1LAJA

The structure of tomato aspermy virus by x-ray crystallography
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
NIASSSAPSLQHPTFIASKKCRAGYTYTSLDVRPTRTEKDKSFGQRLIIPVPVSEYPKKKVSCVQVRLNPSPKFNSTIWVSLRRLDETTLLTSENVFKLFTDGLAVLIYQHVPTGIQPNNKITFDMSNVGAEIGDMGKYALIVYSKDDVLEADEMVIHIDIEHQRIPSASTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Tomato Aspermy Virus by X-Ray Crystallography
pubmed doi rcsb
molecule tags Virus/rna
molecule keywords 5'-R(*AP*AP*A)-3'
total genus 29
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00760 Cucumo_coat Cucumovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.530 Mainly Beta Sandwich Jelly Rolls Cucumovirus coat protein, subunit A 1lajA00
1F15A 1LAJA
chains in the Genus database with same CATH superfamily
3VBHB 4LKDA 3TEWA 4XUTA 4XE9A 4LO5B 5J1XA 1LNSA 1PZ9A 3NNJA 2W68A 1CZTA 3KCCA 4LIVA 1JOPA 1ZX5A 2VBPA 4BE3A 1XC6A 4NPLA 1GZ9A 2XVLA 2QQOA 1I6XA 4LBQD 3SITA 3WG3A 3VZLA 3ZMNA 1W0PA 1BK0A 1S0CA 1VJ2A 3M3QA 2ZHKA 3H1MA 1GOHA 1I3HA 4FPKA 5GZGA 3ACIA 4FPJA 1F9KA 4N43A 3VZOA 1RL3A 4AVSA 3VGIA 2OXBA 2GNTA 3RMYA 3ST7A 1PGW2 4CCJA 2YC0A 4RS5A 3ALQA 4CDWC 2BGCA 4UXAA 2X05A 2VZUA 3HMYA 3NV1A 3WLUA 2RJKA 5D8AC 3EJKA 2RS31 1RGSA 4FPLA 3WCRA 4FP3A 4TLGA 4BQXA 5CFCA 4HLTA 1AYN3 1SLLA 1OPOA 1W3VA 5FLIA 4OQ9A 3FJSA 4UFJA 2J42A 5FZBA 2RDNA 4EV0A 3VBHC 4C0BA 4YVWB 2JG9A 1AR61 1S0BA 1ASJ1 2BU9A 3DL3A 2PQSA 3SLIA 3I2FA 1W2TA 2VVEA 3MW4A 1PO21 4FXKB 1O4ZA 2OPWA 2NYYA 4QKBA 5IUQA 4JDNA 3VZMA 2E6VA 1LKNA 2F4LA 2WFF2 1SDDB 1UCXA 2HWF1 2P6HA 4HL0A 4QPIB 4FFHA 4LMFA 3MLKA 4XETA 5C5TA 1UZZA 1XNKA 1YI9A 1WCKA 2Q5TA 2DBNA 2VOKA 4A2UA 2PELA 1GKBA 4R8HA 1W8UA 4N8MA 1F5FA 2GMPA 2QQLA 5K9YA 3I4IA 1O8SA 3Q8FA 2ENRA 2XQRA 3DPRA 2VCBA 4PJYA 1VBD2 1W6OA 5FZ6A 3OGJA 4JTOA 5KXCA 1PX4A 2PN5A 4DUWA 1RHI2 1WW6A 3CDZB 2VZVA 2VPVA 3NAPB 4H3WA 1IQDC 4Y5TA 3X29B 4OI2A 4AL9A 3H8UA 2RR11 1CR7A 4X8PA 5TSWA 2VL4A 3ZKUA 5CISA 2W95A 3PNAA 4AI0A 3ZO0B 2DCKA 3OEBA 3FHIB 3D5OA 1FT9A 2JG8A 2OPKA 2VMIA 3KV4A 1R1ZA 2A6YA 1F8VA 3I2JA 3ILRA 1WUVA 2OZ6A 2VZQA 3RDIA 2IXLA 5FYZA 2ZMKA 4KQ7A 5JOWA 1SPPA 3HT2A 1AJKA 3POIA 4CYDA 2R073 3RYPA 3LSDA 4GMP1 1YQ5A 1N3PA 2EALA 1A6CA 3AXDA 4ARXA 3VV1A 3O7OA 4XEZA 2D5HA 4CTEA 1EAH1 1ODNA 1W04A 2GNDA 3AVSA 3O14A 1GANA 4K6BA 3VKNA 3ZXAC 4C1XA 4CDXB 5JZGC 5FKBA 3QH6A 5LY2A 4OCTA 2C0ZA 1DZQA 4NO4A 3AFKA 1W39A 3QACA 3T0AA 5IFTA 2TNFA 3GZAA 4ARYA 5C3OA 4K20A 4XABA 2HWD2 1TEIA 1S1AA 1WW5A 3K46A 3CJXA 1US2A 4QPGC 3WHTA 1E5HA 1E5RA 4AI3A 3O1RA 1CAWB 2A70A 4I3GA 5A33A 4CDXC 2KA3A 1LEDA 1Q43A 1E5SA 2C9KA 2O1QA 2IVIB 5FLJA 4YW2A 3L2YA 3FX3A 4GB33 1X33A 3T30A 1K42A 5BPXA 1OH3A 2QUOA 4MGZE 1H8TA 5EJZB 4XW3A 1ZBA1 3H9AA 3C2UA 3INAA 4CDUB 1DQ2A 1FPN2 3CZJA 4CUGA 2HWC1 4XCAA 4B4PA 3EXUA 4JQTA 2EAAA 1O6UA 1ULFA 1URXA 1YQ2A 4QU2A 3U07A 3VBOA 4GB32 1FOD2 1OH4A 1X8MA 3FBMA 4RD7A 4YRDA 1RMU2 1OOPB 1L7RA 2D40A 3C7OA 5BNPC 5EIYB 3FN9A 2VD7A 3UGHA 4COUA 4F3JA 1DF0A 5C3QA 1IS3A 4LQRA 3KV5A 5CIRA 2QCSB 2ARBA 3LE0A 3VZJA 3WP5A 2HWD3 4A7YA 4XPVA 5CEHA 2W91A 2RE9A 1JBCA 4LBLA 4QWNA 2Q0AA 1NZCA 2HH9A 2E9QA 2PLV3 2XB6C 2A75A 3LFIA 3M3CA 2HWE2 1J59A 1GUIA 3L9JT 3O1OA 3SHRA 5CKNA 1V70A 4D6QA 3JU9A 4XDPA 1R081 1E57A 3ZIXA 2FMYA 1CJPA 1UYYA 4CDQB 5GZEA 1FPN3 1DQ1A 5A3NA 4D94A 2P1BA 1CAVA 3OGRA 2HLEA 4IEYA 2UY8A 5F2SA 1Y3TA 4LBMA 3V0BB 1QJX3 3RI9A 4DUVA 5H9QA 1JUHA 1WMXA 4QPIA 4ONUA 3WP3A 1QKQA 3B69A 2I74A 5GM0A 5LBBA 2PAKA 2WJSA 4DB5A 5A3PA 4IEOA 1HN1A 4N43B 1MQTA 1UY1A 3WP4A 3VD3A 5F39A 5KHHA 5LWBA 2PHDA 4YM3A 2VAUA 4AEDA 4KL1A 4RS5B 1NOVA 2WZR1 4WVMA 3SEPA 5K0UC 1MS9A 1IPSA 4A6SA 2ZGNA 3C7HA 3MPBA 2V5YA 3WUCA 5IVVA 5SV5A 3THDA 5JXJA 1FMD1 2JB8A 2DVBA 4XUPA 2YGLA 5C6CA 4K3UA 5FPBA 4FBFA 1C28A 1F4AA 4V2VA 1SMVA 4FCAA 3WR0A 2WLPA 1NYWA 2A6ZA 1WA6X 1KFUL 2BGPA 2IFWA 5T5PA 2Z79A 3VDDA 2W92A 4FTSA 3JQWA 2JG8B 1QJY1 1NZIA 1W9TA 2X5IB 5EYXA 5JVVA 3QLQA 1YEWA 3ENRA 4NUBA 5FY7A 2YPDA 2DDUA 5HV0A 1SPPB 4YVSC 5A3LA 1QJU2 1RB8G 3RZKA 4OLLA 1DYPA 5EJ3A 4B1MA 1G86A 2ATFA 4IGQA 1UIKA 3GXUA 3W59A 2AYHA 4ATFA 1JZ8A 3BTXA 4YW7A 1AR82 1HXS3 3ACHA 1UO9A 3I2KA 3B7MA 3DN7A 4Q4X2 1H30A 1V9U3 2GMMA 1PIV3 3RZJA 2VY0A 1GNHA 3BIWE 3H1WA 4MXVA 5D8AB 5DG2A 1H1AA 3IAQA 1NCQC 2SLIA 1PMHX 2XWBB 2GN7A 4RHV1 1Q8OA 1EUTA 1X9TA 1TNFA 2NP0A 1LENA 1RUF2 1QWRA 1HV1A 3RSJA 2BYVE 2HWC2 4P14A 2VOWA 3V65A 4D6SA 1ZBA2 1JYVA 3NV3A 1V6OA 3ES1A 1HQWA 2IXKA 3WY6A 4E8DA 2QQVA 4R9BA 2HJIA 2XBO2 4Q27A 3VL9A 2ZMNA 3ACGA 3MICA 3U37A 2YBKA 4KWJA 4AFCA 1LOGA 2E7AA 1YJKA 2F4PA 4E2GA 4DZGA 5JSRA 3WSOA 3VDBA 1LODA 1XYNA 4I0AA 4BQYA 4Q4X3 1M4WA 4Y24A 5BNOA 1O91A 2HBUA 3PJYA 2DURA 2IC1A 1CQ9A 2YU2A 2DYCA 4AEKA 3VBUC 2OUHA 3WF3A 2XH6A 3KT7A 3UJOA 1UD1A 5FZHA 4CCEA 2ZX1A 2GH2A 1SLIA 3RMXA 3AKPA 1S0IA 2ZX3A 3M2MA 3O0XA 2QQUA 5I0SA 5C9AB 1C57A 3N7JA 3S5QA 2PHXA 2QJVA 2VVFA 3PMEA 1VBD3 3EYPA 2W94A 3OBTA 4HVRA 1QXJA 3VHOA 3A23A 2RS53 5F7UA 3NSTA 1JU4A 2BBAA 4LA3A 5A7NA 2OUJA 4P9GA 1XE8A 1UPIA 2RS11 4UFMA 4KWUA 3RS6A 1K3IA 1TVGA 1LAJA 2CWMA 3WW4A 1DDLA 1JYNA 1CIYA 1QQP2 4QXHA 1W6QB 4Q29A 5CG8A 3VDAA 1JH5A 4D0QA 3ZFEA 2ZGSA 1CAVB 3CIHA 3WZ1A 1UU6A 4EE2A 5T55A 1HDKA 3UGFA 3DUIA 1LOFC 4BXSV 1IPKA 1DFQA 3AC0A 4UAPA 1LJ7A 1ZBE2 4JRAA 4NHMA 4P9IA 1ND3A 2EICA 2OW4A 1ULEA 4J25A 2OQ7A 1H4GA 2O14A 3RVHA 3H42B 3AZYA 3NNFA 3AKQA 3VBUB 1G9AA 2Y8KA 1SG3A 3U78A 4AI1A 2CAVA 2VO5A 1AX1A 1GV9A 1CJDA 2G4IA 4M4PA 1S2EA 4PDWC 3IPVA 3FMGA 3THTA 1YUDA 1LEMA 3BALA 2RVAA 3N36A 2DFBA 2E33A 1UMHA 4TSVA 2W9XA 5LY1A 3BU0A 3ECQA 2E51A 5IK7A 1JW6A 1MR5A 5D2AA 3T2PA 3PVOA 5IVEA 5IK8A 3O1MA 4E2SA 1PO22 1O3TA 1ND2A 4FPYA 4A44A 5FV3A 3AMPA 3VDDB 2X29A 3FL7A 3MV11 3NJXA 1W8OA 3QD6A 4OZXA 5DAPA 3N7KA 3WQ7A 2IWGB 3VUOA 2D6NA 2DBIA 2FBEA 1UU5A 3NO8A 1YC61 2PAMA 1RUD2 3PURA 5F3GA 2XKPA 1K12A 1RUG1 1VIWB 2UURA 2WDBA 3WHUA 1F2NA 4COVA 3WNKA 5AC92 1SBFA 2XG3A 5DMYA 3ACLA 4Q4W2 2MNGA 3U14A 3KVAA 2GC3A 2R061 2GALA 2UWAA 3G6JB 1RUD3 2E31A 3HN1A 4OUEA 4QX0A 5B2GB 5D8AA 4P00B 3T0DA 4N9IA 2FHRA 3H0OA 3BB6A 1BJQA 1JUIA 4BMEA 3H3UA 3IT8A 4LHKA 3TB0A 4I09A 5A7QA 1RUI1 4ES8A 3AMQA 2JD4A 4QXCA 5FZ8A 1HW5A 2WR9A 2QVSB 2YZ4A 1QOTA 4BJ0A 2W08A 3N3HA 4OHWA 3AL5A 4U36A 1UY0A 4YG0A 3U1XA 1AL22 3LB9A 2A6WA 1MS8A 3MIFA 3NW4A 4XFBA 3ZOIA 4IV1A 2RDQA 5IW0A 3T0BA 1OLQA 3ZFFA 1VBB1 4CXYA 3ZR6A 5GLZA 2WNUC 4BOWA 5FJKA 4DINB 5I0DA 4WM7C 3AYDA 4GQ7A 1VAKA 3LAGA 4NIDA 3NVCA 4JHTA 1VBC1 4AVVA 5LK5A 4N53B 4CCCA 2DTWA 3AJZA 1CN1A 1ZNPA 1ZRCA 3WD5A 1U5ZA 5KXBA 1NG0A 3VKFC 5A3MA 1O3SA 1AR72 3DYOA 1GBGA 4FI9A 5JOYA 4CEYB 2VZSA 2K0GA 2YUEA 4NJ4A 4Z07A 2XPJA 3J7LA 3LOBA 3D3AA 4RR3A 2WRAA 4KGQA 5IFPA 2EVXA 2NMNA 4TLFA 1UXZA 5KC6A 3SISA 3Q8AA 1S2BA 3VHPA 3MZHA 1UF2C 4OMCA 5FOJB 5FZEA 3MIDA 1JZ4A 5HCAA 2AR6A 3WV6A 3VHRA 4HK8A 1IG3A 4IETA 4P08A 2R1BA 2YG0A 1UY4A 2NPIA 2XLAA 3ZXGA 5FYTA 4H55A 4TTGA 1OKQA 5FREA 1GWMA 3ZXDA 1PIV2 1QXPA 4XMIA 5FXZA 4LO8A 4NWWA 4XIKA 1O7FA 1LESA 2OVUA 2XHNA 4HZFA 5A7WA 3SXWA 4CP2A 4IL7A 3VD5A 5LBFA 4EZHA 3BTAA 4S2DA 4GA9A 1SLAA 4IGOA 2BZDA 4MH0E 4URAA 1YI7A 5JWPA 5E1RA 3H7YA 2WA3A 2Y34A 3T08A 5FZ0A 5C7GA 1ND3B 2YGMA 3VBSA 2ZZQA 1ZZ8A 3FWEA 4WVWA 4XFFA 2ZHNA 1RUJ1 2WFF3 3FLTA 2VOTA 2XJQA 4WBBA 1DGWX 4FT8A 1KGYA 1QH6A 2VM9A 3GF6A 3TN93 4CUBA 3LOIA 2GZWA 3AJYA 4QX5A 4XTPA 3QBQA 1LECA 2XGXA 3N9QA 4IV1C 2J1RA 4ZU4A 4ZHNA 1UZYA 4ZY9A 2E32A 2GP5A 1BVVA 1NY71 1PM4A 2BWAA 3VBRC 1XPWA 3R4UA 3DCQA 2MEV2 3OPZA 3JBG3 3AYCA 4MZUA 3RPQA 3N4MA 4QXBA 2GNMA 2VMDA 3M1HA 1NE4A 1NX9A 4XF9A 4XBLA 3WDUA 2O8QA 4PT6A 1IKPA 2W87A 4NIAA 2X8KA 3KCYA 3RZHA 4JTNA 4K1YA 4O65A 5J48A 3AP5A 1C5IA 1VALA 1TME1 3ZXEA 1Q8PA 4ATEA 2QFEA 4S2FA 2VMFA 4OI4A 3O1PA 3OOXA 2AEZA 1H1MA 1CWPA 5HBAA 1AL21 1EUUA 2VZOA 4IE5A 4BK5A 1CX1A 4WM8A 4S2HA 2XLGA 1WW7A 1QIQA 2ET7A 3B9IA 3VBUA 4AHWA 5E6HA 5EWSA 1W6PA 4CA9A 1Q5OA 4UF0B 1RITA 2NZ9A 5BNOC 3PUSA 2WZEA 3BPZA 1MZFA 1OD5A 2VW2A 3LFMA 4QQLA 3CHXA 5C8CC 3BI3A 4JCKA 4BH9A 3BVCA 3J7HA 2VG9A 4Y1XA 2PMWB 1VB2A 2R062 3ZXKA 1BBT2 3RZMA 4YM1A 5FJHA 4P9YA 3I2GA 2ZA9A 4Q4W1 2BOIA 4AVTA 2WBKA 3GBGA 4QKFA 3GZTB 1VLNA 1IHMA 4JKMA 3IZOA 3GM8A 3MW3A 1STMA 1ENQA 5I8TA 1LHOA 1WD3A 1ZM1A 1RUD1 1W2OA 4JX0A 1NY72 1OF3A 4IEWA 4C1WA 5D21A 1NXD1 5CKQA 1O4YA 2WA4A 2NQYA 3AZVA 2ZGTA 1H9WA 2J22A 1RUE2 2I45A 4E4DX 2Q1ZB 5CADA 1V9U1 5LB6A 3OGSA 1RUJ2 5F3CA 4BQ5A 4ES9A 3OPTA 3W20A 3W9AA 2ZMLA 2ZTNA 2Y6KA 4CEYA 3C7GA 1QH7A 1PX3A 1H6YA 3CU7A 4K1ZA 4QMAA 3OB8A 2OKXA 4B29A 2ARXA 3M3IA 5AFBA 1AYN1 1L7LA 4YVSA 3O1SA 1FAYA 2ORZA 3ZSKA 1UPSA 3P5BA 4Y1YA 4P02B 1PK6A 4J1XA 5FY8A 3SH4A 4LBJA 4GJYA 4FOWA 4MGTA 1BVP1 1LGNA 5E8AA 2Y26A 2YDEA 3JD72 2BV4A 3ZDSA 1OLRA 3T2QA 3ZSLA 3N7MA 4I2OA 4JGYA 4CSWA 4BXFA 4LOTA 2W3JA 3HN3A 4L8QA 3OUHA 3JD71 1H8TB 4JC1A 3KVBA 1RUE3 5FP3A 1YIFA 3I7DA 1VE0A 3MFCA 3WT3A 2DVAA 2WWJA 1QQP1 1WCQA 5IAXA 3G7DA 1IG0A 3E6BA 4IEXA 5ANNA 4IV3C 4AEDC 3GHMA 1UY3A 5C8CB 1PNFA 4BQ2A 1FX5A 4XQWA 1AL23 1HQLA 2CNAA 3IDEA 4JHZA 2WSVA 3HIFA 2IXHA 4KBZA 4YYOA 2CDOA 1ULPA 5A6QA 4TYSA 3WQ0A 4PQQA 1XSQA 4HVOA 4CCKA 1VBC2 4MX3A 3ZN5A 1WCUA 1RUE1 5EFUA 4SBVA 5FZGA 3WG4A 1MS4A 1XU2A 5L7OA 1CAUA 3HBKA 2G9FA 4KWKA 3P1IA 1A34A 2W5FA 4AEJA 1WLWA 2VQAA 2D7FA 2XJSA 1JZ5A 2XJPA 1I9RA 5FBJA 5AVPA 3A4UA 4GIQA 2H6BA 1LOEA 4N90A 3OBZA 4GKYA 2D6MA 1WZXA 4N9HA 4YGCA 4XFGA 5A7WB 1SFNA 3ZXJA 1LRHA 2G9ZA 2KR2A 2PLV1 3UL2A 4B4RA 5GLWA 1CD3G 3LA3A 3MF9A 2HEYF 5L36A 1AR83 1GQGA 4XUNA 4AFMA 2CV6A 1I5ZA 1DLCA 3O1VA 1AF9A 4ASMB 1LHNA 2E7QA 2Y64A 4QQHA 2Q4SA 3MIHA 3WNMA 4Z2WA 2XJUA 2ZGKA 1WKYA 1UZVA 1JHNA 2VCCA 1W03A 3BGAA 4NHXA 3R6SA 2ZGQA 3V56A 1GWLA 1RUF3 4V1PA 4E4ZA 2Y0OA 1SQ4A 3TN92 4LT5A 2VXJA 3CJIA 4Y5SA 1RUF1 1W6PB 4UW6A 1H2KA 4GZ9A 2JECA 1GQHA 1OBNA 3VDDC 3M70A 1DG6A 3D0JA 5T5JA 5H9RA 4A41A 1JZ3A 1H8TC 1YQCA 5FZ1A 3KD4A 2WNEA 2WT0A 1HRI2 1NQJA 3RFRA 4GWMA 4H2AA 3WF1A 1OF4A 2W52A 1AR81 3N9PA 3TEZA 4UBHA 3LPGA 1SBEA 2VMHA 4Q8LA 4O9EA 3J8F3 5I0UA 4XJUA 2BNMA 2VW0A 4E8CA 1QJU1 2JDMA 2P5BA 4IE6A 4ZZ8A 2DUQA 2D44A 3QH7A 2BRTA 5C8WA 3JQXA 3A0KA 1BHGA 3AFGA 2ZXQA 4XF1A 4NMIA 4R9DA 1MQTC 3TWIA 4AVCA 4XJ9A 4LK7A 1FNYA 1KITA 4WM8B 2JDHA 2V4AA 1BQPA 1TMF1 3IDCB 4IGPA 3F95A 3MF6A 1Q3EA 5B4NA 2BW8A 4E4SA 4UW3A 1YXWA 4A6OA 4CEYC 4YW4A 2VTFA 4EWEA 1UIJA 5FRAA 1RUC3 5FZCA 1PVC3 3K77A 5IK5A 3BTZA 3NJYA 5F5IA 3ZLIA 5J3UA 1J3PA 4UFKA 2K2SA 2UWBA 4Q0UA 1Y7BA 1IS4A 1JHJA 4RA0A 3T4HB 3I2DA 3SCHA 4F8AA 2JG8C 1Y4WA 5L19A 4XFCA 1X36A 1R1A3 5C3PA 2OIIA 3POEA 4Y1VA 4AQSA 1X50A 4LEJA 1GP4A 4A7ZA 4EJRA 5JR2A 2WL1A 3BTYA 2JDZA 3ES4A 1NXMA 4GJZA 5IWFA 4W6XA 4EN8B 3BODA 2VBDA 1Y9MA 3C3VA 3LKJA 2Q8CA 3EHKA 5J09A 2HWE3 4CPBA 1WCSA 2GNBA 1LULA 4F7ZA 2D5FA 1G6NA 4QX2A 2V72A 1XE7A 4YFWA 3B9CA 1QNYA 3PUAA 1SACA 3WF0A 5C8CA 2Q30A 4FOYA 4MGIE 2ZGMA 3POWA 1SFPA 1XJAA 3O1TA 3M3OA 4FPFA 3TEXA 4BQ4A 3ZM8A 5C9AA 5IHRA 5IYYA 2K46A 2DCYA 4QD2A 5LRRA 5FUIA 4FPCA 4AAXA 3IIIA 4IXLA 4SLIA 2E53A 1AYM3 1N47A 1ASJ3 4CU6A 2AZ5A 1CAUB 2DWRA 3OD4A 1IZ3A 1W8HA 2XUEA 1K5MB 4PI2A 1V6JA 4B7KA 4M3CE 4WZFA 2WNVA 1W8ZA 5FZMA 3ZVXA 3EMRA 3IKWA 3E5XA 5DN2A 5CFCC 1AX0A 2Q1MA 5CB7A 1O5LA 4IEQA 1DBNA 3OBRA 5JCTA 2R1DA 2ZBJA 5FYMA 5JIAA 5D1IA 3MFAA 2BFUL 4CDWA 3E6DA 5FBZA 1W2AX 1QF3A 1OA4A 2BNNA 1VMHA 4Y26A 3S5AA 5I93A 4CU7A 4BQWA 3E5QA 5IT6A 1N1VA 2JDPA 3THPA 5JZGA 4CVUA 1NCRB 1LOAA 1SBDA 3RZLA 5M0TA 1W6MB 4LHSA 1APNA 5F1RA 3ZXLA 3CJIC 2YB7A 1GOGA 1XQNA 5DZEA 3IBMA 4NWVA 2GN3A 4A3XA 3ZYRA 5E88A 1SZBA 5BNNC 5AC91 4KMQA 2RG4A 5LA0A 5FOBB 4K9SA 3NJVA 3N9NA 3ON7A 5L7OB 1J84A 5ERLA 4AHYA 3IPVB 4LA2A 3SNMA 1AZDA 5FZOA 4CCMA 2ZEYA 4FFGA 4N7IA 5F8PA 1VRBA 4UOJA 1AXYA 2MPFA 4IUGA 1ZZ9A 3OG2A 2PYTA 3OYWA 1ND2B 3JD73 1EAH2 4Q0QA 5K8SA 2PHLA 4KI5M 4AQTA 4CEWA 2QQJA 4D6RA 3MLJA 5JI9A 1MVQA 4W6YA 4BMBA 3ZSJA 4HG6B 4AFBA 4BIOA 1F31A 4EQVA 1X7NA 3JB8A 4DXSA 3NRUA 3WQ1A 4QX7A 3LGRA 4YG3A 3NJZA 3ZYIB 3ZYBA 4QGMA 2CGOA 4CCDA 1OT5A 3AKTA 1D4M2 1YO8A 2IXCA 3LDRA 4QPYA 4YVWC 1OQDA 3CJIB 2R042 1H4HA 3CL1A 3ZSMA 2F6BA 1GOFA 4PIXA 5I8YA 1JI6A 1LGCA 1RHI1 3TRSB 1W6OB 2BDRA 5A6YA 5FP8A 3WVJA 4B7EA 3NAPA 2XL9A 1D4M3 1ULGA 1F5JA 4I30A 1L3JA 1TMF2 2MHFA 1XSRA 3TNQA 5FMOS 2DF7A 5DAVA 2ZX2A 3O1UA 1KRIA 1ZBA3 1DQ4A 2R7EB 3TOJA 2BNOA 4W50A 4JKLA 1S4CA 4IV1B 3ZKYA 2HYKA 2BOJA 3N35A 4RS5C 4D7SA 2B4KA 4HSJA 1T2XA 3WDVA 1LB2A 3CEWA 3I8TA 2CTVA 4JAAA 4UFLA 3D8CA 4YM0A 2JIJA 5FY9A 2O8OA 2B46X 2HWE1 2X10A 3PDQA 5BXXA 1ST8A 4MXWA 3AK0A 4Z1VA 4FFIA 2P3YA 4R4ZA 3UKNA 4E9KA 2JIGA 1C1LA 2ZEWA 4IE0A 3RI8A 3N9MA 3BOPA 3R0RA 2VOVA 2WO1A 1JZ7A 2A1XA 3SKVA 4AFAA 1NLSA 5DUUA 4OFGA 2GC0A 3FUQA 3B3QE 2B7YA 2PTMA 3HNYM 4Q0SA 1FOD1 2ETEA 3DGTA 5LZ6A 1ZA4A 4MGSA 1IS5A 4AWDA 1RXFA 3MLLA 1AR63 2PHWA 2VE1A 4LOSA 4BCUA 3VD4A 2GMEA 4MGYE 3QCWA 5E89A 2ZJCA 1J1TA 2PHTA 1C4RA 2B39A 5JUVA 2CDPA 4HKLA 5DG1A 4QHZA 2WNUB 3CZUA 5EJ1B 3VD9A 1BXHA 1V6LA 2WKKA 2RJ2A 3TNPB 5FO7B 4I3PA 5K4LA 1H2NA 3FUOA 3APBA 1QQP3 1YNAA 2A73B 2FCUA 1BZWA 4RFT0 1X8EA 2P4EA 4L92A 4Q0PA 4AI2A 4CDWB 1Q8SA 3V0AB 1XOYA 3POBA 3ZMOA 1UXXX 2G19A 2HWB3 5FZAA 2X5IC 1H1IA 2YYOA 4RHV2 4BU2A 2DVFA 3AZZA 1G9FA 4B1LA 4FAGA 5JZGB 1NCRC 4PLNA 5FUPA 4OHZA 3VBSB 1DGWA 4TZDA 3LIGA 4AEMA 4Q4X1 4META 4QB2A 1OKOA 4WM8C 4NHKA 5A3UA 2WAAA 3PIGA 1HQNA 5LW9A 2JDKA 3HEIA 4XTMA 1WLDA 4W8JA 4EN9B 3GBWA 1ND3C 4QXKA 1YFUA 5FZOB 5FR3A 2ORXA 3FFQA 5EQUA 2WQ4A 3Q8BA 4MSVA 1KJRA 2IXIA 2D98A 4C90A 4YSFA 3K48A 3P3NA 5C5UA 2J7MA 1WLTA 2ARCA 3WDXA 3E6CC 1GQPA 2ILMA 3ZFEC 1MZ5A 3IB3A 5F5AA 4BDVB 4EWAA 1V6NA 1AJOA 4XBQA 5C4WB 2Q8EA 3MUY1 2VUJA 3K51A 1LOCA 3LQCA 2EA7A 1HX6A 2BFUS 2QTWB 3GCXA 4LUMA 2WO3A 3AKSA 5T5OA 1C8M1 1REDA 1W0NA 4L11A 1MZEA 3MGUA 5JMOA 3FLRA 5BYNA 5EPAA 1ENSA 2ZGUA 4PQ9A 5JXHA 3MYXA 4OVEA 5JDBA 2AREA 4RQPA 5LA9A 4WVMB 3RJRA 2V4VA 4EZ4A 4DY5A 1LR5A 1YQ6A 1IQAA 4QU1A 4UF0A 5I0RA 5ACA2 1BMV1 4FOVA 2HWF2 1UYZA 4XVHA 3ZXFA 3NAPC 4YZ5A 3PTRB 1ZYBA 4GWIA 4DXZA 2WQZC 3SEEA 2HBTA 3SCFA 2DFCA 1SLCA 3BU7A 1W8WA 3U11A 1R093 3EQEA 5AC93 2X5IA 2WO2A 4UW5A 1R082 3ASIA 2W39A 1TNRA 5FFOC 1D7PM 1N3OA 5DZGA 3HVDA 4LO6B 1EPZA 1U5YA 2EXKA 2XUMA 4HANA 4HKOA 2TEPA 2VZPA 3VKLA 1P8JA 2WN3A 1QGLA 4D7YA 4XQ4A 1JODA 1JYCA 3ILNA 1TQ5A 3OPWA 1DLLA 3I3EA 3NNMA 1UOFA 5IVYA 2ADEA 2W0XA 1C3HA 3BUCA 3BKZA 4BLJA 1WMEA 4CEWC 5FYHA 2BQPA 1J3RA 1HV0A 2FD8A 4FQ4A 3M8LA 3D4KA 1I5PA 1DZRA 4MO3M 3K3OA 3A22A 4QHBA 4YVSB 1RC6A 4AHZA 3FC0A 2Y38A 2JD9A 5FKCA 1TMF3 2QBXA 1QJEA 1PK6B 1GZCA 2ZABA 3Q9OA 4YLZA 3TN91 1XB9A 4BQ3A 2XWJB 3MO4A 3H8XA 1ULDA 1V6MA 3OCPA 5HXVA 3H1YA 4O7XA 4QPWA 4DEVA 1OVPA 4DRVA 2WIIB 2WNUA 3U10A 4GWJA 2XVKA 4JGYB 1MEC2 1RUH3 3AM2A 5FYCA 4LK6A 4CUAA 5JPNB 3VBRB 5JPMB 2NMOA 1PMIA 1EPWA 5KHGA 3KF5A 1IKQA 1CGPA 1UZWA 5IATA 4AVAA 1OMIA 1KD7A 2HWD1 2UYAA 4IW3A 4Q4Y2 4XJAA 1YFYA 3VN4A 1OLMA 3WW2A 4CU9A 5J7MA 1GICA 4OMDA 2GSYA 4X6RB 3ETQA 4Q8KA 4XHBA 4YW1A 4C8DA 1VMFA 2YROA 2JB4A 4HXCA 5FPXA 1WCDJ 3OF1A 5JAXA 3ZN4A 1POQA 3L2HA 4NE9A 4YM2A 3ZYHA 3AVRA 3GHNA 4Y1UA 1PNGA 4AQ6A 3M7AA 2WNVC 4DRRA 5GZDA 2VMCA 2J1SA 3AMHA 1RUH1 5E16A 5GLTA 4A42A 5F37A 1HRI3 2AUYA 4Q2FA 3MPPG 3VL8A 3WCSA 2YC4A 3BN6A 1YRZA 1S0GA 3WINE 1COV1 1KJLA 1FI2A 5BY5A 3PVNA 3W58A 5HI0A 3KB5A 4UBGA 5EV7A 4CPBD 2VVDA 1R64A 1PVC1 3JBG2 3GYDA 4URTA 3U4SA 2Z5WA 3FFZA 1W6QA 4BZ4A 1ND2C 2JX9A 5FZFA 1HRV2 2GDFA 2W2IA 4BIFA 1TME3 1VMJA 3RWNA 5F3IA 3A21A 4NHYA 4DY3A 2YMZA 3J7NA 2WFPA 1DCSA 1OPMA 2JKBA 3O12A 3OSDA 4ISRA 5ANQA 4DQAA 5EXOA 1QXRA 2H0VA 2XXZA 4CU8A 5IVBA 1VBD1 1VBB3 5H9SA 5JMCA 3EBRA 4Y1ZA 4P9LA 3HWJA 3ILFA 2HEVF 4MHRA 4CUCA 4LHNA 2C9AA 2IFRA 2J1VA 5FCCA 4N53C 3KT4A 5CKMA 1W99A 3VHNA 4ZPIA 2XKOA 1UKGA 3KS7A 3JXSA 1R091 4XQDA 3BCWA 2WS93 1W06A 3AP6A 3VBFC 1UKRA 3OGGA 4FP2A 5DUWA 2OYZA 1RUJ3 1RVF3 2RM22 2WFF1 3DKWA 4PLMA 3H8OA 2ZS6B 4ET7A 2NLRA 1IS6A 2YBPA 4B3NA 4AI8A 4EN6B 1O59A 3RQ0A 2XBO3 3GCWA 5IVJA 1RUC2 4CCNA 2QQPA 3I3MA 1GZWB 1N1YA 1WWYA 3KV6A 2IVJA 1GSLA 4GWNA 3EO6A 2W47A 1QJFA 5ABJA 1O8PA 1GMMA 4ITCA 4XJZA 1PO12 1ACCA 1CZSA 1R1A2 4RSUA 2VULA 4IEUA 3RJ2X 4ZZ5A 4I01A 5FO9B 3Q8EA 1RUI2 1VPHA 1ZZ6A 1AYM2 3K4AA 5ABJC 1AYM1 3S30A 5CAZA 2EIGA 2OX0A 3B94A 4CDQC 1US3A 3WDWA 2JDAA 1SFYA 1PO23 3ATGA 2RS52 2E26A 4WVZA 1W90A 3WF4A 3HOBA 1BYHA 4LTAA 2FZ1A 4Y4YA 3ZN6A 2B9UA 1RUG2 4XDOA 4AQ2A 2WWUA 3LA2A 4XJWA 2L9LA 1YFWA 4BA6A 3CMGA 1PM7A 2VUAA 3FBYA 3MUZ1 2VQ0A 3WP6A 1VAMA 2DU1A 1W3XA 3PTYA 5A32A 1H8VA 5KR7A 1KFXL 4KH9A 1XYPA 4R52A 1O3QA 1OFSA 4XAEA 4PCRA 3HQUA 5JIUA 2VZ1A 4N53A 4QB1A 4Q4W3 1AR93 5A70A 3S7IA 4UI9L 1ZBE3 1JYWA 4I02A 2CAUA 3JCIA 3SH5A 5T50A 3WNOA 2CHHA 4OHYA 4FQZA 1DGRA 2LTNA 4NAMA 4M01A 3OY8B 3DPRC 3WOGA 1DQ6A 1UOBA 2WYSA 2ZX0A 2W1WA 3OUJA 4RR3B 2XR4A 1UZ0A 2GC1A 2VUCA 3AMMA 3Q8CA 4Y20B 3S0MA 5JR7B 3HQRA 4QDQA 3VZKA 1WMDA 1G7YA 3KF3A 4LJHA 4XBNA 2UU8A 4FXGB 4RN5A 1QHDA 4O9GA 4H7LA 2D3RA 2JDYA 4MUVA 5CNAA 4AE2A 2EAKA 1QJX1 4GMP3 1CX4A 3LZZA 5FPAA 5L73A 5A80A 3VZNA 4AVBA 5LEKA 1H6XA 3PJQA 4G9SB 4XJ8A 4ZU7A 4UFIA 3USSA 2DTYA 3H3ZA 3VKMA 1U5IA 1COV3 1M06G 3HAGA 3GZEA 4G3YC 1AYN2 5FY0A 1J3QA 4DOUA 1SLBA 4Q4V3 4XCBA 3ZYPA 4KU8A 1OUXA 2ZGOA 2RS12 3JBG1 4L0PA 2Y0IA 4XAAA 1S2KA 5HCBA 4BWOA 1KQRA 1QJX2 4COWA 4AG4A 4Z8BA 1JN2P 1PGL1 1QOOA 2ET1A 1OQEA 2UY9A 2W1QA 4LXLA 4ISQA 4QX3A 1VR3A 5CFDB 2VCMA 2P34A 2A3YA 3OGVA 1V9U2 1W0OA 2Y6GA 3C8XA 1CPNA 5LBCA 1W28A 1XNTA 4JV4A 1XE0A 2Y6JA 1N1TA 5FY1A 4KNCA 2XOMA 3VKOA 2FDHA 4XURA 1A8DA 1LCLA 4NRPA 1MS3A 4CZSA 1ULOA 4QPIC 1OURA 2CU5A 5JLVA 1AR71 1W2NA 2HWC3 3R4SA 4Q4Y1 5FZKA 4YG6A 2JKXA 2VH9A 1KEXA 3KWVA 3OYWB 5H9PA 3ZYJB 1G9DA 3VLBB 2SBAA 3AP9A 4QAWA 1RHI3 5FXWA 1GZWA 3NWKA 1JOBA 2GAUA 2JDNA 5G05L 3GGLA 1MEC1 4QHOA 1DU3D 3UKVA 4Y33A 4AGRA 4DMIA 4CP1A 4PLOA 3H8RA 4LHLA 1VBB2 5DPNA 5FWJA 3MHZA 1NUKA 2Y60A 5JXIA 2QE3A 4ZXKA 3I3QA 1OI6A 2ADDA 3IWZA 3HR9A 4I0BA 4K8RB 5F2WA 3KSCA 3OBAA 3PIJA 5A7PA 4HOOA 5L7OC 5FZ3A 5FPZA 3KT1A 3T2TA 4ZONA 4WVVA 2VMEA 2CY6A 4XXPA 3PVEA 2D6LX 4HT1T 4JDMA 1RVF2 2RM23 4XUOA 1O4TA 2WSUA 4CCOA 3LCPA 1JXNA 2P37A 3RZGA 2VZ3A 1F15A 2WZR3 2WZ8A 1HB1A 4NRMA 1RINA 2ZEZA 4PBPA 4YW5A 3WDTA 4EN0A 3I2OA 4CDUC 3ZIWA 4CRQA 5IK4A 2QDNA 2XONA 2B5HA 3E5UA 4XDQA 3J9SA 1OVSA 3NV4A 1B35C 4R9CA 1ODMA 2VQTA 3LA7A 1JMUB 4KU7A 1SCSA 5LRSA 2EIEA 2QDRA 2RR13 4IE4A 3FHAA 5CA6A 1UOGA 1SEFA 1CESA 2JG9B 3U75A 1RUOA 1K5MC 3WQBA 4NHLA 3MBWA 1C1FA 4TWTA 3N7LA 4L2NA 1BMV2 5CG9A 4KG8A 1EY2A 1LGBA 1YIPA 2LUWA 1REFA 4LORA 4U2AA 4GH4C 4W4ZA 1IOAA 4K40A 4ORFA 4JVAA 4D8MA 1CIWA 1PVXA 1OD3A 5FIXA 4OI0A 3SKJE 4BISA 2NM1A 4INDA 4W65A 4WV8A 2E63A 3T4VA 4CCLA 5JSOA 3MIEA 5J36A 2HWF3 3OJBA 2WS91 1HXS1 4AGVA 1C8M2 4PF5A 2C5DA 4M0NA 5A32B 1VBE1 3VBFA 3LD8A 5HV4A 4XC9A 1DYOA 1ZVFA 3NV2A 3VBSC 3DF0A 1UX6A 5T52A 3HNBM 4LR4A 3CF6E 1HRV1 2DUPA 5A6ZA 1UW8A 1CONA 5FO8B 1FNZA 3UJQA 1VBC3 2P2KA 1QU0A 1UNBA 3DXTA 5EYYA 5DDJ2 1J1LA 5J98B 3S6PA 1PVC2 4YZ3A 4AZZA 4XFAA 3PVBB 3I2IA 2P6CA 5CFDA 2RMU3 5JSPA 3IMMA 2DV9A 1ENXA 3IN9A 2VGDA 4QDSA 1QOSA 2YPJA 1ENRA 4JDOA 4QT6A 4BHPA 4KG0A 1UL9A 2I2SA 1ONAA 2WO7A 4PHZA 1UN1A 2TBVA 1FV2A 1CPMA 4PDWB 3J7MA 2EXHA 4FPHA 4H7MA 5FZ4A 2VNRA 3B00A 4IERA 4LNVA 4RGKA 3UGGA 2DUOA 3WF2A 2OT7A 1YFXA 3NL1A 2ZZJA 2IZWA 5CBLA 1E5IA 4A4AA 4XILA 4XFHA 2QNKA 2JG9C 3NNLA 3U0ZA 1GU3A 5DAWA 1MPXA 4XIOA 2QZ3A 1UYXA 1QEXA 4JQRA 4LBQA 5B4XA 1CAWA 1O5UA 5A33B 1W05A 4UFHA 2A6VA 4JGZB 4UW4A 2QKDA 3VB9A 2BGOA 3ZFGC 1KS5A 5DQ0A 3RG0A 4IV3B 4LO7A 1POV3 5HXMA 4WM7A 1J58A 4J6GA 4YZ4A 1POV0 1OXCA 1UAIA 4K8FA 5LASA 4GALA 1QJU3 1NQDA 3TBDA 5DAQA 5A7SA 3LEIA 1QJZA 4HN1A 4MYEA 3LEMA 5L9RA 3LDBA 4AR2A 3J8F2 1REEA 4FAHA 4DNYA 1PZ8A 1V6IA 4LBOA 1BEV2 3NKTA 4Y22A 1X9PA 4UT5A 3HPNA 2Q8OA 5JXGA 5DABA 2PHFA 2YBSA 2AGSA 1HB4A 1MACA 2C4XA 1EV11 2QQWA 3POFA 4NPRA 2J1AA 3C7FA 4QM9A 5AFEA 2JE7A 3NMBA 4KBBA 4IQPA 2GP3A 2VR4A 4O61A 4X6QB 1MS5A 5FZIA 5F32A 4V2WA 4MG2A 5T5LA 2R49A 4A45A 3UESA 3DXUA 2WT2A 1XRUA 2B9VA 4KGGA 2JJ6A 3CBNA 4QM8A 5FK8A 5JI7A 4LUKA 4XF4A 5CU1A 4E2QA 1YHFA 2C1FA 3ELNA 2P17A 3NKGA 4AF9A 3MV01 3PUIA 3LSEA 2AH2A 2R0HA 1DGLA 2R6QA 2UYBA 3R4DB 2FQPA 4IEVA 3TYJA 1Z78A 5F5CA 1ZBE1 2BTVC 2ZGLA 2D3SA 2ZKLA 4M0HA 2D6KA 1YWKA 5FMBA 3E1F1 2ZX4A 3SMHA 1Y9QA 1FV3A 1FMD2 4LLOA 5HPOA 2YHJA 5ACA1 1UOJA 1OA2A 4RR3C 5FZDA 1AVBA 5CFDC 3FZ3A 2HWB2 2D43A 1MQTB 2WZR2 1O3RA 2P3KA 2EIBA 2R32A 3GZUC 4QX8A 5IAVA 3PUQA 4PIZA 1XU1A 4D3WA 5KBFA 1JS9A 4AEDB 2PHRA 4DXRA 4DUXA 1HRV3 1VB4A 2QQIA 4MGKE 1ULCA 2W1SA 5LK7B 1RXGA 1DGRN 2FCVA 2VNGA 4RGGA 1IPJA 1SLTA 4QQOA 3ZR5A 1D0HA 1NA1B 3S57A 4ASKA 4RQPC 1NLRA 3ITQA 5BNNA 5APAA 4CP0A 1EYBA 4P5YA 1SDWA 1ZZ7A 4L9BA 3USUB 2VJXA 3ZDVA 4BK4A 3I2HA 1JU3A 2VECA 3MDPA 4XZUG 3ZPYA 5A7OA 4BQ1A 4XXAA 5GJ6A 3N9OA 3IDAA 1G9CA 1V0AA 3IIAA 3T1MA 2WLQA 1PGW1 1HB3A 5GKAC 2H6CA 4J1WA 4NOTA 4RGAA 4TN7A 1Q8VA 1KXGA 3BOWA 1BKZA 4NR1A 5LCWL 4OZOA 1K5MA 2YY1A 1UU4A 1S0FA 2R063 1VBA2 4RHV3 2WNVB 2FDGA 2XBO1 5LBEA 2C6SA 1RMU1 5T54A 4FPGA 1JZ2A 2CWSA 2R0FA 3K4ZA 1FXZA 1VP6A 3NQHA 2VC9A 5T3NA 3UYJA 1FPN1 4YGEA 3KQRA 5F5QA 3OD0A 1NA1C 1W9FA 3DYMA 4Q0VA 5FQ0B 1D2SA 1U0AA 3OUIA 2ZACA 4QB6A 4GKXA 2Z4FA 5FLHA 3GJBA 1LOBA 1NCRA 4AXOA 5IVCA 3AKRA 3M4FA 2D3PA 5KXEA 1W6MA 1B35B 3UK9A 5J37A 2VTXA 1OSGA 3W5NA 4WM7B 1TZOA 1V6KA 2RS33 5GLVA 3K2OA 4AI9A 4YW3A 4BLIA 4XMAA 1QJY3 2VUDA 1DZTA 1OA3A 3CNAA 3T09A 4PDWA 4KWLA 1AX2A 4K21A 5BNOB 2OQ6A 5ACA3 1Y43B 3BYWA 3K3NA 3HBZA 3RYRA 4HMZA 1OOPC 5C3SA 4QX1A 3F2ZA 3THCA 4DEQA 1D4VB 1EP0A 1QJY2 2EIDA 4H14A 2JICA 2ZAAA 4Q5OA 5FYSA 2HKXA 5DAXA 5FMCA 1I1EA 1FATA 2KXLA 2LRPA 1GLHA 5HCHA 1OC1A 1H2MA 1U12A 4CEWB 5ISLA 1LOFA 2WNOA 1D0GA 3PU3A 2QZ2A 2VZRA 1WGPA 1KDKA 4JGZA 1ZRFA 5ABJB 2WQ8A 1ZREA 3MEPA 1GP6A 4A3ZA 1Z7S1 5LA2A 4BYYA 4AGGA 2LW8A 3H3LA 1JZ6A 2E7TA 3D0SA 1QY4A 4NROA 4CE8A 2RMU1 1DIWA 4HN0A 4MGQA 4XOGA 3ZFEB 2WINB 2OA2A 4CP9A 4FVVA 1JYIA 3K4DA 1IGOA 1TG7A 2DVGA 2G9GA 4RFRB 1PGL2 2XMLA 1R083 1WMFA 3IDBB 4EWDA 1G8WA 1XYOA 3ZYFA 2OZJA 4K7JA 2ZPXA 4X8NA 3ME2A 2R041 2PA7A 3H50A 1AL0G 2WYFA 3ZN6B 1D4M1 1C8NA 2A6XA 5C71A 4FO9A 1K45A 1UYPA 2BJSA 2ZCWA 5K0UA 3UT0A 4COYA 2R071 2AENA 1DQ5A 1Z7S2 5FY5A 1ZA7A 4OULA 4P9JA 5FYBA 2O0OA 3O0VA 4HVQA 5I91A 2YFZA 4MXWB 5FY4A 1W9WA 2CYFA 1UMZA 1WBLA 2VCAA 1RMU3 3LEKA 2Z2SB 3RZZA 3WW1A 1LHUA 4YVWA 3D82A 1H9PA 1S0EA 4WZCA 1AR62 3GALA 1PHMA 1B09A 1PMJX 1H0BA 1YYNA 2RJLA 3AMNA 3GNEA 4MVTA 4YPJA 3RWKX 2K9ZA 1F35A 2AACA 3OY8A 2BERA 1WLCA 4XACA 1HIXA 2BWCA 4AW7A 1XNBA 3OEAA 4GB31 4M3CA 4HKWA 5GZFA 5A3OA 2BBVA 3WNNA 2B42B 1GFF2 2OS2A 5A1FA 1NCQA 4JZRA 3AX4A 3HJRA 2PXJA 2WAOA 2VOXA 2XJTA 2RDSA 2XL7A 3MI8A 1UWWA 5I0TA 1Z7S3 3POGA 3CLPA 3AZWA 4FPOB 4NIIA 1GZTA 5KHJA 1GNZA 2V5DA 2XQXA 1Z0HA 3J26N 4AAPA 1JOJA 1H2LA 4YZ2A 5BNNB 2BPA2 4DO0A 2D6PA 1MS1A 4IDZA 5FP9A 1RYYA 4ZXEA 3UKTA 3V0AA 4FPEA 4Q1PA 5FQ0A 5L9BA 1NE6A 2QQNA 1MVEA 5GLUA 3KLSA 5FZ9A 3GJAA 4FSJA 4GXLA 1VBA1 3AB0A 3DEMA 5KWRA 3CKHA 5DUVA 1XXNA 4L97A 3A0NA 5LATA 5C70A 3V64A 1W6NB 4YZ1A 4Z92B 4YGDA 2RDRA 5A3WA 4PF1A 3LPFA 4QKDA 1HLCA 4CDXA 5FAXA 2YU1A 2LS6A 1ZRRA 2X53S 3BIEA 3I3BA 4HK9A 1N3QA 1XBFA 1LU1A 1W8FA 2DCTA 2A7AA 3KM5A 5A1AA 4EYUA 4FTEA 4JRLA 4Q26A 5EP9A 2ARAA 1PK6C 2RR12 4UWDA 5C4WA 5C9AC 4I0WB 2AEYA 3OTFA 5BNQA 1SHWB 5FYIA 1DHKB 5FTTC 2N7GA 5FP7A 1VBE2 5KHKA 2VMGA 4LIUA 4AK3A 4MOAA 2RV9A 4UYBA 4R4XA 1RUG3 2WC2A 4NAOA 4XF3A 3UV9A 2YV8A 2D6OX 2P3JA 2ERFA 2A71A 4DPNA 4COZA 3RGBA 4RQPB 1YCIA 3T1LA 4GULA 4LBNA 4LPLA 3VD7A 5K7PA 4E4HA 2HWB1 3VBOB 4CP9B 2NN8A 4NVPA 3SCGA 4MV2A 4ASLA 1LTEA 1OOPA 3KGZA 1LU2A 3KCXA 1MS0A 4Q4V1 1RIRA 3W5MA 1AR92 3ORJA 2VBBA 4ZKTB 2CSGA 5FXVA 2VZTA 3WG2A 1Q56A 4XFIA 5FYUA 3ZSEA 2Y33A 1ASJ2 4XF0A 1L7QA 3SH3A 5FUNA 3WDYA 4GD4A 2LROA 1V00A 1DYKA 4E27A 1JYXA 2ZHMA 1T6GC 1VBA3 3DKQA 2IUWA 4BM8A 5BNPA 3I97A 5K0UB 5EZWA 3VBOC 2RS32 4W6WA 3T3YA 2GC2A 2J1EA 4OUMA 3QOPA 3B02A 2EXJA 1U5XA 2Q8DA 4P9XA 2DCZA 3KGLA 3IM0A 4RYDA 3FHQA 1T6BX 4YNIA 4CDQA 1FOD3 5C4WC 3TEYA 3PUHA 5A3TA 4S2GA 2FDKA 1EV12 2QQMA 2WN2A 1WBFA 2VXRA 1ZRDA 1HRI1 3LEGA 5L9VA 3V0BA 4D7TA 4DS0A 1MZ6A 4QPGA 1BEV1 4OHXA 5FWEA 2VNOA 3ZPOA 3E97A 3J8F1 3U4XA 3WUDA 5FPUA 2JEMA 4N7UA 2EXIA 3O0WA 4P9WA 2PHUA 2RS13 3I59B 5DDJ3 3RNSA 1QNWA 1RTVA 4Q1RA 5CVRA 2W46A 1OHFA 2RS51 5KXDA 3I49A 2PFWA 2DCJA 2Y6LA 3J4UH 2XJVA 4LBKA 3LIHA 4DXTA 4DIQA 3H7JA 4GH4B 4XHXA 5BUVA 3VBFB 1W8TA 2LALA 3VBRA 2HEWF 4LE3A 1KDMA 3GDBA 4N43C 4HBNA 1EAH3 4MADA 1W2UA 5FMOL 4Z2AA 3HNMA 1JTZX 2CGNA 3KHBA 3RYKA 1CVNA 1HJFA 4AYUA 2ZGPA 2CL2A 2C24A 3WNXA 4DFSA 2PLV2 4Z82A 2PAEA 1NT0A 3MIGA 4PI0A 5F6LB 4L99A 2F17A 4JKKA 4HPKB 5C3RA 3ZX7A 2R16A 2MEV1 2GU9A 3S7EA 2FCTA 4OYUA 5GZCA 1OLME 2V09A 4M3CB 2XVGA 4IE7A 4C91A 5KHIA 1G9BA 3R05A 3JUUA 2Y6FA 3DECA 4A7KA 1YQ8A 2Y6HA 1NCQB 2FZ2A 2VW1A 2JENA 1QMJA 2A3XA 3EB7A 2R30A 1S55A 5AVAA 5A1LA 3LWCA 3PU8A 1AXKA 3PHMA 1ALYA 2ZKNA 1X82A 1A3KA 3FE5A 5HCFA 2XLFA 2Z42A 5DDJ1 1R092 3HQXA 5CYYA 1K5JA 2J1TA 3HT1A 1QDOA 1YJLA 2JE9A 1PGSA 2UWCA 4PIYA 1RJ7A 1BEV3 4LKSA 3SQOA 4D69A 3KHCA 1PIV1 2ES3A 4NIGA 1OQ1A 3WW3A 4LBQB 5JOZA 1CAXA 4XUQA 3BPSA 2ZOEB 2VTXJ 4YWAA 4R9AA 4B4QA 1W9YA 2W1UA 1OFNA 2B45X 3RRDA 5EHDA 4IV3A 4F83A 1HXS2 3VBHA 1UX7A 4OUSA 2WS92 3WG1A 5DZFA 5J96B 4QKNA 3AXEA 1XNCA 2ZHLA 1W6NA 4Y3OA 5LA1A 4OHVA 5FZ7A 2QQKA 1GP5A 2B8MA 2VNVA 1VAVA 3AZXA 2DVDA 2FDJA 5SV8A 5C33A 1F4HA 2EF6A 1S0JA 4P5HA 1GNYA 1JYTA 1KS4A 2BUKA 1PZ7A 4JGYC 4HSLA 2Z69A 2ZAHA 5GALA 1VRH3 4LULA 3LDKA 3ZFFC 2Q1FA 4Y22B 1LHVA 1COV2 3A7QA 2RHPA 2KM2A 4AHXA 4B8EA 1FMD3 1PO13 2LM3A 1MEC3 1RUH2 2WWSA 1HJGA 4M4RA 1W9SA 2BP6A 5BNPB 2YXSA 3NNGA 1VRH2 2XDVA 4PBOA 2FDIA 5FPLA 1VBE3 2DU0A 3ZFGA 1RUI3 5FMDA 4JGZC 4BPZA 2VQUA 2AC1A 1NKGA 1ZZCA 4Q4Y3 5CFCB 2JXAA 2VU9A 1RJ8A 3P3PA 4QDRA 4ZS2A 1AR73 2V73A 4MLOA 3AP7A 3B5LB 1BBT3 2GH8A 2FMDA 4MHUA 4ZU5A 4OI1A 4EN7B 1BBT1 1YLLA 1RVF1 1GWKA 4LO4B 2ZGRA 2G1MA 4QGLA 4LITA 4NRQA 4AFDA 4CXWA 2FDFA 2D93A 2JE8A 1BK1A 1A8MA 1AUYA 4LE4A 1GR3A 2WT1A 1UQXA 4XZPA 1LHWA 4QQ2A 3UETA 4M00A 4Y4RA 3PLQA 5JOXA 5A6XA 2I07B 1R1A1 1GYKA 1XNAA 1PO11 4LKEA 1UMIA 3B93A 2JDUA 4HONA 4YGBA 2ID4A 3VDCA 4EROA 2YC2A 3MIBA 3KV9A 5CZKA 3ABZA 3DPRB 5FXXA 3UNPA 5IVFA 2MEV3 5F9TA 4AOCA 1VRH1 1TME2 4M3CF 4OQ8A 1NA1A 3B01A 3AP4A 1WA4A 2KD7A 4HETA 1RUC1 4QQPA 4G4FA 3FLPA 2HYXA 2C26A 3USUA 3URFA 3I3DA 1N1SA 2CGPA 4YFZA 2IXJA 1DQ0A 2RM21 3GBFA 1ZRIA 2BVVA 3K75B 2XJRA 3KMHA 4QPGB 4Y5Z0 2WUHA 5FK7A 3MW2A 2H0BA 1OUSA 2R072 3ACFA 3KQ4B 5I8SA 3ZYGA 4HFSA 4Y20A 4ZS3A 3I59A 2WABA 4FFFA 5G04L 3W21A 1UY2A 4NPMA 4TXWA 3DYPA 4XYXA 1RUNA 3P6BA 5FYYA 5FP4A 4GH4A 4YARA 3PL0A 2WZPP 2PQQA 5KC5A 1AR91 4IEPA 4BB3A 4NN0A 4Q4V2 3WNPA 3DV8A 2D97A 1QDCA 4IEZA 4YW6A 1D2QA 1S0DA 2TUNA 5FYVA 3WNLA 1ZZBA 2RMU2 2YFUA 5F3EA 2XHKA 4GAZA 2JWPA 1BLZA 1BCXA 1CZVA 5F6KA 4HPKA 1SCRA 3WX5A 1AXZA 1CAXB 2A5ZA 3POJA 5FPVA 3T2OA 3ZFFB 4FTBA 1W8NA 1WW4A 1B35A 4NIHA 1HKDA 5DXDA 2A3WA 4C0HA 1AHSA 1EV13 2BVBA 2ZEXA 4QGNA 3HD8B 4CXXA 4GMP0 3PMSA 5FZLA 3KZ4C 4CDUA 3IMNA 3IAPA 1HB2A 2X09A 3I54A 3ROUA 1XNDA 5LEJA 3TAYA 5DUXA 1C8M3 3SC7X 3CQOA 4FOQA 1C5HA 3M3EA 3POSA 3JB4C 1HN0A 1NAEA 3WXPA 3ETPA 4RL7A 2P3IA 3JZVA 1A78A 2R043 1FYUA 1Y9GA 1J83A 1WD4A 3CO2A 4LKFA 3POYA 1TE1B 1NLQA 3AL6A 3O5SA 3AYEA 3N9LA 1POV1 5IJRA 2BEOA 3AYAA 4LLFA 2J1UA 3WEZA 4IESA 1DP0A 3C7EA 3D6EA 3LF7A 1Q8QA 3ZFGB 5BV6A 5FDBA
chains in the Genus database with same CATH topology
1F15A 1LAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F15 A;  1LAJ A; 
#chains in the Genus database with same CATH topology
 3VBH B;  4LKD A;  3TEW A;  4XUT A;  4XE9 A;  4LO5 B;  5J1X A;  1LNS A;  1PZ9 A;  3NNJ A;  2W68 A;  1CZT A;  3KCC A;  4LIV A;  1JOP A;  1ZX5 A;  2VBP A;  4BE3 A;  1XC6 A;  4NPL A;  1GZ9 A;  2XVL A;  2QQO A;  1I6X A;  4LBQ D;  3SIT A;  3WG3 A;  3VZL A;  3ZMN A;  1W0P A;  1BK0 A;  1S0C A;  1VJ2 A;  3M3Q A;  2ZHK A;  3H1M A;  1GOH A;  1I3H A;  4FPK A;  5GZG A;  3ACI A;  4FPJ A;  1F9K A;  4N43 A;  3VZO A;  1RL3 A;  4AVS A;  3VGI A;  2OXB A;  2GNT A;  3RMY A;  3ST7 A;  1PGW 2;  4CCJ A;  2YC0 A;  4RS5 A;  3ALQ A;  4CDW C;  2BGC A;  4UXA A;  2X05 A;  2VZU A;  3HMY A;  3NV1 A;  3WLU A;  2RJK A;  5D8A C;  3EJK A;  2RS3 1;  1RGS A;  4FPL A;  3WCR A;  4FP3 A;  4TLG A;  4BQX A;  5CFC A;  4HLT A;  1AYN 3;  1SLL A;  1OPO A;  1W3V A;  5FLI A;  4OQ9 A;  3FJS A;  4UFJ A;  2J42 A;  5FZB A;  2RDN A;  4EV0 A;  3VBH C;  4C0B A;  4YVW B;  2JG9 A;  1AR6 1;  1S0B A;  1ASJ 1;  2BU9 A;  3DL3 A;  2PQS A;  3SLI A;  3I2F A;  1W2T A;  2VVE A;  3MW4 A;  1PO2 1;  4FXK B;  1O4Z A;  2OPW A;  2NYY A;  4QKB A;  5IUQ A;  4JDN A;  3VZM A;  2E6V A;  1LKN A;  2F4L A;  2WFF 2;  1SDD B;  1UCX A;  2HWF 1;  2P6H A;  4HL0 A;  4QPI B;  4FFH A;  4LMF A;  3MLK A;  4XET A;  5C5T A;  1UZZ A;  1XNK A;  1YI9 A;  1WCK A;  2Q5T A;  2DBN A;  2VOK A;  4A2U A;  2PEL A;  1GKB A;  4R8H A;  1W8U A;  4N8M A;  1F5F A;  2GMP A;  2QQL A;  5K9Y A;  3I4I A;  1O8S A;  3Q8F A;  2ENR A;  2XQR A;  3DPR A;  2VCB A;  4PJY A;  1VBD 2;  1W6O A;  5FZ6 A;  3OGJ A;  4JTO A;  5KXC A;  1PX4 A;  2PN5 A;  4DUW A;  1RHI 2;  1WW6 A;  3CDZ B;  2VZV A;  2VPV A;  3NAP B;  4H3W A;  1IQD C;  4Y5T A;  3X29 B;  4OI2 A;  4AL9 A;  3H8U A;  2RR1 1;  1CR7 A;  4X8P A;  5TSW A;  2VL4 A;  3ZKU A;  5CIS A;  2W95 A;  3PNA A;  4AI0 A;  3ZO0 B;  2DCK A;  3OEB A;  3FHI B;  3D5O A;  1FT9 A;  2JG8 A;  2OPK A;  2VMI A;  3KV4 A;  1R1Z A;  2A6Y A;  1F8V A;  3I2J A;  3ILR A;  1WUV A;  2OZ6 A;  2VZQ A;  3RDI A;  2IXL A;  5FYZ A;  2ZMK A;  4KQ7 A;  5JOW A;  1SPP A;  3HT2 A;  1AJK A;  3POI A;  4CYD A;  2R07 3;  3RYP A;  3LSD A;  4GMP 1;  1YQ5 A;  1N3P A;  2EAL A;  1A6C A;  3AXD A;  4ARX A;  3VV1 A;  3O7O A;  4XEZ A;  2D5H A;  4CTE A;  1EAH 1;  1ODN A;  1W04 A;  2GND A;  3AVS A;  3O14 A;  1GAN A;  4K6B A;  3VKN A;  3ZXA C;  4C1X A;  4CDX B;  5JZG C;  5FKB A;  3QH6 A;  5LY2 A;  4OCT A;  2C0Z A;  1DZQ A;  4NO4 A;  3AFK A;  1W39 A;  3QAC A;  3T0A A;  5IFT A;  2TNF A;  3GZA A;  4ARY A;  5C3O A;  4K20 A;  4XAB A;  2HWD 2;  1TEI A;  1S1A A;  1WW5 A;  3K46 A;  3CJX A;  1US2 A;  4QPG C;  3WHT A;  1E5H A;  1E5R A;  4AI3 A;  3O1R A;  1CAW B;  2A70 A;  4I3G A;  5A33 A;  4CDX C;  2KA3 A;  1LED A;  1Q43 A;  1E5S A;  2C9K A;  2O1Q A;  2IVI B;  5FLJ A;  4YW2 A;  3L2Y A;  3FX3 A;  4GB3 3;  1X33 A;  3T30 A;  1K42 A;  5BPX A;  1OH3 A;  2QUO A;  4MGZ E;  1H8T A;  5EJZ B;  4XW3 A;  1ZBA 1;  3H9A A;  3C2U A;  3INA A;  4CDU B;  1DQ2 A;  1FPN 2;  3CZJ A;  4CUG A;  2HWC 1;  4XCA A;  4B4P A;  3EXU A;  4JQT A;  2EAA A;  1O6U A;  1ULF A;  1URX A;  1YQ2 A;  4QU2 A;  3U07 A;  3VBO A;  4GB3 2;  1FOD 2;  1OH4 A;  1X8M A;  3FBM A;  4RD7 A;  4YRD A;  1RMU 2;  1OOP B;  1L7R A;  2D40 A;  3C7O A;  5BNP C;  5EIY B;  3FN9 A;  2VD7 A;  3UGH A;  4COU A;  4F3J A;  1DF0 A;  5C3Q A;  1IS3 A;  4LQR A;  3KV5 A;  5CIR A;  2QCS B;  2ARB A;  3LE0 A;  3VZJ A;  3WP5 A;  2HWD 3;  4A7Y A;  4XPV A;  5CEH A;  2W91 A;  2RE9 A;  1JBC A;  4LBL A;  4QWN A;  2Q0A A;  1NZC A;  2HH9 A;  2E9Q A;  2PLV 3;  2XB6 C;  2A75 A;  3LFI A;  3M3C A;  2HWE 2;  1J59 A;  1GUI A;  3L9J T;  3O1O A;  3SHR A;  5CKN A;  1V70 A;  4D6Q A;  3JU9 A;  4XDP A;  1R08 1;  1E57 A;  3ZIX A;  2FMY A;  1CJP A;  1UYY A;  4CDQ B;  5GZE A;  1FPN 3;  1DQ1 A;  5A3N A;  4D94 A;  2P1B A;  1CAV A;  3OGR A;  2HLE A;  4IEY A;  2UY8 A;  5F2S A;  1Y3T A;  4LBM A;  3V0B B;  1QJX 3;  3RI9 A;  4DUV A;  5H9Q A;  1JUH A;  1WMX A;  4QPI A;  4ONU A;  3WP3 A;  1QKQ A;  3B69 A;  2I74 A;  5GM0 A;  5LBB A;  2PAK A;  2WJS A;  4DB5 A;  5A3P A;  4IEO A;  1HN1 A;  4N43 B;  1MQT A;  1UY1 A;  3WP4 A;  3VD3 A;  5F39 A;  5KHH A;  5LWB A;  2PHD A;  4YM3 A;  2VAU A;  4AED A;  4KL1 A;  4RS5 B;  1NOV A;  2WZR 1;  4WVM A;  3SEP A;  5K0U C;  1MS9 A;  1IPS A;  4A6S A;  2ZGN A;  3C7H A;  3MPB A;  2V5Y A;  3WUC A;  5IVV A;  5SV5 A;  3THD A;  5JXJ A;  1FMD 1;  2JB8 A;  2DVB A;  4XUP A;  2YGL A;  5C6C A;  4K3U A;  5FPB A;  4FBF A;  1C28 A;  1F4A A;  4V2V A;  1SMV A;  4FCA A;  3WR0 A;  2WLP A;  1NYW A;  2A6Z A;  1WA6 X;  1KFU L;  2BGP A;  2IFW A;  5T5P A;  2Z79 A;  3VDD A;  2W92 A;  4FTS A;  3JQW A;  2JG8 B;  1QJY 1;  1NZI A;  1W9T A;  2X5I B;  5EYX A;  5JVV A;  3QLQ A;  1YEW A;  3ENR A;  4NUB A;  5FY7 A;  2YPD A;  2DDU A;  5HV0 A;  1SPP B;  4YVS C;  5A3L A;  1QJU 2;  1RB8 G;  3RZK A;  4OLL A;  1DYP A;  5EJ3 A;  4B1M A;  1G86 A;  2ATF A;  4IGQ A;  1UIK A;  3GXU A;  3W59 A;  2AYH A;  4ATF A;  1JZ8 A;  3BTX A;  4YW7 A;  1AR8 2;  1HXS 3;  3ACH A;  1UO9 A;  3I2K A;  3B7M A;  3DN7 A;  4Q4X 2;  1H30 A;  1V9U 3;  2GMM A;  1PIV 3;  3RZJ A;  2VY0 A;  1GNH A;  3BIW E;  3H1W A;  4MXV A;  5D8A B;  5DG2 A;  1H1A A;  3IAQ A;  1NCQ C;  2SLI A;  1PMH X;  2XWB B;  2GN7 A;  4RHV 1;  1Q8O A;  1EUT A;  1X9T A;  1TNF A;  2NP0 A;  1LEN A;  1RUF 2;  1QWR A;  1HV1 A;  3RSJ A;  2BYV E;  2HWC 2;  4P14 A;  2VOW A;  3V65 A;  4D6S A;  1ZBA 2;  1JYV A;  3NV3 A;  1V6O A;  3ES1 A;  1HQW A;  2IXK A;  3WY6 A;  4E8D A;  2QQV A;  4R9B A;  2HJI A;  2XBO 2;  4Q27 A;  3VL9 A;  2ZMN A;  3ACG A;  3MIC A;  3U37 A;  2YBK A;  4KWJ A;  4AFC A;  1LOG A;  2E7A A;  1YJK A;  2F4P A;  4E2G A;  4DZG A;  5JSR A;  3WSO A;  3VDB A;  1LOD A;  1XYN A;  4I0A A;  4BQY A;  4Q4X 3;  1M4W A;  4Y24 A;  5BNO A;  1O91 A;  2HBU A;  3PJY A;  2DUR A;  2IC1 A;  1CQ9 A;  2YU2 A;  2DYC A;  4AEK A;  3VBU C;  2OUH A;  3WF3 A;  2XH6 A;  3KT7 A;  3UJO A;  1UD1 A;  5FZH A;  4CCE A;  2ZX1 A;  2GH2 A;  1SLI A;  3RMX A;  3AKP A;  1S0I A;  2ZX3 A;  3M2M A;  3O0X A;  2QQU A;  5I0S A;  5C9A B;  1C57 A;  3N7J A;  3S5Q A;  2PHX A;  2QJV A;  2VVF A;  3PME A;  1VBD 3;  3EYP A;  2W94 A;  3OBT A;  4HVR A;  1QXJ A;  3VHO A;  3A23 A;  2RS5 3;  5F7U A;  3NST A;  1JU4 A;  2BBA A;  4LA3 A;  5A7N A;  2OUJ A;  4P9G A;  1XE8 A;  1UPI A;  2RS1 1;  4UFM A;  4KWU A;  3RS6 A;  1K3I A;  1TVG A;  1LAJ A;  2CWM A;  3WW4 A;  1DDL A;  1JYN A;  1CIY A;  1QQP 2;  4QXH A;  1W6Q B;  4Q29 A;  5CG8 A;  3VDA A;  1JH5 A;  4D0Q A;  3ZFE A;  2ZGS A;  1CAV B;  3CIH A;  3WZ1 A;  1UU6 A;  4EE2 A;  5T55 A;  1HDK A;  3UGF A;  3DUI A;  1LOF C;  4BXS V;  1IPK A;  1DFQ A;  3AC0 A;  4UAP A;  1LJ7 A;  1ZBE 2;  4JRA A;  4NHM A;  4P9I A;  1ND3 A;  2EIC A;  2OW4 A;  1ULE A;  4J25 A;  2OQ7 A;  1H4G A;  2O14 A;  3RVH A;  3H42 B;  3AZY A;  3NNF A;  3AKQ A;  3VBU B;  1G9A A;  2Y8K A;  1SG3 A;  3U78 A;  4AI1 A;  2CAV A;  2VO5 A;  1AX1 A;  1GV9 A;  1CJD A;  2G4I A;  4M4P A;  1S2E A;  4PDW C;  3IPV A;  3FMG A;  3THT A;  1YUD A;  1LEM A;  3BAL A;  2RVA A;  3N36 A;  2DFB A;  2E33 A;  1UMH A;  4TSV A;  2W9X A;  5LY1 A;  3BU0 A;  3ECQ A;  2E51 A;  5IK7 A;  1JW6 A;  1MR5 A;  5D2A A;  3T2P A;  3PVO A;  5IVE A;  5IK8 A;  3O1M A;  4E2S A;  1PO2 2;  1O3T A;  1ND2 A;  4FPY A;  4A44 A;  5FV3 A;  3AMP A;  3VDD B;  2X29 A;  3FL7 A;  3MV1 1;  3NJX A;  1W8O A;  3QD6 A;  4OZX A;  5DAP A;  3N7K A;  3WQ7 A;  2IWG B;  3VUO A;  2D6N A;  2DBI A;  2FBE A;  1UU5 A;  3NO8 A;  1YC6 1;  2PAM A;  1RUD 2;  3PUR A;  5F3G A;  2XKP A;  1K12 A;  1RUG 1;  1VIW B;  2UUR A;  2WDB A;  3WHU A;  1F2N A;  4COV A;  3WNK A;  5AC9 2;  1SBF A;  2XG3 A;  5DMY A;  3ACL A;  4Q4W 2;  2MNG A;  3U14 A;  3KVA A;  2GC3 A;  2R06 1;  2GAL A;  2UWA A;  3G6J B;  1RUD 3;  2E31 A;  3HN1 A;  4OUE A;  4QX0 A;  5B2G B;  5D8A A;  4P00 B;  3T0D A;  4N9I A;  2FHR A;  3H0O A;  3BB6 A;  1BJQ A;  1JUI A;  4BME A;  3H3U A;  3IT8 A;  4LHK A;  3TB0 A;  4I09 A;  5A7Q A;  1RUI 1;  4ES8 A;  3AMQ A;  2JD4 A;  4QXC A;  5FZ8 A;  1HW5 A;  2WR9 A;  2QVS B;  2YZ4 A;  1QOT A;  4BJ0 A;  2W08 A;  3N3H A;  4OHW A;  3AL5 A;  4U36 A;  1UY0 A;  4YG0 A;  3U1X A;  1AL2 2;  3LB9 A;  2A6W A;  1MS8 A;  3MIF A;  3NW4 A;  4XFB A;  3ZOI A;  4IV1 A;  2RDQ A;  5IW0 A;  3T0B A;  1OLQ A;  3ZFF A;  1VBB 1;  4CXY A;  3ZR6 A;  5GLZ A;  2WNU C;  4BOW A;  5FJK A;  4DIN B;  5I0D A;  4WM7 C;  3AYD A;  4GQ7 A;  1VAK A;  3LAG A;  4NID A;  3NVC A;  4JHT A;  1VBC 1;  4AVV A;  5LK5 A;  4N53 B;  4CCC A;  2DTW A;  3AJZ A;  1CN1 A;  1ZNP A;  1ZRC A;  3WD5 A;  1U5Z A;  5KXB A;  1NG0 A;  3VKF C;  5A3M A;  1O3S A;  1AR7 2;  3DYO A;  1GBG A;  4FI9 A;  5JOY A;  4CEY B;  2VZS A;  2K0G A;  2YUE A;  4NJ4 A;  4Z07 A;  2XPJ A;  3J7L A;  3LOB A;  3D3A A;  4RR3 A;  2WRA A;  4KGQ A;  5IFP A;  2EVX A;  2NMN A;  4TLF A;  1UXZ A;  5KC6 A;  3SIS A;  3Q8A A;  1S2B A;  3VHP A;  3MZH A;  1UF2 C;  4OMC A;  5FOJ B;  5FZE A;  3MID A;  1JZ4 A;  5HCA A;  2AR6 A;  3WV6 A;  3VHR A;  4HK8 A;  1IG3 A;  4IET A;  4P08 A;  2R1B A;  2YG0 A;  1UY4 A;  2NPI A;  2XLA A;  3ZXG A;  5FYT A;  4H55 A;  4TTG A;  1OKQ A;  5FRE A;  1GWM A;  3ZXD A;  1PIV 2;  1QXP A;  4XMI A;  5FXZ A;  4LO8 A;  4NWW A;  4XIK A;  1O7F A;  1LES A;  2OVU A;  2XHN A;  4HZF A;  5A7W A;  3SXW A;  4CP2 A;  4IL7 A;  3VD5 A;  5LBF A;  4EZH A;  3BTA A;  4S2D A;  4GA9 A;  1SLA A;  4IGO A;  2BZD A;  4MH0 E;  4URA A;  1YI7 A;  5JWP A;  5E1R A;  3H7Y A;  2WA3 A;  2Y34 A;  3T08 A;  5FZ0 A;  5C7G A;  1ND3 B;  2YGM A;  3VBS A;  2ZZQ A;  1ZZ8 A;  3FWE A;  4WVW A;  4XFF A;  2ZHN A;  1RUJ 1;  2WFF 3;  3FLT A;  2VOT A;  2XJQ A;  4WBB A;  1DGW X;  4FT8 A;  1KGY A;  1QH6 A;  2VM9 A;  3GF6 A;  3TN9 3;  4CUB A;  3LOI A;  2GZW A;  3AJY A;  4QX5 A;  4XTP A;  3QBQ A;  1LEC A;  2XGX A;  3N9Q A;  4IV1 C;  2J1R A;  4ZU4 A;  4ZHN A;  1UZY A;  4ZY9 A;  2E32 A;  2GP5 A;  1BVV A;  1NY7 1;  1PM4 A;  2BWA A;  3VBR C;  1XPW A;  3R4U A;  3DCQ A;  2MEV 2;  3OPZ A;  3JBG 3;  3AYC A;  4MZU A;  3RPQ A;  3N4M A;  4QXB A;  2GNM A;  2VMD A;  3M1H A;  1NE4 A;  1NX9 A;  4XF9 A;  4XBL A;  3WDU A;  2O8Q A;  4PT6 A;  1IKP A;  2W87 A;  4NIA A;  2X8K A;  3KCY A;  3RZH A;  4JTN A;  4K1Y A;  4O65 A;  5J48 A;  3AP5 A;  1C5I A;  1VAL A;  1TME 1;  3ZXE A;  1Q8P A;  4ATE A;  2QFE A;  4S2F A;  2VMF A;  4OI4 A;  3O1P A;  3OOX A;  2AEZ A;  1H1M A;  1CWP A;  5HBA A;  1AL2 1;  1EUU A;  2VZO A;  4IE5 A;  4BK5 A;  1CX1 A;  4WM8 A;  4S2H A;  2XLG A;  1WW7 A;  1QIQ A;  2ET7 A;  3B9I A;  3VBU A;  4AHW A;  5E6H A;  5EWS A;  1W6P A;  4CA9 A;  1Q5O A;  4UF0 B;  1RIT A;  2NZ9 A;  5BNO C;  3PUS A;  2WZE A;  3BPZ A;  1MZF A;  1OD5 A;  2VW2 A;  3LFM A;  4QQL A;  3CHX A;  5C8C C;  3BI3 A;  4JCK A;  4BH9 A;  3BVC A;  3J7H A;  2VG9 A;  4Y1X A;  2PMW B;  1VB2 A;  2R06 2;  3ZXK A;  1BBT 2;  3RZM A;  4YM1 A;  5FJH A;  4P9Y A;  3I2G A;  2ZA9 A;  4Q4W 1;  2BOI A;  4AVT A;  2WBK A;  3GBG A;  4QKF A;  3GZT B;  1VLN A;  1IHM A;  4JKM A;  3IZO A;  3GM8 A;  3MW3 A;  1STM A;  1ENQ A;  5I8T A;  1LHO A;  1WD3 A;  1ZM1 A;  1RUD 1;  1W2O A;  4JX0 A;  1NY7 2;  1OF3 A;  4IEW A;  4C1W A;  5D21 A;  1NXD 1;  5CKQ A;  1O4Y A;  2WA4 A;  2NQY A;  3AZV A;  2ZGT A;  1H9W A;  2J22 A;  1RUE 2;  2I45 A;  4E4D X;  2Q1Z B;  5CAD A;  1V9U 1;  5LB6 A;  3OGS A;  1RUJ 2;  5F3C A;  4BQ5 A;  4ES9 A;  3OPT A;  3W20 A;  3W9A A;  2ZML A;  2ZTN A;  2Y6K A;  4CEY A;  3C7G A;  1QH7 A;  1PX3 A;  1H6Y A;  3CU7 A;  4K1Z A;  4QMA A;  3OB8 A;  2OKX A;  4B29 A;  2ARX A;  3M3I A;  5AFB A;  1AYN 1;  1L7L A;  4YVS A;  3O1S A;  1FAY A;  2ORZ A;  3ZSK A;  1UPS A;  3P5B A;  4Y1Y A;  4P02 B;  1PK6 A;  4J1X A;  5FY8 A;  3SH4 A;  4LBJ A;  4GJY A;  4FOW A;  4MGT A;  1BVP 1;  1LGN A;  5E8A A;  2Y26 A;  2YDE A;  3JD7 2;  2BV4 A;  3ZDS A;  1OLR A;  3T2Q A;  3ZSL A;  3N7M A;  4I2O A;  4JGY A;  4CSW A;  4BXF A;  4LOT A;  2W3J A;  3HN3 A;  4L8Q A;  3OUH A;  3JD7 1;  1H8T B;  4JC1 A;  3KVB A;  1RUE 3;  5FP3 A;  1YIF A;  3I7D A;  1VE0 A;  3MFC A;  3WT3 A;  2DVA A;  2WWJ A;  1QQP 1;  1WCQ A;  5IAX A;  3G7D A;  1IG0 A;  3E6B A;  4IEX A;  5ANN A;  4IV3 C;  4AED C;  3GHM A;  1UY3 A;  5C8C B;  1PNF A;  4BQ2 A;  1FX5 A;  4XQW A;  1AL2 3;  1HQL A;  2CNA A;  3IDE A;  4JHZ A;  2WSV A;  3HIF A;  2IXH A;  4KBZ A;  4YYO A;  2CDO A;  1ULP A;  5A6Q A;  4TYS A;  3WQ0 A;  4PQQ A;  1XSQ A;  4HVO A;  4CCK A;  1VBC 2;  4MX3 A;  3ZN5 A;  1WCU A;  1RUE 1;  5EFU A;  4SBV A;  5FZG A;  3WG4 A;  1MS4 A;  1XU2 A;  5L7O A;  1CAU A;  3HBK A;  2G9F A;  4KWK A;  3P1I A;  1A34 A;  2W5F A;  4AEJ A;  1WLW A;  2VQA A;  2D7F A;  2XJS A;  1JZ5 A;  2XJP A;  1I9R A;  5FBJ A;  5AVP A;  3A4U A;  4GIQ A;  2H6B A;  1LOE A;  4N90 A;  3OBZ A;  4GKY A;  2D6M A;  1WZX A;  4N9H A;  4YGC A;  4XFG A;  5A7W B;  1SFN A;  3ZXJ A;  1LRH A;  2G9Z A;  2KR2 A;  2PLV 1;  3UL2 A;  4B4R A;  5GLW A;  1CD3 G;  3LA3 A;  3MF9 A;  2HEY F;  5L36 A;  1AR8 3;  1GQG A;  4XUN A;  4AFM A;  2CV6 A;  1I5Z A;  1DLC A;  3O1V A;  1AF9 A;  4ASM B;  1LHN A;  2E7Q A;  2Y64 A;  4QQH A;  2Q4S A;  3MIH A;  3WNM A;  4Z2W A;  2XJU A;  2ZGK A;  1WKY A;  1UZV A;  1JHN A;  2VCC A;  1W03 A;  3BGA A;  4NHX A;  3R6S A;  2ZGQ A;  3V56 A;  1GWL A;  1RUF 3;  4V1P A;  4E4Z A;  2Y0O A;  1SQ4 A;  3TN9 2;  4LT5 A;  2VXJ A;  3CJI A;  4Y5S A;  1RUF 1;  1W6P B;  4UW6 A;  1H2K A;  4GZ9 A;  2JEC A;  1GQH A;  1OBN A;  3VDD C;  3M70 A;  1DG6 A;  3D0J A;  5T5J A;  5H9R A;  4A41 A;  1JZ3 A;  1H8T C;  1YQC A;  5FZ1 A;  3KD4 A;  2WNE A;  2WT0 A;  1HRI 2;  1NQJ A;  3RFR A;  4GWM A;  4H2A A;  3WF1 A;  1OF4 A;  2W52 A;  1AR8 1;  3N9P A;  3TEZ A;  4UBH A;  3LPG A;  1SBE A;  2VMH A;  4Q8L A;  4O9E A;  3J8F 3;  5I0U A;  4XJU A;  2BNM A;  2VW0 A;  4E8C A;  1QJU 1;  2JDM A;  2P5B A;  4IE6 A;  4ZZ8 A;  2DUQ A;  2D44 A;  3QH7 A;  2BRT A;  5C8W A;  3JQX A;  3A0K A;  1BHG A;  3AFG A;  2ZXQ A;  4XF1 A;  4NMI A;  4R9D A;  1MQT C;  3TWI A;  4AVC A;  4XJ9 A;  4LK7 A;  1FNY A;  1KIT A;  4WM8 B;  2JDH A;  2V4A A;  1BQP A;  1TMF 1;  3IDC B;  4IGP A;  3F95 A;  3MF6 A;  1Q3E A;  5B4N A;  2BW8 A;  4E4S A;  4UW3 A;  1YXW A;  4A6O A;  4CEY C;  4YW4 A;  2VTF A;  4EWE A;  1UIJ A;  5FRA A;  1RUC 3;  5FZC A;  1PVC 3;  3K77 A;  5IK5 A;  3BTZ A;  3NJY A;  5F5I A;  3ZLI A;  5J3U A;  1J3P A;  4UFK A;  2K2S A;  2UWB A;  4Q0U A;  1Y7B A;  1IS4 A;  1JHJ A;  4RA0 A;  3T4H B;  3I2D A;  3SCH A;  4F8A A;  2JG8 C;  1Y4W A;  5L19 A;  4XFC A;  1X36 A;  1R1A 3;  5C3P A;  2OII A;  3POE A;  4Y1V A;  4AQS A;  1X50 A;  4LEJ A;  1GP4 A;  4A7Z A;  4EJR A;  5JR2 A;  2WL1 A;  3BTY A;  2JDZ A;  3ES4 A;  1NXM A;  4GJZ A;  5IWF A;  4W6X A;  4EN8 B;  3BOD A;  2VBD A;  1Y9M A;  3C3V A;  3LKJ A;  2Q8C A;  3EHK A;  5J09 A;  2HWE 3;  4CPB A;  1WCS A;  2GNB A;  1LUL A;  4F7Z A;  2D5F A;  1G6N A;  4QX2 A;  2V72 A;  1XE7 A;  4YFW A;  3B9C A;  1QNY A;  3PUA A;  1SAC A;  3WF0 A;  5C8C A;  2Q30 A;  4FOY A;  4MGI E;  2ZGM A;  3POW A;  1SFP A;  1XJA A;  3O1T A;  3M3O A;  4FPF A;  3TEX A;  4BQ4 A;  3ZM8 A;  5C9A A;  5IHR A;  5IYY A;  2K46 A;  2DCY A;  4QD2 A;  5LRR A;  5FUI A;  4FPC A;  4AAX A;  3III A;  4IXL A;  4SLI A;  2E53 A;  1AYM 3;  1N47 A;  1ASJ 3;  4CU6 A;  2AZ5 A;  1CAU B;  2DWR A;  3OD4 A;  1IZ3 A;  1W8H A;  2XUE A;  1K5M B;  4PI2 A;  1V6J A;  4B7K A;  4M3C E;  4WZF A;  2WNV A;  1W8Z A;  5FZM A;  3ZVX A;  3EMR A;  3IKW A;  3E5X A;  5DN2 A;  5CFC C;  1AX0 A;  2Q1M A;  5CB7 A;  1O5L A;  4IEQ A;  1DBN A;  3OBR A;  5JCT A;  2R1D A;  2ZBJ A;  5FYM A;  5JIA A;  5D1I A;  3MFA A;  2BFU L;  4CDW A;  3E6D A;  5FBZ A;  1W2A X;  1QF3 A;  1OA4 A;  2BNN A;  1VMH A;  4Y26 A;  3S5A A;  5I93 A;  4CU7 A;  4BQW A;  3E5Q A;  5IT6 A;  1N1V A;  2JDP A;  3THP A;  5JZG A;  4CVU A;  1NCR B;  1LOA A;  1SBD A;  3RZL A;  5M0T A;  1W6M B;  4LHS A;  1APN A;  5F1R A;  3ZXL A;  3CJI C;  2YB7 A;  1GOG A;  1XQN A;  5DZE A;  3IBM A;  4NWV A;  2GN3 A;  4A3X A;  3ZYR A;  5E88 A;  1SZB A;  5BNN C;  5AC9 1;  4KMQ A;  2RG4 A;  5LA0 A;  5FOB B;  4K9S A;  3NJV A;  3N9N A;  3ON7 A;  5L7O B;  1J84 A;  5ERL A;  4AHY A;  3IPV B;  4LA2 A;  3SNM A;  1AZD A;  5FZO A;  4CCM A;  2ZEY A;  4FFG A;  4N7I A;  5F8P A;  1VRB A;  4UOJ A;  1AXY A;  2MPF A;  4IUG A;  1ZZ9 A;  3OG2 A;  2PYT A;  3OYW A;  1ND2 B;  3JD7 3;  1EAH 2;  4Q0Q A;  5K8S A;  2PHL A;  4KI5 M;  4AQT A;  4CEW A;  2QQJ A;  4D6R A;  3MLJ A;  5JI9 A;  1MVQ A;  4W6Y A;  4BMB A;  3ZSJ A;  4HG6 B;  4AFB A;  4BIO A;  1F31 A;  4EQV A;  1X7N A;  3JB8 A;  4DXS A;  3NRU A;  3WQ1 A;  4QX7 A;  3LGR A;  4YG3 A;  3NJZ A;  3ZYI B;  3ZYB A;  4QGM A;  2CGO A;  4CCD A;  1OT5 A;  3AKT A;  1D4M 2;  1YO8 A;  2IXC A;  3LDR A;  4QPY A;  4YVW C;  1OQD A;  3CJI B;  2R04 2;  1H4H A;  3CL1 A;  3ZSM A;  2F6B A;  1GOF A;  4PIX A;  5I8Y A;  1JI6 A;  1LGC A;  1RHI 1;  3TRS B;  1W6O B;  2BDR A;  5A6Y A;  5FP8 A;  3WVJ A;  4B7E A;  3NAP A;  2XL9 A;  1D4M 3;  1ULG A;  1F5J A;  4I30 A;  1L3J A;  1TMF 2;  2MHF A;  1XSR A;  3TNQ A;  5FMO S;  2DF7 A;  5DAV A;  2ZX2 A;  3O1U A;  1KRI A;  1ZBA 3;  1DQ4 A;  2R7E B;  3TOJ A;  2BNO A;  4W50 A;  4JKL A;  1S4C A;  4IV1 B;  3ZKY A;  2HYK A;  2BOJ A;  3N35 A;  4RS5 C;  4D7S A;  2B4K A;  4HSJ A;  1T2X A;  3WDV A;  1LB2 A;  3CEW A;  3I8T A;  2CTV A;  4JAA A;  4UFL A;  3D8C A;  4YM0 A;  2JIJ A;  5FY9 A;  2O8O A;  2B46 X;  2HWE 1;  2X10 A;  3PDQ A;  5BXX A;  1ST8 A;  4MXW A;  3AK0 A;  4Z1V A;  4FFI A;  2P3Y A;  4R4Z A;  3UKN A;  4E9K A;  2JIG A;  1C1L A;  2ZEW A;  4IE0 A;  3RI8 A;  3N9M A;  3BOP A;  3R0R A;  2VOV A;  2WO1 A;  1JZ7 A;  2A1X A;  3SKV A;  4AFA A;  1NLS A;  5DUU A;  4OFG A;  2GC0 A;  3FUQ A;  3B3Q E;  2B7Y A;  2PTM A;  3HNY M;  4Q0S A;  1FOD 1;  2ETE A;  3DGT A;  5LZ6 A;  1ZA4 A;  4MGS A;  1IS5 A;  4AWD A;  1RXF A;  3MLL A;  1AR6 3;  2PHW A;  2VE1 A;  4LOS A;  4BCU A;  3VD4 A;  2GME A;  4MGY E;  3QCW A;  5E89 A;  2ZJC A;  1J1T A;  2PHT A;  1C4R A;  2B39 A;  5JUV A;  2CDP A;  4HKL A;  5DG1 A;  4QHZ A;  2WNU B;  3CZU A;  5EJ1 B;  3VD9 A;  1BXH A;  1V6L A;  2WKK A;  2RJ2 A;  3TNP B;  5FO7 B;  4I3P A;  5K4L A;  1H2N A;  3FUO A;  3APB A;  1QQP 3;  1YNA A;  2A73 B;  2FCU A;  1BZW A;  4RFT 0;  1X8E A;  2P4E A;  4L92 A;  4Q0P A;  4AI2 A;  4CDW B;  1Q8S A;  3V0A B;  1XOY A;  3POB A;  3ZMO A;  1UXX X;  2G19 A;  2HWB 3;  5FZA A;  2X5I C;  1H1I A;  2YYO A;  4RHV 2;  4BU2 A;  2DVF A;  3AZZ A;  1G9F A;  4B1L A;  4FAG A;  5JZG B;  1NCR C;  4PLN A;  5FUP A;  4OHZ A;  3VBS B;  1DGW A;  4TZD A;  3LIG A;  4AEM A;  4Q4X 1;  4MET A;  4QB2 A;  1OKO A;  4WM8 C;  4NHK A;  5A3U A;  2WAA A;  3PIG A;  1HQN A;  5LW9 A;  2JDK A;  3HEI A;  4XTM A;  1WLD A;  4W8J A;  4EN9 B;  3GBW A;  1ND3 C;  4QXK A;  1YFU A;  5FZO B;  5FR3 A;  2ORX A;  3FFQ A;  5EQU A;  2WQ4 A;  3Q8B A;  4MSV A;  1KJR A;  2IXI A;  2D98 A;  4C90 A;  4YSF A;  3K48 A;  3P3N A;  5C5U A;  2J7M A;  1WLT A;  2ARC A;  3WDX A;  3E6C C;  1GQP A;  2ILM A;  3ZFE C;  1MZ5 A;  3IB3 A;  5F5A A;  4BDV B;  4EWA A;  1V6N A;  1AJO A;  4XBQ A;  5C4W B;  2Q8E A;  3MUY 1;  2VUJ A;  3K51 A;  1LOC A;  3LQC A;  2EA7 A;  1HX6 A;  2BFU S;  2QTW B;  3GCX A;  4LUM A;  2WO3 A;  3AKS A;  5T5O A;  1C8M 1;  1RED A;  1W0N A;  4L11 A;  1MZE A;  3MGU A;  5JMO A;  3FLR A;  5BYN A;  5EPA A;  1ENS A;  2ZGU A;  4PQ9 A;  5JXH A;  3MYX A;  4OVE A;  5JDB A;  2ARE A;  4RQP A;  5LA9 A;  4WVM B;  3RJR A;  2V4V A;  4EZ4 A;  4DY5 A;  1LR5 A;  1YQ6 A;  1IQA A;  4QU1 A;  4UF0 A;  5I0R A;  5ACA 2;  1BMV 1;  4FOV A;  2HWF 2;  1UYZ A;  4XVH A;  3ZXF A;  3NAP C;  4YZ5 A;  3PTR B;  1ZYB A;  4GWI A;  4DXZ A;  2WQZ C;  3SEE A;  2HBT A;  3SCF A;  2DFC A;  1SLC A;  3BU7 A;  1W8W A;  3U11 A;  1R09 3;  3EQE A;  5AC9 3;  2X5I A;  2WO2 A;  4UW5 A;  1R08 2;  3ASI A;  2W39 A;  1TNR A;  5FFO C;  1D7P M;  1N3O A;  5DZG A;  3HVD A;  4LO6 B;  1EPZ A;  1U5Y A;  2EXK A;  2XUM A;  4HAN A;  4HKO A;  2TEP A;  2VZP A;  3VKL A;  1P8J A;  2WN3 A;  1QGL A;  4D7Y A;  4XQ4 A;  1JOD A;  1JYC A;  3ILN A;  1TQ5 A;  3OPW A;  1DLL A;  3I3E A;  3NNM A;  1UOF A;  5IVY A;  2ADE A;  2W0X A;  1C3H A;  3BUC A;  3BKZ A;  4BLJ A;  1WME A;  4CEW C;  5FYH A;  2BQP A;  1J3R A;  1HV0 A;  2FD8 A;  4FQ4 A;  3M8L A;  3D4K A;  1I5P A;  1DZR A;  4MO3 M;  3K3O A;  3A22 A;  4QHB A;  4YVS B;  1RC6 A;  4AHZ A;  3FC0 A;  2Y38 A;  2JD9 A;  5FKC A;  1TMF 3;  2QBX A;  1QJE A;  1PK6 B;  1GZC A;  2ZAB A;  3Q9O A;  4YLZ A;  3TN9 1;  1XB9 A;  4BQ3 A;  2XWJ B;  3MO4 A;  3H8X A;  1ULD A;  1V6M A;  3OCP A;  5HXV A;  3H1Y A;  4O7X A;  4QPW A;  4DEV A;  1OVP A;  4DRV A;  2WII B;  2WNU A;  3U10 A;  4GWJ A;  2XVK A;  4JGY B;  1MEC 2;  1RUH 3;  3AM2 A;  5FYC A;  4LK6 A;  4CUA A;  5JPN B;  3VBR B;  5JPM B;  2NMO A;  1PMI A;  1EPW A;  5KHG A;  3KF5 A;  1IKQ A;  1CGP A;  1UZW A;  5IAT A;  4AVA A;  1OMI A;  1KD7 A;  2HWD 1;  2UYA A;  4IW3 A;  4Q4Y 2;  4XJA A;  1YFY A;  3VN4 A;  1OLM A;  3WW2 A;  4CU9 A;  5J7M A;  1GIC A;  4OMD A;  2GSY A;  4X6R B;  3ETQ A;  4Q8K A;  4XHB A;  4YW1 A;  4C8D A;  1VMF A;  2YRO A;  2JB4 A;  4HXC A;  5FPX A;  1WCD J;  3OF1 A;  5JAX A;  3ZN4 A;  1POQ A;  3L2H A;  4NE9 A;  4YM2 A;  3ZYH A;  3AVR A;  3GHN A;  4Y1U A;  1PNG A;  4AQ6 A;  3M7A A;  2WNV C;  4DRR A;  5GZD A;  2VMC A;  2J1S A;  3AMH A;  1RUH 1;  5E16 A;  5GLT A;  4A42 A;  5F37 A;  1HRI 3;  2AUY A;  4Q2F A;  3MPP G;  3VL8 A;  3WCS A;  2YC4 A;  3BN6 A;  1YRZ A;  1S0G A;  3WIN E;  1COV 1;  1KJL A;  1FI2 A;  5BY5 A;  3PVN A;  3W58 A;  5HI0 A;  3KB5 A;  4UBG A;  5EV7 A;  4CPB D;  2VVD A;  1R64 A;  1PVC 1;  3JBG 2;  3GYD A;  4URT A;  3U4S A;  2Z5W A;  3FFZ A;  1W6Q A;  4BZ4 A;  1ND2 C;  2JX9 A;  5FZF A;  1HRV 2;  2GDF A;  2W2I A;  4BIF A;  1TME 3;  1VMJ A;  3RWN A;  5F3I A;  3A21 A;  4NHY A;  4DY3 A;  2YMZ A;  3J7N A;  2WFP A;  1DCS A;  1OPM A;  2JKB A;  3O12 A;  3OSD A;  4ISR A;  5ANQ A;  4DQA A;  5EXO A;  1QXR A;  2H0V A;  2XXZ A;  4CU8 A;  5IVB A;  1VBD 1;  1VBB 3;  5H9S A;  5JMC A;  3EBR A;  4Y1Z A;  4P9L A;  3HWJ A;  3ILF A;  2HEV F;  4MHR A;  4CUC A;  4LHN A;  2C9A A;  2IFR A;  2J1V A;  5FCC A;  4N53 C;  3KT4 A;  5CKM A;  1W99 A;  3VHN A;  4ZPI A;  2XKO A;  1UKG A;  3KS7 A;  3JXS A;  1R09 1;  4XQD A;  3BCW A;  2WS9 3;  1W06 A;  3AP6 A;  3VBF C;  1UKR A;  3OGG A;  4FP2 A;  5DUW A;  2OYZ A;  1RUJ 3;  1RVF 3;  2RM2 2;  2WFF 1;  3DKW A;  4PLM A;  3H8O A;  2ZS6 B;  4ET7 A;  2NLR A;  1IS6 A;  2YBP A;  4B3N A;  4AI8 A;  4EN6 B;  1O59 A;  3RQ0 A;  2XBO 3;  3GCW A;  5IVJ A;  1RUC 2;  4CCN A;  2QQP A;  3I3M A;  1GZW B;  1N1Y A;  1WWY A;  3KV6 A;  2IVJ A;  1GSL A;  4GWN A;  3EO6 A;  2W47 A;  1QJF A;  5ABJ A;  1O8P A;  1GMM A;  4ITC A;  4XJZ A;  1PO1 2;  1ACC A;  1CZS A;  1R1A 2;  4RSU A;  2VUL A;  4IEU A;  3RJ2 X;  4ZZ5 A;  4I01 A;  5FO9 B;  3Q8E A;  1RUI 2;  1VPH A;  1ZZ6 A;  1AYM 2;  3K4A A;  5ABJ C;  1AYM 1;  3S30 A;  5CAZ A;  2EIG A;  2OX0 A;  3B94 A;  4CDQ C;  1US3 A;  3WDW A;  2JDA A;  1SFY A;  1PO2 3;  3ATG A;  2RS5 2;  2E26 A;  4WVZ A;  1W90 A;  3WF4 A;  3HOB A;  1BYH A;  4LTA A;  2FZ1 A;  4Y4Y A;  3ZN6 A;  2B9U A;  1RUG 2;  4XDO A;  4AQ2 A;  2WWU A;  3LA2 A;  4XJW A;  2L9L A;  1YFW A;  4BA6 A;  3CMG A;  1PM7 A;  2VUA A;  3FBY A;  3MUZ 1;  2VQ0 A;  3WP6 A;  1VAM A;  2DU1 A;  1W3X A;  3PTY A;  5A32 A;  1H8V A;  5KR7 A;  1KFX L;  4KH9 A;  1XYP A;  4R52 A;  1O3Q A;  1OFS A;  4XAE A;  4PCR A;  3HQU A;  5JIU A;  2VZ1 A;  4N53 A;  4QB1 A;  4Q4W 3;  1AR9 3;  5A70 A;  3S7I A;  4UI9 L;  1ZBE 3;  1JYW A;  4I02 A;  2CAU A;  3JCI A;  3SH5 A;  5T50 A;  3WNO A;  2CHH A;  4OHY A;  4FQZ A;  1DGR A;  2LTN A;  4NAM A;  4M01 A;  3OY8 B;  3DPR C;  3WOG A;  1DQ6 A;  1UOB A;  2WYS A;  2ZX0 A;  2W1W A;  3OUJ A;  4RR3 B;  2XR4 A;  1UZ0 A;  2GC1 A;  2VUC A;  3AMM A;  3Q8C A;  4Y20 B;  3S0M A;  5JR7 B;  3HQR A;  4QDQ A;  3VZK A;  1WMD A;  1G7Y A;  3KF3 A;  4LJH A;  4XBN A;  2UU8 A;  4FXG B;  4RN5 A;  1QHD A;  4O9G A;  4H7L A;  2D3R A;  2JDY A;  4MUV A;  5CNA A;  4AE2 A;  2EAK A;  1QJX 1;  4GMP 3;  1CX4 A;  3LZZ A;  5FPA A;  5L73 A;  5A80 A;  3VZN A;  4AVB A;  5LEK A;  1H6X A;  3PJQ A;  4G9S B;  4XJ8 A;  4ZU7 A;  4UFI A;  3USS A;  2DTY A;  3H3Z A;  3VKM A;  1U5I A;  1COV 3;  1M06 G;  3HAG A;  3GZE A;  4G3Y C;  1AYN 2;  5FY0 A;  1J3Q A;  4DOU A;  1SLB A;  4Q4V 3;  4XCB A;  3ZYP A;  4KU8 A;  1OUX A;  2ZGO A;  2RS1 2;  3JBG 1;  4L0P A;  2Y0I A;  4XAA A;  1S2K A;  5HCB A;  4BWO A;  1KQR A;  1QJX 2;  4COW A;  4AG4 A;  4Z8B A;  1JN2 P;  1PGL 1;  1QOO A;  2ET1 A;  1OQE A;  2UY9 A;  2W1Q A;  4LXL A;  4ISQ A;  4QX3 A;  1VR3 A;  5CFD B;  2VCM A;  2P34 A;  2A3Y A;  3OGV A;  1V9U 2;  1W0O A;  2Y6G A;  3C8X A;  1CPN A;  5LBC A;  1W28 A;  1XNT A;  4JV4 A;  1XE0 A;  2Y6J A;  1N1T A;  5FY1 A;  4KNC A;  2XOM A;  3VKO A;  2FDH A;  4XUR A;  1A8D A;  1LCL A;  4NRP A;  1MS3 A;  4CZS A;  1ULO A;  4QPI C;  1OUR A;  2CU5 A;  5JLV A;  1AR7 1;  1W2N A;  2HWC 3;  3R4S A;  4Q4Y 1;  5FZK A;  4YG6 A;  2JKX A;  2VH9 A;  1KEX A;  3KWV A;  3OYW B;  5H9P A;  3ZYJ B;  1G9D A;  3VLB B;  2SBA A;  3AP9 A;  4QAW A;  1RHI 3;  5FXW A;  1GZW A;  3NWK A;  1JOB A;  2GAU A;  2JDN A;  5G05 L;  3GGL A;  1MEC 1;  4QHO A;  1DU3 D;  3UKV A;  4Y33 A;  4AGR A;  4DMI A;  4CP1 A;  4PLO A;  3H8R A;  4LHL A;  1VBB 2;  5DPN A;  5FWJ A;  3MHZ A;  1NUK A;  2Y60 A;  5JXI A;  2QE3 A;  4ZXK A;  3I3Q A;  1OI6 A;  2ADD A;  3IWZ A;  3HR9 A;  4I0B A;  4K8R B;  5F2W A;  3KSC A;  3OBA A;  3PIJ A;  5A7P A;  4HOO A;  5L7O C;  5FZ3 A;  5FPZ A;  3KT1 A;  3T2T A;  4ZON A;  4WVV A;  2VME A;  2CY6 A;  4XXP A;  3PVE A;  2D6L X;  4HT1 T;  4JDM A;  1RVF 2;  2RM2 3;  4XUO A;  1O4T A;  2WSU A;  4CCO A;  3LCP A;  1JXN A;  2P37 A;  3RZG A;  2VZ3 A;  1F15 A;  2WZR 3;  2WZ8 A;  1HB1 A;  4NRM A;  1RIN A;  2ZEZ A;  4PBP A;  4YW5 A;  3WDT A;  4EN0 A;  3I2O A;  4CDU C;  3ZIW A;  4CRQ A;  5IK4 A;  2QDN A;  2XON A;  2B5H A;  3E5U A;  4XDQ A;  3J9S A;  1OVS A;  3NV4 A;  1B35 C;  4R9C A;  1ODM A;  2VQT A;  3LA7 A;  1JMU B;  4KU7 A;  1SCS A;  5LRS A;  2EIE A;  2QDR A;  2RR1 3;  4IE4 A;  3FHA A;  5CA6 A;  1UOG A;  1SEF A;  1CES A;  2JG9 B;  3U75 A;  1RUO A;  1K5M C;  3WQB A;  4NHL A;  3MBW A;  1C1F A;  4TWT A;  3N7L A;  4L2N A;  1BMV 2;  5CG9 A;  4KG8 A;  1EY2 A;  1LGB A;  1YIP A;  2LUW A;  1REF A;  4LOR A;  4U2A A;  4GH4 C;  4W4Z A;  1IOA A;  4K40 A;  4ORF A;  4JVA A;  4D8M A;  1CIW A;  1PVX A;  1OD3 A;  5FIX A;  4OI0 A;  3SKJ E;  4BIS A;  2NM1 A;  4IND A;  4W65 A;  4WV8 A;  2E63 A;  3T4V A;  4CCL A;  5JSO A;  3MIE A;  5J36 A;  2HWF 3;  3OJB A;  2WS9 1;  1HXS 1;  4AGV A;  1C8M 2;  4PF5 A;  2C5D A;  4M0N A;  5A32 B;  1VBE 1;  3VBF A;  3LD8 A;  5HV4 A;  4XC9 A;  1DYO A;  1ZVF A;  3NV2 A;  3VBS C;  3DF0 A;  1UX6 A;  5T52 A;  3HNB M;  4LR4 A;  3CF6 E;  1HRV 1;  2DUP A;  5A6Z A;  1UW8 A;  1CON A;  5FO8 B;  1FNZ A;  3UJQ A;  1VBC 3;  2P2K A;  1QU0 A;  1UNB A;  3DXT A;  5EYY A;  5DDJ 2;  1J1L A;  5J98 B;  3S6P A;  1PVC 2;  4YZ3 A;  4AZZ A;  4XFA A;  3PVB B;  3I2I A;  2P6C A;  5CFD A;  2RMU 3;  5JSP A;  3IMM A;  2DV9 A;  1ENX A;  3IN9 A;  2VGD A;  4QDS A;  1QOS A;  2YPJ A;  1ENR A;  4JDO A;  4QT6 A;  4BHP A;  4KG0 A;  1UL9 A;  2I2S A;  1ONA A;  2WO7 A;  4PHZ A;  1UN1 A;  2TBV A;  1FV2 A;  1CPM A;  4PDW B;  3J7M A;  2EXH A;  4FPH A;  4H7M A;  5FZ4 A;  2VNR A;  3B00 A;  4IER A;  4LNV A;  4RGK A;  3UGG A;  2DUO A;  3WF2 A;  2OT7 A;  1YFX A;  3NL1 A;  2ZZJ A;  2IZW A;  5CBL A;  1E5I A;  4A4A A;  4XIL A;  4XFH A;  2QNK A;  2JG9 C;  3NNL A;  3U0Z A;  1GU3 A;  5DAW A;  1MPX A;  4XIO A;  2QZ3 A;  1UYX A;  1QEX A;  4JQR A;  4LBQ A;  5B4X A;  1CAW A;  1O5U A;  5A33 B;  1W05 A;  4UFH A;  2A6V A;  4JGZ B;  4UW4 A;  2QKD A;  3VB9 A;  2BGO A;  3ZFG C;  1KS5 A;  5DQ0 A;  3RG0 A;  4IV3 B;  4LO7 A;  1POV 3;  5HXM A;  4WM7 A;  1J58 A;  4J6G A;  4YZ4 A;  1POV 0;  1OXC A;  1UAI A;  4K8F A;  5LAS A;  4GAL A;  1QJU 3;  1NQD A;  3TBD A;  5DAQ A;  5A7S A;  3LEI A;  1QJZ A;  4HN1 A;  4MYE A;  3LEM A;  5L9R A;  3LDB A;  4AR2 A;  3J8F 2;  1REE A;  4FAH A;  4DNY A;  1PZ8 A;  1V6I A;  4LBO A;  1BEV 2;  3NKT A;  4Y22 A;  1X9P A;  4UT5 A;  3HPN A;  2Q8O A;  5JXG A;  5DAB A;  2PHF A;  2YBS A;  2AGS A;  1HB4 A;  1MAC A;  2C4X A;  1EV1 1;  2QQW A;  3POF A;  4NPR A;  2J1A A;  3C7F A;  4QM9 A;  5AFE A;  2JE7 A;  3NMB A;  4KBB A;  4IQP A;  2GP3 A;  2VR4 A;  4O61 A;  4X6Q B;  1MS5 A;  5FZI A;  5F32 A;  4V2W A;  4MG2 A;  5T5L A;  2R49 A;  4A45 A;  3UES A;  3DXU A;  2WT2 A;  1XRU A;  2B9V A;  4KGG A;  2JJ6 A;  3CBN A;  4QM8 A;  5FK8 A;  5JI7 A;  4LUK A;  4XF4 A;  5CU1 A;  4E2Q A;  1YHF A;  2C1F A;  3ELN A;  2P17 A;  3NKG A;  4AF9 A;  3MV0 1;  3PUI A;  3LSE A;  2AH2 A;  2R0H A;  1DGL A;  2R6Q A;  2UYB A;  3R4D B;  2FQP A;  4IEV A;  3TYJ A;  1Z78 A;  5F5C A;  1ZBE 1;  2BTV C;  2ZGL A;  2D3S A;  2ZKL A;  4M0H A;  2D6K A;  1YWK A;  5FMB A;  3E1F 1;  2ZX4 A;  3SMH A;  1Y9Q A;  1FV3 A;  1FMD 2;  4LLO A;  5HPO A;  2YHJ A;  5ACA 1;  1UOJ A;  1OA2 A;  4RR3 C;  5FZD A;  1AVB A;  5CFD C;  3FZ3 A;  2HWB 2;  2D43 A;  1MQT B;  2WZR 2;  1O3R A;  2P3K A;  2EIB A;  2R32 A;  3GZU C;  4QX8 A;  5IAV A;  3PUQ A;  4PIZ A;  1XU1 A;  4D3W A;  5KBF A;  1JS9 A;  4AED B;  2PHR A;  4DXR A;  4DUX A;  1HRV 3;  1VB4 A;  2QQI A;  4MGK E;  1ULC A;  2W1S A;  5LK7 B;  1RXG A;  1DGR N;  2FCV A;  2VNG A;  4RGG A;  1IPJ A;  1SLT A;  4QQO A;  3ZR5 A;  1D0H A;  1NA1 B;  3S57 A;  4ASK A;  4RQP C;  1NLR A;  3ITQ A;  5BNN A;  5APA A;  4CP0 A;  1EYB A;  4P5Y A;  1SDW A;  1ZZ7 A;  4L9B A;  3USU B;  2VJX A;  3ZDV A;  4BK4 A;  3I2H A;  1JU3 A;  2VEC A;  3MDP A;  4XZU G;  3ZPY A;  5A7O A;  4BQ1 A;  4XXA A;  5GJ6 A;  3N9O A;  3IDA A;  1G9C A;  1V0A A;  3IIA A;  3T1M A;  2WLQ A;  1PGW 1;  1HB3 A;  5GKA C;  2H6C A;  4J1W A;  4NOT A;  4RGA A;  4TN7 A;  1Q8V A;  1KXG A;  3BOW A;  1BKZ A;  4NR1 A;  5LCW L;  4OZO A;  1K5M A;  2YY1 A;  1UU4 A;  1S0F A;  2R06 3;  1VBA 2;  4RHV 3;  2WNV B;  2FDG A;  2XBO 1;  5LBE A;  2C6S A;  1RMU 1;  5T54 A;  4FPG A;  1JZ2 A;  2CWS A;  2R0F A;  3K4Z A;  1FXZ A;  1VP6 A;  3NQH A;  2VC9 A;  5T3N A;  3UYJ A;  1FPN 1;  4YGE A;  3KQR A;  5F5Q A;  3OD0 A;  1NA1 C;  1W9F A;  3DYM A;  4Q0V A;  5FQ0 B;  1D2S A;  1U0A A;  3OUI A;  2ZAC A;  4QB6 A;  4GKX A;  2Z4F A;  5FLH A;  3GJB A;  1LOB A;  1NCR A;  4AXO A;  5IVC A;  3AKR A;  3M4F A;  2D3P A;  5KXE A;  1W6M A;  1B35 B;  3UK9 A;  5J37 A;  2VTX A;  1OSG A;  3W5N A;  4WM7 B;  1TZO A;  1V6K A;  2RS3 3;  5GLV A;  3K2O A;  4AI9 A;  4YW3 A;  4BLI A;  4XMA A;  1QJY 3;  2VUD A;  1DZT A;  1OA3 A;  3CNA A;  3T09 A;  4PDW A;  4KWL A;  1AX2 A;  4K21 A;  5BNO B;  2OQ6 A;  5ACA 3;  1Y43 B;  3BYW A;  3K3N A;  3HBZ A;  3RYR A;  4HMZ A;  1OOP C;  5C3S A;  4QX1 A;  3F2Z A;  3THC A;  4DEQ A;  1D4V B;  1EP0 A;  1QJY 2;  2EID A;  4H14 A;  2JIC A;  2ZAA A;  4Q5O A;  5FYS A;  2HKX A;  5DAX A;  5FMC A;  1I1E A;  1FAT A;  2KXL A;  2LRP A;  1GLH A;  5HCH A;  1OC1 A;  1H2M A;  1U12 A;  4CEW B;  5ISL A;  1LOF A;  2WNO A;  1D0G A;  3PU3 A;  2QZ2 A;  2VZR A;  1WGP A;  1KDK A;  4JGZ A;  1ZRF A;  5ABJ B;  2WQ8 A;  1ZRE A;  3MEP A;  1GP6 A;  4A3Z A;  1Z7S 1;  5LA2 A;  4BYY A;  4AGG A;  2LW8 A;  3H3L A;  1JZ6 A;  2E7T A;  3D0S A;  1QY4 A;  4NRO A;  4CE8 A;  2RMU 1;  1DIW A;  4HN0 A;  4MGQ A;  4XOG A;  3ZFE B;  2WIN B;  2OA2 A;  4CP9 A;  4FVV A;  1JYI A;  3K4D A;  1IGO A;  1TG7 A;  2DVG A;  2G9G A;  4RFR B;  1PGL 2;  2XML A;  1R08 3;  1WMF A;  3IDB B;  4EWD A;  1G8W A;  1XYO A;  3ZYF A;  2OZJ A;  4K7J A;  2ZPX A;  4X8N A;  3ME2 A;  2R04 1;  2PA7 A;  3H50 A;  1AL0 G;  2WYF A;  3ZN6 B;  1D4M 1;  1C8N A;  2A6X A;  5C71 A;  4FO9 A;  1K45 A;  1UYP A;  2BJS A;  2ZCW A;  5K0U A;  3UT0 A;  4COY A;  2R07 1;  2AEN A;  1DQ5 A;  1Z7S 2;  5FY5 A;  1ZA7 A;  4OUL A;  4P9J A;  5FYB A;  2O0O A;  3O0V A;  4HVQ A;  5I91 A;  2YFZ A;  4MXW B;  5FY4 A;  1W9W A;  2CYF A;  1UMZ A;  1WBL A;  2VCA A;  1RMU 3;  3LEK A;  2Z2S B;  3RZZ A;  3WW1 A;  1LHU A;  4YVW A;  3D82 A;  1H9P A;  1S0E A;  4WZC A;  1AR6 2;  3GAL A;  1PHM A;  1B09 A;  1PMJ X;  1H0B A;  1YYN A;  2RJL A;  3AMN A;  3GNE A;  4MVT A;  4YPJ A;  3RWK X;  2K9Z A;  1F35 A;  2AAC A;  3OY8 A;  2BER A;  1WLC A;  4XAC A;  1HIX A;  2BWC A;  4AW7 A;  1XNB A;  3OEA A;  4GB3 1;  4M3C A;  4HKW A;  5GZF A;  5A3O A;  2BBV A;  3WNN A;  2B42 B;  1GFF 2;  2OS2 A;  5A1F A;  1NCQ A;  4JZR A;  3AX4 A;  3HJR A;  2PXJ A;  2WAO A;  2VOX A;  2XJT A;  2RDS A;  2XL7 A;  3MI8 A;  1UWW A;  5I0T A;  1Z7S 3;  3POG A;  3CLP A;  3AZW A;  4FPO B;  4NII A;  1GZT A;  5KHJ A;  1GNZ A;  2V5D A;  2XQX A;  1Z0H A;  3J26 N;  4AAP A;  1JOJ A;  1H2L A;  4YZ2 A;  5BNN B;  2BPA 2;  4DO0 A;  2D6P A;  1MS1 A;  4IDZ A;  5FP9 A;  1RYY A;  4ZXE A;  3UKT A;  3V0A A;  4FPE A;  4Q1P A;  5FQ0 A;  5L9B A;  1NE6 A;  2QQN A;  1MVE A;  5GLU A;  3KLS A;  5FZ9 A;  3GJA A;  4FSJ A;  4GXL A;  1VBA 1;  3AB0 A;  3DEM A;  5KWR A;  3CKH A;  5DUV A;  1XXN A;  4L97 A;  3A0N A;  5LAT A;  5C70 A;  3V64 A;  1W6N B;  4YZ1 A;  4Z92 B;  4YGD A;  2RDR A;  5A3W A;  4PF1 A;  3LPF A;  4QKD A;  1HLC A;  4CDX A;  5FAX A;  2YU1 A;  2LS6 A;  1ZRR A;  2X53 S;  3BIE A;  3I3B A;  4HK9 A;  1N3Q A;  1XBF A;  1LU1 A;  1W8F A;  2DCT A;  2A7A A;  3KM5 A;  5A1A A;  4EYU A;  4FTE A;  4JRL A;  4Q26 A;  5EP9 A;  2ARA A;  1PK6 C;  2RR1 2;  4UWD A;  5C4W A;  5C9A C;  4I0W B;  2AEY A;  3OTF A;  5BNQ A;  1SHW B;  5FYI A;  1DHK B;  5FTT C;  2N7G A;  5FP7 A;  1VBE 2;  5KHK A;  2VMG A;  4LIU A;  4AK3 A;  4MOA A;  2RV9 A;  4UYB A;  4R4X A;  1RUG 3;  2WC2 A;  4NAO A;  4XF3 A;  3UV9 A;  2YV8 A;  2D6O X;  2P3J A;  2ERF A;  2A71 A;  4DPN A;  4COZ A;  3RGB A;  4RQP B;  1YCI A;  3T1L A;  4GUL A;  4LBN A;  4LPL A;  3VD7 A;  5K7P A;  4E4H A;  2HWB 1;  3VBO B;  4CP9 B;  2NN8 A;  4NVP A;  3SCG A;  4MV2 A;  4ASL A;  1LTE A;  1OOP A;  3KGZ A;  1LU2 A;  3KCX A;  1MS0 A;  4Q4V 1;  1RIR A;  3W5M A;  1AR9 2;  3ORJ A;  2VBB A;  4ZKT B;  2CSG A;  5FXV A;  2VZT A;  3WG2 A;  1Q56 A;  4XFI A;  5FYU A;  3ZSE A;  2Y33 A;  1ASJ 2;  4XF0 A;  1L7Q A;  3SH3 A;  5FUN A;  3WDY A;  4GD4 A;  2LRO A;  1V00 A;  1DYK A;  4E27 A;  1JYX A;  2ZHM A;  1T6G C;  1VBA 3;  3DKQ A;  2IUW A;  4BM8 A;  5BNP A;  3I97 A;  5K0U B;  5EZW A;  3VBO C;  2RS3 2;  4W6W A;  3T3Y A;  2GC2 A;  2J1E A;  4OUM A;  3QOP A;  3B02 A;  2EXJ A;  1U5X A;  2Q8D A;  4P9X A;  2DCZ A;  3KGL A;  3IM0 A;  4RYD A;  3FHQ A;  1T6B X;  4YNI A;  4CDQ A;  1FOD 3;  5C4W C;  3TEY A;  3PUH A;  5A3T A;  4S2G A;  2FDK A;  1EV1 2;  2QQM A;  2WN2 A;  1WBF A;  2VXR A;  1ZRD A;  1HRI 1;  3LEG A;  5L9V A;  3V0B A;  4D7T A;  4DS0 A;  1MZ6 A;  4QPG A;  1BEV 1;  4OHX A;  5FWE A;  2VNO A;  3ZPO A;  3E97 A;  3J8F 1;  3U4X A;  3WUD A;  5FPU A;  2JEM A;  4N7U A;  2EXI A;  3O0W A;  4P9W A;  2PHU A;  2RS1 3;  3I59 B;  5DDJ 3;  3RNS A;  1QNW A;  1RTV A;  4Q1R A;  5CVR A;  2W46 A;  1OHF A;  2RS5 1;  5KXD A;  3I49 A;  2PFW A;  2DCJ A;  2Y6L A;  3J4U H;  2XJV A;  4LBK A;  3LIH A;  4DXT A;  4DIQ A;  3H7J A;  4GH4 B;  4XHX A;  5BUV A;  3VBF B;  1W8T A;  2LAL A;  3VBR A;  2HEW F;  4LE3 A;  1KDM A;  3GDB A;  4N43 C;  4HBN A;  1EAH 3;  4MAD A;  1W2U A;  5FMO L;  4Z2A A;  3HNM A;  1JTZ X;  2CGN A;  3KHB A;  3RYK A;  1CVN A;  1HJF A;  4AYU A;  2ZGP A;  2CL2 A;  2C24 A;  3WNX A;  4DFS A;  2PLV 2;  4Z82 A;  2PAE A;  1NT0 A;  3MIG A;  4PI0 A;  5F6L B;  4L99 A;  2F17 A;  4JKK A;  4HPK B;  5C3R A;  3ZX7 A;  2R16 A;  2MEV 1;  2GU9 A;  3S7E A;  2FCT A;  4OYU A;  5GZC A;  1OLM E;  2V09 A;  4M3C B;  2XVG A;  4IE7 A;  4C91 A;  5KHI A;  1G9B A;  3R05 A;  3JUU A;  2Y6F A;  3DEC A;  4A7K A;  1YQ8 A;  2Y6H A;  1NCQ B;  2FZ2 A;  2VW1 A;  2JEN A;  1QMJ A;  2A3X A;  3EB7 A;  2R30 A;  1S55 A;  5AVA A;  5A1L A;  3LWC A;  3PU8 A;  1AXK A;  3PHM A;  1ALY A;  2ZKN A;  1X82 A;  1A3K A;  3FE5 A;  5HCF A;  2XLF A;  2Z42 A;  5DDJ 1;  1R09 2;  3HQX A;  5CYY A;  1K5J A;  2J1T A;  3HT1 A;  1QDO A;  1YJL A;  2JE9 A;  1PGS A;  2UWC A;  4PIY A;  1RJ7 A;  1BEV 3;  4LKS A;  3SQO A;  4D69 A;  3KHC A;  1PIV 1;  2ES3 A;  4NIG A;  1OQ1 A;  3WW3 A;  4LBQ B;  5JOZ A;  1CAX A;  4XUQ A;  3BPS A;  2ZOE B;  2VTX J;  4YWA A;  4R9A A;  4B4Q A;  1W9Y A;  2W1U A;  1OFN A;  2B45 X;  3RRD A;  5EHD A;  4IV3 A;  4F83 A;  1HXS 2;  3VBH A;  1UX7 A;  4OUS A;  2WS9 2;  3WG1 A;  5DZF A;  5J96 B;  4QKN A;  3AXE A;  1XNC A;  2ZHL A;  1W6N A;  4Y3O A;  5LA1 A;  4OHV A;  5FZ7 A;  2QQK A;  1GP5 A;  2B8M A;  2VNV A;  1VAV A;  3AZX A;  2DVD A;  2FDJ A;  5SV8 A;  5C33 A;  1F4H A;  2EF6 A;  1S0J A;  4P5H A;  1GNY A;  1JYT A;  1KS4 A;  2BUK A;  1PZ7 A;  4JGY C;  4HSL A;  2Z69 A;  2ZAH A;  5GAL A;  1VRH 3;  4LUL A;  3LDK A;  3ZFF C;  2Q1F A;  4Y22 B;  1LHV A;  1COV 2;  3A7Q A;  2RHP A;  2KM2 A;  4AHX A;  4B8E A;  1FMD 3;  1PO1 3;  2LM3 A;  1MEC 3;  1RUH 2;  2WWS A;  1HJG A;  4M4R A;  1W9S A;  2BP6 A;  5BNP B;  2YXS A;  3NNG A;  1VRH 2;  2XDV A;  4PBO A;  2FDI A;  5FPL A;  1VBE 3;  2DU0 A;  3ZFG A;  1RUI 3;  5FMD A;  4JGZ C;  4BPZ A;  2VQU A;  2AC1 A;  1NKG A;  1ZZC A;  4Q4Y 3;  5CFC B;  2JXA A;  2VU9 A;  1RJ8 A;  3P3P A;  4QDR A;  4ZS2 A;  1AR7 3;  2V73 A;  4MLO A;  3AP7 A;  3B5L B;  1BBT 3;  2GH8 A;  2FMD A;  4MHU A;  4ZU5 A;  4OI1 A;  4EN7 B;  1BBT 1;  1YLL A;  1RVF 1;  1GWK A;  4LO4 B;  2ZGR A;  2G1M A;  4QGL A;  4LIT A;  4NRQ A;  4AFD A;  4CXW A;  2FDF A;  2D93 A;  2JE8 A;  1BK1 A;  1A8M A;  1AUY A;  4LE4 A;  1GR3 A;  2WT1 A;  1UQX A;  4XZP A;  1LHW A;  4QQ2 A;  3UET A;  4M00 A;  4Y4R A;  3PLQ A;  5JOX A;  5A6X A;  2I07 B;  1R1A 1;  1GYK A;  1XNA A;  1PO1 1;  4LKE A;  1UMI A;  3B93 A;  2JDU A;  4HON A;  4YGB A;  2ID4 A;  3VDC A;  4ERO A;  2YC2 A;  3MIB A;  3KV9 A;  5CZK A;  3ABZ A;  3DPR B;  5FXX A;  3UNP A;  5IVF A;  2MEV 3;  5F9T A;  4AOC A;  1VRH 1;  1TME 2;  4M3C F;  4OQ8 A;  1NA1 A;  3B01 A;  3AP4 A;  1WA4 A;  2KD7 A;  4HET A;  1RUC 1;  4QQP A;  4G4F A;  3FLP A;  2HYX A;  2C26 A;  3USU A;  3URF A;  3I3D A;  1N1S A;  2CGP A;  4YFZ A;  2IXJ A;  1DQ0 A;  2RM2 1;  3GBF A;  1ZRI A;  2BVV A;  3K75 B;  2XJR A;  3KMH A;  4QPG B;  4Y5Z 0;  2WUH A;  5FK7 A;  3MW2 A;  2H0B A;  1OUS A;  2R07 2;  3ACF A;  3KQ4 B;  5I8S A;  3ZYG A;  4HFS A;  4Y20 A;  4ZS3 A;  3I59 A;  2WAB A;  4FFF A;  5G04 L;  3W21 A;  1UY2 A;  4NPM A;  4TXW A;  3DYP A;  4XYX A;  1RUN A;  3P6B A;  5FYY A;  5FP4 A;  4GH4 A;  4YAR A;  3PL0 A;  2WZP P;  2PQQ A;  5KC5 A;  1AR9 1;  4IEP A;  4BB3 A;  4NN0 A;  4Q4V 2;  3WNP A;  3DV8 A;  2D97 A;  1QDC A;  4IEZ A;  4YW6 A;  1D2Q A;  1S0D A;  2TUN A;  5FYV A;  3WNL A;  1ZZB A;  2RMU 2;  2YFU A;  5F3E A;  2XHK A;  4GAZ A;  2JWP A;  1BLZ A;  1BCX A;  1CZV A;  5F6K A;  4HPK A;  1SCR A;  3WX5 A;  1AXZ A;  1CAX B;  2A5Z A;  3POJ A;  5FPV A;  3T2O A;  3ZFF B;  4FTB A;  1W8N A;  1WW4 A;  1B35 A;  4NIH A;  1HKD A;  5DXD A;  2A3W A;  4C0H A;  1AHS A;  1EV1 3;  2BVB A;  2ZEX A;  4QGN A;  3HD8 B;  4CXX A;  4GMP 0;  3PMS A;  5FZL A;  3KZ4 C;  4CDU A;  3IMN A;  3IAP A;  1HB2 A;  2X09 A;  3I54 A;  3ROU A;  1XND A;  5LEJ A;  3TAY A;  5DUX A;  1C8M 3;  3SC7 X;  3CQO A;  4FOQ A;  1C5H A;  3M3E A;  3POS A;  3JB4 C;  1HN0 A;  1NAE A;  3WXP A;  3ETP A;  4RL7 A;  2P3I A;  3JZV A;  1A78 A;  2R04 3;  1FYU A;  1Y9G A;  1J83 A;  1WD4 A;  3CO2 A;  4LKF A;  3POY A;  1TE1 B;  1NLQ A;  3AL6 A;  3O5S A;  3AYE A;  3N9L A;  1POV 1;  5IJR A;  2BEO A;  3AYA A;  4LLF A;  2J1U A;  3WEZ A;  4IES A;  1DP0 A;  3C7E A;  3D6E A;  3LF7 A;  1Q8Q A;  3ZFG B;  5BV6 A;  5FDB A; 
#chains in the Genus database with same CATH homology
 1F15 A;  1LAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...