 1BHGA 4IEYA 1YHFA 3WG2A 1K45A 1PX4A 2D93A 2V5DA 2ZGSA 5DUXA 3I3BA 5I0RA 4JKMA 1JU3A 2HEVF 4JVAA 2W91A 1ENRA 2R063 4Y5TA 4G4FA 4GA9A 2ILMA 1AXYA 2Y34A 1W2OA 3U10A 5HCHA 3AFKA 5B4XA 2A75A 3MIHA 3T08A 4A6OA 1X82A 1MZFA 5FZOA 4IL7A 3CIHA 3I2KA 2VMFA 1W9TA 3VV1A 4YVSA 3KCXA 3AKQA 5FMBA 1RHI2 4MHUA 5C8CA 3DUIA 1SACA 2P6CA 2ZABA 5FYTA 3HPNA 1HXS2 2RG4A 4V2VA 5FY5A 3ENRA 4ZY9A 3UKTA 5J48A 4ZKTB 5JOWA 4GQ7A 4EN7B 2BPA2 1W05A 1LOFA 2HWB1 4QX2A 4AF9A 1BCXA 2XKPA 1NUKA 3N3HA 3SMHA 3MBWA 1H2KA 1BXHA 2W1QA 2ZGLA 2XWBB 4Q27A 4CUGA 3ORJA 4GB31 4COYA 4ZS3A 5C8WA 2A6VA 4AVCA 4AFDA 4LITA 1R081 2LW8A 3OB8A 1KGYA 2ZXQA 5C3OA 1HRV1 3N9MA 5KXDA 1UYZA 2ZJCA 2YUEA 4RSUA 3HN3A 4COUA 5LZ6A 3U4XA 2NP0A 4PIXA 1K42A 3T2OA 3WOGA 1COV2 5T55A 4NWWA 4DINB 4FBFA 3T0BA 1AJKA 4ASKA 3VHRA 3JB4C 5HI0A 1W90A 3WP6A 4AHYA 1H30A 1F35A 5BNPC 3LZZA 1HQLA 1S2KA 4Q8LA 4META 3VHOA 4QPGA 2YC4A 1XYOA 1PO22 1W9FA 3FHQA 2YV8A 3O1PA 1HV0A 2PLV1 5A3UA 3IAPA 5IVEA 1OA3A 3POEA 1MZ6A 1LCLA 2WNUB 3AP5A 1FATA 3BIWE 1BEV1 3T2TA 4BMEA 1AYM1 3RGBA 1RUD3 2W5FA 3UK9A 3WEZA 2GNMA 4B29A 4D7SA 1DGWA 5A7NA 4D69A 4LHSA 1MS8A 3U78A 2XHNA 3AKTA 3IDCB 4AFCA 1MPXA 4LBKA 4AI2A 1JYVA 1JYTA 2A7AA 5CISA 4OFGA 3RZLA 2X5IA 4YW2A 2BBVA 4CPBA 4EN6B 3VBRC 1NX9A 2JDAA 5EPAA 3FBMA 4BXSV 3SITA 1WMEA 4CU6A 3JBG3 2RM23 3H0OA 2GN7A 1PIV1 5CG8A 5FO8B 2VUAA 1BBT1 2PYTA 4BJ0A 3JD71 1ULFA 3CO2A 5L73A 3AMHA 1FT9A 2JE8A 2E33A 2W68A 4IEZA 1LENA 3A0NA 4MH0E 2RJ2A 2WLPA 3THDA 4O61A 5L7OA 3FHIB 5IUQA 4KL1A 2E26A 4E8DA 1TNFA 4Q1RA 4B4QA 3BTXA 4UFJA 2FMDA 2R7EB 1W6OB 4UW5A 2E32A 3BI3A 2JKBA 5FZ4A 1OOPA 1SLCA 2HWF3 4CCDA 1CZTA 2D44A 2F17A 3V0AB 1W6PB 2P17A 1CJDA 2W39A 4RL7A 3RG0A 1OVSA 1O3QA 2A73B 3N36A 5KHHA 1GICA 1FX5A 1DQ6A 2ERFA 4Q2FA 4UW3A 3A22A 1YWKA 2JG8C 1KJRA 4IEVA 4TN7A 3WHUA 2CGNA 4N43C 4QQ2A 5F39A 5EJZB 5LWBA 5C9AB 3AZXA 5AVAA 4XUNA 2XBO2 3JZVA 3PIGA 4HMZA 4IEQA 3OUHA 1SPPB 3I59B 1QHDA 3H50A 4UF0B 3EJKA 4LUMA 1YI9A 2DUQA 3OUIA 5DDJ2 2CYFA 2NLRA 3S0MA 2FDKA 1GLHA 1GZWA 3DECA 5D21A 1PM7A 1S2EA 1S0FA 4UFLA 3V64A 4MOAA 3CBNA 4XJWA 5L36A 3PIJA 4PLMA 1R092 2ADDA 1WCQA 4KG8A 5T5LA 5JMCA 5FZBA 3UL2A 2G9FA 3VDAA 5LA1A 3FBYA 4NE9A 3OF1A 3AKSA 2B39A 3FL7A 3WSOA 5JVVA 4AZZA 1UU5A 1PZ9A 4MSVA 4SLIA 4D7TA 4CDWA 1O4YA 3L2HA 3LAGA 5A7SA 3USUB 4CDXB 2WO7A 4JDNA 2SBAA 4M00A 2VZSA 4PQ9A 1RHI1 2CHHA 4L99A 2PA7A 3NVCA 5FBJA 5G04L 1CZSA 3H7YA 1Q8PA 3HEIA 3BB6A 4K21A 1HXS1 2AZ5A 1ONAA 4NOTA 5ABJB 1QH7A 4CE8A 3PDQA 1PGL2 4QGMA 2PELA 4GWMA 3WCRA 4CCMA 1JZ3A 5JIAA 4FAHA 4I2OA 3RYRA 1O59A 1X8MA 1ZZ6A 1KDMA 4OZOA 1C28A 3MUZ1 2PAEA 2EA7A 1RUC2 4AL9A 1MZEA 1YCIA 1D2QA 4JDOA 1O4ZA 2XHKA 3BU7A 5FK7A 5E6HA 2PHRA 4AOCA 4AWDA 4AQ2A 5F5AA 1QJFA 3S5AA 1ZBE3 1JHNA 1IS4A 4OULA 1NAEA 4K20A 2XLAA 5A6XA 1RXFA 4E4HA 1RVF3 1JYXA 4IGQA 1A34A 3OGGA 4W6YA 5IHRA 4QDQA 5A33B 3M3OA 4DS0A 3M4FA 1R1A3 5CFDB 5JOYA 3USSA 1UX6A 5C3SA 3ZXJA 1GBGA 2VCBA 1PO13 3M3EA 3JQXA 2D5FA 1UY1A 5F7UA 2AREA 3HWJA 4LBQB 1HN0A 4CTEA 4UBGA 1YI7A 3OYWA 2VQTA 2PFWA 5FYBA 4BQXA 5BNNA 4RHV3 2BVBA 2UY8A 5FXXA 3SHRA 3WDTA 4BQ1A 4HKWA 5A7WA 4FPGA 3POGA 3KF3A 2WZEA 3ZFEB 2XJRA 1WGPA 3TWIA 1ODNA 4L8QA 2XL9A 2PHDA 2MEV2 3ZVXA 5JCTA 4C8DA 2YMZA 3ZDVA 5FJKA 1ND3B 5D8AA 3B3QE 3WDXA 1GOFA 2W9XA 3RNSA 2JDMA 2XGXA 1XC6A 5DMYA 2A6YA 3ZN6B 1I5ZA 1ND2B 1RUG3 2BBAA 4LNVA 4L0PA 5L9RA 5FMDA 2J1RA 4DRRA 2A3WA 5LASA 2D6KA 3UJOA 4DB5A 1OQ1A 1E5SA 1LESA 2EXJA 2ZX4A 4LO5B 4JHTA 4BPZA 1DGRN 1GQHA 2CAVA 4AVVA 2WT0A 3CF6E 1RUJ3 3CZUA 2W0XA 5AFBA 4IE5A 4EQVA 4EROA 3ZPOA 4EV0A 4NHLA 1ENXA 1W2UA 2RE9A 1QJEA 2RS51 2RDRA 5J96B 1ST8A 4YPJA 4AI3A 5J1XA 1D4VB 2D6OX 4TWTA 5JR7B 3ZSJA 5AFEA 1ZRCA 3EBRA 3AJYA 5DZGA 1VBE3 5T3NA 2GH2A 2YBPA 1OLQA 1OH3A 2JDHA 3N7MA 1AR83 5DUUA 4CP9B 2WNVB 3C7FA 3N9OA 4M3CA 1YIFA 2HWE1 2YC0A 2R062 3KV9A 2JD9A 4XBLA 3AYCA 1ZA7A 2R32A 1Y7BA 3NNGA 4XMAA 3IPVB 2XBO1 4DNYA 5C5UA 5IVBA 3LIHA 3FFQA 3MPBA 1VE0A 1XNBA 5DDJ1 2VBBA 4AXOA 4LKDA 2NN8A 1RJ8A 3G7DA 3VBSB 4B1LA 1DQ4A 4NN0A 3ZN5A 5JIUA 3CKHA 2CL2A 1S0CA 2RDSA 3I3DA 3LFIA 1R091 2VR4A 3FUOA 4IXLA 3WDUA 3ZXGA 3DPRC 4B4RA 4CUCA 5JWPA 3OY8A 3PUQA 4QX3A 3H1YA 1WD3A 1JYIA 1H0BA 1V6JA 3O0VA 4KWLA 2K2SA 1PM4A 4GKYA 1D7PM 4Q4V3 2WO2A 5FLHA 3S57A 1RC6A 3E5XA 1YNAA 3AP9A 4C1XA 1RGSA 2UU8A 4CCNA 4DUXA 4LK7A 3Q8CA 3NRUA 1H2MA 1IG3A 2PQQA 5FO7B 3OBRA 5FYVA 2DDUA 4A7KA 5FP9A 1PGL1 2ZEXA 4RS5A 1G86A 2YG0A 5FOBB 3TEYA 4JGZB 1B09A 4AAPA 2BU9A 2QZ2A 2VOVA 1V6MA 4KBZA 4CDQB 1E5IA 4DPNA 1FOD3 1H4GA 1GP5A 1US2A 4FOVA 1RUC1 2WNUC 4F8AA 4GALA 1SLAA 4ZZ5A 3ME2A 2G19A 2VCCA 2Q0AA 4YZ2A 4QPIA 1XNKA 3KGLA 4Y5SA 3IT8A 5C5TA 2P3JA 4CVUA 4QXBA 1ENSA 3M3CA 5B4NA 2GC1A 3CQOA 1QJU1 2HYXA 1LOEA 4B1MA 2YY1A 3CL1A 4QGNA 1RUD2 2XJPA 2IWGB 2X8KA 1OQDA 1X50A 3OBZA 5HXMA 1ZZBA 2HWC3 4A6SA 3MFCA 3HT2A 4UWDA 3U0ZA 4QKFA 3T4VA 4L11A 3OSDA 1QNYA 2W08A 5F3IA 2EALA 3WNKA 4QXHA 2CNAA 4C1WA 5J37A 1QNWA 3FJSA 4CCOA 5CFCB 5ANNA 1HQWA 2CSGA 1MZ5A 1KRIA 2VUJA 4M01A 3I2DA 3C2UA 5J98B 1UPIA 4BQ2A 3BVCA 3JBG2 1NQDA 1WMXA 2RM22 3GZAA 3WQ1A 4AGRA 4PLNA 2DCKA 1HX6A 4CP1A 3AKRA 3WX5A 3KMHA 3ACLA 1V6OA 3K3NA 4WVZA 1HIXA 3KT7A 5FKCA 4A45A 1OLME 2D6NA 1K12A 1EAH1 2SLIA 1W2NA 2UWCA 3H3UA 4CXYA 3POJA 2CU5A 3ZKYA 1LEDA 2V5YA 3P1IA 4XQDA 1S2BA 4URAA 3F2ZA 1N1VA 3POFA 3ACFA 4AVAA 2H0BA 4YFZA 1OURA 2FMYA 1O3SA 1R1ZA 4C91A 2WC2A 2HWF2 4AGGA 2PQSA 3EXUA 4PIZA 4Z8BA 1T6BX 4A7YA 1UY0A 1LU1A 4JHZA 4XDOA 3VBFC 3QACA 2ET7A 1PVC3 3PLQA 1YQ8A 4R52A 4QMAA 2ZGMA 1KDKA 5EP9A 3IIAA 5FZCA 5A70A 2DCZA 4H7MA 3ZR5A 4HVOA 3RDIA 1PGSA 2AACA 2AH2A 4XF9A 1TME3 3SKJE 3IDBB 4FXKB 3GBWA 1GQPA 4W4ZA 4CP2A 3HBZA 2Q8EA 3RWKX 3FZ3A 5HV4A 5FZDA 4Q8KA 1AR62 3N9QA 1KS4A 1UZYA 4XEZA 3O7OA 4QT6A 3DKWA 5LBCA 4XPVA 2HBTA 4QHZA 1WBFA 1OFSA 2WQZC 4HANA 2R061 2WFPA 4XZUG 4X8NA 2JIGA 2D97A 1SFPA 3O0XA 2R0FA 1UOJA 3EB7A 5FFOC 1P8JA 1V6NA 5BNPB 4MGTA 3GCWA 2GSYA 3LB9A 3A0KA 5JMOA 5FK8A 2XG3A 1RTVA 1W6NB 2VMGA 4YW3A 1Y4WA 3LE0A 2WWSA 5A1FA 1TMF3 5ABJC 1L3JA 4WM7A 2VD7A 1MS4A 2VTXJ 5FZ3A 1D2SA 1LOAA 5I8SA 5FZ1A 3HMYA 3HBKA 1QDOA 1Q43A 1WA6X 1WKYA 4KBBA 1RUE1 2VTXA 2R043 1FPN3 1ZBA3 1W8NA 2IC1A 1J3RA 1SZBA 2L9LA 3SEEA 4E4DX 4Z1VA 3W5NA 2DBIA 5T5OA 5A3PA 2WA3A 4XACA 1W8HA 3ZYIB 4MGKE 2D40A 1TZOA 1J83A 3VBRB 4ZU5A 2FDFA 2NPIA 3MLJA 2YC2A 4XQWA 2RMU3 3GZTB 2IXIA 5FPXA 4LBJA 5IYYA 3ITQA 4MXWA 3TEXA 3WF1A 5JZGA 3O1TA 4Y1YA 1DZRA 2ZEYA 3MW2A 5FV3A 5I0DA 1UIJA 2QQMA 2W1WA 3I3MA 3VKFC 2Y6GA 4ITCA 1ZBE2 4CU7A 4EWAA 2FZ1A 2D43A 4HG6B 3AVRA 2QQUA 2YXSA 2ZTNA 2D5HA 2D6MA 4AEDA 4JKKA 4IV1C 3H42B 1F4AA 1C57A 2WFF1 1R1A2 2XR4A 1K3IA 4FFGA 1AYN3 1OPOA 4AGVA 3WDVA 1FV3A 4LHLA 4Q4Y3 4OI1A 1PO12 4QPWA 5C4WA 1RITA 4I0WB 4R4XA 3WW4A 5CBLA 4Q0QA 3ZFEC 3K51A 3OCPA 4WM8C 3QCWA 3ZYGA 5C33A 2VE1A 3JQWA 2BYVE 4NHKA 4RHV2 1NY72 2B7YA 2JG8B 1RUD1 2D98A 5IK5A 4N43B 4CEWC 4Z2WA 3GNEA 2H0VA 4FPKA 2ZGKA 3SH4A 3AMNA 4X6QB 2ORZA 4RQPC 4CCKA 4HETA 3SCGA 4S2GA 1UOBA 4QKBA 1V6LA 2P3YA 2BWCA 5FZMA 4GJZA 1ND2C 1W2AX 2DU0A 5ISLA 5IVVA 2Y6LA 2G9GA 5FQ0A 2RM21 1YFUA 5DN2A 1XQNA 2WWJA 1V6KA 1RUG2 2WL1A 3AYAA 3WG4A 5IFTA 3AM2A 3LPGA 1B35C 3OPWA 1RMU3 2I45A 3B7MA 4QX8A 2DURA 1CESA 2H6BA 2DFCA 2QUOA 2CWSA 3KT4A 5KWRA 2DBNA 3SH5A 5J3UA 3ZFFA 1U5ZA 3OUJA 3B9CA 4P00B 1POV3 2RR12 3PVBB 4HSLA 2ZGUA 1YXWA 3WLUA 3RI8A 3MF9A 1VB2A 3MF6A 1VB4A 3N9NA 4B4PA 1VBE2 2VOKA 1CAVA 2QQVA 4FPEA 1JZ7A 2OT7A 2Y38A 4XYXA 1QXPA 1YUDA 4TLFA 5K0UC 1AR82 1IS3A 4A7ZA 4E9KA 5JAXA 4R9CA 4HVRA 2R071 4GKXA 5CU1A 5JSOA 1VBA3 2W52A 3AK0A 1GZCA 2ZZJA 4DEVA 2C5DA 3O1OA 3R4UA 4I02A 5GM0A 1OF3A 4TTGA 1MS5A 1V00A 4YGEA 2VECA 1OVPA 4W6WA 4L2NA 3VZNA 4ZU7A 3LOBA 4Z92B 5FREA 1UZ0A 4UFKA 3FN9A 2JB4A 3MIBA 3TNQA 3ZXKA 1LECA 1UN1A 1PK6C 2OXBA 5FZ7A 5GZEA 1K5MB 4OUEA 2XLFA 5FY9A 4AI9A 1WMFA 4XUPA 4H14A 2VJXA 4QX1A 4Y33A 4BK5A 3VBUC 1GNZA 4Y1VA 2DCYA 1CJPA 4RR3B 4PDWC 2WT2A 1YO8A 3S5QA 4D0QA 4JRLA 4Q4V2 4D8MA 1LR5A 1NA1C 1TEIA 2BTVC 3E5UA 3NNLA 4LIUA 3WZ1A 4HXCA 4OVEA 1WW6A 3VZJA 2WSVA 3MLLA 2WA4A 2BOIA 3X29B 4GJYA 1DGRA 3BN6A 5DUWA 4JGZC 1KEXA 3QBQA 1W04A 2ZHKA 2WZPP 4LULA 4FTBA 2A3YA 5BNOA 4P14A 4R9BA 3VDDA 4GMP3 4BQ5A 2J1UA 4XCAA 1HKDA 4RD7A 3Q8AA 3RYPA 3RZHA 4FP2A 4K40A 4N7UA 4XFCA 1F31A 5BNNB 3LEMA 3LKJA 4C0HA 1FOD2 1POQA 2E53A 1GWMA 2H6CA 2QQIA 2I07B 1DP0A 3BPSA 3QOPA 4NIAA 4Y4RA 4YGCA 5A7OA 5T5PA 2AEZA 1GNHA 1UXXX 2BRTA 2BNOA 3Q8BA 1UU6A 3KVAA 3TYJA 3HN1A 2OZJA 1ZBE1 2W47A 2Y64A 4CEYC 3M7AA 4YZ4A 3K48A 2Q1MA 5KBFA 4HKOA 3BOPA 3LEKA 4W65A 3W20A 5FZ8A 2WO1A 1RVF1 4GWIA 1W8UA 5JPNB 2HWC2 4CDUA 2Q4SA 4CU9A 1ULCA 4HK8A 1OLRA 5GLVA 1WZXA 4E8CA 1R1A1 3A4UA 3SH3A 4A41A 2Z69A 3AJZA 1QOSA 1MS9A 2IFWA 1PMJX 3U37A 3KHBA 3VDCA 1APNA 1BJQA 4KH9A 2D3PA 1PO11 1YJLA 1Z7S1 2BNNA 2J1EA 3B93A 3OBTA 3WY6A 2FDHA 4FT8A 4LXLA 1QJY3 1AXKA 2VZRA 4UT5A 3VZKA 3FLPA 3GHNA 3GM8A 3UETA 1YIPA 1W6MA 2GP3A 4G3YC 3PUAA 2Z42A 4RHV1 1NY71 4FPYA 3RZZA 1D0HA 4NHMA 1H8TB 4FPCA 1ZM1A 4EN8B 3PNAA 4EWDA 3N9PA 2C9AA 5A32B 3UNPA 4YGBA 1UZZA 5IVFA 4LO4B 4AI1A 2RS33 4OUMA 4DEQA 5L19A 4MZUA 2RS13 3CJXA 4BLIA 5KXCA 4INDA 4XC9A 3ALQA 5GZCA 2A3XA 4PF5A 1FYUA 2KXLA 4QD2A 5JUVA 3LA3A 4XW3A 3KM5A 1LHWA 2UY9A 3ZYJB 4YVSC 1RUG1 2OW4A 1PVC2 3GBFA 1AL23 5K4LA 3VBOA 4BWOA 1CQ9A 5C8CC 1M06G 2WR9A 3DPRB 2AR6A 1GOHA 2XONA 1F2NA 2WZR3 3I54A 2GMPA 2GN3A 3O1UA 1QJX1 2E7TA 4PCRA 3E6BA 3M2MA 5FP8A 1LOCA 2NMNA 1RUJ1 5F2SA 4WVMB 1LOFC 2EXKA 3WT3A 1I1EA 2VZVA 4ORFA 1TME2 1YYNA 5H9QA 2XJUA 4DQAA 2JX9A 1H1MA 2P34A 2QVSB 1VBE1 1GOGA 4AHWA 3NJZA 1OBNA 5FPZA 1L7RA 1PVXA 4NAMA 4BQYA 4I30A 5C6CA 4S2HA 5FZGA 3KV5A 4CCLA 2B45X 2V72A 2OUJA 2X53S 1CAXB 3GF6A 4QAWA 2XJTA 4LR4A 4YVWA 1JOPA 1UKGA 1VJ2A 3VD9A 1DLLA 5D2AA 5IVYA 3ELNA 2B9VA 3J9SA 2C24A 4QPGC 1TMF2 4KWUA 3VUOA 2ZHMA 2HEWF 3IAQA 5JSRA 1ACCA 3D8CA 3PTYA 2WQ4A 4K7JA 1Y9MA 3OPTA 2VTFA 4P5HA 5EJ1B 1ULEA 5FYHA 5FCCA 2R042 1JZ8A 1FPN2 1ZBA2 4LHNA 3V0BB 1W8OA 2Y6KA 1I3HA 3NAPA 3ZXEA 1F8VA 2QQWA 3KD4A 3PTRB 3ZSEA 4DUWA 1H4HA 5FYMA 3NO8A 3VKNA 4BE3A 4YFWA 1LGBA 4Q4V1 3O12A 4CPBD 2B8MA 1F5FA 1G9AA 1IS5A 5HPOA 1S0EA 2RMU2 2X5IC 2XDVA 3ZXDA 4LA3A 1US3A 2OZ6A 4OQ8A 2J7MA 1VMJA 4CXWA 1V6IA 4QX5A 1QOTA 2C1FA 3LIGA 2QNKA 5CZKA 2Z79A 1ZRIA 3F95A 2WRAA 1AJOA 4FFHA 5DAPA 1EYBA 1FNYA 2JG9A 4UW4A 2AGSA 1KFXL 1FOD1 2WNOA 2ZHNA 4CCJA 4LE3A 1OLMA 1AYN2 5EZWA 4XDPA 4Y3OA 2Q1ZB 1GKBA 4Q4Y2 1L7LA 4R4ZA 3VBFB 5FKBA 1OOPC 3WQ0A 3GYDA 5FR3A 4KNCA 4MX3A 1IS6A 2FCVA 4OYUA 1VBB2 3ST7A 5JR2A 5SV8A 4HK9A 1H6XA 3B01A 3R4SA 2VAUA 1GZTA 4BISA 1XYNA 3UKNA 2JEMA 1YFXA 2VULA 1C5HA 4XCBA 2HWC1 1JW6A 1FMD3 1VBC3 2DF7A 3NKGA 2ZA9A 1NCQA 2VOXA 1UY3A 2WNEA 5GLZA 1AR63 3JU9A 3OGVA 4NWVA 2K46A 2IXHA 3T1LA 2Y0IA 4JRAA 4LBOA 3ZIWA 3O1SA 2BVVA 4EN0A 1UO9A 2RDQA 3VL8A 2CV6A 2LALA 1ZZ9A 3ZYHA 3KQRA 3E6DA 4AE2A 3B00A 3M70A 5DXDA 3W9AA 5FZLA 4XFAA 1IQDC 5EYXA 1MQTA 1YRZA 2ADEA 4DY3A 3WUCA 4FAGA 3ZFGA 1TVGA 1WD4A 2WAOA 4GH4A 4NHXA 1EUTA 5F8PA 1RMU2 1NZIA 3SKVA 1SCSA 3CEWA 3MV11 4QKDA 1DDLA 4YW5A 1OT5A 1ULDA 1W03A 2R30A 4QGLA 1DYKA 5DAVA 5F6KA 1H8VA 2XL7A 4XVHA 1UIKA 4CDWC 4K6BA 4DMIA 2WSUA 1LEMA 2W1SA 2QQOA 1JZ5A 3BTYA 1PVC1 4KGQA 3PUSA 4BK4A 1CAUA 1W99A 1X7NA 4Y4YA 4ZXKA 1JMUB 4CCCA 1ZZCA 1W3VA 1CIWA 1JOBA 2PHXA 3ACIA 3J7NA 3VD3A 2ZHLA 4QPYA 4MYEA 1DQ0A 3KT1A 3MDPA 4IE0A 1VBA2 1W8FA 2XQRA 4N53A 2JECA 1QOOA 3WDYA 4YZ1A 1AVBA 3VHNA 4COVA 3PUIA 1O5UA 5EFUA 4L9BA 3WNNA 5I8YA 5FUIA 1TME1 1DGLA 3BALA 3QLQA 3OGJA 1COV1 4RN5A 5F3EA 1K5MC 4HPKA 2KD7A 1JZ6A 2AENA 3NKTA 5FLJA 2OIIA 1WCKA 2ZOEB 4P5YA 1W6QA 5AVPA 1W3XA 4RGAA 3ON7A 3UV9A 4RR3C 4PF1A 3NWKA 4XIKA 1NCRA 1QEXA 1H1IA 1O7FA 2R16A 4IV1B 4NRQA 1W0NA 1PO21 2QBXA 4MUVA 5FMOS 3WG1A 1S0BA 4F83A 4JV4A 2DU1A 2YPJA 5LATA 4IETA 1NXD1 1YFYA 2EVXA 4HKLA 2FDJA 3SCFA 1LHOA 5FMCA 4LE4A 4L92A 3LDRA 4WM8B 1TMF1 2PN5A 1G9DA 4XFGA 5EIYB 1W0OA 2FZ2A 1XRUA 2TBVA 4XUQA 3UYJA 2PTMA 4I01A 4J6GA 1SFYA 4CEWB 5BNNC 1FPN1 1LJ7A 1ZBA1 3C3VA 4PHZA 3NNJA 3VBHA 2J1AA 4YNIA 2XPJA 1YLLA 4RQPB 5ANQA 2DTYA 1F15A 2Q8CA 4PI2A 2IXLA 1W39A 4UBHA 4KQ7A 3AXEA 3T3YA 3ZPYA 4LO7A 5D8AC 4FPJA 3IMMA 3NW4A 1IHMA 1ULGA 1PZ8A 1KJLA 5FZKA 3N7KA 3KGZA 3H8RA 2ARBA 4ZXEA 2RR13 1B35B 3I3EA 5FIXA 3RSJA 4CSWA 4JGYA 5A3TA 2PAKA 4OMDA 1RJ7A 2ZKLA 4COZA 1RB8G 2BUKA 4IW3A 3BTAA 1DFQA 5GLUA 3TAYA 3QD6A 5CA6A 3R6SA 2QDNA 2ZGOA 2ZGPA 5G05L 3U75A 4AVSA 4BYYA 1AYN1 1STMA 2Q5TA 3N35A 3I2OA 2W3JA 1AX0A 2WYFA 4PQQA 3DEMA 4AI0A 2XLGA 4GB33 1HQNA 1OD5A 1QJY2 5DQ0A 5LBBA 1H8TC 3MW3A 2VY0A 4K8FA 4U36A 5L9BA 5TSWA 3E5QA 2A71A 2WT1A 2G9ZA 3K4AA 4XJAA 5K0UB 1DLCA 1QIQA 4UFIA 4WBBA 1ENQA 4XURA 5LEJA 1CAWB 1VBD3 3P3NA 3FLTA 5JXJA 1WLTA 2GZWA 2RJLA 3IDAA 3K2OA 1ULPA 4JQRA 1BVVA 3RJ2X 5LA0A 2JXAA 3K77A 3J8F3 4XQ4A 3UT0A 3IN9A 3DV8A 3HD8B 2RS32 2FD8A 1VAMA 2RDNA 3FMGA 2DUPA 1CN1A 2RS12 3NSTA 4Y20B 5CVRA 1UPSA 2BERA 2O8OA 4XJZA 2ZBJA 2FDIA 3S7IA 2DTWA 3WUDA 4XHBA 2ZS6B 1PK6B 2PLV3 1LODA 2HWD3 2KM2A 1GP4A 2XWJB 3PVOA 3WW3A 4AQSA 1AL22 3W58A 4FTSA 2CDPA 5GLWA 5LK5A 5HXVA 4F7ZA 1RUH3 2C0ZA 4Q5OA 5DAWA 3VBUB 1RMU1 1VLNA 2WZR2 2ZX0A 3LEIA 4PDWB 3POYA 1IGOA 3MPPG 1O4TA 3BGAA 3I8TA 3OBAA 4LEJA 4NAOA 3N4MA 1REDA 1NA1B 3OEAA 1POV1 3WNLA 4WZFA 3AZZA 2P3IA 5KXBA 3MUY1 4QQHA 2BGCA 1TQ5A 3PMEA 4LPLA 2NZ9A 4FPOB 3GDBA 5CADA 5FPVA 3GHMA 5I8TA 1A6CA 1IZ3A 3ROUA 5LY1A 5HV0A 1BBT3 5BNQA 2JENA 4XAAA 1Q5OA 2BZDA 3MIGA 3QH7A 4ES8A 2VGDA 4JDMA 3H1WA 2PHTA 1VBA1 2WDBA 1WW4A 3Q8FA 4RYDA 4Y22B 4RS5C 4R9AA 5FBZA 2B9UA 1W9WA 4NUBA 5DG2A 4A2UA 4ZHNA 1H9PA 3LA2A 3G6JB 2WNUA 2BJSA 5DPNA 4RA0A 4DXTA 2TNFA 4P9GA 1DF0A 5F5CA 1Q8QA 3WW2A 4CEYB 3OTFA 4XFHA 2QTWB 4QPIC 1JYWA 3AKPA 3UGGA 4LT5A 1ZVFA 4MGQA 4U2AA 4DOUA 4AI8A 4H55A 2VC9A 3I2FA 1XU2A 4QXKA 3J4UH 3H1MA 2VCMA 4IERA 1ZRRA 2HJIA 1Q56A 3KVBA 1CX4A 3FX3A 4O9GA 1BQPA 3BOWA 2V73A 1I5PA 1U5YA 1WLDA 4FPFA 1IPKA 1LOBA 2KA3A 4DZGA 3I2JA 3HNBM 5KR7A 1D4M3 4Y1ZA 2MEV1 3J7MA 3JB8A 1AL0G 4OLLA 1JYNA 2Y6JA 1G9FA 1KD7A 2JDNA 4AVBA 2YZ4A 3FE5A 4GMP1 2PHUA 3VKOA 5DG1A 3AP6A 4H3WA 4IE4A 5FJHA 2QQJA 1W6PA 3V0AA 2IZWA 4XTPA 1OI6A 2EIGA 2K9ZA 4Y26A 1LHVA 4XF3A 2J22A 1N3PA 5FZOB 4BHPA 3MEPA 3PU8A 5I0SA 1BLZA 2VBDA 3CMGA 3IWZA 5A3NA 4OI0A 4YVSB 3LDKA 1UXZA 3M3QA 4LBMA 1UL9A 4NPLA 3ZLIA 5IT6A 3U14A 4W8JA 5C8CB 5IWFA 3NV3A 2HYKA 4YRDA 2YROA 5FY1A 4PJYA 3CJIA 5C9AA 4UAPA 4FVVA 5A7QA 1WCSA 2XXZA 1MVQA 3P6BA 4QDSA 3PHMA 4IESA 1SPPA 3I59A 3E97A 4LMFA 4RFT0 4UF0A 1FMD2 1VBC2 3CNAA 1N1TA 4QX0A 1CPNA 1KQRA 4JZRA 1GP6A 3NMBA 2BNMA 3O14A 4A4AA 1UZVA 3MIEA 4XXAA 1W28A 2A6XA 4HVQA 3CHXA 1SDWA 4QQOA 3A7QA 4D3WA 3SC7X 5FPLA 5LRSA 2B5HA 4YM0A 4DXZA 2YFUA 3H8XA 2VNVA 2VMCA 4QX7A 4YARA 4URTA 5T52A 1ZREA 5FYSA 3I49A 2Q30A 2ETEA 3AP7A 3MW4A 4XABA 1JZ4A 1O8PA 3B9IA 3USUA 4CDXA 1D0GA 1UCXA 4QM9A 3GCXA 2RS31 3GZUC 2FCTA 2RS11 2UWBA 4QPGB 1OKQA 5ABJA 3AXDA 3OD4A 5FZFA 4DIQA 2R1DA 2X29A 1J3PA 4FQ4A 4HN0A 4WM7C 1XXNA 2JDUA 5F32A 2WO3A 1AX1A 1Q8VA 4W6XA 1AR93 1BK0A 3BPZA 5GLTA 4BQ4A 5FYUA 2WZR1 3R4DB 2NYYA 3W5MA 1K5JA 4QQLA 1JS9A 2CTVA 4NRMA 1WWYA 4Z07A 4ET7A 2EF6A 2QFEA 3SNMA 2X5IB 4UXAA 1XE7A 4Q4X3 3D3AA 4ZPIA 2J42A 3BIEA 2Q1FA 5LBFA 4XF1A 1PGW2 5EHDA 3ILFA 2FDGA 4NRPA 4UYBA 4TYSA 5JZGC 3ZXAC 4CYDA 5A33A 1GWKA 2E31A 1EPWA 5CFDA 1O91A 1WW5A 1F9KA 4IEWA 3R05A 4WZCA 2JDYA 2Y26A 2JWPA 4HSJA 1NE4A 5L7OB 3FHAA 2DWRA 3O1VA 4AEDC 4LBQA 3BYWA 4XF4A 1VBB3 1N47A 5JXHA 4CA9A 2VMDA 1YQCA
chains in the Genus database with same CATH topology
1F15A 1LAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F15 A;  1LAJ A; 
#chains in the Genus database with same CATH topology
 4KWJ A;  4SBV A;  3NJY A;  3HOB A;  4ISR A;  1S0D A;  5I91 A;  1OOP B;  5CKQ A;  2RS5 3;  2LM3 A;  5HCF A;  4CZS A;  4MHR A;  3III A;  2YFZ A;  5C4W C;  2BOJ A;  4LBQ D;  3B02 A;  5F3G A;  2WAB A;  4IUG A;  4B8E A;  3KF5 A;  1QGL A;  2WKK A;  3KCC A;  2O14 A;  1F4H A;  1ND3 A;  2VMH A;  3D4K A;  1RYY A;  5JOZ A;  1ASJ 3;  2ARC A;  3JBG 1;  2HWE 3;  3WNX A;  4CUB A;  3AL6 A;  4UI9 L;  1OPM A;  3M8L A;  5LK7 B;  4MAD A;  3D6E A;  2JB8 A;  5E16 A;  3ZN6 A;  3M3I A;  3AL5 A;  4LTA A;  4CUA A;  1BMV 2;  4JCK A;  1C5I A;  2IFR A;  2VCA A;  3MI8 A;  4WV8 A;  5GZD A;  1OXC A;  2VPV A;  1AUY A;  1LKN A;  5FLI A;  3WF4 A;  5K9Y A;  2ZZQ A;  1QF3 A;  1GZW B;  2GH8 A;  2FBE A;  4NJ4 A;  1QWR A;  1CGP A;  1QMJ A;  1VRH 3;  2EID A;  4QHO A;  2HWF 1;  2ZGN A;  3W59 A;  5C3P A;  3HJR A;  1FXZ A;  3LFM A;  3LOI A;  2JDP A;  2EXI A;  1OH4 A;  2ARA A;  3KWV A;  2HWB 2;  4IV3 A;  1YQ2 A;  5CKN A;  1GUI A;  2RJK A;  4GXL A;  4QKN A;  1HDK A;  1NE6 A;  1T2X A;  4I0B A;  4JTO A;  1LHU A;  3KS7 A;  4CDW B;  4MGY E;  4M4P A;  3MV0 1;  2WNV A;  3RPQ A;  4CP9 A;  4GB3 2;  3LDB A;  1SMV A;  3LF7 A;  1NG0 A;  2CGP A;  2HH9 A;  2UYB A;  5F3C A;  1BZW A;  2G4I A;  3THP A;  3WF2 A;  3IPV A;  4A3X A;  4FTE A;  2VNR A;  1VBD 2;  1AF9 A;  4NHY A;  4DUV A;  4O65 A;  5FO9 B;  1FMD 1;  1VBC 1;  1DCS A;  2RV9 A;  4MGZ E;  3TOJ A;  4K1Z A;  1PZ7 A;  1AR6 1;  1RUF 3;  4FPH A;  4LKS A;  3ZDS A;  5E8A A;  1DIW A;  2D3R A;  3VBS A;  2JIC A;  2VH9 A;  2J1V A;  3J8F 2;  4MV2 A;  3T4H B;  1WLC A;  4EZH A;  2ZEZ A;  4UFM A;  2XJQ A;  4UOJ A;  5A3M A;  1XYP A;  4BZ4 A;  4GUL A;  5LEK A;  1DG6 A;  3O5S A;  2ZAH A;  4EZ4 A;  5J7M A;  1WLW A;  1N1S A;  1HRI 3;  5FYI A;  4XJU A;  5LB6 A;  2PLV 2;  2HWD 2;  3AVS A;  5BYN A;  5A6Y A;  2WWU A;  5FPU A;  2CAU A;  3ZYP A;  1T6G C;  1QJU 3;  4QB1 A;  2CDO A;  3IBM A;  3VLB B;  3ZO0 B;  1RUH 2;  1U5X A;  2D6P A;  4ZS2 A;  5KXE A;  2IXK A;  3TEW A;  3T0D A;  4NPM A;  1NKG A;  2IUW A;  1OMI A;  1RL3 A;  2WAA A;  4IEO A;  3LSD A;  4FO9 A;  4LOT A;  3U1X A;  4BOW A;  1GWL A;  1NCR B;  4LHK A;  1G7Y A;  4N7I A;  3DF0 A;  2XUE A;  3WXP A;  1FI2 A;  4FOQ A;  5CYY A;  3VL9 A;  3OYW B;  1XPW A;  2VZ3 A;  5B2G B;  2ZEW A;  1Z78 A;  3H3Z A;  4JGZ A;  1JXN A;  3K4Z A;  2WZ8 A;  3QH6 A;  2VZT A;  5I0U A;  5A7W B;  1UX7 A;  1BBT 2;  4CDQ A;  2V09 A;  3KV4 A;  4JTN A;  3EYP A;  3M1H A;  4D6R A;  5BNO C;  2BWA A;  4Y24 A;  1EAH 3;  3OGR A;  4A44 A;  2W87 A;  2ZX3 A;  2N7G A;  4E2G A;  3GAL A;  2GC3 A;  3VD7 A;  4AW7 A;  5D8A B;  3KB5 A;  4ZZ8 A;  1WMD A;  2P4E A;  4OMC A;  5JXI A;  1PGW 1;  5FY0 A;  3MYX A;  4L97 A;  3HQU A;  2WN2 A;  1NLQ A;  1S55 A;  1UD1 A;  4YM1 A;  1XSQ A;  1BYH A;  1UW8 A;  3IM0 A;  3BUC A;  3I4I A;  3MFA A;  4FQZ A;  4BIF A;  3OEB A;  2VVD A;  4A42 A;  3J26 N;  4GIQ A;  4LLO A;  5CFC A;  4BM8 A;  2R1B A;  4AG4 A;  3OJB A;  2BDR A;  4P9W A;  5FXZ A;  4CDU C;  3RJR A;  2QDR A;  4XJ8 A;  4TLG A;  3D5O A;  1LB2 A;  4XJ9 A;  2WS9 3;  3S6P A;  3MZH A;  3MO4 A;  5DAB A;  4DXS A;  5E88 A;  2QJV A;  3APB A;  1D4M 2;  5AC9 3;  4JQT A;  5FDB A;  1DHK B;  1VAV A;  2AEY A;  2VUC A;  4LBN A;  4FSJ A;  3THT A;  1UF2 C;  5KHJ A;  4LLF A;  1W8T A;  4M3C B;  3ZM8 A;  4P9J A;  5CB7 A;  1GR3 A;  3I2H A;  3ZIX A;  2XKO A;  5E1R A;  2LUW A;  2JJ6 A;  3Q9O A;  1URX A;  5FXW A;  3B69 A;  3K4D A;  5F37 A;  2Y0O A;  1BMV 1;  1GZ9 A;  5LA2 A;  4Q1P A;  4BXF A;  3SQO A;  4HOO A;  3AYD A;  3ILR A;  3LD8 A;  1J1T A;  1IKP A;  2GU9 A;  1YC6 1;  4H7L A;  1VR3 A;  4MO3 M;  4COW A;  1XND A;  4CRQ A;  3ZSM A;  3LSE A;  1EY2 A;  3NNF A;  3W21 A;  2Y60 A;  1S1A A;  2Q8O A;  5IJR A;  2RR1 1;  4HL0 A;  3VBO C;  5LBE A;  2DUO A;  1RUE 3;  1GNY A;  5H9P A;  1DQ1 A;  3OY8 B;  4LIV A;  2P2K A;  2ZAA A;  4X8P A;  1YEW A;  5E89 A;  3T30 A;  3HAG A;  2A5Z A;  4D6Q A;  5FY8 A;  3TB0 A;  2C9K A;  5CIR A;  3O1M A;  2BFU L;  1UMH A;  5GAL A;  5EV7 A;  1AR8 1;  4AR2 A;  3ZMN A;  4JC1 A;  1QU0 A;  4FPL A;  1SDD B;  4GAZ A;  4NMI A;  1DYO A;  2XH6 A;  3ZYF A;  4PLO A;  5KHG A;  2QQK A;  2FQP A;  2DVD A;  3U11 A;  1LTE A;  3TBD A;  2LTN A;  5L9V A;  1VBD 1;  5BNP A;  2JE7 A;  1QDC A;  4O7X A;  4YZ3 A;  5F9T A;  4RS5 B;  2O1Q A;  3LCP A;  3ZOI A;  5K7P A;  2RVA A;  4GZ9 A;  4XBN A;  5IAV A;  3WP4 A;  1W6N A;  3OOX A;  1VAK A;  4MGI E;  5LRR A;  4AFM A;  4FOW A;  4XFF A;  2FCU A;  5EJ3 A;  3DL3 A;  3T09 A;  1QXR A;  5JDB A;  2XVG A;  2CWM A;  3J8F 1;  2WFF 3;  2NMO A;  1QQP 3;  2VU9 A;  2GP5 A;  1U0A A;  4YVW C;  2ZMK A;  5FRA A;  4MLO A;  3VKL A;  1Z0H A;  1G6N A;  1OFN A;  3NNM A;  3H9A A;  5D1I A;  4YM3 A;  4QPI B;  3VGI A;  2HWD 1;  1DZQ A;  1NLR A;  4E27 A;  3KHC A;  3AZY A;  3H8U A;  4Q29 A;  1W8Z A;  1R64 A;  2VXJ A;  4Q0V A;  5F5Q A;  4AYU A;  1AR9 2;  4B3N A;  3VBR A;  5KHI A;  1RUH 1;  4N9H A;  5HCB A;  4YWA A;  2LRP A;  1LU2 A;  4AEK A;  1XSR A;  1RUO A;  4KI5 M;  3ILN A;  3NAP C;  1EV1 3;  3GJA A;  5J36 A;  3FC0 A;  4MVT A;  1O5L A;  2F6B A;  2FHR A;  4Q4X 2;  1H2L A;  3TRS B;  3VB9 A;  3DXU A;  1HN1 A;  2KR2 A;  4QDR A;  2PHW A;  4IE7 A;  4FOY A;  3HQX A;  4E4S A;  1UOF A;  1UYY A;  1ZA4 A;  3POI A;  5A1A A;  1UQX A;  3HNY M;  4YM2 A;  5L7O C;  2E7Q A;  4P08 A;  3WDW A;  4LO8 A;  3ZX7 A;  1HB3 A;  4TSV A;  2GNT A;  1NQJ A;  4DO0 A;  3WG3 A;  4XOG A;  1XOY A;  2DFB A;  4K9S A;  1YQ5 A;  2VQA A;  4XXP A;  2JG9 C;  1IPS A;  1O8S A;  4Y1X A;  1OD3 A;  4YG6 A;  3P3P A;  3TEZ A;  3N9L A;  4UFH A;  2JG8 A;  5JI9 A;  2RS5 2;  3GJB A;  4XIL A;  4OZX A;  4N43 A;  5EXO A;  3I97 A;  4Z2A A;  1WCD J;  3I7D A;  4BCU A;  2Y33 A;  1DZT A;  1GYK A;  5EQU A;  4EJR A;  5CEH A;  1AR7 3;  1OC1 A;  1XB9 A;  1H1A A;  3T2P A;  4NIG A;  2VZQ A;  3ETP A;  5HCA A;  1NZC A;  5DZF A;  5ERL A;  3GBG A;  5FZI A;  1ASJ 2;  1XE8 A;  2R07 3;  2HWE 2;  4NVP A;  1N3Q A;  1XU1 A;  2WJS A;  3CDZ B;  2F4P A;  5FZE A;  1NCQ C;  1MS3 A;  1RUI 3;  1UWW A;  3NV4 A;  3AYE A;  3PVE A;  1DU3 D;  3CJI B;  1GAN A;  1V9U 3;  1JYC A;  3AMP A;  4M3C F;  4RGG A;  1M4W A;  2BEO A;  1MR5 A;  1KFU L;  2W95 A;  3HVD A;  4HBN A;  4XBQ A;  3K3O A;  2LRO A;  3NL1 A;  1D4M 1;  2AC1 A;  2WQ8 A;  1Y3T A;  4YG3 A;  2Q8D A;  2VO5 A;  4YGD A;  1A8D A;  4S2F A;  3VDB A;  4QM8 A;  1I6X A;  1VRH 2;  1FAY A;  3N7L A;  2Z4F A;  1MQT C;  1G9B A;  3IB3 A;  3TN9 3;  3ZFG C;  1FNZ A;  3AMM A;  4KG0 A;  2X09 A;  4GH4 C;  4YLZ A;  3HR9 A;  4HFS A;  4Y1U A;  2QCS B;  3AFG A;  3WNO A;  2C6S A;  3E1F 1;  3IMN A;  5F2W A;  4Q4W 3;  4IDZ A;  4N8M A;  4DXR A;  1MEC 3;  1I9R A;  2VQ0 A;  3BTZ A;  5FUP A;  1CWP A;  4ASL A;  1X9P A;  2A6Z A;  5T54 A;  3SEP A;  5FZH A;  1CR7 A;  4WM7 B;  4XDQ A;  5H9R A;  3V56 A;  3VZM A;  4K8R B;  1LOG A;  5KHK A;  1UZW A;  3NV2 A;  1O3T A;  3MGU A;  3WVJ A;  2YDE A;  4W50 A;  5DUV A;  4R9D A;  3MLK A;  4BLJ A;  1UMI A;  5KC5 A;  1HJG A;  2ZAC A;  2Z5W A;  1IPJ A;  2HEY F;  3WF3 A;  4BU2 A;  4LOR A;  1WW7 A;  4XMI A;  2D7F A;  2A6W A;  1RUF 2;  1UMZ A;  3POB A;  2P1B A;  4I0A A;  1OSG A;  1C8M 3;  5K8S A;  2XVK A;  4N53 C;  3I2I A;  1DGW X;  3T1M A;  2A1X A;  4ISQ A;  4UW6 A;  1K5M A;  2YPD A;  4WVW A;  4MXW B;  5JZG B;  4XFB A;  3KQ4 B;  4KGG A;  3RMX A;  5ACA 3;  4IGO A;  2W94 A;  3PJY A;  5APA A;  4BMB A;  2W1U A;  1HRI 2;  2OPW A;  3H8O A;  4RR3 A;  4JX0 A;  4BA6 A;  5F6L B;  2WIN B;  3AP4 A;  4AK3 A;  4EYU A;  5IK8 A;  1NCR C;  1QJU 2;  2I74 A;  1X33 A;  4AED B;  2YB7 A;  3ZR6 A;  4D94 A;  4OHZ A;  4PIY A;  2J1S A;  1HV1 A;  2OA2 A;  2VW2 A;  3PJQ A;  3U4S A;  4J1X A;  1TE1 B;  2VNO A;  2ZCW A;  3FFZ A;  5FYC A;  2VME A;  2R04 1;  2R49 A;  1MAC A;  4QU1 A;  5C4W B;  4KWK A;  1Z7S 3;  1QKQ A;  2JD4 A;  3HIF A;  4Q0P A;  1SLT A;  2WII B;  5IK7 A;  1O6U A;  4LA2 A;  5IFP A;  3WNP A;  3DKQ A;  2NM1 A;  2YBK A;  1BK1 A;  4XF0 A;  2DV9 A;  1AR9 1;  5GZF A;  1JUH A;  4IEP A;  2RMU 1;  1JN2 P;  2B4K A;  4TXW A;  3VBH C;  4AAX A;  5FYZ A;  1EAH 2;  1JHJ A;  5C3Q A;  1QH6 A;  1NOV A;  2R6Q A;  3OPZ A;  1NT0 A;  1SLL A;  4PBO A;  4YG0 A;  2JDZ A;  1SFN A;  1PMI A;  1SQ4 A;  1U5I A;  1H6Y A;  3WP3 A;  4Q4X 1;  3NQH A;  2P3K A;  1POV 0;  3L9J T;  5FAX A;  5FQ0 B;  4OCT A;  3HNM A;  3SIS A;  1JI6 A;  2MHF A;  3JUU A;  2OPK A;  5IAT A;  4QB6 A;  1LAJ A;  4OI2 A;  2HWB 3;  3DGT A;  3EMR A;  3DYM A;  2YHJ A;  2R0H A;  4AQT A;  2PAM A;  3BU0 A;  1PNF A;  3P5B A;  5CNA A;  2OQ6 A;  1A8M A;  4NO4 A;  3J7L A;  4Q4Y 1;  4XAE A;  4JGY C;  1S4C A;  3PUR A;  3LWC A;  1AX2 A;  5A7P A;  1JTZ X;  1QJX 3;  1IQA A;  3THC A;  1ZZ7 A;  2UWA A;  1R08 3;  1VBB 1;  2XJV A;  2ES3 A;  3ZFF B;  2ZGR A;  2E6V A;  5FP4 A;  3D0J A;  2PXJ A;  2WN3 A;  1HRV 3;  2WS9 2;  2EAK A;  1RIN A;  2P6H A;  4GWJ A;  3U07 A;  1PHM A;  4EN9 B;  3WP5 A;  2DVG A;  2W2I A;  2F4L A;  2JIJ A;  1H8T A;  4HLT A;  5BUV A;  5FUN A;  5AC9 2;  4LO6 B;  2BW8 A;  1VAL A;  2VXR A;  3DXT A;  4IV3 B;  4PT6 A;  5EYY A;  4AHZ A;  4HON A;  1REE A;  1CAV B;  5CKM A;  1IG0 A;  1PMH X;  5A32 A;  5CAZ A;  5C7G A;  1J1L A;  5BY5 A;  5F5I A;  3RS6 A;  5DZE A;  5A6Q A;  3UKV A;  1ASJ 1;  2B42 B;  2P5B A;  5FZ0 A;  4OHV A;  5FOJ B;  2Y8K A;  5H9S A;  1SHW B;  2V4A A;  2XVL A;  2TEP A;  3ASI A;  5FY7 A;  3GZE A;  4BDV B;  3ABZ A;  4P9I A;  2PMW B;  2XB6 C;  1H9W A;  4NR1 A;  4X6R B;  3PUH A;  4OI4 A;  1QY4 A;  1BEV 3;  3TNP B;  4ARY A;  3DPR A;  3BKZ A;  1AYM 3;  2D3S A;  2UUR A;  3MIC A;  1GSL A;  3LQC A;  4S2D A;  4GWN A;  4O9E A;  1EUU A;  1UYX A;  3A21 A;  4E2S A;  4NID A;  2K0G A;  4DRV A;  1ODM A;  1PX3 A;  1VRH 1;  3J7H A;  4MXV A;  4WVM A;  3ZKU A;  3GGL A;  1JU4 A;  4NIH A;  4I3G A;  4MG2 A;  3ETQ A;  1RUE 2;  2IVJ A;  4XE9 A;  3ZSK A;  4GMP 0;  4IEX A;  1SBF A;  2GAL A;  3IDE A;  1XNT A;  4BQW A;  3WQB A;  1C4R A;  1PIV 3;  1VRB A;  3ACG A;  3Q8E A;  5T5J A;  4XUO A;  4AFB A;  2VVF A;  2VOT A;  4J1W A;  1HB1 A;  3JD7 3;  5GJ6 A;  5GKA C;  5IK4 A;  1HW5 A;  2VM9 A;  1MS1 A;  1ALY A;  4MGS A;  4J25 A;  3NJX A;  4QWN A;  4BIO A;  1LHN A;  2IXJ A;  1CAX A;  2GC2 A;  4AFA A;  5BNO B;  1OUX A;  1E5R A;  3LA7 A;  3VDD B;  3UES A;  5A3L A;  1UKR A;  2QE3 A;  3PL0 A;  1YQ6 A;  1IKQ A;  1QXJ A;  3C8X A;  1UYP A;  1XE0 A;  2ZML A;  1RUF 1;  3WW1 A;  4NRO A;  2OUH A;  1VPH A;  5BV6 A;  5C70 A;  1ZZ8 A;  1J3Q A;  2I2S A;  4GD4 A;  2GAU A;  4I09 A;  2WFF 2;  1N3O A;  1QQP 2;  4Z82 A;  4AQ6 A;  5FYY A;  1GMM A;  3AC0 A;  4V2W A;  5DAQ A;  3RZM A;  3LEG A;  3NV1 A;  4CCE A;  2MNG A;  4IEU A;  3V0B A;  2Y6F A;  1RUN A;  3N7J A;  3UGF A;  1HRI 1;  3LPF A;  4FP3 A;  5FY4 A;  4OHY A;  4FI9 A;  1DYP A;  2VNG A;  5SV5 A;  3RZK A;  2BGO A;  2ZGT A;  3O0W A;  5HBA A;  2E51 A;  4K1Y A;  4CDU B;  5IVC A;  2LS6 A;  3RQ0 A;  1EV1 2;  2QQN A;  3RZJ A;  5CG9 A;  1SEF A;  3I2G A;  5KC6 A;  2ZPX A;  4PBP A;  5FWE A;  3IZO A;  3RWN A;  1VP6 A;  3ZYR A;  5GZG A;  1HB4 A;  1C3H A;  1W6O A;  1Q8S A;  2VBP A;  2HBU A;  2ZX2 A;  3B94 A;  2EXH A;  3ZXF A;  5M0T A;  3ZXL A;  1NYW A;  4DY5 A;  1A3K A;  1G8W A;  1NXM A;  1W6M B;  2UYA A;  3VKM A;  5JSP A;  2J1T A;  3HQR A;  1ZRD A;  3OGS A;  5FPB A;  3AZW A;  1U12 A;  3IKW A;  1AZD A;  1WA4 A;  2XQX A;  3EQE A;  3VN4 A;  5EWS A;  4IGP A;  3VBF A;  1JUI A;  1KIT A;  1OHF A;  1W9S A;  3SXW A;  1RHI 3;  3K46 A;  4KMQ A;  4ZON A;  5BXX A;  1AHS A;  2ZMN A;  3KV6 A;  1XNA A;  3C7O A;  4XIO A;  5LW9 A;  5IAX A;  1OA4 A;  4LKF A;  1W8W A;  1AXZ A;  1HXS 3;  4BB3 A;  2PHL A;  4P9L A;  1S0J A;  4FFF A;  3WIN E;  2DVA A;  1UU4 A;  2DVB A;  2JDK A;  2ZGQ A;  1ULO A;  1WCU A;  2Y6H A;  1GQG A;  1UY2 A;  5BPX A;  5LCW L;  1AR7 2;  3H3L A;  3KLS A;  3VBO B;  4M0N A;  1PNG A;  4OHW A;  1FV2 A;  2W46 A;  3VD4 A;  1UOG A;  3WR0 A;  5C9A C;  2ZX1 A;  3CJI C;  2X10 A;  4E2Q A;  4ASM B;  2YBS A;  1QJY 1;  2VG9 A;  3ATG A;  4KU8 A;  2R07 2;  3FWE A;  1GU3 A;  5LY2 A;  4P9X A;  4LOS A;  3LGR A;  1RUI 2;  2BV4 A;  3MID A;  4XET A;  2C4X A;  5T50 A;  2OYZ A;  3WQ7 A;  4AEM A;  1V9U 2;  2WS9 1;  3CU7 A;  2OS2 A;  2ARX A;  1COV 3;  4YZ5 A;  5AC9 1;  4YW7 A;  4K3U A;  3POS A;  3MIF A;  1V0A A;  2E7A A;  3ZYB A;  5IVJ A;  1CPM A;  4RFR B;  1CX1 A;  3VD5 A;  2OQ7 A;  4JKL A;  2JE9 A;  2WUH A;  3WF0 A;  1Y9Q A;  2QZ3 A;  1Y9G A;  3TN9 2;  3ZMO A;  1DQ2 A;  3ZSL A;  1DBN A;  1PO2 3;  4HT1 T;  5JPM B;  1EPZ A;  2YGL A;  1BKZ A;  1W2T A;  2VVE A;  3ECQ A;  4LUK A;  4YVW B;  4CDX C;  1AL2 1;  1F5J A;  4FFI A;  3KSC A;  4Q4W 2;  1LGC A;  1MEC 2;  2DVF A;  2NQY A;  3DN7 A;  3OG2 A;  2V4V A;  4LBL A;  4ARX A;  4B7K A;  5A3O A;  3RMY A;  2HLE A;  3VZO A;  2GND A;  4N9I A;  4ES9 A;  1QJZ A;  2BFU S;  3PVN A;  4V1P A;  1HB2 A;  5FMO L;  1SBE A;  4CXX A;  2CY6 A;  3ES4 A;  2DYC A;  1C1L A;  1GV9 A;  2GDF A;  4NII A;  3RVH A;  1NLS A;  1SBD A;  3NAP B;  4OUS A;  1LRH A;  5FZ9 A;  3INA A;  1C8M 2;  4QHB A;  2IVI B;  3DYP A;  4FCA A;  5A3W A;  3RYK A;  4BH9 A;  3POW A;  2XJS A;  2BP6 A;  3PMS A;  3V65 A;  1SG3 A;  3ZN4 A;  4G9S B;  4IV1 A;  4ONU A;  1OF4 A;  4QB2 A;  4D6S A;  5I0T A;  3AMQ A;  5ACA 2;  2VW0 A;  3A23 A;  1W06 A;  3FUQ A;  1SCR A;  5FZ6 A;  3T0A A;  1C1F A;  5CFD C;  1J58 A;  1HJF A;  2RHP A;  5A6Z A;  3C7H A;  3BCW A;  3WNM A;  3WHT A;  4IE6 A;  3ZFE A;  1RVF 2;  2OKX A;  1SLI A;  2ORX A;  4WM8 A;  1DQ5 A;  2JG9 B;  4C90 A;  1UAI A;  4QXC A;  1JZ2 A;  1L7Q A;  2YU2 A;  4HZF A;  1QQP 1;  3HT1 A;  4ZU4 A;  2O8Q A;  4A3Z A;  1OUS A;  1ZNP A;  1KXG A;  1WUV A;  1TG7 A;  4CEW A;  5C71 A;  2VMI A;  1Z7S 2;  2TUN A;  3RI9 A;  2D6L X;  4OQ9 A;  4RQP A;  5I93 A;  1X36 A;  4KU7 A;  4P02 B;  2VZ1 A;  5JXG A;  3JCI A;  1HLC A;  2VQU A;  1MVE A;  1JOJ A;  2XBO 3;  3URF A;  1ND2 A;  3B5L B;  2VZU A;  1Y43 B;  3C7E A;  3UGH A;  1JBC A;  1ND3 C;  1NCQ B;  3D0S A;  4XZP A;  2WYS A;  5DDJ 3;  1EV1 1;  1CZV A;  2EIC A;  1UY4 A;  2ATF A;  2EIB A;  2WLQ A;  5FZA A;  2EAA A;  4R8H A;  4D7Y A;  1CON A;  2AYH A;  2GNB A;  5JOX A;  2DCJ A;  4BQ3 A;  3SLI A;  3AZV A;  2ZKN A;  1V70 A;  1B35 A;  3L2Y A;  3R0R A;  1R09 3;  1X9T A;  3D82 A;  5IW0 A;  1LNS A;  4H2A A;  1OQE A;  1W0P A;  3E6C C;  4E4Z A;  5DAX A;  2VUD A;  1S0G A;  4ATE A;  3JXS A;  1MQT B;  2EIE A;  2VW1 A;  2BGP A;  3ZFG B;  2QKD A;  2HKX A;  3ZFF C;  4GH4 B;  5FPA A;  4AEJ A;  2PHF A;  4XHX A;  3CZJ A;  1LUL A;  4YSF A;  1ZYB A;  4M3C E;  1QJX 2;  2IXC A;  4C0B A;  2CGO A;  3WD5 A;  3O1R A;  1R08 2;  1REF A;  4YW4 A;  1RUJ 2;  1OKO A;  4IV3 C;  1CIY A;  4RGK A;  5K0U A;  1HRV 2;  1ZX5 A;  2JKX A;  3K75 B;  1CD3 G;  2VOW A;  1CAW A;  1H2N A;  2GMM A;  3PU3 A;  2OX0 A;  2Z2S B;  2AUY A;  5A1L A;  2G1M A;  2WNV C;  1BVP 1;  3KCY A;  1AR7 1;  3KZ4 C;  1XBF A;  4IQP A;  3S30 A;  1CAU B;  1GFF 2;  1LGN A;  3VHP A;  4F3J A;  1E5H A;  1JH5 A;  3DCQ A;  5FP3 A;  5JLV A;  4ATF A;  2E9Q A;  4B7E A;  4HN1 A;  1RUC 3;  3CLP A;  4QQP A;  4CU8 A;  1MS0 A;  3C7G A;  4Y20 A;  4LKE A;  2GME A;  4N53 B;  4AVT A;  1RUI 1;  2VL4 A;  2GC0 A;  4M0H A;  3RZG A;  1V9U 1;  1PK6 A;  3DYO A;  3VBS C;  1E57 A;  2YU1 A;  1BEV 2;  3H7J A;  4LK6 A;  5C3R A;  3RFR A;  1AYM 2;  4HPK B;  1RIR A;  2WBK A;  3VBU A;  4QU2 A;  3NJV A;  1W6Q B;  4PDW A;  1Q8O A;  2P37 A;  2DCT A;  3S7E A;  1VMH A;  1ZRF A;  1J84 A;  4LQR A;  4YYO A;  2OVU A;  5A80 A;  1NA1 A;  4AHX A;  3TN9 1;  3EO6 A;  2QQP A;  4Q26 A;  1UNB A;  4M4R A;  5FXV A;  3AB0 A;  1W9Y A;  2ENR A;  3ES1 A;  1A78 A;  2E63 A;  1SLB A;  5FP7 A;  2QQL A;  1JOD A;  4Q4W 1;  1PIV 2;  1VIW B;  2MPF A;  4N90 A;  4EE2 A;  4TZD A;  1MEC 1;  1CVN A;  1OA2 A;  4Q0U A;  1XNC A;  2ET1 A;  3BOD A;  3JD7 2;  4YW6 A;  3VDD C;  2BQP A;  1YFW A;  4DFS A;  2YYO A;  2W92 A;  4Y22 A;  1G9C A;  2MEV 3;  4P9Y A;  3GXU A;  2C26 A;  5FTT C;  4XFI A;  1IOA A;  3EHK A;  1YJK A;  3VBH B;  1C8N A;  3MHZ A;  4OHX A;  4CDQ C;  4EWE A;  5FWJ A;  4XTM A;  1VMF A;  4Y5Z 0;  3UJQ A;  2X05 A;  3I3Q A;  3AX4 A;  1C8M 1;  4CEY A;  1Q3E A;  3FLR A;  1EP0 A;  2B46 X;  2XUM A;  2XOM A;  4WVV A;  5LA9 A;  4I3P A;  2YGM A;  5J09 A;  3RRD A;  2VZO A;  4JAA A;  4FXG B;  4CP0 A;  4XUT A;  1TNR A;  1X8E A;  3OD0 A;  5ACA 1;  1O3R A;  2O0O A;  4Q0S A;  1KS5 A;  1XJA A;  3ACH A;  3WCS A;  2XML A;  2VZP A;  1S0I A;  1J59 A;  3SCH A;  3T2Q A;  1N1Y A;  2A70 A;  4JGY B;  3WV6 A;  1RXG A;  4LJH A;  4PI0 A;  3VZL A;  1WBL A;  5F1R A;  2ID4 A;  5CFC C;  4YW1 A;  4NPR A;  5JI7 A;  1BHG A;  4IEY A;  1YHF A;  3WG2 A;  1K45 A;  1PX4 A;  2D93 A;  2V5D A;  2ZGS A;  5DUX A;  3I3B A;  5I0R A;  4JKM A;  1JU3 A;  2HEV F;  4JVA A;  2W91 A;  1ENR A;  2R06 3;  4Y5T A;  4G4F A;  4GA9 A;  2ILM A;  1AXY A;  2Y34 A;  1W2O A;  3U10 A;  5HCH A;  3AFK A;  5B4X A;  2A75 A;  3MIH A;  3T08 A;  4A6O A;  1X82 A;  1MZF A;  5FZO A;  4IL7 A;  3CIH A;  3I2K A;  2VMF A;  1W9T A;  3VV1 A;  4YVS A;  3KCX A;  3AKQ A;  5FMB A;  1RHI 2;  4MHU A;  5C8C A;  3DUI A;  1SAC A;  2P6C A;  2ZAB A;  5FYT A;  3HPN A;  1HXS 2;  2RG4 A;  4V2V A;  5FY5 A;  3ENR A;  4ZY9 A;  3UKT A;  5J48 A;  4ZKT B;  5JOW A;  4GQ7 A;  4EN7 B;  2BPA 2;  1W05 A;  1LOF A;  2HWB 1;  4QX2 A;  4AF9 A;  1BCX A;  2XKP A;  1NUK A;  3N3H A;  3SMH A;  3MBW A;  1H2K A;  1BXH A;  2W1Q A;  2ZGL A;  2XWB B;  4Q27 A;  4CUG A;  3ORJ A;  4GB3 1;  4COY A;  4ZS3 A;  5C8W A;  2A6V A;  4AVC A;  4AFD A;  4LIT A;  1R08 1;  2LW8 A;  3OB8 A;  1KGY A;  2ZXQ A;  5C3O A;  1HRV 1;  3N9M A;  5KXD A;  1UYZ A;  2ZJC A;  2YUE A;  4RSU A;  3HN3 A;  4COU A;  5LZ6 A;  3U4X A;  2NP0 A;  4PIX A;  1K42 A;  3T2O A;  3WOG A;  1COV 2;  5T55 A;  4NWW A;  4DIN B;  4FBF A;  3T0B A;  1AJK A;  4ASK A;  3VHR A;  3JB4 C;  5HI0 A;  1W90 A;  3WP6 A;  4AHY A;  1H30 A;  1F35 A;  5BNP C;  3LZZ A;  1HQL A;  1S2K A;  4Q8L A;  4MET A;  3VHO A;  4QPG A;  2YC4 A;  1XYO A;  1PO2 2;  1W9F A;  3FHQ A;  2YV8 A;  3O1P A;  1HV0 A;  2PLV 1;  5A3U A;  3IAP A;  5IVE A;  1OA3 A;  3POE A;  1MZ6 A;  1LCL A;  2WNU B;  3AP5 A;  1FAT A;  3BIW E;  1BEV 1;  3T2T A;  4BME A;  1AYM 1;  3RGB A;  1RUD 3;  2W5F A;  3UK9 A;  3WEZ A;  2GNM A;  4B29 A;  4D7S A;  1DGW A;  5A7N A;  4D69 A;  4LHS A;  1MS8 A;  3U78 A;  2XHN A;  3AKT A;  3IDC B;  4AFC A;  1MPX A;  4LBK A;  4AI2 A;  1JYV A;  1JYT A;  2A7A A;  5CIS A;  4OFG A;  3RZL A;  2X5I A;  4YW2 A;  2BBV A;  4CPB A;  4EN6 B;  3VBR C;  1NX9 A;  2JDA A;  5EPA A;  3FBM A;  4BXS V;  3SIT A;  1WME A;  4CU6 A;  3JBG 3;  2RM2 3;  3H0O A;  2GN7 A;  1PIV 1;  5CG8 A;  5FO8 B;  2VUA A;  1BBT 1;  2PYT A;  4BJ0 A;  3JD7 1;  1ULF A;  3CO2 A;  5L73 A;  3AMH A;  1FT9 A;  2JE8 A;  2E33 A;  2W68 A;  4IEZ A;  1LEN A;  3A0N A;  4MH0 E;  2RJ2 A;  2WLP A;  3THD A;  4O61 A;  5L7O A;  3FHI B;  5IUQ A;  4KL1 A;  2E26 A;  4E8D A;  1TNF A;  4Q1R A;  4B4Q A;  3BTX A;  4UFJ A;  2FMD A;  2R7E B;  1W6O B;  4UW5 A;  2E32 A;  3BI3 A;  2JKB A;  5FZ4 A;  1OOP A;  1SLC A;  2HWF 3;  4CCD A;  1CZT A;  2D44 A;  2F17 A;  3V0A B;  1W6P B;  2P17 A;  1CJD A;  2W39 A;  4RL7 A;  3RG0 A;  1OVS A;  1O3Q A;  2A73 B;  3N36 A;  5KHH A;  1GIC A;  1FX5 A;  1DQ6 A;  2ERF A;  4Q2F A;  4UW3 A;  3A22 A;  1YWK A;  2JG8 C;  1KJR A;  4IEV A;  4TN7 A;  3WHU A;  2CGN A;  4N43 C;  4QQ2 A;  5F39 A;  5EJZ B;  5LWB A;  5C9A B;  3AZX A;  5AVA A;  4XUN A;  2XBO 2;  3JZV A;  3PIG A;  4HMZ A;  4IEQ A;  3OUH A;  1SPP B;  3I59 B;  1QHD A;  3H50 A;  4UF0 B;  3EJK A;  4LUM A;  1YI9 A;  2DUQ A;  3OUI A;  5DDJ 2;  2CYF A;  2NLR A;  3S0M A;  2FDK A;  1GLH A;  1GZW A;  3DEC A;  5D21 A;  1PM7 A;  1S2E A;  1S0F A;  4UFL A;  3V64 A;  4MOA A;  3CBN A;  4XJW A;  5L36 A;  3PIJ A;  4PLM A;  1R09 2;  2ADD A;  1WCQ A;  4KG8 A;  5T5L A;  5JMC A;  5FZB A;  3UL2 A;  2G9F A;  3VDA A;  5LA1 A;  3FBY A;  4NE9 A;  3OF1 A;  3AKS A;  2B39 A;  3FL7 A;  3WSO A;  5JVV A;  4AZZ A;  1UU5 A;  1PZ9 A;  4MSV A;  4SLI A;  4D7T A;  4CDW A;  1O4Y A;  3L2H A;  3LAG A;  5A7S A;  3USU B;  4CDX B;  2WO7 A;  4JDN A;  2SBA A;  4M00 A;  2VZS A;  4PQ9 A;  1RHI 1;  2CHH A;  4L99 A;  2PA7 A;  3NVC A;  5FBJ A;  5G04 L;  1CZS A;  3H7Y A;  1Q8P A;  3HEI A;  3BB6 A;  4K21 A;  1HXS 1;  2AZ5 A;  1ONA A;  4NOT A;  5ABJ B;  1QH7 A;  4CE8 A;  3PDQ A;  1PGL 2;  4QGM A;  2PEL A;  4GWM A;  3WCR A;  4CCM A;  1JZ3 A;  5JIA A;  4FAH A;  4I2O A;  3RYR A;  1O59 A;  1X8M A;  1ZZ6 A;  1KDM A;  4OZO A;  1C28 A;  3MUZ 1;  2PAE A;  2EA7 A;  1RUC 2;  4AL9 A;  1MZE A;  1YCI A;  1D2Q A;  4JDO A;  1O4Z A;  2XHK A;  3BU7 A;  5FK7 A;  5E6H A;  2PHR A;  4AOC A;  4AWD A;  4AQ2 A;  5F5A A;  1QJF A;  3S5A A;  1ZBE 3;  1JHN A;  1IS4 A;  4OUL A;  1NAE A;  4K20 A;  2XLA A;  5A6X A;  1RXF A;  4E4H A;  1RVF 3;  1JYX A;  4IGQ A;  1A34 A;  3OGG A;  4W6Y A;  5IHR A;  4QDQ A;  5A33 B;  3M3O A;  4DS0 A;  3M4F A;  1R1A 3;  5CFD B;  5JOY A;  3USS A;  1UX6 A;  5C3S A;  3ZXJ A;  1GBG A;  2VCB A;  1PO1 3;  3M3E A;  3JQX A;  2D5F A;  1UY1 A;  5F7U A;  2ARE A;  3HWJ A;  4LBQ B;  1HN0 A;  4CTE A;  4UBG A;  1YI7 A;  3OYW A;  2VQT A;  2PFW A;  5FYB A;  4BQX A;  5BNN A;  4RHV 3;  2BVB A;  2UY8 A;  5FXX A;  3SHR A;  3WDT A;  4BQ1 A;  4HKW A;  5A7W A;  4FPG A;  3POG A;  3KF3 A;  2WZE A;  3ZFE B;  2XJR A;  1WGP A;  3TWI A;  1ODN A;  4L8Q A;  2XL9 A;  2PHD A;  2MEV 2;  3ZVX A;  5JCT A;  4C8D A;  2YMZ A;  3ZDV A;  5FJK A;  1ND3 B;  5D8A A;  3B3Q E;  3WDX A;  1GOF A;  2W9X A;  3RNS A;  2JDM A;  2XGX A;  1XC6 A;  5DMY A;  2A6Y A;  3ZN6 B;  1I5Z A;  1ND2 B;  1RUG 3;  2BBA A;  4LNV A;  4L0P A;  5L9R A;  5FMD A;  2J1R A;  4DRR A;  2A3W A;  5LAS A;  2D6K A;  3UJO A;  4DB5 A;  1OQ1 A;  1E5S A;  1LES A;  2EXJ A;  2ZX4 A;  4LO5 B;  4JHT A;  4BPZ A;  1DGR N;  1GQH A;  2CAV A;  4AVV A;  2WT0 A;  3CF6 E;  1RUJ 3;  3CZU A;  2W0X A;  5AFB A;  4IE5 A;  4EQV A;  4ERO A;  3ZPO A;  4EV0 A;  4NHL A;  1ENX A;  1W2U A;  2RE9 A;  1QJE A;  2RS5 1;  2RDR A;  5J96 B;  1ST8 A;  4YPJ A;  4AI3 A;  5J1X A;  1D4V B;  2D6O X;  4TWT A;  5JR7 B;  3ZSJ A;  5AFE A;  1ZRC A;  3EBR A;  3AJY A;  5DZG A;  1VBE 3;  5T3N A;  2GH2 A;  2YBP A;  1OLQ A;  1OH3 A;  2JDH A;  3N7M A;  1AR8 3;  5DUU A;  4CP9 B;  2WNV B;  3C7F A;  3N9O A;  4M3C A;  1YIF A;  2HWE 1;  2YC0 A;  2R06 2;  3KV9 A;  2JD9 A;  4XBL A;  3AYC A;  1ZA7 A;  2R32 A;  1Y7B A;  3NNG A;  4XMA A;  3IPV B;  2XBO 1;  4DNY A;  5C5U A;  5IVB A;  3LIH A;  3FFQ A;  3MPB A;  1VE0 A;  1XNB A;  5DDJ 1;  2VBB A;  4AXO A;  4LKD A;  2NN8 A;  1RJ8 A;  3G7D A;  3VBS B;  4B1L A;  1DQ4 A;  4NN0 A;  3ZN5 A;  5JIU A;  3CKH A;  2CL2 A;  1S0C A;  2RDS A;  3I3D A;  3LFI A;  1R09 1;  2VR4 A;  3FUO A;  4IXL A;  3WDU A;  3ZXG A;  3DPR C;  4B4R A;  4CUC A;  5JWP A;  3OY8 A;  3PUQ A;  4QX3 A;  3H1Y A;  1WD3 A;  1JYI A;  1H0B A;  1V6J A;  3O0V A;  4KWL A;  2K2S A;  1PM4 A;  4GKY A;  1D7P M;  4Q4V 3;  2WO2 A;  5FLH A;  3S57 A;  1RC6 A;  3E5X A;  1YNA A;  3AP9 A;  4C1X A;  1RGS A;  2UU8 A;  4CCN A;  4DUX A;  4LK7 A;  3Q8C A;  3NRU A;  1H2M A;  1IG3 A;  2PQQ A;  5FO7 B;  3OBR A;  5FYV A;  2DDU A;  4A7K A;  5FP9 A;  1PGL 1;  2ZEX A;  4RS5 A;  1G86 A;  2YG0 A;  5FOB B;  3TEY A;  4JGZ B;  1B09 A;  4AAP A;  2BU9 A;  2QZ2 A;  2VOV A;  1V6M A;  4KBZ A;  4CDQ B;  1E5I A;  4DPN A;  1FOD 3;  1H4G A;  1GP5 A;  1US2 A;  4FOV A;  1RUC 1;  2WNU C;  4F8A A;  4GAL A;  1SLA A;  4ZZ5 A;  3ME2 A;  2G19 A;  2VCC A;  2Q0A A;  4YZ2 A;  4QPI A;  1XNK A;  3KGL A;  4Y5S A;  3IT8 A;  5C5T A;  2P3J A;  4CVU A;  4QXB A;  1ENS A;  3M3C A;  5B4N A;  2GC1 A;  3CQO A;  1QJU 1;  2HYX A;  1LOE A;  4B1M A;  2YY1 A;  3CL1 A;  4QGN A;  1RUD 2;  2XJP A;  2IWG B;  2X8K A;  1OQD A;  1X50 A;  3OBZ A;  5HXM A;  1ZZB A;  2HWC 3;  4A6S A;  3MFC A;  3HT2 A;  4UWD A;  3U0Z A;  4QKF A;  3T4V A;  4L11 A;  3OSD A;  1QNY A;  2W08 A;  5F3I A;  2EAL A;  3WNK A;  4QXH A;  2CNA A;  4C1W A;  5J37 A;  1QNW A;  3FJS A;  4CCO A;  5CFC B;  5ANN A;  1HQW A;  2CSG A;  1MZ5 A;  1KRI A;  2VUJ A;  4M01 A;  3I2D A;  3C2U A;  5J98 B;  1UPI A;  4BQ2 A;  3BVC A;  3JBG 2;  1NQD A;  1WMX A;  2RM2 2;  3GZA A;  3WQ1 A;  4AGR A;  4PLN A;  2DCK A;  1HX6 A;  4CP1 A;  3AKR A;  3WX5 A;  3KMH A;  3ACL A;  1V6O A;  3K3N A;  4WVZ A;  1HIX A;  3KT7 A;  5FKC A;  4A45 A;  1OLM E;  2D6N A;  1K12 A;  1EAH 1;  2SLI A;  1W2N A;  2UWC A;  3H3U A;  4CXY A;  3POJ A;  2CU5 A;  3ZKY A;  1LED A;  2V5Y A;  3P1I A;  4XQD A;  1S2B A;  4URA A;  3F2Z A;  1N1V A;  3POF A;  3ACF A;  4AVA A;  2H0B A;  4YFZ A;  1OUR A;  2FMY A;  1O3S A;  1R1Z A;  4C91 A;  2WC2 A;  2HWF 2;  4AGG A;  2PQS A;  3EXU A;  4PIZ A;  4Z8B A;  1T6B X;  4A7Y A;  1UY0 A;  1LU1 A;  4JHZ A;  4XDO A;  3VBF C;  3QAC A;  2ET7 A;  1PVC 3;  3PLQ A;  1YQ8 A;  4R52 A;  4QMA A;  2ZGM A;  1KDK A;  5EP9 A;  3IIA A;  5FZC A;  5A70 A;  2DCZ A;  4H7M A;  3ZR5 A;  4HVO A;  3RDI A;  1PGS A;  2AAC A;  2AH2 A;  4XF9 A;  1TME 3;  3SKJ E;  3IDB B;  4FXK B;  3GBW A;  1GQP A;  4W4Z A;  4CP2 A;  3HBZ A;  2Q8E A;  3RWK X;  3FZ3 A;  5HV4 A;  5FZD A;  4Q8K A;  1AR6 2;  3N9Q A;  1KS4 A;  1UZY A;  4XEZ A;  3O7O A;  4QT6 A;  3DKW A;  5LBC A;  4XPV A;  2HBT A;  4QHZ A;  1WBF A;  1OFS A;  2WQZ C;  4HAN A;  2R06 1;  2WFP A;  4XZU G;  4X8N A;  2JIG A;  2D97 A;  1SFP A;  3O0X A;  2R0F A;  1UOJ A;  3EB7 A;  5FFO C;  1P8J A;  1V6N A;  5BNP B;  4MGT A;  3GCW A;  2GSY A;  3LB9 A;  3A0K A;  5JMO A;  5FK8 A;  2XG3 A;  1RTV A;  1W6N B;  2VMG A;  4YW3 A;  1Y4W A;  3LE0 A;  2WWS A;  5A1F A;  1TMF 3;  5ABJ C;  1L3J A;  4WM7 A;  2VD7 A;  1MS4 A;  2VTX J;  5FZ3 A;  1D2S A;  1LOA A;  5I8S A;  5FZ1 A;  3HMY A;  3HBK A;  1QDO A;  1Q43 A;  1WA6 X;  1WKY A;  4KBB A;  1RUE 1;  2VTX A;  2R04 3;  1FPN 3;  1ZBA 3;  1W8N A;  2IC1 A;  1J3R A;  1SZB A;  2L9L A;  3SEE A;  4E4D X;  4Z1V A;  3W5N A;  2DBI A;  5T5O A;  5A3P A;  2WA3 A;  4XAC A;  1W8H A;  3ZYI B;  4MGK E;  2D40 A;  1TZO A;  1J83 A;  3VBR B;  4ZU5 A;  2FDF A;  2NPI A;  3MLJ A;  2YC2 A;  4XQW A;  2RMU 3;  3GZT B;  2IXI A;  5FPX A;  4LBJ A;  5IYY A;  3ITQ A;  4MXW A;  3TEX A;  3WF1 A;  5JZG A;  3O1T A;  4Y1Y A;  1DZR A;  2ZEY A;  3MW2 A;  5FV3 A;  5I0D A;  1UIJ A;  2QQM A;  2W1W A;  3I3M A;  3VKF C;  2Y6G A;  4ITC A;  1ZBE 2;  4CU7 A;  4EWA A;  2FZ1 A;  2D43 A;  4HG6 B;  3AVR A;  2QQU A;  2YXS A;  2ZTN A;  2D5H A;  2D6M A;  4AED A;  4JKK A;  4IV1 C;  3H42 B;  1F4A A;  1C57 A;  2WFF 1;  1R1A 2;  2XR4 A;  1K3I A;  4FFG A;  1AYN 3;  1OPO A;  4AGV A;  3WDV A;  1FV3 A;  4LHL A;  4Q4Y 3;  4OI1 A;  1PO1 2;  4QPW A;  5C4W A;  1RIT A;  4I0W B;  4R4X A;  3WW4 A;  5CBL A;  4Q0Q A;  3ZFE C;  3K51 A;  3OCP A;  4WM8 C;  3QCW A;  3ZYG A;  5C33 A;  2VE1 A;  3JQW A;  2BYV E;  4NHK A;  4RHV 2;  1NY7 2;  2B7Y A;  2JG8 B;  1RUD 1;  2D98 A;  5IK5 A;  4N43 B;  4CEW C;  4Z2W A;  3GNE A;  2H0V A;  4FPK A;  2ZGK A;  3SH4 A;  3AMN A;  4X6Q B;  2ORZ A;  4RQP C;  4CCK A;  4HET A;  3SCG A;  4S2G A;  1UOB A;  4QKB A;  1V6L A;  2P3Y A;  2BWC A;  5FZM A;  4GJZ A;  1ND2 C;  1W2A X;  2DU0 A;  5ISL A;  5IVV A;  2Y6L A;  2G9G A;  5FQ0 A;  2RM2 1;  1YFU A;  5DN2 A;  1XQN A;  2WWJ A;  1V6K A;  1RUG 2;  2WL1 A;  3AYA A;  3WG4 A;  5IFT A;  3AM2 A;  3LPG A;  1B35 C;  3OPW A;  1RMU 3;  2I45 A;  3B7M A;  4QX8 A;  2DUR A;  1CES A;  2H6B A;  2DFC A;  2QUO A;  2CWS A;  3KT4 A;  5KWR A;  2DBN A;  3SH5 A;  5J3U A;  3ZFF A;  1U5Z A;  3OUJ A;  3B9C A;  4P00 B;  1POV 3;  2RR1 2;  3PVB B;  4HSL A;  2ZGU A;  1YXW A;  3WLU A;  3RI8 A;  3MF9 A;  1VB2 A;  3MF6 A;  1VB4 A;  3N9N A;  4B4P A;  1VBE 2;  2VOK A;  1CAV A;  2QQV A;  4FPE A;  1JZ7 A;  2OT7 A;  2Y38 A;  4XYX A;  1QXP A;  1YUD A;  4TLF A;  5K0U C;  1AR8 2;  1IS3 A;  4A7Z A;  4E9K A;  5JAX A;  4R9C A;  4HVR A;  2R07 1;  4GKX A;  5CU1 A;  5JSO A;  1VBA 3;  2W52 A;  3AK0 A;  1GZC A;  2ZZJ A;  4DEV A;  2C5D A;  3O1O A;  3R4U A;  4I02 A;  5GM0 A;  1OF3 A;  4TTG A;  1MS5 A;  1V00 A;  4YGE A;  2VEC A;  1OVP A;  4W6W A;  4L2N A;  3VZN A;  4ZU7 A;  3LOB A;  4Z92 B;  5FRE A;  1UZ0 A;  4UFK A;  3FN9 A;  2JB4 A;  3MIB A;  3TNQ A;  3ZXK A;  1LEC A;  1UN1 A;  1PK6 C;  2OXB A;  5FZ7 A;  5GZE A;  1K5M B;  4OUE A;  2XLF A;  5FY9 A;  4AI9 A;  1WMF A;  4XUP A;  4H14 A;  2VJX A;  4QX1 A;  4Y33 A;  4BK5 A;  3VBU C;  1GNZ A;  4Y1V A;  2DCY A;  1CJP A;  4RR3 B;  4PDW C;  2WT2 A;  1YO8 A;  3S5Q A;  4D0Q A;  4JRL A;  4Q4V 2;  4D8M A;  1LR5 A;  1NA1 C;  1TEI A;  2BTV C;  3E5U A;  3NNL A;  4LIU A;  3WZ1 A;  4HXC A;  4OVE A;  1WW6 A;  3VZJ A;  2WSV A;  3MLL A;  2WA4 A;  2BOI A;  3X29 B;  4GJY A;  1DGR A;  3BN6 A;  5DUW A;  4JGZ C;  1KEX A;  3QBQ A;  1W04 A;  2ZHK A;  2WZP P;  4LUL A;  4FTB A;  2A3Y A;  5BNO A;  4P14 A;  4R9B A;  3VDD A;  4GMP 3;  4BQ5 A;  2J1U A;  4XCA A;  1HKD A;  4RD7 A;  3Q8A A;  3RYP A;  3RZH A;  4FP2 A;  4K40 A;  4N7U A;  4XFC A;  1F31 A;  5BNN B;  3LEM A;  3LKJ A;  4C0H A;  1FOD 2;  1POQ A;  2E53 A;  1GWM A;  2H6C A;  2QQI A;  2I07 B;  1DP0 A;  3BPS A;  3QOP A;  4NIA A;  4Y4R A;  4YGC A;  5A7O A;  5T5P A;  2AEZ A;  1GNH A;  1UXX X;  2BRT A;  2BNO A;  3Q8B A;  1UU6 A;  3KVA A;  3TYJ A;  3HN1 A;  2OZJ A;  1ZBE 1;  2W47 A;  2Y64 A;  4CEY C;  3M7A A;  4YZ4 A;  3K48 A;  2Q1M A;  5KBF A;  4HKO A;  3BOP A;  3LEK A;  4W65 A;  3W20 A;  5FZ8 A;  2WO1 A;  1RVF 1;  4GWI A;  1W8U A;  5JPN B;  2HWC 2;  4CDU A;  2Q4S A;  4CU9 A;  1ULC A;  4HK8 A;  1OLR A;  5GLV A;  1WZX A;  4E8C A;  1R1A 1;  3A4U A;  3SH3 A;  4A41 A;  2Z69 A;  3AJZ A;  1QOS A;  1MS9 A;  2IFW A;  1PMJ X;  3U37 A;  3KHB A;  3VDC A;  1APN A;  1BJQ A;  4KH9 A;  2D3P A;  1PO1 1;  1YJL A;  1Z7S 1;  2BNN A;  2J1E A;  3B93 A;  3OBT A;  3WY6 A;  2FDH A;  4FT8 A;  4LXL A;  1QJY 3;  1AXK A;  2VZR A;  4UT5 A;  3VZK A;  3FLP A;  3GHN A;  3GM8 A;  3UET A;  1YIP A;  1W6M A;  2GP3 A;  4G3Y C;  3PUA A;  2Z42 A;  4RHV 1;  1NY7 1;  4FPY A;  3RZZ A;  1D0H A;  4NHM A;  1H8T B;  4FPC A;  1ZM1 A;  4EN8 B;  3PNA A;  4EWD A;  3N9P A;  2C9A A;  5A32 B;  3UNP A;  4YGB A;  1UZZ A;  5IVF A;  4LO4 B;  4AI1 A;  2RS3 3;  4OUM A;  4DEQ A;  5L19 A;  4MZU A;  2RS1 3;  3CJX A;  4BLI A;  5KXC A;  4IND A;  4XC9 A;  3ALQ A;  5GZC A;  2A3X A;  4PF5 A;  1FYU A;  2KXL A;  4QD2 A;  5JUV A;  3LA3 A;  4XW3 A;  3KM5 A;  1LHW A;  2UY9 A;  3ZYJ B;  4YVS C;  1RUG 1;  2OW4 A;  1PVC 2;  3GBF A;  1AL2 3;  5K4L A;  3VBO A;  4BWO A;  1CQ9 A;  5C8C C;  1M06 G;  2WR9 A;  3DPR B;  2AR6 A;  1GOH A;  2XON A;  1F2N A;  2WZR 3;  3I54 A;  2GMP A;  2GN3 A;  3O1U A;  1QJX 1;  2E7T A;  4PCR A;  3E6B A;  3M2M A;  5FP8 A;  1LOC A;  2NMN A;  1RUJ 1;  5F2S A;  4WVM B;  1LOF C;  2EXK A;  3WT3 A;  1I1E A;  2VZV A;  4ORF A;  1TME 2;  1YYN A;  5H9Q A;  2XJU A;  4DQA A;  2JX9 A;  1H1M A;  2P34 A;  2QVS B;  1VBE 1;  1GOG A;  4AHW A;  3NJZ A;  1OBN A;  5FPZ A;  1L7R A;  1PVX A;  4NAM A;  4BQY A;  4I30 A;  5C6C A;  4S2H A;  5FZG A;  3KV5 A;  4CCL A;  2B45 X;  2V72 A;  2OUJ A;  2X53 S;  1CAX B;  3GF6 A;  4QAW A;  2XJT A;  4LR4 A;  4YVW A;  1JOP A;  1UKG A;  1VJ2 A;  3VD9 A;  1DLL A;  5D2A A;  5IVY A;  3ELN A;  2B9V A;  3J9S A;  2C24 A;  4QPG C;  1TMF 2;  4KWU A;  3VUO A;  2ZHM A;  2HEW F;  3IAQ A;  5JSR A;  1ACC A;  3D8C A;  3PTY A;  2WQ4 A;  4K7J A;  1Y9M A;  3OPT A;  2VTF A;  4P5H A;  5EJ1 B;  1ULE A;  5FYH A;  5FCC A;  2R04 2;  1JZ8 A;  1FPN 2;  1ZBA 2;  4LHN A;  3V0B B;  1W8O A;  2Y6K A;  1I3H A;  3NAP A;  3ZXE A;  1F8V A;  2QQW A;  3KD4 A;  3PTR B;  3ZSE A;  4DUW A;  1H4H A;  5FYM A;  3NO8 A;  3VKN A;  4BE3 A;  4YFW A;  1LGB A;  4Q4V 1;  3O12 A;  4CPB D;  2B8M A;  1F5F A;  1G9A A;  1IS5 A;  5HPO A;  1S0E A;  2RMU 2;  2X5I C;  2XDV A;  3ZXD A;  4LA3 A;  1US3 A;  2OZ6 A;  4OQ8 A;  2J7M A;  1VMJ A;  4CXW A;  1V6I A;  4QX5 A;  1QOT A;  2C1F A;  3LIG A;  2QNK A;  5CZK A;  2Z79 A;  1ZRI A;  3F95 A;  2WRA A;  1AJO A;  4FFH A;  5DAP A;  1EYB A;  1FNY A;  2JG9 A;  4UW4 A;  2AGS A;  1KFX L;  1FOD 1;  2WNO A;  2ZHN A;  4CCJ A;  4LE3 A;  1OLM A;  1AYN 2;  5EZW A;  4XDP A;  4Y3O A;  2Q1Z B;  1GKB A;  4Q4Y 2;  1L7L A;  4R4Z A;  3VBF B;  5FKB A;  1OOP C;  3WQ0 A;  3GYD A;  5FR3 A;  4KNC A;  4MX3 A;  1IS6 A;  2FCV A;  4OYU A;  1VBB 2;  3ST7 A;  5JR2 A;  5SV8 A;  4HK9 A;  1H6X A;  3B01 A;  3R4S A;  2VAU A;  1GZT A;  4BIS A;  1XYN A;  3UKN A;  2JEM A;  1YFX A;  2VUL A;  1C5H A;  4XCB A;  2HWC 1;  1JW6 A;  1FMD 3;  1VBC 3;  2DF7 A;  3NKG A;  2ZA9 A;  1NCQ A;  2VOX A;  1UY3 A;  2WNE A;  5GLZ A;  1AR6 3;  3JU9 A;  3OGV A;  4NWV A;  2K46 A;  2IXH A;  3T1L A;  2Y0I A;  4JRA A;  4LBO A;  3ZIW A;  3O1S A;  2BVV A;  4EN0 A;  1UO9 A;  2RDQ A;  3VL8 A;  2CV6 A;  2LAL A;  1ZZ9 A;  3ZYH A;  3KQR A;  3E6D A;  4AE2 A;  3B00 A;  3M70 A;  5DXD A;  3W9A A;  5FZL A;  4XFA A;  1IQD C;  5EYX A;  1MQT A;  1YRZ A;  2ADE A;  4DY3 A;  3WUC A;  4FAG A;  3ZFG A;  1TVG A;  1WD4 A;  2WAO A;  4GH4 A;  4NHX A;  1EUT A;  5F8P A;  1RMU 2;  1NZI A;  3SKV A;  1SCS A;  3CEW A;  3MV1 1;  4QKD A;  1DDL A;  4YW5 A;  1OT5 A;  1ULD A;  1W03 A;  2R30 A;  4QGL A;  1DYK A;  5DAV A;  5F6K A;  1H8V A;  2XL7 A;  4XVH A;  1UIK A;  4CDW C;  4K6B A;  4DMI A;  2WSU A;  1LEM A;  2W1S A;  2QQO A;  1JZ5 A;  3BTY A;  1PVC 1;  4KGQ A;  3PUS A;  4BK4 A;  1CAU A;  1W99 A;  1X7N A;  4Y4Y A;  4ZXK A;  1JMU B;  4CCC A;  1ZZC A;  1W3V A;  1CIW A;  1JOB A;  2PHX A;  3ACI A;  3J7N A;  3VD3 A;  2ZHL A;  4QPY A;  4MYE A;  1DQ0 A;  3KT1 A;  3MDP A;  4IE0 A;  1VBA 2;  1W8F A;  2XQR A;  4N53 A;  2JEC A;  1QOO A;  3WDY A;  4YZ1 A;  1AVB A;  3VHN A;  4COV A;  3PUI A;  1O5U A;  5EFU A;  4L9B A;  3WNN A;  5I8Y A;  5FUI A;  1TME 1;  1DGL A;  3BAL A;  3QLQ A;  3OGJ A;  1COV 1;  4RN5 A;  5F3E A;  1K5M C;  4HPK A;  2KD7 A;  1JZ6 A;  2AEN A;  3NKT A;  5FLJ A;  2OII A;  1WCK A;  2ZOE B;  4P5Y A;  1W6Q A;  5AVP A;  1W3X A;  4RGA A;  3ON7 A;  3UV9 A;  4RR3 C;  4PF1 A;  3NWK A;  4XIK A;  1NCR A;  1QEX A;  1H1I A;  1O7F A;  2R16 A;  4IV1 B;  4NRQ A;  1W0N A;  1PO2 1;  2QBX A;  4MUV A;  5FMO S;  3WG1 A;  1S0B A;  4F83 A;  4JV4 A;  2DU1 A;  2YPJ A;  5LAT A;  4IET A;  1NXD 1;  1YFY A;  2EVX A;  4HKL A;  2FDJ A;  3SCF A;  1LHO A;  5FMC A;  4LE4 A;  4L92 A;  3LDR A;  4WM8 B;  1TMF 1;  2PN5 A;  1G9D A;  4XFG A;  5EIY B;  1W0O A;  2FZ2 A;  1XRU A;  2TBV A;  4XUQ A;  3UYJ A;  2PTM A;  4I01 A;  4J6G A;  1SFY A;  4CEW B;  5BNN C;  1FPN 1;  1LJ7 A;  1ZBA 1;  3C3V A;  4PHZ A;  3NNJ A;  3VBH A;  2J1A A;  4YNI A;  2XPJ A;  1YLL A;  4RQP B;  5ANQ A;  2DTY A;  1F15 A;  2Q8C A;  4PI2 A;  2IXL A;  1W39 A;  4UBH A;  4KQ7 A;  3AXE A;  3T3Y A;  3ZPY A;  4LO7 A;  5D8A C;  4FPJ A;  3IMM A;  3NW4 A;  1IHM A;  1ULG A;  1PZ8 A;  1KJL A;  5FZK A;  3N7K A;  3KGZ A;  3H8R A;  2ARB A;  4ZXE A;  2RR1 3;  1B35 B;  3I3E A;  5FIX A;  3RSJ A;  4CSW A;  4JGY A;  5A3T A;  2PAK A;  4OMD A;  1RJ7 A;  2ZKL A;  4COZ A;  1RB8 G;  2BUK A;  4IW3 A;  3BTA A;  1DFQ A;  5GLU A;  3TAY A;  3QD6 A;  5CA6 A;  3R6S A;  2QDN A;  2ZGO A;  2ZGP A;  5G05 L;  3U75 A;  4AVS A;  4BYY A;  1AYN 1;  1STM A;  2Q5T A;  3N35 A;  3I2O A;  2W3J A;  1AX0 A;  2WYF A;  4PQQ A;  3DEM A;  4AI0 A;  2XLG A;  4GB3 3;  1HQN A;  1OD5 A;  1QJY 2;  5DQ0 A;  5LBB A;  1H8T C;  3MW3 A;  2VY0 A;  4K8F A;  4U36 A;  5L9B A;  5TSW A;  3E5Q A;  2A71 A;  2WT1 A;  2G9Z A;  3K4A A;  4XJA A;  5K0U B;  1DLC A;  1QIQ A;  4UFI A;  4WBB A;  1ENQ A;  4XUR A;  5LEJ A;  1CAW B;  1VBD 3;  3P3N A;  3FLT A;  5JXJ A;  1WLT A;  2GZW A;  2RJL A;  3IDA A;  3K2O A;  1ULP A;  4JQR A;  1BVV A;  3RJ2 X;  5LA0 A;  2JXA A;  3K77 A;  3J8F 3;  4XQ4 A;  3UT0 A;  3IN9 A;  3DV8 A;  3HD8 B;  2RS3 2;  2FD8 A;  1VAM A;  2RDN A;  3FMG A;  2DUP A;  1CN1 A;  2RS1 2;  3NST A;  4Y20 B;  5CVR A;  1UPS A;  2BER A;  2O8O A;  4XJZ A;  2ZBJ A;  2FDI A;  3S7I A;  2DTW A;  3WUD A;  4XHB A;  2ZS6 B;  1PK6 B;  2PLV 3;  1LOD A;  2HWD 3;  2KM2 A;  1GP4 A;  2XWJ B;  3PVO A;  3WW3 A;  4AQS A;  1AL2 2;  3W58 A;  4FTS A;  2CDP A;  5GLW A;  5LK5 A;  5HXV A;  4F7Z A;  1RUH 3;  2C0Z A;  4Q5O A;  5DAW A;  3VBU B;  1RMU 1;  1VLN A;  2WZR 2;  2ZX0 A;  3LEI A;  4PDW B;  3POY A;  1IGO A;  3MPP G;  1O4T A;  3BGA A;  3I8T A;  3OBA A;  4LEJ A;  4NAO A;  3N4M A;  1RED A;  1NA1 B;  3OEA A;  1POV 1;  3WNL A;  4WZF A;  3AZZ A;  2P3I A;  5KXB A;  3MUY 1;  4QQH A;  2BGC A;  1TQ5 A;  3PME A;  4LPL A;  2NZ9 A;  4FPO B;  3GDB A;  5CAD A;  5FPV A;  3GHM A;  5I8T A;  1A6C A;  1IZ3 A;  3ROU A;  5LY1 A;  5HV0 A;  1BBT 3;  5BNQ A;  2JEN A;  4XAA A;  1Q5O A;  2BZD A;  3MIG A;  3QH7 A;  4ES8 A;  2VGD A;  4JDM A;  3H1W A;  2PHT A;  1VBA 1;  2WDB A;  1WW4 A;  3Q8F A;  4RYD A;  4Y22 B;  4RS5 C;  4R9A A;  5FBZ A;  2B9U A;  1W9W A;  4NUB A;  5DG2 A;  4A2U A;  4ZHN A;  1H9P A;  3LA2 A;  3G6J B;  2WNU A;  2BJS A;  5DPN A;  4RA0 A;  4DXT A;  2TNF A;  4P9G A;  1DF0 A;  5F5C A;  1Q8Q A;  3WW2 A;  4CEY B;  3OTF A;  4XFH A;  2QTW B;  4QPI C;  1JYW A;  3AKP A;  3UGG A;  4LT5 A;  1ZVF A;  4MGQ A;  4U2A A;  4DOU A;  4AI8 A;  4H55 A;  2VC9 A;  3I2F A;  1XU2 A;  4QXK A;  3J4U H;  3H1M A;  2VCM A;  4IER A;  1ZRR A;  2HJI A;  1Q56 A;  3KVB A;  1CX4 A;  3FX3 A;  4O9G A;  1BQP A;  3BOW A;  2V73 A;  1I5P A;  1U5Y A;  1WLD A;  4FPF A;  1IPK A;  1LOB A;  2KA3 A;  4DZG A;  3I2J A;  3HNB M;  5KR7 A;  1D4M 3;  4Y1Z A;  2MEV 1;  3J7M A;  3JB8 A;  1AL0 G;  4OLL A;  1JYN A;  2Y6J A;  1G9F A;  1KD7 A;  2JDN A;  4AVB A;  2YZ4 A;  3FE5 A;  4GMP 1;  2PHU A;  3VKO A;  5DG1 A;  3AP6 A;  4H3W A;  4IE4 A;  5FJH A;  2QQJ A;  1W6P A;  3V0A A;  2IZW A;  4XTP A;  1OI6 A;  2EIG A;  2K9Z A;  4Y26 A;  1LHV A;  4XF3 A;  2J22 A;  1N3P A;  5FZO B;  4BHP A;  3MEP A;  3PU8 A;  5I0S A;  1BLZ A;  2VBD A;  3CMG A;  3IWZ A;  5A3N A;  4OI0 A;  4YVS B;  3LDK A;  1UXZ A;  3M3Q A;  4LBM A;  1UL9 A;  4NPL A;  3ZLI A;  5IT6 A;  3U14 A;  4W8J A;  5C8C B;  5IWF A;  3NV3 A;  2HYK A;  4YRD A;  2YRO A;  5FY1 A;  4PJY A;  3CJI A;  5C9A A;  4UAP A;  4FVV A;  5A7Q A;  1WCS A;  2XXZ A;  1MVQ A;  3P6B A;  4QDS A;  3PHM A;  4IES A;  1SPP A;  3I59 A;  3E97 A;  4LMF A;  4RFT 0;  4UF0 A;  1FMD 2;  1VBC 2;  3CNA A;  1N1T A;  4QX0 A;  1CPN A;  1KQR A;  4JZR A;  1GP6 A;  3NMB A;  2BNM A;  3O14 A;  4A4A A;  1UZV A;  3MIE A;  4XXA A;  1W28 A;  2A6X A;  4HVQ A;  3CHX A;  1SDW A;  4QQO A;  3A7Q A;  4D3W A;  3SC7 X;  5FPL A;  5LRS A;  2B5H A;  4YM0 A;  4DXZ A;  2YFU A;  3H8X A;  2VNV A;  2VMC A;  4QX7 A;  4YAR A;  4URT A;  5T52 A;  1ZRE A;  5FYS A;  3I49 A;  2Q30 A;  2ETE A;  3AP7 A;  3MW4 A;  4XAB A;  1JZ4 A;  1O8P A;  3B9I A;  3USU A;  4CDX A;  1D0G A;  1UCX A;  4QM9 A;  3GCX A;  2RS3 1;  3GZU C;  2FCT A;  2RS1 1;  2UWB A;  4QPG B;  1OKQ A;  5ABJ A;  3AXD A;  3OD4 A;  5FZF A;  4DIQ A;  2R1D A;  2X29 A;  1J3P A;  4FQ4 A;  4HN0 A;  4WM7 C;  1XXN A;  2JDU A;  5F32 A;  2WO3 A;  1AX1 A;  1Q8V A;  4W6X A;  1AR9 3;  1BK0 A;  3BPZ A;  5GLT A;  4BQ4 A;  5FYU A;  2WZR 1;  3R4D B;  2NYY A;  3W5M A;  1K5J A;  4QQL A;  1JS9 A;  2CTV A;  4NRM A;  1WWY A;  4Z07 A;  4ET7 A;  2EF6 A;  2QFE A;  3SNM A;  2X5I B;  4UXA A;  1XE7 A;  4Q4X 3;  3D3A A;  4ZPI A;  2J42 A;  3BIE A;  2Q1F A;  5LBF A;  4XF1 A;  1PGW 2;  5EHD A;  3ILF A;  2FDG A;  4NRP A;  4UYB A;  4TYS A;  5JZG C;  3ZXA C;  4CYD A;  5A33 A;  1GWK A;  2E31 A;  1EPW A;  5CFD A;  1O91 A;  1WW5 A;  1F9K A;  4IEW A;  3R05 A;  4WZC A;  2JDY A;  2Y26 A;  2JWP A;  4HSJ A;  1NE4 A;  5L7O B;  3FHA A;  2DWR A;  3O1V A;  4AED C;  4LBQ A;  3BYW A;  4XF4 A;  1VBB 3;  1N47 A;  5JXH A;  4CA9 A;  2VMD A;  1YQC A; 
#chains in the Genus database with same CATH homology
 1F15 A;  1LAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...