1LAJA

The structure of tomato aspermy virus by x-ray crystallography
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
174
structure length
174
Chain Sequence
NIASSSAPSLQHPTFIASKKCRAGYTYTSLDVRPTRTEKDKSFGQRLIIPVPVSEYPKKKVSCVQVRLNPSPKFNSTIWVSLRRLDETTLLTSENVFKLFTDGLAVLIYQHVPTGIQPNNKITFDMSNVGAEIGDMGKYALIVYSKDDVLEADEMVIHIDIEHQRIPSASTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*A)-3'
publication title The Structure of Tomato Aspermy Virus by X-Ray Crystallography
pubmed doi rcsb
molecule tags Virus/rna
total genus 29
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00760 Cucumo_coat Cucumovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.530 Mainly Beta Sandwich Jelly Rolls Cucumovirus coat protein, subunit A 1lajA00
1LAJA 1F15A
chains in the Genus database with same CATH superfamily
3ZYBA 1SEFA 1D4M1 1YI9A 5C3SA 2W94A 1UIJA 3WUDA 4ZONA 1QJU3 4FFFA 5JXGA 1YNAA 1CAWB 1U5ZA 1W6QB 1ZZCA 1F5JA 2RHPA 3MV11 2VZPA 5LBBA 4Z82A 5KC5A 4CEWB 4QGMA 3D5OA 4JGZB 3KVAA 2VVDA 2HWB2 1JTZX 2NM1A 1POV3 4CUBA 3K3OA 4LNVA 2AUYA 1MS1A 2B9UA 5FAXA 1CAVA 2TEPA 3WNXA 3ZM8A 5I0SA 4UW4A 2FZ2A 1ND2A 1RMU3 3K51A 1ZZBA 1YEWA 3GALA 3WF0A 5I93A 5LRSA 5FYCA 2WABA 4ZZ5A 3T2QA 3ZPOA 1O6UA 4A6SA 4DY5A 1ND3B 4NWVA 4DINB 1OURA 3OUHA 4IUGA 1H8TB 4N9HA 2QQVA 1HQLA 3N9LA 1IKPA 1JU4A 2YBSA 5A7OA 3UJOA 2PHUA 3ORJA 4RS5A 5EIYB 5C9AA 2ID4A 1VBE1 3AP7A 5I8SA 1IG0A 4QX2A 2H0BA 4FOWA 4R8HA 4UW6A 4B8EA 3QCWA 1QJU1 2VNGA 5BY5A 3B7MA 1SFNA 4GMP3 2WLPA 3WG1A 5BYNA 3OGVA 3ZVXA 1ZYBA 3LPGA 5FPAA 3V65A 4LKFA 4XUNA 3B01A 4GWNA 3JB4C 1AX0A 5CFDC 4QXHA 5BNNA 2R0HA 2XLFA 2A6XA 4I3PA 4NOTA 3RG0A 5FR3A 5GLTA 1UOFA 1JMUB 1UU4A 2KXLA 3D82A 1AR63 4RL7A 3FFZA 1GFF2 3H1YA 4P00B 2Y6GA 3U4SA 1RMU1 3AKSA 1JZ4A 3Q9OA 3LIGA 3BOPA 2OXBA 1ZBA2 4P9IA 3VBHA 1PX3A 1SLLA 1V6NA 2JG9B 2GU9A 2XKPA 1WBFA 2X29A 2VVFA 4XJ9A 3EB7A 2EIEA 4NJ4A 3U37A 1PZ9A 3BPZA 4XUTA 1RUF3 2HBUA 3ZFGB 1GNYA 1OKQA 1JYVA 1CESA 1K45A 2NPIA 2PHLA 3W21A 5BNPC 2IXKA 4ZU5A 4C8DA 4A3XA 2D43A 4MUVA 2R1BA 2FDFA 4Q1RA 1AF9A 2QZ2A 3VBSB 1N47A 4NPRA 1BQPA 4Q4V3 1H6XA 2WFF1 2XVKA 2IXCA 1DYOA 3P6BA 1XSRA 4YVWC 4M01A 3BGAA 3WW1A 4HK8A 2WBKA 4CU8A 2YFUA 2ZX2A 5EPAA 3BIEA 2RG4A 1OBNA 2OPKA 2V4AA 1QXJA 4BA6A 2XWJB 3M3OA 4QGNA 4A6OA 1S2KA 1UY2A 1EV13 2GMMA 2VTFA 3IDCB 3EBRA 2Q5TA 4W6YA 2PHFA 2WO7A 1AJOA 1TNFA 1LHNA 5F39A 5FJKA 4QXKA 1AR61 2VZOA 4NWWA 1ODMA 5CU1A 2OYZA 2Q8CA 3POWA 5JOZA 3D0JA 4GWJA 3LIHA 4YZ2A 1C1FA 1G7YA 1QIQA 2D98A 2OW4A 4PT6A 3WP4A 4HPKB 2QQMA 1I1EA 2Z69A 2ET7A 1NCQB 3AVSA 4Y4RA 1LHVA 4OI4A 2H0VA 4XFCA 4K3UA 2BNNA 3VL9A 4L92A 1OPOA 2JKXA 1CAWA 1W6QA 4BQYA 1PGSA 4LT5A 3ES4A 2DURA 3RYPA 1ULCA 3IMNA 2ADDA 4CEWA 2HWD1 3S5AA 2E33A 1QDOA 4JGZA 5F5AA 4Z92B 3T0BA 4DNYA 1AXKA 3ZMNA 2EXIA 1W9FA 4RYDA 2NMNA 4V2WA 4XJWA 2E31A 3AKQA 3H7YA 1ZM1A 5JSPA 5C3RA 1W06A 3H9AA 3IIIA 1FMD2 3CLPA 2J1SA 2ZX1A 3TNQA 5IK4A 3T2TA 1YFWA 2XBO2 1RUE2 3NNMA 4I2OA 3WQ1A 1TNRA 1VE0A 1ND3A 2ZJCA 3V64A 4RSUA 1O91A 2UWBA 4ZPIA 2E26A 2EXKA 5G04L 2IFWA 1XXNA 1LCLA 1LAJA 1H8TA 1WZXA 1Y43B 3RS6A 1DGRN 1O3RA 3T30A 2NYYA 3JQWA 4K40A 4TLGA 1W3VA 5FZ1A 4XF9A 4AI8A 4MGTA 4E4ZA 5IFPA 3KHCA 3OPTA 3ES1A 4YW1A 2HWF1 5FXWA 3L2YA 4XHBA 5FPVA 3VLBB 4AVBA 3J8F1 2RR13 3PJYA 5BNPB 4K8FA 3BODA 5A3LA 2Y60A 3WT3A 1C1LA 2XQXA 4QWNA 4LIUA 5AFEA 4URTA 1HRV2 1N3QA 4CA9A 2JWPA 2GP5A 1RUD1 3M8LA 2QQLA 4YVWB 2VQUA 1C8M3 2EAKA 1BJQA 2A6YA 1GZTA 3A0NA 3ZN5A 5L9VA 3BCWA 3DKQA 1NAEA 4XFIA 1FNZA 1LOGA 5IVYA 2DBIA 1GNZA 1QH7A 4CCCA 2A73B 1MEC3 5KBFA 2WUHA 4IL7A 5FYUA 1TE1B 4FCAA 3ZLIA 4AR2A 2JDMA 2OVUA 1ZZ8A 5JZGC 2VXRA 1BK1A 2X5IA 4MXVA 4WVZA 2YUEA 1FPN3 1AYM1 1GQHA 2JG9A 4BQ3A 5FYYA 1W8TA 4CCLA 1KS4A 1VMJA 2Y0OA 4KG0A 2AYHA 2QQIA 3GHNA 4B29A 4DO0A 3ZFGA 3DN7A 2ZX0A 5FZOB 1QY4A 4Q4W2 4XFAA 3ZYGA 5J09A 3RYKA 4XF3A 4OQ9A 3DPRC 3VBSA 4QKBA 3WNPA 4NHXA 2QDNA 2BWCA 2QJVA 2W9XA 1HV0A 1R64A 3ALQA 3JD73 3M2MA 4HKOA 1UPSA 1AR82 4IGOA 4NVPA 4BPZA 4KU8A 5JUVA 5T5PA 1LEMA 2VAUA 1US3A 1BBT3 1Q8PA 2RS11 4N7IA 5IVJA 4NR1A 1HRI3 1XU2A 2O8QA 1ULOA 4XF0A 5CYYA 3R05A 1GQGA 1R1A3 2YU1A 3J9SA 1W04A 1JZ3A 1C8M1 2ILMA 2NQYA 4CXWA 2G19A 5C33A 4DOUA 1KDMA 1LOFA 3NKGA 1MEC1 2I07B 3GJBA 3RMXA 4KWUA 4Q0UA 2QQKA 3CBNA 1NCQA 5ABJC 4YGBA 2P5BA 2YYOA 3LWCA 3OSDA 2Q8EA 1FPN1 4OHYA 1VJ2A 1JYIA 5FJHA 2ZGTA 2FDIA 5CADA 1LULA 1ZVFA 4XXPA 3SCFA 2V5YA 4XURA 5HXVA 4ASMB 2J1TA 2ET1A 3VBOA 5FQ0B 3G6JB 1COV3 2MNGA 4ITCA 3ZSKA 4URAA 4OLLA 3GDBA 1W6MB 3H8RA 5LZ6A 4LO8A 3KS7A 1DYPA 5DQ0A 5DZGA 5EJ3A 4D69A 3PJQA 3PUIA 4PIXA 1GUIA 3LEGA 2ZZQA 1SDDB 2YZ4A 3S6PA 5HCBA 2QFEA 2WNUC 2BGPA 4UWDA 4Q0VA 2BVVA 2RM22 3RVHA 1QJFA 3ZXEA 1R1ZA 2AGSA 2WAOA 1BBT1 3T4VA 3VHRA 5FZAA 1R1A1 4JRLA 5FK7A 1HLCA 2BEOA 2BZDA 4MV2A 4BIOA 2A75A 5C71A 3W59A 4E4SA 1C28A 2LUWA 3C8XA 3JU9A 1YIFA 1RVF3 2C4XA 2VOXA 3ZSEA 4CDUC 4C91A 1YQ5A 1K42A 2RS33 4GB31 4BXFA 1LU2A 1TMF3 5DUUA 4COUA 1ULDA 2PHTA 3EO6A 4WZCA 5FYSA 4IEUA 1CX1A 1EYBA 1XYNA 1RHI2 1XPWA 2P3IA 1HIXA 2OQ6A 5GLZA 1LESA 5BNPA 1CIYA 2XXZA 3R4DB 1RUH2 1Z0HA 4D3WA 1FI2A 3DPRB 1SHWB 2GNBA 3VKFC 3UGHA 2WDBA 2VVEA 3AC0A 4FPEA 3I2HA 5HI0A 5JSOA 4M3CF 4I3GA 4TZDA 4CCDA 4C1XA 2WIIB 4YVWA 3B02A 1QJX1 2VMEA 4CEYB 2HWC3 4IEPA 2PFWA 3GF6A 3WINE 3ZXJA 4EJRA 3K4AA 1VAKA 1JH5A 4BXSV 1EAH2 4O9GA 4OUMA 2E7QA 5FMDA 1MZFA 2B8MA 4I0AA 4KBBA 1ASJ3 4L0PA 4UW3A 1WD4A 3N7KA 5FZ0A 4DEQA 4E27A 2WT0A 3KF3A 4R9CA 2CSGA 3WP5A 4Y3OA 4DMIA 4QHZA 5LEKA 4JHTA 4MGZE 2JDAA 1AR92 4JTOA 3U0ZA 3ZXKA 5ABJB 2J42A 4Q26A 5FZOA 4UAPA 1TMF1 1VRH1 2FCUA 1H0BA 5FZ4A 4D6RA 5JPMB 5D2AA 2ZHKA 3HN3A 4QXCA 2BPA2 4YFWA 3VD4A 3WZ1A 2KD7A 1K5MC 2WWJA 2OQ7A 2WS93 3BOWA 4N43C 4KWLA 4QPYA 5E89A 2ZKLA 4CP9A 2LALA 4YLZA 2VZRA 1ULFA 4K6BA 2ZMNA 1LGCA 4XPVA 5FZ9A 4AQTA 4BH9A 1DP0A 1FV3A 2MEV3 2VW0A 3KGZA 5B4NA 1XQNA 4Q1PA 3RQ0A 4OFGA 2HH9A 2K46A 2VGDA 2VCBA 4F83A 1H9PA 3AM2A 1FATA 2YMZA 2Y6JA 3KV5A 5I0RA 4QKNA 3MIGA 2DFBA 5CKMA 1CZTA 4AVSA 1UNBA 4CPBD 2YBKA 2AZ5A 3NJYA 4YFZA 5JXHA 5CAZA 3SH3A 5FY1A 1WA6X 4COWA 1MS4A 1ZA7A 2TBVA 1OLQA 3B00A 1A8DA 3WF1A 1RUC2 2ZGSA 3OD4A 1AX2A 3PUSA 4K7JA 4UXAA 5KR7A 1KJLA 1OLMA 3H3ZA 1AZDA 1D4VB 1DQ1A 1YQCA 4DXSA 3TN93 4BDVB 2XR4A 3ATGA 1W6MA 4IV3A 3A22A 4WVWA 3A7QA 3LGRA 4K20A 4R9BA 2ES3A 4R9DA 2XGXA 3C7GA 3N7JA 3HNMA 1NT0A 4KG8A 2WS91 3EXUA 2EXHA 2WO1A 3ETPA 1NG0A 4PIZA 4Y5Z0 5FPBA 5FO7B 1C5IA 1OH3A 4N90A 3H8OA 1DZRA 2NLRA 1G9DA 3A23A 5BUVA 5FLHA 2XOMA 2ARXA 3EYPA 5DABA 3ZDSA 3EMRA 2IXIA 2DV9A 2XL9A 3B9CA 4AHXA 1HN1A 4E2SA 3CIHA 1QOOA 2K9ZA 4QX0A 2PN5A 4KGQA 4KU7A 4DZGA 1EPZA 4LA3A 4GIQA 1SLAA 4M3CB 2P3YA 2ZGPA 5IJRA 4QPIB 1JOPA 3LOIA 2OKXA 2VZUA 5H9PA 1LHWA 1UXZA 1BHGA 1J84A 1RXFA 1MS8A 5A7WB 1ZBA1 4HXCA 4AFBA 4JAAA 4PHZA 3MIBA 1ZA4A 1U12A 2K2SA 4XBQA 4ZU4A 2IC1A 5CG8A 1CPMA 1K5MB 1DFQA 1UMZA 3WDUA 3KVBA 2Y6LA 4N43B 3VHOA 2CAUA 1E5SA 1O8SA 2DCZA 5FZ6A 2Y6FA 3ZYFA 4F8AA 1WMFA 2XJVA 4R4ZA 4NE9A 1OD3A 1E5IA 4CCJA 3ZSJA 1V9U1 1QQP3 3TEWA 3FWEA 3T3YA 2RS52 4MGQA 3DXUA 1GBGA 3BIWE 1NLSA 1STMA 3MIHA 4YG3A 3LB9A 1WCSA 2PHXA 2QKDA 2BJSA 2IXLA 4PBOA 3MEPA 1AL0G 5ABJA 2VZVA 5HCFA 3OYWB 4SBVA 4DB5A 3UESA 1MS0A 3WNMA 2ZGRA 3GBGA 3ZN4A 1KFXL 2ZS6B 2ZACA 3C3VA 4BCUA 5FZ7A 5FP4A 3FFQA 3MPBA 3ZOIA 5C3QA 1N1YA 4EWEA 1J3RA 1PGW1 2DCJA 1Q3EA 3E1F1 4MGSA 5LBEA 5K0UC 3AFGA 5DUXA 2ADEA 1BCXA 3JBG3 1PMHX 5M0TA 3UNPA 3S57A 3E6CC 1PX4A 2XLAA 5APAA 3BTYA 1CN1A 4Z2AA 2XHKA 4Y22B 1TVGA 2OPWA 4A44A 4FPFA 2R16A 3R0RA 2VOVA 1PZ8A 4DXTA 4Z8BA 5LBCA 3V0BB 4LHLA 3V0AB 1Z7S3 3TBDA 3GGLA 3AMPA 5A3OA 1QQP1 3TWIA 3POBA 4FBFA 3GZAA 1WKYA 1AX1A 5CNAA 2CWMA 1FMD1 3N4MA 3K4DA 2XBO1 2B42B 1RUE1 4LO7A 3BVCA 3NJVA 3POGA 4I30A 3MO4A 5GJ6A 3UKTA 1GLHA 4OMCA 3I2IA 2XLGA 3AX4A 2XKOA 2CGOA 3KQ4B 5EV7A 3WUCA 3LSDA 2ORXA 2DVBA 5D1IA 4LLOA 3THDA 3PVNA 5FYTA 4IDZA 3ZXFA 5C3OA 3OF1A 4NRMA 2YC4A 3NVCA 2GNMA 2HJIA 1XRUA 2PMWB 3NJZA 2C0ZA 3VBRC 5AFBA 3GZTB 3MLLA 5J3UA 3ZR5A 4YW5A 3JBG1 4AWDA 2X8KA 2LTNA 2PLV3 2PYTA 3IDEA 4XFFA 4AI1A 3T2OA 2GC0A 5A70A 2B7YA 3O1OA 4ATFA 4CDWB 5H9QA 2TUNA 1TEIA 1TZOA 1UZWA 2GMPA 1Q5OA 1LOBA 3N9NA 4YW4A 1MACA 2J1RA 5EP9A 2JD9A 4NIDA 4M3CA 1ENQA 1BVP1 4QPIA 4K1YA 3B5LB 5DXDA 4YNIA 3C7OA 1FNYA 1JUIA 5FP9A 5FOBB 2JB4A 1ZBE2 2Y34A 1W2TA 2WJSA 1LOAA 1GKBA 1NY72 4KQ7A 4NAOA 2XL7A 3PU8A 3TRSB 4C0HA 3HOBA 1YCIA 2R30A 1K5MA 2VUAA 1F5FA 1AR73 1PIV2 3OBAA 1GP6A 4META 1F31A 4N43A 5A7NA 3K75B 5FP7A 1H2LA 3WP6A 4FP2A 1GU3A 1H1AA 4KI5M 4Q4W1 4Y24A 5JIAA 5KXCA 1PO22 4B1MA 4TXWA 1BYHA 2PHDA 4A7YA 1CGPA 3HMYA 4XUPA 1R081 4A3ZA 2XVLA 5DDJ3 3WXPA 1U5IA 1AR81 5GZEA 5C8CC 1IZ3A 4D7TA 4W50A 4Y1YA 3JD72 1AL23 4W65A 1MZ5A 2FDGA 2JB8A 3M3CA 1RYYA 2WZR3 1BEV3 2P6HA 5B2GB 2DDUA 5DAVA 4LBMA 1HRI2 5HCHA 3HPNA 5FZDA 4NHMA 5C3PA 1AXYA 3MHZA 3S5QA 1W6NB 4N9IA 1RUJ2 2JDUA 3LA3A 4QQOA 1ZRCA 4LBJA 2YC0A 4FQZA 3WSOA 1VB2A 4CRQA 5LEJA 4I02A 5KXDA 1W28A 3WEZA 4ZU7A 3HAGA 3U07A 4BQ5A 3ZKUA 5JOWA 1PO13 2Y26A 3AXEA 4CP0A 1GICA 1GP5A 3H3UA 4GWMA 2O0OA 4XZUG 5FZEA 5FZHA 1JYCA 1YRZA 2W1UA 3BTXA 1XC6A 2PTMA 3CDZB 3HQUA 1RUI3 4EWAA 2CV6A 2FDHA 2ZHLA 3AXDA 2VBDA 4FQ4A 2QVSB 1UIKA 1XYOA 2CNAA 2J1UA 2BGCA 3OBTA 5K4LA 3VBRB 1VBA2 2W1WA 4Q0SA 5CFCC 1HKDA 3M3IA 3H1MA 1CJDA 4HSJA 3O7OA 4KWJA 4S2DA 4W4ZA 5I0TA 3V0AA 1W9YA 1OQEA 1REDA 1Y7BA 2DUPA 4P14A 4MXWA 1XNTA 3IBMA 4FOQA 3QH7A 4WVMB 5FZLA 5ANNA 4NN0A 2VY0A 2WZR1 4PIYA 2WZPP 3ZFEC 5IK8A 4UF0A 1CD3G 1RGSA 4CDQB 1PK6C 2D6KA 1QF3A 3KF5A 4QM8A 3SITA 4CVUA 5FYZA 3NJXA 5DPNA 4YPJA 4A2UA 3E5QA 1VBE3 2B39A 4V1PA 4JV4A 5JXIA 2WA3A 2VULA 1XU1A 3PUHA 4I0BA 3ROUA 4DS0A 1RVF2 1JHJA 3QLQA 1IQDC 1W03A 1VBB2 2RS32 1VBC3 2QZ3A 1GZCA 1MR5A 1FYUA 1RUG2 1PO11 1W90A 1RHI1 2Y6HA 3MDPA 5DAWA 1QJY2 1SACA 1T2XA 2JKBA 2UYBA 3WF2A 1UZYA 4HG6B 4OCTA 1GZWB 1C5HA 4OYUA 3IZOA 1QEXA 1RUH1 2G1MA 1RUI1 1HJGA 5A7SA 3E6BA 2F6BA 4CDWA 5KHGA 3N35A 3OGGA 5HPOA 1D2QA 3MGUA 2DUQA 2EVXA 3AP5A 4CCKA 3G7DA 1NXD1 5C8CB 3ZYIB 2K0GA 1X9PA 2Z2SB 4HMZA 1CZSA 4OUEA 2HWC2 3T4HB 1WLTA 1UCXA 2DYCA 4AG4A 1S0FA 4XUQA 2GH2A 2VMIA 3PLQA 1O3TA 4PCRA 4PBPA 3C7EA 4AGVA 5DMYA 1NZIA 3CHXA 4HVOA 1FOD2 2Q1FA 1G9FA 5IVCA 5J37A 4GKXA 1CPNA 3ZYPA 1VIWB 2AENA 4QMAA 5DN2A 4BE3A 3LKJA 2WFF3 1AR91 1YFUA 3VB9A 4CYDA 4H55A 3W5NA 2R043 3AP9A 2RDRA 1JZ6A 4H3WA 4EN7B 1WLWA 4LO4B 3AYEA 3RWNA 1VBC1 3MFAA 2A6WA 1V00A 3OY8B 4M4RA 4C0BA 4XE9A 4YZ4A 5ACA3 3OTFA 2VMDA 2ERFA 2BFUS 2W92A 3AZWA 2BYVE 4NO4A 2HWE1 1YC61 1K12A 5EJZB 3I97A 4JZRA 1KITA 4J1XA 3PVOA 5CFCB 3C7HA 1WW4A 4XAAA 4XFGA 2NN8A 1C3HA 2A3WA 1SPPB 1SZBA 2DWRA 1GOGA 3OGSA 1EP0A 2A3YA 2A70A 2R073 5GZFA 1W6NA 2J22A 4Q8KA 4MH0E 3PURA 2XJUA 3IPVB 2EXJA 3GM8A 1JZ7A 5I8TA 2ZZJA 2GAUA 4NRPA 1B09A 1AXZA 1PK6B 1KDKA 3GXUA 4UBGA 1LENA 1YLLA 2I74A 4DUVA 2A5ZA 2HWD3 4GWIA 1PVC2 5KHHA 2R062 1O4YA 4J1WA 4FPJA 1RUC1 4Q4X2 4E4DX 5FMCA 4FXGB 2RV9A 2IVIB 3IT8A 1UMIA 5FXVA 2R041 4KNCA 2JICA 3LFMA 4XEZA 4QU1A 4RFRB 2DU1A 3GJAA 3VBRA 5IVVA 2RDNA 1JYWA 2QCSB 4IESA 2GSYA 2WNVA 5ACA1 5LK7B 1XSQA 2IXJA 3I2KA 4QD2A 5A7PA 2F4LA 1CAXA 3DECA 3KT1A 4WVMA 1VAVA 2GALA 1XE0A 3CQOA 4LIVA 3WP3A 1G9AA 2WNEA 5FWJA 3KB5A 4CP2A 5IVFA 1QXRA 2VZ3A 4CDQA 1OT5A 4OMDA 4AFAA 5F3EA 1YJLA 1WCDJ 2FQPA 3H1WA 4AVVA 2R071 1W9WA 2HWF3 3CJIC 4B4RA 3TAYA 1VMFA 4JHZA 1UWWA 4QX5A 2LW8A 2F17A 1AUYA 3J8F3 5F37A 2F4PA 2WFPA 3DL3A 4U36A 4XIOA 3NAPC 3P3PA 4EROA 2QTWB 1O4ZA 1HW5A 3U4XA 5DUVA 1DYKA 3EHKA 1OA4A 1RUD3 3DXTA 5FRAA 4JC1A 3ITQA 2C1FA 1UZ0A 4AHWA 3E6DA 4Y26A 1O3QA 3FBYA 4ZHNA 1HQWA 5BNQA 1LKNA 1XNAA 2OT7A 3AZYA 4OQ8A 4PF1A 2XG3A 1X8EA 2XDVA 2ZA9A 5CFDB 3OBRA 1GP4A 4MVTA 3VD7A 3I4IA 4CU6A 3DYPA 2VMHA 4BQ2A 2W46A 1JU3A 3NKTA 1XYPA 5AC92 3L2HA 5C8CA 1R093 4PI2A 4J6GA 1AYM3 2XUEA 3M7AA 3TB0A 1TME2 4MYEA 4ZS3A 1MVQA 2RMU3 1QJZA 3Q8CA 3OJBA 2R32A 5A1FA 2VQ0A 5FZBA 5C4WC 3BPSA 1KFUL 2BTVC 5EQUA 1HJFA 4BIFA 1X33A 2JECA 2QQWA 4L9BA 4ISQA 2RS51 4XQ4A 3FUQA 5F8PA 3L9JT 4IETA 3WHUA 1QH6A 4NHYA 1WMDA 3P3NA 4YZ3A 4OUSA 2DCYA 1LGNA 1URXA 2D6LX 2SLIA 3MUY1 2DVGA 2OIIA 2ETEA 4H14A 2IWGB 2RS13 4ARYA 3WF4A 4HZFA 4JQRA 4NUBA 1OOPC 2BBAA 3DKWA 3J7NA 5IT6A 4D8MA 1GYKA 3OY8A 1D7PM 3RZMA 1QOTA 5AVPA 3NW4A 1W9TA 5FKCA 4IE4A 4IE5A 2BFUL 1QMJA 3GNEA 3QD6A 4P9GA 1VAMA 3N3HA 4BMEA 4DY3A 2GNTA 3WNLA 4FI9A 2DCKA 4XAEA 1DBNA 1NKGA 5LY1A 5CG9A 1SPPA 3O1TA 1PMIA 5JR7B 1R091 1I3HA 1W8HA 2VG9A 3IPVA 1BMV1 4HOOA 2JDZA 4Y1UA 3LEIA 3ZSMA 5J36A 2RMU1 1IQAA 1PK6A 1YFXA 1YWKA 2E63A 4DQAA 1W9SA 1LHOA 4R4XA 1V6LA 3J4UH 3CJIB 4LUMA 4B7EA 3S7EA 3BKZA 3VN4A 4HONA 1DLLA 2VE1A 3HBKA 2VR4A 4XTMA 1UZZA 1GSLA 1ENRA 2R1DA 1IS6A 3FHAA 3NAPB 3OEBA 3K48A 4LE4A 1SLTA 1ULEA 1VBD2 4A7KA 3ZXAC 5GLWA 5A3TA 4M4PA 4DXRA 3THCA 3MLJA 3UKVA 3AYDA 1QKQA 1X50A 4IEWA 2VJXA 1OFSA 3I2FA 3PL0A 3SEEA 5J7MA 1D0GA 4XCBA 4DUXA 4YW6A 1O8PA 1OD5A 1RL3A 3OGJA 2PAEA 3J26N 4I01A 5FTTC 1UL9A 4IEOA 4A7ZA 1RUOA 3U78A 4GB33 2VTXA 4P9LA 4QX3A 3SKJE 4HPKA 5IW0A 5CKNA 5JCTA 1GZ9A 4H7LA 4ZY9A 3ZXDA 1AYN3 2D97A 4QKDA 5FY8A 5C4WB 3BI3A 2XB6C 3BTAA 1L7QA 4RHV2 1V6KA 3N7LA 1B35C 3EQEA 3KD4A 4LPLA 3R4SA 2B45X 3HR9A 3N9QA 1C8NA 2CTVA 4LHSA 3VD9A 2DVAA 5JI7A 5A33B 1QJX3 4FPCA 1ZBE1 3E5XA 4CXXA 5J48A 1NY71 4IEYA 4QB2A 2EAAA 4GH4C 4LLFA 1OOPB 2DVFA 3RYRA 2B9VA 1T6GC 2ZEWA 3CO2A 1HXS2 1OVSA 5CFDA 2P37A 2X09A 5DG1A 3RRDA 4CCEA 1SCSA 3INAA 4YYOA 2AACA 4ET7A 4OI1A 4BK5A 3VV1A 4O61A 2H6CA 2P1BA 3UJQA 2E32A 2V72A 4OHVA 1PO21 1W8UA 3FBMA 1NQDA 2YDEA 4Y33A 5JZGB 4OHXA 3CZJA 4XXAA 4E8DA 1GWLA 1VRH3 5IUQA 4RR3C 5LA2A 5EXOA 4H2AA 2EALA 2Y8KA 3OEAA 2ZAHA 3ZMOA 1MPXA 1YQ2A 4XF1A 3I3EA 5J96B 4IV1C 1AYN1 1RUNA 3FN9A 3WF3A 2CL2A 1LRHA 3BU7A 1F8VA 2D5HA 2WWUA 3I2OA 1D4M2 1U5YA 5SV5A 3T0DA 1HV1A 3PIJA 4HANA 4Q27A 1E57A 3GBFA 5FKBA 4FTEA 4L99A 3LSEA 4X6QB 1DCSA 3RWKX 4MZUA 3WNKA 1DQ4A 4EE2A 2HWB3 3ZYRA 4LBLA 5DZFA 1W2NA 3WDTA 5D8AC 2ZOEB 4U2AA 1JZ2A 1ST8A 4YGDA 3CNAA 2JG8C 2DF7A 1GOHA 4HKLA 3KHBA 4YGCA 4Z07A 2BRTA 1VBA1 2WZEA 4NRQA 2JE9A 5KHIA 4FO9A 3ST7A 3O1VA 3ZXLA 2GH8A 3LE0A 1NA1C 3CJIA 1IOAA 1PGL2 4O7XA 4ES8A 4MSVA 3PTYA 4Q4Y1 1YO8A 5T50A 1BKZA 4QDRA 3NAPA 1B35B 1Q8OA 4KL1A 4P9XA 2YGLA 3FL7A 4SLIA 1FV2A 3UYJA 5A1LA 4FTBA 4H7MA 3BB6A 2JJ6A 1PNFA 3IN9A 5FPZA 2XHNA 2WL1A 1P8JA 4WZFA 5FZ8A 4HT1T 2FD8A 4GH4B 2P17A 2WNUB 3GZUC 4CU7A 5FFOC 3J7MA 3H8XA 1JOBA 2RJLA 1IPSA 1VBB1 1W2UA 2P3JA 1H9WA 4N7UA 1QJU2 4Q29A 4NIAA 2QQOA 1WA4A 4QX8A 3ABZA 5CZKA 5F9TA 1W2OA 2HWB1 1QJY1 4Q0QA 5A7QA 5IAXA 4XUOA 2G4IA 1J58A 1ALYA 1A78A 2ZMLA 4N8MA 3ACGA 2XMLA 1WW7A 3JUUA 4BU2A 2ZGMA 2JX9A 4BJ0A 3LPFA 2YBPA 5F1RA 2VCAA 4CDUB 3LDKA 5C4WA 3VZNA 1DG6A 4WBBA 3CU7A 3NO8A 5T3NA 1ZBA3 1MVEA 3AMMA 1RMU2 4RR3B 1JW6A 3FUOA 3Q8EA 1U0AA 3MW2A 5FQ0A 1ZZ7A 1OMIA 2ZGOA 5F3CA 3OPWA 4IV1B 4AFDA 4OVEA 1W0OA 3H3LA 1OQDA 5A33A 5LW9A 2W68A 4LORA 3NL1A 1VLNA 1H30A 2EIGA 5K9YA 3UT0A 1V6OA 2ZMKA 3UETA 1CIWA 1REEA 1RJ7A 2AEZA 4GD4A 3MZHA 2D93A 1FOD1 4LBQD 3USUB 1OOPA 1ULPA 3O1SA 2JDNA 3NV3A 1CAUB 5HCAA 3SXWA 2YC2A 3NNFA 4LBNA 4WM8C 3U10A 4AI2A 5CVRA 5FPUA 2Z79A 1A6CA 1D0HA 3NV2A 2YXSA 3MBWA 1V9U3 5JR2A 4EZ4A 1SBFA 1Q56A 1M4WA 1UYZA 2V73A 4JDOA 1ZRRA 3RNSA 4BQ4A 1JUHA 4D7SA 1CVNA 1WWYA 2Z4FA 3LZZA 5D8AB 3WCRA 1AHSA 5JZGA 1DZTA 4BM8A 1S2BA 2WLQA 1BZWA 2JG8B 4GULA 4KGGA 4OHWA 1V6JA 4XHXA 2G9FA 2W1QA 3ACFA 2WINB 3T0AA 4PQQA 5C8WA 2BNMA 4R52A 3TEXA 1NLRA 4E2QA 2H6BA 5E1RA 2OS2A 1AR62 2BDRA 4WM7C 4XQWA 3VHPA 4BQWA 1NA1B 2CU5A 3FX3A 4BB3A 3U14A 3DPRA 1RIRA 4D0QA 1JN2P 3FLPA 5A1AA 4QX7A 5DG2A 1MZ6A 4QDSA 4CEYA 2V09A 3AB0A 1PZ7A 1EY2A 3VDDC 2ZTNA 1RUF2 2WWSA 4KBZA 3AKTA 1SCRA 2HLEA 2DU0A 2R061 3OB8A 2NZ9A 3VBUC 3QBQA 1X8MA 1SQ4A 2EIDA 5A3UA 2CAVA 3MIDA 1NE4A 1VALA 2IXHA 2P4EA 2VNOA 4ORFA 4Q4V2 4AZZA 3PNAA 1G9CA 4KMQA 1WGPA 5FWEA 1FMD3 2UY9A 5ANQA 2W0XA 4CUGA 1UO9A 3VHNA 5L19A 2W47A 2XBO3 1RUE3 2C9AA 3M3EA 2GC1A 2BVBA 3VD3A 1UX6A 1EV12 2IZWA 1UOBA 2D6PA 3H50A 2BNOA 2EIBA 1SFPA 2VUJA 2WYSA 4FPOB 4LMFA 3S0MA 1UOGA 2J1EA 4LR4A 4Y1ZA 1B35A 1OXCA 3ON7A 2VCCA 1UY0A 3K3NA 1KRIA 1YYNA 5FYVA 4JDNA 3KV9A 1UXXX 4DIQA 1UU5A 3SH5A 1AVBA 3RFRA 1XNKA 2HEYF 3I2GA 4GH4A 2WYFA 2WNUA 4HFSA 1BXHA 3J7HA 2VZ1A 3PMEA 3M3QA 2YROA 3IKWA 4LXLA 4CE8A 4WM8B 4EN0A 3AP4A 3HT1A 4OHZA 5GZDA 4BLJA 1RB8G 4AEMA 2VC9A 3AL6A 4RS5C 3SQOA 2RDQA 1W2AX 2CGNA 3HVDA 3RJ2X 2XJRA 3U75A 2AR6A 5L9BA 5CISA 2XVGA 2NMOA 4CDUA 2VZTA 4JVAA 2V4VA 2ZXQA 4XZPA 2GC3A 4RR3A 4YRDA 4AYUA 4QDQA 1J3QA 1WCUA 1AYM2 4COVA 1F35A 4GJZA 4AQ2A 4WM7B 3USSA 2B4KA 1DGLA 4ASKA 2RVAA 4HKWA 1YFYA 1GANA 1JYNA 1UF2C 1K5JA 4LE3A 3MICA 4Q4W3 3USUA 3CF6E 1XNCA 1CAUA 3EJKA 3WDVA 2DCTA 5FY9A 1R083 1SLIA 2IUWA 1AR83 5LBFA 4BISA 2XQRA 2YV8A 2RR12 1IKQA 2VM9A 4UYBA 4RQPC 3Q8FA 4CPBA 1HRV1 3ELNA 3VBUB 5DAXA 1XNBA 4P5HA 1MZEA 5D8AA 4QT6A 3FLRA 3T09A 3IM0A 3NNLA 1DLCA 2D3RA 3B69A 4HL0A 2JG8A 2YG0A 1BVVA 4LK7A 4A42A 1C8M2 3S30A 1N1SA 2CYFA 2Z5WA 1SBDA 2VQAA 2YPDA 4WV8A 4NIIA 1GMMA 2ZGNA 4B4PA 5JDBA 3ZX7A 3RDIA 2WNOA 5A7WA 4PLMA 1GR3A 3MW4A 1MEC2 3VZKA 2VECA 2BV4A 2PELA 3VD5A 2WT2A 3ETQA 1FPN2 3ZYJB 2ZX4A 1H4HA 3AKRA 2VO5A 3AK0A 2YB7A 3ZSLA 3UGGA 4OI2A 5K0UB 5CEHA 1JYTA 1GWMA 4FPYA 4XDOA 2QUOA 2W5FA 2PAMA 3OGRA 5FMOS 5FZIA 3VBFC 1OSGA 3AVRA 1VBD1 3HQXA 3IDAA 1LOEA 4XBLA 1NCRC 2OA2A 2E53A 3D4KA 3RZKA 2WO3A 1HB2A 2VL4A 5IWFA 2CGPA 3MW3A 3WR0A 1BBT2 4PI0A 4IERA 3N9PA 1ODNA 3VZMA 4EV0A 5FMBA 5F6KA 5IK7A 1XBFA 3OYWA 5FZMA 1R1A2 4FAGA 4XABA 5F32A 1FXZA 5FYBA 2OZJA 3D0SA 4AI0A 2C9KA 4B1LA 3VDDA 5I0UA 1S2EA 5C6CA 3CJXA 4QQLA 3IAPA 4K8RB 1QWRA 3DGTA 1YQ8A 2AC1A 2BUKA 2C24A 2BBVA 4Y4YA 3HEIA 3PIGA 4IEZA 4DFSA 1RHI3 3AJZA 4RN5A 3VKNA 2VZQA 1KXGA 3KT4A 3HN1A 1PVXA 2VQTA 1L7RA 3SCHA 5LK5A 4DUWA 1H1MA 1RUH3 3PHMA 4CSWA 4D6QA 2MHFA 1D2SA 4LKEA 5IVEA 5FUIA 4WM8A 3ECQA 1MS3A 1H8VA 3RSJA 1F15A 1F4AA 1PHMA 1COV2 4I09A 4Y22A 3WG2A 4MLOA 5KC6A 5JMCA 3V0BA 2JDHA 2Y64A 1QJX2 3DCQA 4RQPB 2VXJA 1EAH3 4XJ8A 3VDAA 2RM21 3ENRA 3OOXA 2WAAA 5HV0A 4LUKA 5IAVA 5FYHA 1VMHA 3THPA 2QQPA 4YG6A 3ZO0B 4UFMA 1RITA 4LKDA 3IB3A 5IHRA 5CKQA 1SLBA 4RA0A 4XF4A 4HN1A 5DAPA 3N7MA 1TQ5A 3APBA 2Q8OA 3SCGA 3VKOA 3NQHA 5K7PA 4WM7A 1Z78A 2XJQA 1AR93 2LM3A 1UAIA 3P1IA 2RJ2A 4GXLA 4LULA 1LOCA 4XOGA 1J1LA 3DF0A 5KXEA 4QQ2A 4OI0A 1A3KA 2JXAA 4FOVA 1TMF2 1VRH2 2X5IC 1J59A 2VW1A 4P02B 1U5XA 3O0XA 3HWJA 3POYA 4GQ7A 2HWE3 4COZA 4CTEA 1KEXA 5FP8A 2QE3A 4QPGC 1W39A 2YPJA 3ZFGC 1JZ8A 3VBUA 4BQXA 1NUKA 1WMXA 3VBFB 4LHKA 1OH4A 1WUVA 4HLTA 3VBSC 1LHUA 2IFRA 5T5LA 1XJAA 1NCRB 5JWPA 2YU2A 1EAH1 2VMFA 4K9SA 5EJ1B 4B7KA 3H42B 3T2PA 5SV8A 1UYPA 1Y9MA 5GZCA 4A45A 4XMIA 4G9SB 4PLOA 5IVBA 5IK5A 4BK4A 3HD8B 1ASJ2 4AFCA 4FVVA 2LROA 4AL9A 1VRBA 3HNYM 5JAXA 1RUC3 3BTZA 2EICA 1W8FA 3ILNA 4LQRA 1FAYA 4CCMA 1LOFC 3F2ZA 1NX9A 4D7YA 1N1TA 4IEVA 3W5MA 2UWCA 2O14A 3I2JA 3FJSA 3JXSA 4JDMA 4XDQA 5K0UA 4AOCA 3WG3A 5I91A 1W6PB 1PGL1 4LO6B 4S2HA 1NCQC 1OC1A 3ZDVA 5I0DA 5F3IA 1NZCA 5GZGA 1OA3A 1DU3D 1W99A 3IMMA 2QDRA 5FMOL 5L36A 1UYXA 2WS92 4Q8LA 4AGGA 2EF6A 4LTAA 4XDPA 3VBOC 4QB6A 1CJPA 4CUAA 4IEQA 2CHHA 5TSWA 2E7AA 2ZKNA 1POQA 4OZXA 3HIFA 1HB3A 1HB1A 1S0GA 2MEV2 2GN7A 2J7MA 4FP3A 2JEMA 4RD7A 1UY3A 4BOWA 5IFTA 1US2A 3N9OA 3ZFEB 3FZ3A 3JCIA 3MFCA 2GDFA 4O9EA 3RZZA 5FP3A 2O8OA 3LEMA 2Q4SA 4Y20B 3B3QE 1POV1 1QOSA 1QXPA 4MADA 4ZKTB 2WQZC 5HXMA 3LOBA 1W0PA 4AW7A 5HBAA 4E8CA 3NNJA 3SHRA 3RZGA 4R9AA 1X36A 4QPWA 2QQJA 5LA0A 3AZZA 5FUNA 4XJUA 2BU9A 1LTEA 2X5IB 4P5YA 1Q8QA 2Q30A 3RJRA 1DGWA 3TNPB 4YM2A 1LB2A 5EYYA 3TN92 1IS4A 4GALA 4YM0A 2JE7A 2QQNA 5JPNB 3K4ZA 1QNYA 3WVJA 1DIWA 3ILFA 3NWKA 1SDWA 3I3DA 4QPGB 4RQPA 5LATA 3VZJA 3K46A 1UYYA 5FY0A 5A80A 1H4GA 4QU2A 4FPLA 3QACA 4LITA 2ZCWA 1XNDA 2WO2A 3NMBA 3RZHA 1Q8SA 3P5BA 4AQSA 4MO3M 4AI9A 4FPGA 2HKXA 1ENXA 4K21A 1I5PA 1V9U2 2RS53 2VW2A 1APNA 3PUQA 1E5RA 3PUAA 4AAPA 5BV6A 5I8YA 5JIUA 4GMP1 4LK6A 4QQPA 4Z2WA 2FDKA 2UU8A 1W8ZA 1GV9A 3CZUA 4YARA 5EFUA 5CA6A 3AKPA 2AEYA 5FBJA 2ZGQA 4AVCA 2PA7A 1W6OB 4OULA 4YZ5A 3ZR6A 5C5UA 4L97A 4BZ4A 3HQRA 2VNRA 3TEYA 1KGYA 1JODA 4TN7A 3URFA 3KSCA 1GZWA 4JKLA 3A21A 1GQPA 3LDRA 4XBNA 4CCNA 2VOWA 1N3PA 3ILRA 1PGW2 4NPLA 3O5SA 3VBFA 4XTPA 3KCCA 4RGAA 5FREA 4CUCA 4Z1VA 4XMAA 4E2GA 1Y4WA 3AMQA 3NV1A 4WVVA 4EN6B 1SFYA 1NCRA 2UYAA 1IGOA 2W1SA 3AZVA 1RUF1 2HYKA 2OUHA 3VBOB 4JTNA 1G6NA 2DBNA 2OUJA 4X8NA 1ZREA 1H2KA 4RFT0 3FHIB 3BYWA 4UFIA 2FZ1A 2Q8DA 2D6OX 1UY4A 4AF9A 1XE8A 3I2DA 4Q4V1 5A3WA 3T1MA 2UY8A 4QAWA 4AEJA 3M70A 1QQP2 4FFHA 5FYIA 4GKYA 1N3OA 3OUIA 2YY1A 1QDCA 1NLQA 5F5IA 1W8NA 3V56A 3HT2A 1FT9A 1NQJA 2G9ZA 4AEDC 1EV11 1OHFA 3DEMA 3LEKA 1I9RA 1WD3A 4HBNA 4G4FA 4LHNA 3UV9A 1DQ5A 4FXKB 3WCSA 1W6PA 2LRPA 5J1XA 1UMHA 3K2OA 4UBHA 4OZOA 1FX5A 4FPKA 4YW7A 4TWTA 3E5UA 1UQXA 1OVPA 1QGLA 4O65A 4UI9L 3ACIA 3O14A 3I3MA 2FBEA 4NAMA 5CFCA 1J3PA 3O1PA 4AGRA 1L3JA 2PQQA 4XJAA 4YM1A 2ZAAA 4XETA 3KV4A 4IV3C 5F2WA 1W0NA 2BWAA 3WW3A 1VB4A 1LNSA 4BLIA 3MUZ1 2QNKA 3JBG2 3AJYA 4CXYA 2GP3A 2N7GA 2VD7A 3QH6A 5FXXA 3KWVA 4LBKA 5GLVA 4LKSA 3ZFEA 2DTWA 1VPHA 1DHKB 3MF6A 1YQ6A 4QKFA 3D3AA 4P9WA 3MIEA 4Y20A 2GNDA 5GKAC 4MGKE 3ZXGA 4AEKA 1Z7S2 4W8JA 5JVVA 2PXJA 3WX5A 1HDKA 2O1QA 4NHKA 4XACA 2WSVA 1ZBE3 4ASLA 4Y5SA 5JLVA 2Q0AA 3KQRA 1QHDA 5KWRA 4MGIE 3VUOA 1IS5A 1UN1A 3O1UA 1F4HA 3HNBM 3GYDA 1UKGA 4JX0A 1LECA 3JQXA 1T6BX 3VZOA 4Q5OA 1GWKA 5H9SA 4AHYA 1TG7A 3Q8BA 4W6WA 3WLUA 4DRVA 1PIV3 3RGBA 1DDLA 1MS5A 1GOFA 3LQCA 5CBLA 2ZABA 1I6XA 3AFKA 4LEJA 4QPGA 4W6XA 1A8MA 4GJYA 3HJRA 2PAKA 3CKHA 1NE6A 5F5QA 5LASA 4AVAA 1PO23 5FY5A 3BU0A 2J1AA 4QHBA 1S55A 2BOJA 3U11A 1ZZ6A 1WW6A 1DGWX 3A0KA 5CIRA 3S7IA 4MG2A 4M0NA 2R49A 2D6NA 5FYMA 4A4AA 1R082 4N53C 1HN0A 2CDOA 4P9JA 3GCWA 2RR11 1BK0A 3TYJA 3IWZA 3KLSA 1EPWA 1VP6A 2PHWA 2PLV2 4IW3A 4JKMA 4V2VA 5EHDA 5LRRA 1PM4A 1WCKA 2YFZA 3LF7A 3TOJA 4CP9B 1OLME 1W05A 4DRRA 1HQNA 2ZGLA 5A32B 1RUJ3 4QX1A 2Y33A 1W6OA 2ZPXA 3OD0A 1JZ5A 1H1IA 5J98B 3GBWA 1V6IA 5FOJB 3ACLA 4AEDB 1BLZA 2ZX3A 4QB1A 1VR3A 3LDBA 1A34A 2HBTA 4MHRA 5T5JA 5A6YA 3W9AA 1S0JA 5FV3A 2VZSA 1KJRA 2ZEXA 2WR9A 1PIV1 1ULGA 2GZWA 1AR72 3KV6A 2W3JA 2Z42A 4M0HA 1IS3A 1O5UA 1VBA3 2OZ6A 3UK9A 4LA2A 4IV3B 3PMSA 4FFIA 1O3SA 1JXNA 4FOYA 5F5CA 5DDJ2 1JHNA 3JD71 4GA9A 2IVJA 2NP0A 1MQTC 4Q4Y3 4Y1XA 3ZKYA 5G05L 4FAHA 2YGMA 1AL22 1S1AA 4ARXA 3IIAA 1HRI1 1S4CA 3WW2A 4XCAA 2WZR2 1BEV2 1XE7A 2DFCA 2RE9A 3AMNA 3U1XA 3ZPYA 2VNVA 5KHKA 3SLIA 1M06G 1MS9A 1UPIA 1F2NA 1RUJ1 2W95A 2WC2A 4XC9A 4FPHA 4XJZA 1ZX5A 1UW8A 5FZCA 1WMEA 3ME2A 3WV6A 2WT1A 3SC7X 4EWDA 2FMYA 1VBB3 5A3PA 1CQ9A 3WQBA 2Y0IA 4EN8B 5FDBA 2C6SA 1RUG3 2CWSA 4TLFA 4CDXC 3WNNA 1QJY3 2VUCA 1G8WA 1PO12 4A41A 3AP6A 3SH4A 2HYXA 2VPVA 3ZFFC 3POIA 3I7DA 1JI6A 1PMJX 1RUI2 2XH6A 3NV4A 3LCPA 5FO8B 3D8CA 3IAQA 3MPPG 1COV1 4B4QA 4ATEA 5L7OC 4NHLA 2SBAA 3MV01 4N53B 3W20A 5FIXA 2RDSA 3MI8A 3O0VA 1H6YA 2WQ8A 4EN9B 2D40A 1HB4A 1E5HA 2BERA 3WNOA 3FHQA 3OCPA 3DV8A 2A3XA 1FOD3 2WSUA 4AI3A 5JI9A 2WN3A 2VMCA 5LCWL 3PVEA 3I49A 4UOJA 4E9KA 2WA4A 3I8TA 1ZNPA 1WW5A 1LEDA 4GZ9A 4P9YA 5CB7A 4MHUA 1OFNA 3KT7A 1RTVA 4G3YC 4L8QA 4LOTA 4INDA 3N36A 4QPIC 4IEXA 3KCYA 1VBE2 2JDKA 5ISLA 1RVF1 1UY1A 5JXJA 1PM7A 4XYXA 5FPLA 2RS31 4Y1VA 2AH2A 5E8AA 5DAQA 4JGYC 1RUG1 5BPXA 4EZHA 2ZGUA 3RZLA 1VBC2 4NPMA 5KXBA 4S2FA 3WQ7A 3O1MA 2HWE2 3FMGA 4IXLA 3UL2A 1QNWA 3PDQA 2KA3A 3NNGA 3SKVA 2A7AA 3A4UA 4RGGA 3KM5A 5LY2A 2PHRA 5GLUA 3ASIA 3LA7A 1ZRFA 1GNHA 1JBCA 3D6EA 1J1TA 2VCMA 3FLTA 5A32A 2HWC1 1MQTB 1RXGA 5BXXA 2JIJA 2LS6A 3POSA 4LJHA 3RPQA 5K8SA 3ZN6B 5C70A 4LBOA 4X6RB 4PDWC 2P6CA 4LO5B 2BW8A 3SEPA 5L73A 2XJSA 4AEDA 1S0IA 4XVHA 4YG0A 5FK8A 5T5OA 3SMHA 1ASJ1 5FZKA 2GMEA 3WHTA 1PVC3 2D3SA 5EZWA 2R063 3LFIA 5AVAA 4Q4X3 5BNOC 2E7TA 2E51A 2JDYA 4UFJA 4XW3A 3SISA 2W91A 4UW5A 3ZIWA 4F3JA 1ZRDA 2X53S 2WFF2 3BALA 4HSLA 5FBZA 1SMVA 4CDXB 2R042 3WW4A 3F95A 4ES9A 2A6VA 3NSTA 3VDBA 4L11A 4JKKA 2MPFA 1ENSA 1YJKA 3LA2A 2EA7A 2PQSA 4QXBA 3WOGA 2W39A 4M3CE 2XJPA 5LA9A 3ZFFB 4YM3A 1YI7A 5ACA2 1AJKA 3I3QA 1OPMA 4EQVA 2YHJA 3MLKA 4FSJA 5F3GA 1LJ7A 2FDJA 4D94A 2ARAA 2ARCA 4JQTA 5L7OB 4PF5A 1OF4A 1OQ1A 1NXMA 2GC2A 2VUDA 3LAGA 1O5LA 1PNGA 2VH9A 4DXZA 5A6XA 1RINA 5ERLA 4ZZ8A 2MEV1 4YVSC 4LBQB 2R072 2KR2A 3CEWA 1NOVA 5T54A 4Y5TA 2D7FA 1S0CA 1POV0 4S2GA 2FCTA 2VTXJ 5FCCA 1G86A 1KS5A 2AREA 1DQ2A 3UKNA 2Q1ZB 3PVBB 4QGLA 4XILA 2FHRA 1IPKA 1PVC1 2JD4A 3SNMA 5JOYA 1QU0A 4LOSA 5DZEA 1YHFA 1K3IA 2HWD2 3AZXA 4JRAA 3AL5A 4Q4X1 1RC6A 3WDXA 3B93A 1Y9GA 4YW2A 2WQ4A 5DUWA 4AHZA 2ZEYA 4Q2FA 4M00A 4DPNA 4JGYB 1OA2A 2FMDA 4P08A 4RGKA 4NROA 4UFHA 3TN91 1UU6A 1LODA 4UT5A 4BQ1A 4TTGA 4N53A 4XFHA 5AC93 3AYAA 3E97A 2E9QA 4BYYA 1WBLA 2Q1MA 4IGQA 1TME3 1HX6A 1X9TA 1WCQA 5FY7A 4AXOA 1G9BA 3M1HA 2P3KA 2WZ8A 4F7ZA 3RZJA 4CDWC 5FZ3A 5A3MA 4HK9A 2B46X 1ND2C 1RJ8A 2D44A 2XUMA 1EUTA 2JIGA 4GMP0 3OG2A 1KQRA 3POFA 2ZHNA 1SBEA 4PDWB 4UFKA 1DQ6A 4QHOA 2HWF2 3O12A 1W3XA 1WLCA 2X10A 1UKRA 2HEWF 2I2SA 3AYCA 3J8F2 4NMIA 3PU3A 2BOIA 3C7FA 1HRV3 1EUUA 4YZ1A 4IE6A 1OF3A 1LR5A 5BNOB 3UGFA 2W08A 2D5FA 1CONA 3K77A 4BWOA 4FTSA 1Y3TA 1RUD2 2ORZA 4I0WB 5T52A 5C9AC 2WKKA 1X82A 5GM0A 5IYYA 1UOJA 2Y6KA 1DGRA 5JOXA 3MF9A 2DTYA 3VKMA 1OLRA 5H9RA 1N1VA 1XOYA 2P34A 2ZBJA 1IPJA 5FY4A 5LA1A 4XFBA 5AC91 1V70A 5C5TA 1ACCA 2D6MA 1MQTA 2JE8A 4IQPA 1JS9A 5FZGA 5BNNC 1R092 1TME1 3MYXA 4IV1A 4PLNA 3ZN6A 2G9GA 1UD1A 5B4XA 1BMV2 4J25A 4BMBA 5FUPA 2RMU2 5F6LB 4ZXEA 4ZXKA 4COYA 5A6QA 4PQ9A 4YVSB 2ENRA 3VL8A 3T1LA 2WN2A 3RI8A 3M4FA 3OUJA 1DZQA 3VBHC 1O7FA 2W87A 4KWKA 1REFA 4MXWB 2DUOA 4YGEA 3WDWA 1F9KA 1C57A 4X8PA 2A71A 5FZFA 1YIPA 1S0EA 2XONA 2TNFA 3JZVA 5F7UA 3VDDB 1VBD3 2JENA 3R6SA 4UF0B 3CL1A 3KCXA 2JDPA 3I59B 4PJYA 4AK3A 4CDXA 1SG3A 1LGBA 4IE0A 2KM2A 3C2UA 2FCVA 1J83A 2RS12 4XQDA 4YW3A 5EWSA 2WRAA 4UFLA 2ZEZA 3ZFFA 1CWPA 3GZEA 1S0BA 4ISRA 3TEZA 4CCOA 4BHPA 2ZHMA 5L7OA 5LB6A 4NIHA 3OBZA 5E16A 5T55A 2QQUA 1OUSA 4FT8A 4AFMA 1NA1A 1Q43A 2WNVC 3GCXA 5FLIA 4NIGA 4LBQA 5JMOA 4QM9A 2CDPA 2I45A 1CAVB 4MX3A 2GN3A 4IGPA 3GHMA 4B3NA 1CR7A 2VBPA 2E6VA 3I54A 2XPJA 4RHV3 2OX0A 1ZZ9A 1ND2B 2VBBA 2V5DA 4IE7A 2C5DA 3THTA 3VDCA 2W52A 5JSRA 3WDYA 3VGIA 2A1XA 5EYXA 1QJEA 1Z7S1 3FC0A 4AE2A 4CDQC 1H2NA 1CX4A 4DEVA 1XB9A 4CZSA 2BGOA 2ARBA 2VMGA 3DYMA 5L9RA 2D3PA 2XWBB 1LU1A 4TYSA 2RM23 4JGYA 5FO9B 1HXS3 1JOJA 3X29B 3JB8A 3W58A 4RS5B 5C9AB 4CEWC 2Y38A 4JGZC 4CP1A 4MOAA 3MIFA 4D6SA 4E4HA 2DVDA 5LWBA 3WG4A 5D21A 3BN6A 4QQHA 2R0FA 3VKLA 3POEA 5GALA 3H8UA 5HV4A 5KHJA 1YXWA 2C26A 3WD5A 4TSVA 4HVQA 5BNNB 2B5HA 1KD7A 2QBXA 3AMHA 4GB32 3FE5A 2HEVF 5A3NA 1ONAA 1OI6A 1OKOA 2PLV1 2UWAA 1V6MA 1ND3C 3OPZA 4PDWA 3N9MA 1DF0A 4Q0PA 3RI9A 1V0AA 1I5ZA 1IHMA 1X7NA 3J7LA 4KH9A 1AYN2 4K1ZA 4RHV1 2J1VA 4ZS2A 3WY6A 3KZ4C 3ZIXA 1CZVA 4XIKA 5F2SA 3PTRB 1H8TC 3VBHB 4ONUA 5BNOA 1S0DA 1D4M3 5A6ZA 2W2IA 1L7LA 4HVRA 4MGYE 2XJTA 1W8WA 3ACHA 3RMYA 3T08A 3R4UA 4JCKA 4YSFA 4GAZA 3LD8A 4C1WA 5IATA 4CU9A 1ZRIA 3POJA 3B94A 1W8OA 1HXS1 3VZLA 4AVTA 2CY6A 2R6QA 3WQ0A 3H7JA 2P2KA 3HBZA 1AR71 4L2NA 2VOTA 4HN0A 4AQ6A 1YUDA 5FXZA 4CEYC 2L9LA 4FFGA 4EYUA 3H0OA 3KMHA 2BQPA 4HETA 1JYXA 3DUIA 1C4RA 3IDBB 2A6ZA 3ZYHA 2WNVB 3I3BA 4YVSA 3O0WA 5DDJ1 3Q8AA 1WLDA 2UURA 3CMGA 2R7EB 4AAXA 1CAXB 3B9IA 5E88A 4YWAA 4C90A 3NRUA 1AL21 2JG9C 3BUCA 1O59A 1OUXA 1UX7A 1Y9QA 4Q4Y2 5C7GA 5FPXA 1O4TA 1BEV1 1UZVA 2RJKA 3QOPA 5FLJA 2ZGKA 3DYOA 5E6HA 2X05A 2ATFA 3I59A 2BP6A 3O1RA 1H2MA 1DQ0A 2VOKA 1SLCA 2VU9A 3KGLA 1NYWA 1IG3A 1Q8VA
chains in the Genus database with same CATH topology
1LAJA 1F15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAJ A;  1F15 A; 
#chains in the Genus database with same CATH topology
 3ZYB A;  1SEF A;  1D4M 1;  1YI9 A;  5C3S A;  2W94 A;  1UIJ A;  3WUD A;  4ZON A;  1QJU 3;  4FFF A;  5JXG A;  1YNA A;  1CAW B;  1U5Z A;  1W6Q B;  1ZZC A;  1F5J A;  2RHP A;  3MV1 1;  2VZP A;  5LBB A;  4Z82 A;  5KC5 A;  4CEW B;  4QGM A;  3D5O A;  4JGZ B;  3KVA A;  2VVD A;  2HWB 2;  1JTZ X;  2NM1 A;  1POV 3;  4CUB A;  3K3O A;  4LNV A;  2AUY A;  1MS1 A;  2B9U A;  5FAX A;  1CAV A;  2TEP A;  3WNX A;  3ZM8 A;  5I0S A;  4UW4 A;  2FZ2 A;  1ND2 A;  1RMU 3;  3K51 A;  1ZZB A;  1YEW A;  3GAL A;  3WF0 A;  5I93 A;  5LRS A;  5FYC A;  2WAB A;  4ZZ5 A;  3T2Q A;  3ZPO A;  1O6U A;  4A6S A;  4DY5 A;  1ND3 B;  4NWV A;  4DIN B;  1OUR A;  3OUH A;  4IUG A;  1H8T B;  4N9H A;  2QQV A;  1HQL A;  3N9L A;  1IKP A;  1JU4 A;  2YBS A;  5A7O A;  3UJO A;  2PHU A;  3ORJ A;  4RS5 A;  5EIY B;  5C9A A;  2ID4 A;  1VBE 1;  3AP7 A;  5I8S A;  1IG0 A;  4QX2 A;  2H0B A;  4FOW A;  4R8H A;  4UW6 A;  4B8E A;  3QCW A;  1QJU 1;  2VNG A;  5BY5 A;  3B7M A;  1SFN A;  4GMP 3;  2WLP A;  3WG1 A;  5BYN A;  3OGV A;  3ZVX A;  1ZYB A;  3LPG A;  5FPA A;  3V65 A;  4LKF A;  4XUN A;  3B01 A;  4GWN A;  3JB4 C;  1AX0 A;  5CFD C;  4QXH A;  5BNN A;  2R0H A;  2XLF A;  2A6X A;  4I3P A;  4NOT A;  3RG0 A;  5FR3 A;  5GLT A;  1UOF A;  1JMU B;  1UU4 A;  2KXL A;  3D82 A;  1AR6 3;  4RL7 A;  3FFZ A;  1GFF 2;  3H1Y A;  4P00 B;  2Y6G A;  3U4S A;  1RMU 1;  3AKS A;  1JZ4 A;  3Q9O A;  3LIG A;  3BOP A;  2OXB A;  1ZBA 2;  4P9I A;  3VBH A;  1PX3 A;  1SLL A;  1V6N A;  2JG9 B;  2GU9 A;  2XKP A;  1WBF A;  2X29 A;  2VVF A;  4XJ9 A;  3EB7 A;  2EIE A;  4NJ4 A;  3U37 A;  1PZ9 A;  3BPZ A;  4XUT A;  1RUF 3;  2HBU A;  3ZFG B;  1GNY A;  1OKQ A;  1JYV A;  1CES A;  1K45 A;  2NPI A;  2PHL A;  3W21 A;  5BNP C;  2IXK A;  4ZU5 A;  4C8D A;  4A3X A;  2D43 A;  4MUV A;  2R1B A;  2FDF A;  4Q1R A;  1AF9 A;  2QZ2 A;  3VBS B;  1N47 A;  4NPR A;  1BQP A;  4Q4V 3;  1H6X A;  2WFF 1;  2XVK A;  2IXC A;  1DYO A;  3P6B A;  1XSR A;  4YVW C;  4M01 A;  3BGA A;  3WW1 A;  4HK8 A;  2WBK A;  4CU8 A;  2YFU A;  2ZX2 A;  5EPA A;  3BIE A;  2RG4 A;  1OBN A;  2OPK A;  2V4A A;  1QXJ A;  4BA6 A;  2XWJ B;  3M3O A;  4QGN A;  4A6O A;  1S2K A;  1UY2 A;  1EV1 3;  2GMM A;  2VTF A;  3IDC B;  3EBR A;  2Q5T A;  4W6Y A;  2PHF A;  2WO7 A;  1AJO A;  1TNF A;  1LHN A;  5F39 A;  5FJK A;  4QXK A;  1AR6 1;  2VZO A;  4NWW A;  1ODM A;  5CU1 A;  2OYZ A;  2Q8C A;  3POW A;  5JOZ A;  3D0J A;  4GWJ A;  3LIH A;  4YZ2 A;  1C1F A;  1G7Y A;  1QIQ A;  2D98 A;  2OW4 A;  4PT6 A;  3WP4 A;  4HPK B;  2QQM A;  1I1E A;  2Z69 A;  2ET7 A;  1NCQ B;  3AVS A;  4Y4R A;  1LHV A;  4OI4 A;  2H0V A;  4XFC A;  4K3U A;  2BNN A;  3VL9 A;  4L92 A;  1OPO A;  2JKX A;  1CAW A;  1W6Q A;  4BQY A;  1PGS A;  4LT5 A;  3ES4 A;  2DUR A;  3RYP A;  1ULC A;  3IMN A;  2ADD A;  4CEW A;  2HWD 1;  3S5A A;  2E33 A;  1QDO A;  4JGZ A;  5F5A A;  4Z92 B;  3T0B A;  4DNY A;  1AXK A;  3ZMN A;  2EXI A;  1W9F A;  4RYD A;  2NMN A;  4V2W A;  4XJW A;  2E31 A;  3AKQ A;  3H7Y A;  1ZM1 A;  5JSP A;  5C3R A;  1W06 A;  3H9A A;  3III A;  1FMD 2;  3CLP A;  2J1S A;  2ZX1 A;  3TNQ A;  5IK4 A;  3T2T A;  1YFW A;  2XBO 2;  1RUE 2;  3NNM A;  4I2O A;  3WQ1 A;  1TNR A;  1VE0 A;  1ND3 A;  2ZJC A;  3V64 A;  4RSU A;  1O91 A;  2UWB A;  4ZPI A;  2E26 A;  2EXK A;  5G04 L;  2IFW A;  1XXN A;  1LCL A;  1LAJ A;  1H8T A;  1WZX A;  1Y43 B;  3RS6 A;  1DGR N;  1O3R A;  3T30 A;  2NYY A;  3JQW A;  4K40 A;  4TLG A;  1W3V A;  5FZ1 A;  4XF9 A;  4AI8 A;  4MGT A;  4E4Z A;  5IFP A;  3KHC A;  3OPT A;  3ES1 A;  4YW1 A;  2HWF 1;  5FXW A;  3L2Y A;  4XHB A;  5FPV A;  3VLB B;  4AVB A;  3J8F 1;  2RR1 3;  3PJY A;  5BNP B;  4K8F A;  3BOD A;  5A3L A;  2Y60 A;  3WT3 A;  1C1L A;  2XQX A;  4QWN A;  4LIU A;  5AFE A;  4URT A;  1HRV 2;  1N3Q A;  4CA9 A;  2JWP A;  2GP5 A;  1RUD 1;  3M8L A;  2QQL A;  4YVW B;  2VQU A;  1C8M 3;  2EAK A;  1BJQ A;  2A6Y A;  1GZT A;  3A0N A;  3ZN5 A;  5L9V A;  3BCW A;  3DKQ A;  1NAE A;  4XFI A;  1FNZ A;  1LOG A;  5IVY A;  2DBI A;  1GNZ A;  1QH7 A;  4CCC A;  2A73 B;  1MEC 3;  5KBF A;  2WUH A;  4IL7 A;  5FYU A;  1TE1 B;  4FCA A;  3ZLI A;  4AR2 A;  2JDM A;  2OVU A;  1ZZ8 A;  5JZG C;  2VXR A;  1BK1 A;  2X5I A;  4MXV A;  4WVZ A;  2YUE A;  1FPN 3;  1AYM 1;  1GQH A;  2JG9 A;  4BQ3 A;  5FYY A;  1W8T A;  4CCL A;  1KS4 A;  1VMJ A;  2Y0O A;  4KG0 A;  2AYH A;  2QQI A;  3GHN A;  4B29 A;  4DO0 A;  3ZFG A;  3DN7 A;  2ZX0 A;  5FZO B;  1QY4 A;  4Q4W 2;  4XFA A;  3ZYG A;  5J09 A;  3RYK A;  4XF3 A;  4OQ9 A;  3DPR C;  3VBS A;  4QKB A;  3WNP A;  4NHX A;  2QDN A;  2BWC A;  2QJV A;  2W9X A;  1HV0 A;  1R64 A;  3ALQ A;  3JD7 3;  3M2M A;  4HKO A;  1UPS A;  1AR8 2;  4IGO A;  4NVP A;  4BPZ A;  4KU8 A;  5JUV A;  5T5P A;  1LEM A;  2VAU A;  1US3 A;  1BBT 3;  1Q8P A;  2RS1 1;  4N7I A;  5IVJ A;  4NR1 A;  1HRI 3;  1XU2 A;  2O8Q A;  1ULO A;  4XF0 A;  5CYY A;  3R05 A;  1GQG A;  1R1A 3;  2YU1 A;  3J9S A;  1W04 A;  1JZ3 A;  1C8M 1;  2ILM A;  2NQY A;  4CXW A;  2G19 A;  5C33 A;  4DOU A;  1KDM A;  1LOF A;  3NKG A;  1MEC 1;  2I07 B;  3GJB A;  3RMX A;  4KWU A;  4Q0U A;  2QQK A;  3CBN A;  1NCQ A;  5ABJ C;  4YGB A;  2P5B A;  2YYO A;  3LWC A;  3OSD A;  2Q8E A;  1FPN 1;  4OHY A;  1VJ2 A;  1JYI A;  5FJH A;  2ZGT A;  2FDI A;  5CAD A;  1LUL A;  1ZVF A;  4XXP A;  3SCF A;  2V5Y A;  4XUR A;  5HXV A;  4ASM B;  2J1T A;  2ET1 A;  3VBO A;  5FQ0 B;  3G6J B;  1COV 3;  2MNG A;  4ITC A;  3ZSK A;  4URA A;  4OLL A;  3GDB A;  1W6M B;  3H8R A;  5LZ6 A;  4LO8 A;  3KS7 A;  1DYP A;  5DQ0 A;  5DZG A;  5EJ3 A;  4D69 A;  3PJQ A;  3PUI A;  4PIX A;  1GUI A;  3LEG A;  2ZZQ A;  1SDD B;  2YZ4 A;  3S6P A;  5HCB A;  2QFE A;  2WNU C;  2BGP A;  4UWD A;  4Q0V A;  2BVV A;  2RM2 2;  3RVH A;  1QJF A;  3ZXE A;  1R1Z A;  2AGS A;  2WAO A;  1BBT 1;  3T4V A;  3VHR A;  5FZA A;  1R1A 1;  4JRL A;  5FK7 A;  1HLC A;  2BEO A;  2BZD A;  4MV2 A;  4BIO A;  2A75 A;  5C71 A;  3W59 A;  4E4S A;  1C28 A;  2LUW A;  3C8X A;  3JU9 A;  1YIF A;  1RVF 3;  2C4X A;  2VOX A;  3ZSE A;  4CDU C;  4C91 A;  1YQ5 A;  1K42 A;  2RS3 3;  4GB3 1;  4BXF A;  1LU2 A;  1TMF 3;  5DUU A;  4COU A;  1ULD A;  2PHT A;  3EO6 A;  4WZC A;  5FYS A;  4IEU A;  1CX1 A;  1EYB A;  1XYN A;  1RHI 2;  1XPW A;  2P3I A;  1HIX A;  2OQ6 A;  5GLZ A;  1LES A;  5BNP A;  1CIY A;  2XXZ A;  3R4D B;  1RUH 2;  1Z0H A;  4D3W A;  1FI2 A;  3DPR B;  1SHW B;  2GNB A;  3VKF C;  3UGH A;  2WDB A;  2VVE A;  3AC0 A;  4FPE A;  3I2H A;  5HI0 A;  5JSO A;  4M3C F;  4I3G A;  4TZD A;  4CCD A;  4C1X A;  2WII B;  4YVW A;  3B02 A;  1QJX 1;  2VME A;  4CEY B;  2HWC 3;  4IEP A;  2PFW A;  3GF6 A;  3WIN E;  3ZXJ A;  4EJR A;  3K4A A;  1VAK A;  1JH5 A;  4BXS V;  1EAH 2;  4O9G A;  4OUM A;  2E7Q A;  5FMD A;  1MZF A;  2B8M A;  4I0A A;  4KBB A;  1ASJ 3;  4L0P A;  4UW3 A;  1WD4 A;  3N7K A;  5FZ0 A;  4DEQ A;  4E27 A;  2WT0 A;  3KF3 A;  4R9C A;  2CSG A;  3WP5 A;  4Y3O A;  4DMI A;  4QHZ A;  5LEK A;  4JHT A;  4MGZ E;  2JDA A;  1AR9 2;  4JTO A;  3U0Z A;  3ZXK A;  5ABJ B;  2J42 A;  4Q26 A;  5FZO A;  4UAP A;  1TMF 1;  1VRH 1;  2FCU A;  1H0B A;  5FZ4 A;  4D6R A;  5JPM B;  5D2A A;  2ZHK A;  3HN3 A;  4QXC A;  2BPA 2;  4YFW A;  3VD4 A;  3WZ1 A;  2KD7 A;  1K5M C;  2WWJ A;  2OQ7 A;  2WS9 3;  3BOW A;  4N43 C;  4KWL A;  4QPY A;  5E89 A;  2ZKL A;  4CP9 A;  2LAL A;  4YLZ A;  2VZR A;  1ULF A;  4K6B A;  2ZMN A;  1LGC A;  4XPV A;  5FZ9 A;  4AQT A;  4BH9 A;  1DP0 A;  1FV3 A;  2MEV 3;  2VW0 A;  3KGZ A;  5B4N A;  1XQN A;  4Q1P A;  3RQ0 A;  4OFG A;  2HH9 A;  2K46 A;  2VGD A;  2VCB A;  4F83 A;  1H9P A;  3AM2 A;  1FAT A;  2YMZ A;  2Y6J A;  3KV5 A;  5I0R A;  4QKN A;  3MIG A;  2DFB A;  5CKM A;  1CZT A;  4AVS A;  1UNB A;  4CPB D;  2YBK A;  2AZ5 A;  3NJY A;  4YFZ A;  5JXH A;  5CAZ A;  3SH3 A;  5FY1 A;  1WA6 X;  4COW A;  1MS4 A;  1ZA7 A;  2TBV A;  1OLQ A;  3B00 A;  1A8D A;  3WF1 A;  1RUC 2;  2ZGS A;  3OD4 A;  1AX2 A;  3PUS A;  4K7J A;  4UXA A;  5KR7 A;  1KJL A;  1OLM A;  3H3Z A;  1AZD A;  1D4V B;  1DQ1 A;  1YQC A;  4DXS A;  3TN9 3;  4BDV B;  2XR4 A;  3ATG A;  1W6M A;  4IV3 A;  3A22 A;  4WVW A;  3A7Q A;  3LGR A;  4K20 A;  4R9B A;  2ES3 A;  4R9D A;  2XGX A;  3C7G A;  3N7J A;  3HNM A;  1NT0 A;  4KG8 A;  2WS9 1;  3EXU A;  2EXH A;  2WO1 A;  3ETP A;  1NG0 A;  4PIZ A;  4Y5Z 0;  5FPB A;  5FO7 B;  1C5I A;  1OH3 A;  4N90 A;  3H8O A;  1DZR A;  2NLR A;  1G9D A;  3A23 A;  5BUV A;  5FLH A;  2XOM A;  2ARX A;  3EYP A;  5DAB A;  3ZDS A;  3EMR A;  2IXI A;  2DV9 A;  2XL9 A;  3B9C A;  4AHX A;  1HN1 A;  4E2S A;  3CIH A;  1QOO A;  2K9Z A;  4QX0 A;  2PN5 A;  4KGQ A;  4KU7 A;  4DZG A;  1EPZ A;  4LA3 A;  4GIQ A;  1SLA A;  4M3C B;  2P3Y A;  2ZGP A;  5IJR A;  4QPI B;  1JOP A;  3LOI A;  2OKX A;  2VZU A;  5H9P A;  1LHW A;  1UXZ A;  1BHG A;  1J84 A;  1RXF A;  1MS8 A;  5A7W B;  1ZBA 1;  4HXC A;  4AFB A;  4JAA A;  4PHZ A;  3MIB A;  1ZA4 A;  1U12 A;  2K2S A;  4XBQ A;  4ZU4 A;  2IC1 A;  5CG8 A;  1CPM A;  1K5M B;  1DFQ A;  1UMZ A;  3WDU A;  3KVB A;  2Y6L A;  4N43 B;  3VHO A;  2CAU A;  1E5S A;  1O8S A;  2DCZ A;  5FZ6 A;  2Y6F A;  3ZYF A;  4F8A A;  1WMF A;  2XJV A;  4R4Z A;  4NE9 A;  1OD3 A;  1E5I A;  4CCJ A;  3ZSJ A;  1V9U 1;  1QQP 3;  3TEW A;  3FWE A;  3T3Y A;  2RS5 2;  4MGQ A;  3DXU A;  1GBG A;  3BIW E;  1NLS A;  1STM A;  3MIH A;  4YG3 A;  3LB9 A;  1WCS A;  2PHX A;  2QKD A;  2BJS A;  2IXL A;  4PBO A;  3MEP A;  1AL0 G;  5ABJ A;  2VZV A;  5HCF A;  3OYW B;  4SBV A;  4DB5 A;  3UES A;  1MS0 A;  3WNM A;  2ZGR A;  3GBG A;  3ZN4 A;  1KFX L;  2ZS6 B;  2ZAC A;  3C3V A;  4BCU A;  5FZ7 A;  5FP4 A;  3FFQ A;  3MPB A;  3ZOI A;  5C3Q A;  1N1Y A;  4EWE A;  1J3R A;  1PGW 1;  2DCJ A;  1Q3E A;  3E1F 1;  4MGS A;  5LBE A;  5K0U C;  3AFG A;  5DUX A;  2ADE A;  1BCX A;  3JBG 3;  1PMH X;  5M0T A;  3UNP A;  3S57 A;  3E6C C;  1PX4 A;  2XLA A;  5APA A;  3BTY A;  1CN1 A;  4Z2A A;  2XHK A;  4Y22 B;  1TVG A;  2OPW A;  4A44 A;  4FPF A;  2R16 A;  3R0R A;  2VOV A;  1PZ8 A;  4DXT A;  4Z8B A;  5LBC A;  3V0B B;  4LHL A;  3V0A B;  1Z7S 3;  3TBD A;  3GGL A;  3AMP A;  5A3O A;  1QQP 1;  3TWI A;  3POB A;  4FBF A;  3GZA A;  1WKY A;  1AX1 A;  5CNA A;  2CWM A;  1FMD 1;  3N4M A;  3K4D A;  2XBO 1;  2B42 B;  1RUE 1;  4LO7 A;  3BVC A;  3NJV A;  3POG A;  4I30 A;  3MO4 A;  5GJ6 A;  3UKT A;  1GLH A;  4OMC A;  3I2I A;  2XLG A;  3AX4 A;  2XKO A;  2CGO A;  3KQ4 B;  5EV7 A;  3WUC A;  3LSD A;  2ORX A;  2DVB A;  5D1I A;  4LLO A;  3THD A;  3PVN A;  5FYT A;  4IDZ A;  3ZXF A;  5C3O A;  3OF1 A;  4NRM A;  2YC4 A;  3NVC A;  2GNM A;  2HJI A;  1XRU A;  2PMW B;  3NJZ A;  2C0Z A;  3VBR C;  5AFB A;  3GZT B;  3MLL A;  5J3U A;  3ZR5 A;  4YW5 A;  3JBG 1;  4AWD A;  2X8K A;  2LTN A;  2PLV 3;  2PYT A;  3IDE A;  4XFF A;  4AI1 A;  3T2O A;  2GC0 A;  5A70 A;  2B7Y A;  3O1O A;  4ATF A;  4CDW B;  5H9Q A;  2TUN A;  1TEI A;  1TZO A;  1UZW A;  2GMP A;  1Q5O A;  1LOB A;  3N9N A;  4YW4 A;  1MAC A;  2J1R A;  5EP9 A;  2JD9 A;  4NID A;  4M3C A;  1ENQ A;  1BVP 1;  4QPI A;  4K1Y A;  3B5L B;  5DXD A;  4YNI A;  3C7O A;  1FNY A;  1JUI A;  5FP9 A;  5FOB B;  2JB4 A;  1ZBE 2;  2Y34 A;  1W2T A;  2WJS A;  1LOA A;  1GKB A;  1NY7 2;  4KQ7 A;  4NAO A;  2XL7 A;  3PU8 A;  3TRS B;  4C0H A;  3HOB A;  1YCI A;  2R30 A;  1K5M A;  2VUA A;  1F5F A;  1AR7 3;  1PIV 2;  3OBA A;  1GP6 A;  4MET A;  1F31 A;  4N43 A;  5A7N A;  3K75 B;  5FP7 A;  1H2L A;  3WP6 A;  4FP2 A;  1GU3 A;  1H1A A;  4KI5 M;  4Q4W 1;  4Y24 A;  5JIA A;  5KXC A;  1PO2 2;  4B1M A;  4TXW A;  1BYH A;  2PHD A;  4A7Y A;  1CGP A;  3HMY A;  4XUP A;  1R08 1;  4A3Z A;  2XVL A;  5DDJ 3;  3WXP A;  1U5I A;  1AR8 1;  5GZE A;  5C8C C;  1IZ3 A;  4D7T A;  4W50 A;  4Y1Y A;  3JD7 2;  1AL2 3;  4W65 A;  1MZ5 A;  2FDG A;  2JB8 A;  3M3C A;  1RYY A;  2WZR 3;  1BEV 3;  2P6H A;  5B2G B;  2DDU A;  5DAV A;  4LBM A;  1HRI 2;  5HCH A;  3HPN A;  5FZD A;  4NHM A;  5C3P A;  1AXY A;  3MHZ A;  3S5Q A;  1W6N B;  4N9I A;  1RUJ 2;  2JDU A;  3LA3 A;  4QQO A;  1ZRC A;  4LBJ A;  2YC0 A;  4FQZ A;  3WSO A;  1VB2 A;  4CRQ A;  5LEJ A;  4I02 A;  5KXD A;  1W28 A;  3WEZ A;  4ZU7 A;  3HAG A;  3U07 A;  4BQ5 A;  3ZKU A;  5JOW A;  1PO1 3;  2Y26 A;  3AXE A;  4CP0 A;  1GIC A;  1GP5 A;  3H3U A;  4GWM A;  2O0O A;  4XZU G;  5FZE A;  5FZH A;  1JYC A;  1YRZ A;  2W1U A;  3BTX A;  1XC6 A;  2PTM A;  3CDZ B;  3HQU A;  1RUI 3;  4EWA A;  2CV6 A;  2FDH A;  2ZHL A;  3AXD A;  2VBD A;  4FQ4 A;  2QVS B;  1UIK A;  1XYO A;  2CNA A;  2J1U A;  2BGC A;  3OBT A;  5K4L A;  3VBR B;  1VBA 2;  2W1W A;  4Q0S A;  5CFC C;  1HKD A;  3M3I A;  3H1M A;  1CJD A;  4HSJ A;  3O7O A;  4KWJ A;  4S2D A;  4W4Z A;  5I0T A;  3V0A A;  1W9Y A;  1OQE A;  1RED A;  1Y7B A;  2DUP A;  4P14 A;  4MXW A;  1XNT A;  3IBM A;  4FOQ A;  3QH7 A;  4WVM B;  5FZL A;  5ANN A;  4NN0 A;  2VY0 A;  2WZR 1;  4PIY A;  2WZP P;  3ZFE C;  5IK8 A;  4UF0 A;  1CD3 G;  1RGS A;  4CDQ B;  1PK6 C;  2D6K A;  1QF3 A;  3KF5 A;  4QM8 A;  3SIT A;  4CVU A;  5FYZ A;  3NJX A;  5DPN A;  4YPJ A;  4A2U A;  3E5Q A;  1VBE 3;  2B39 A;  4V1P A;  4JV4 A;  5JXI A;  2WA3 A;  2VUL A;  1XU1 A;  3PUH A;  4I0B A;  3ROU A;  4DS0 A;  1RVF 2;  1JHJ A;  3QLQ A;  1IQD C;  1W03 A;  1VBB 2;  2RS3 2;  1VBC 3;  2QZ3 A;  1GZC A;  1MR5 A;  1FYU A;  1RUG 2;  1PO1 1;  1W90 A;  1RHI 1;  2Y6H A;  3MDP A;  5DAW A;  1QJY 2;  1SAC A;  1T2X A;  2JKB A;  2UYB A;  3WF2 A;  1UZY A;  4HG6 B;  4OCT A;  1GZW B;  1C5H A;  4OYU A;  3IZO A;  1QEX A;  1RUH 1;  2G1M A;  1RUI 1;  1HJG A;  5A7S A;  3E6B A;  2F6B A;  4CDW A;  5KHG A;  3N35 A;  3OGG A;  5HPO A;  1D2Q A;  3MGU A;  2DUQ A;  2EVX A;  3AP5 A;  4CCK A;  3G7D A;  1NXD 1;  5C8C B;  3ZYI B;  2K0G A;  1X9P A;  2Z2S B;  4HMZ A;  1CZS A;  4OUE A;  2HWC 2;  3T4H B;  1WLT A;  1UCX A;  2DYC A;  4AG4 A;  1S0F A;  4XUQ A;  2GH2 A;  2VMI A;  3PLQ A;  1O3T A;  4PCR A;  4PBP A;  3C7E A;  4AGV A;  5DMY A;  1NZI A;  3CHX A;  4HVO A;  1FOD 2;  2Q1F A;  1G9F A;  5IVC A;  5J37 A;  4GKX A;  1CPN A;  3ZYP A;  1VIW B;  2AEN A;  4QMA A;  5DN2 A;  4BE3 A;  3LKJ A;  2WFF 3;  1AR9 1;  1YFU A;  3VB9 A;  4CYD A;  4H55 A;  3W5N A;  2R04 3;  3AP9 A;  2RDR A;  1JZ6 A;  4H3W A;  4EN7 B;  1WLW A;  4LO4 B;  3AYE A;  3RWN A;  1VBC 1;  3MFA A;  2A6W A;  1V00 A;  3OY8 B;  4M4R A;  4C0B A;  4XE9 A;  4YZ4 A;  5ACA 3;  3OTF A;  2VMD A;  2ERF A;  2BFU S;  2W92 A;  3AZW A;  2BYV E;  4NO4 A;  2HWE 1;  1YC6 1;  1K12 A;  5EJZ B;  3I97 A;  4JZR A;  1KIT A;  4J1X A;  3PVO A;  5CFC B;  3C7H A;  1WW4 A;  4XAA A;  4XFG A;  2NN8 A;  1C3H A;  2A3W A;  1SPP B;  1SZB A;  2DWR A;  1GOG A;  3OGS A;  1EP0 A;  2A3Y A;  2A70 A;  2R07 3;  5GZF A;  1W6N A;  2J22 A;  4Q8K A;  4MH0 E;  3PUR A;  2XJU A;  3IPV B;  2EXJ A;  3GM8 A;  1JZ7 A;  5I8T A;  2ZZJ A;  2GAU A;  4NRP A;  1B09 A;  1AXZ A;  1PK6 B;  1KDK A;  3GXU A;  4UBG A;  1LEN A;  1YLL A;  2I74 A;  4DUV A;  2A5Z A;  2HWD 3;  4GWI A;  1PVC 2;  5KHH A;  2R06 2;  1O4Y A;  4J1W A;  4FPJ A;  1RUC 1;  4Q4X 2;  4E4D X;  5FMC A;  4FXG B;  2RV9 A;  2IVI B;  3IT8 A;  1UMI A;  5FXV A;  2R04 1;  4KNC A;  2JIC A;  3LFM A;  4XEZ A;  4QU1 A;  4RFR B;  2DU1 A;  3GJA A;  3VBR A;  5IVV A;  2RDN A;  1JYW A;  2QCS B;  4IES A;  2GSY A;  2WNV A;  5ACA 1;  5LK7 B;  1XSQ A;  2IXJ A;  3I2K A;  4QD2 A;  5A7P A;  2F4L A;  1CAX A;  3DEC A;  3KT1 A;  4WVM A;  1VAV A;  2GAL A;  1XE0 A;  3CQO A;  4LIV A;  3WP3 A;  1G9A A;  2WNE A;  5FWJ A;  3KB5 A;  4CP2 A;  5IVF A;  1QXR A;  2VZ3 A;  4CDQ A;  1OT5 A;  4OMD A;  4AFA A;  5F3E A;  1YJL A;  1WCD J;  2FQP A;  3H1W A;  4AVV A;  2R07 1;  1W9W A;  2HWF 3;  3CJI C;  4B4R A;  3TAY A;  1VMF A;  4JHZ A;  1UWW A;  4QX5 A;  2LW8 A;  2F17 A;  1AUY A;  3J8F 3;  5F37 A;  2F4P A;  2WFP A;  3DL3 A;  4U36 A;  4XIO A;  3NAP C;  3P3P A;  4ERO A;  2QTW B;  1O4Z A;  1HW5 A;  3U4X A;  5DUV A;  1DYK A;  3EHK A;  1OA4 A;  1RUD 3;  3DXT A;  5FRA A;  4JC1 A;  3ITQ A;  2C1F A;  1UZ0 A;  4AHW A;  3E6D A;  4Y26 A;  1O3Q A;  3FBY A;  4ZHN A;  1HQW A;  5BNQ A;  1LKN A;  1XNA A;  2OT7 A;  3AZY A;  4OQ8 A;  4PF1 A;  2XG3 A;  1X8E A;  2XDV A;  2ZA9 A;  5CFD B;  3OBR A;  1GP4 A;  4MVT A;  3VD7 A;  3I4I A;  4CU6 A;  3DYP A;  2VMH A;  4BQ2 A;  2W46 A;  1JU3 A;  3NKT A;  1XYP A;  5AC9 2;  3L2H A;  5C8C A;  1R09 3;  4PI2 A;  4J6G A;  1AYM 3;  2XUE A;  3M7A A;  3TB0 A;  1TME 2;  4MYE A;  4ZS3 A;  1MVQ A;  2RMU 3;  1QJZ A;  3Q8C A;  3OJB A;  2R32 A;  5A1F A;  2VQ0 A;  5FZB A;  5C4W C;  3BPS A;  1KFU L;  2BTV C;  5EQU A;  1HJF A;  4BIF A;  1X33 A;  2JEC A;  2QQW A;  4L9B A;  4ISQ A;  2RS5 1;  4XQ4 A;  3FUQ A;  5F8P A;  3L9J T;  4IET A;  3WHU A;  1QH6 A;  4NHY A;  1WMD A;  3P3N A;  4YZ3 A;  4OUS A;  2DCY A;  1LGN A;  1URX A;  2D6L X;  2SLI A;  3MUY 1;  2DVG A;  2OII A;  2ETE A;  4H14 A;  2IWG B;  2RS1 3;  4ARY A;  3WF4 A;  4HZF A;  4JQR A;  4NUB A;  1OOP C;  2BBA A;  3DKW A;  3J7N A;  5IT6 A;  4D8M A;  1GYK A;  3OY8 A;  1D7P M;  3RZM A;  1QOT A;  5AVP A;  3NW4 A;  1W9T A;  5FKC A;  4IE4 A;  4IE5 A;  2BFU L;  1QMJ A;  3GNE A;  3QD6 A;  4P9G A;  1VAM A;  3N3H A;  4BME A;  4DY3 A;  2GNT A;  3WNL A;  4FI9 A;  2DCK A;  4XAE A;  1DBN A;  1NKG A;  5LY1 A;  5CG9 A;  1SPP A;  3O1T A;  1PMI A;  5JR7 B;  1R09 1;  1I3H A;  1W8H A;  2VG9 A;  3IPV A;  1BMV 1;  4HOO A;  2JDZ A;  4Y1U A;  3LEI A;  3ZSM A;  5J36 A;  2RMU 1;  1IQA A;  1PK6 A;  1YFX A;  1YWK A;  2E63 A;  4DQA A;  1W9S A;  1LHO A;  4R4X A;  1V6L A;  3J4U H;  3CJI B;  4LUM A;  4B7E A;  3S7E A;  3BKZ A;  3VN4 A;  4HON A;  1DLL A;  2VE1 A;  3HBK A;  2VR4 A;  4XTM A;  1UZZ A;  1GSL A;  1ENR A;  2R1D A;  1IS6 A;  3FHA A;  3NAP B;  3OEB A;  3K48 A;  4LE4 A;  1SLT A;  1ULE A;  1VBD 2;  4A7K A;  3ZXA C;  5GLW A;  5A3T A;  4M4P A;  4DXR A;  3THC A;  3MLJ A;  3UKV A;  3AYD A;  1QKQ A;  1X50 A;  4IEW A;  2VJX A;  1OFS A;  3I2F A;  3PL0 A;  3SEE A;  5J7M A;  1D0G A;  4XCB A;  4DUX A;  4YW6 A;  1O8P A;  1OD5 A;  1RL3 A;  3OGJ A;  2PAE A;  3J26 N;  4I01 A;  5FTT C;  1UL9 A;  4IEO A;  4A7Z A;  1RUO A;  3U78 A;  4GB3 3;  2VTX A;  4P9L A;  4QX3 A;  3SKJ E;  4HPK A;  5IW0 A;  5CKN A;  5JCT A;  1GZ9 A;  4H7L A;  4ZY9 A;  3ZXD A;  1AYN 3;  2D97 A;  4QKD A;  5FY8 A;  5C4W B;  3BI3 A;  2XB6 C;  3BTA A;  1L7Q A;  4RHV 2;  1V6K A;  3N7L A;  1B35 C;  3EQE A;  3KD4 A;  4LPL A;  3R4S A;  2B45 X;  3HR9 A;  3N9Q A;  1C8N A;  2CTV A;  4LHS A;  3VD9 A;  2DVA A;  5JI7 A;  5A33 B;  1QJX 3;  4FPC A;  1ZBE 1;  3E5X A;  4CXX A;  5J48 A;  1NY7 1;  4IEY A;  4QB2 A;  2EAA A;  4GH4 C;  4LLF A;  1OOP B;  2DVF A;  3RYR A;  2B9V A;  1T6G C;  2ZEW A;  3CO2 A;  1HXS 2;  1OVS A;  5CFD A;  2P37 A;  2X09 A;  5DG1 A;  3RRD A;  4CCE A;  1SCS A;  3INA A;  4YYO A;  2AAC A;  4ET7 A;  4OI1 A;  4BK5 A;  3VV1 A;  4O61 A;  2H6C A;  2P1B A;  3UJQ A;  2E32 A;  2V72 A;  4OHV A;  1PO2 1;  1W8U A;  3FBM A;  1NQD A;  2YDE A;  4Y33 A;  5JZG B;  4OHX A;  3CZJ A;  4XXA A;  4E8D A;  1GWL A;  1VRH 3;  5IUQ A;  4RR3 C;  5LA2 A;  5EXO A;  4H2A A;  2EAL A;  2Y8K A;  3OEA A;  2ZAH A;  3ZMO A;  1MPX A;  1YQ2 A;  4XF1 A;  3I3E A;  5J96 B;  4IV1 C;  1AYN 1;  1RUN A;  3FN9 A;  3WF3 A;  2CL2 A;  1LRH A;  3BU7 A;  1F8V A;  2D5H A;  2WWU A;  3I2O A;  1D4M 2;  1U5Y A;  5SV5 A;  3T0D A;  1HV1 A;  3PIJ A;  4HAN A;  4Q27 A;  1E57 A;  3GBF A;  5FKB A;  4FTE A;  4L99 A;  3LSE A;  4X6Q B;  1DCS A;  3RWK X;  4MZU A;  3WNK A;  1DQ4 A;  4EE2 A;  2HWB 3;  3ZYR A;  4LBL A;  5DZF A;  1W2N A;  3WDT A;  5D8A C;  2ZOE B;  4U2A A;  1JZ2 A;  1ST8 A;  4YGD A;  3CNA A;  2JG8 C;  2DF7 A;  1GOH A;  4HKL A;  3KHB A;  4YGC A;  4Z07 A;  2BRT A;  1VBA 1;  2WZE A;  4NRQ A;  2JE9 A;  5KHI A;  4FO9 A;  3ST7 A;  3O1V A;  3ZXL A;  2GH8 A;  3LE0 A;  1NA1 C;  3CJI A;  1IOA A;  1PGL 2;  4O7X A;  4ES8 A;  4MSV A;  3PTY A;  4Q4Y 1;  1YO8 A;  5T50 A;  1BKZ A;  4QDR A;  3NAP A;  1B35 B;  1Q8O A;  4KL1 A;  4P9X A;  2YGL A;  3FL7 A;  4SLI A;  1FV2 A;  3UYJ A;  5A1L A;  4FTB A;  4H7M A;  3BB6 A;  2JJ6 A;  1PNF A;  3IN9 A;  5FPZ A;  2XHN A;  2WL1 A;  1P8J A;  4WZF A;  5FZ8 A;  4HT1 T;  2FD8 A;  4GH4 B;  2P17 A;  2WNU B;  3GZU C;  4CU7 A;  5FFO C;  3J7M A;  3H8X A;  1JOB A;  2RJL A;  1IPS A;  1VBB 1;  1W2U A;  2P3J A;  1H9W A;  4N7U A;  1QJU 2;  4Q29 A;  4NIA A;  2QQO A;  1WA4 A;  4QX8 A;  3ABZ A;  5CZK A;  5F9T A;  1W2O A;  2HWB 1;  1QJY 1;  4Q0Q A;  5A7Q A;  5IAX A;  4XUO A;  2G4I A;  1J58 A;  1ALY A;  1A78 A;  2ZML A;  4N8M A;  3ACG A;  2XML A;  1WW7 A;  3JUU A;  4BU2 A;  2ZGM A;  2JX9 A;  4BJ0 A;  3LPF A;  2YBP A;  5F1R A;  2VCA A;  4CDU B;  3LDK A;  5C4W A;  3VZN A;  1DG6 A;  4WBB A;  3CU7 A;  3NO8 A;  5T3N A;  1ZBA 3;  1MVE A;  3AMM A;  1RMU 2;  4RR3 B;  1JW6 A;  3FUO A;  3Q8E A;  1U0A A;  3MW2 A;  5FQ0 A;  1ZZ7 A;  1OMI A;  2ZGO A;  5F3C A;  3OPW A;  4IV1 B;  4AFD A;  4OVE A;  1W0O A;  3H3L A;  1OQD A;  5A33 A;  5LW9 A;  2W68 A;  4LOR A;  3NL1 A;  1VLN A;  1H30 A;  2EIG A;  5K9Y A;  3UT0 A;  1V6O A;  2ZMK A;  3UET A;  1CIW A;  1REE A;  1RJ7 A;  2AEZ A;  4GD4 A;  3MZH A;  2D93 A;  1FOD 1;  4LBQ D;  3USU B;  1OOP A;  1ULP A;  3O1S A;  2JDN A;  3NV3 A;  1CAU B;  5HCA A;  3SXW A;  2YC2 A;  3NNF A;  4LBN A;  4WM8 C;  3U10 A;  4AI2 A;  5CVR A;  5FPU A;  2Z79 A;  1A6C A;  1D0H A;  3NV2 A;  2YXS A;  3MBW A;  1V9U 3;  5JR2 A;  4EZ4 A;  1SBF A;  1Q56 A;  1M4W A;  1UYZ A;  2V73 A;  4JDO A;  1ZRR A;  3RNS A;  4BQ4 A;  1JUH A;  4D7S A;  1CVN A;  1WWY A;  2Z4F A;  3LZZ A;  5D8A B;  3WCR A;  1AHS A;  5JZG A;  1DZT A;  4BM8 A;  1S2B A;  2WLQ A;  1BZW A;  2JG8 B;  4GUL A;  4KGG A;  4OHW A;  1V6J A;  4XHX A;  2G9F A;  2W1Q A;  3ACF A;  2WIN B;  3T0A A;  4PQQ A;  5C8W A;  2BNM A;  4R52 A;  3TEX A;  1NLR A;  4E2Q A;  2H6B A;  5E1R A;  2OS2 A;  1AR6 2;  2BDR A;  4WM7 C;  4XQW A;  3VHP A;  4BQW A;  1NA1 B;  2CU5 A;  3FX3 A;  4BB3 A;  3U14 A;  3DPR A;  1RIR A;  4D0Q A;  1JN2 P;  3FLP A;  5A1A A;  4QX7 A;  5DG2 A;  1MZ6 A;  4QDS A;  4CEY A;  2V09 A;  3AB0 A;  1PZ7 A;  1EY2 A;  3VDD C;  2ZTN A;  1RUF 2;  2WWS A;  4KBZ A;  3AKT A;  1SCR A;  2HLE A;  2DU0 A;  2R06 1;  3OB8 A;  2NZ9 A;  3VBU C;  3QBQ A;  1X8M A;  1SQ4 A;  2EID A;  5A3U A;  2CAV A;  3MID A;  1NE4 A;  1VAL A;  2IXH A;  2P4E A;  2VNO A;  4ORF A;  4Q4V 2;  4AZZ A;  3PNA A;  1G9C A;  4KMQ A;  1WGP A;  5FWE A;  1FMD 3;  2UY9 A;  5ANQ A;  2W0X A;  4CUG A;  1UO9 A;  3VHN A;  5L19 A;  2W47 A;  2XBO 3;  1RUE 3;  2C9A A;  3M3E A;  2GC1 A;  2BVB A;  3VD3 A;  1UX6 A;  1EV1 2;  2IZW A;  1UOB A;  2D6P A;  3H50 A;  2BNO A;  2EIB A;  1SFP A;  2VUJ A;  2WYS A;  4FPO B;  4LMF A;  3S0M A;  1UOG A;  2J1E A;  4LR4 A;  4Y1Z A;  1B35 A;  1OXC A;  3ON7 A;  2VCC A;  1UY0 A;  3K3N A;  1KRI A;  1YYN A;  5FYV A;  4JDN A;  3KV9 A;  1UXX X;  4DIQ A;  1UU5 A;  3SH5 A;  1AVB A;  3RFR A;  1XNK A;  2HEY F;  3I2G A;  4GH4 A;  2WYF A;  2WNU A;  4HFS A;  1BXH A;  3J7H A;  2VZ1 A;  3PME A;  3M3Q A;  2YRO A;  3IKW A;  4LXL A;  4CE8 A;  4WM8 B;  4EN0 A;  3AP4 A;  3HT1 A;  4OHZ A;  5GZD A;  4BLJ A;  1RB8 G;  4AEM A;  2VC9 A;  3AL6 A;  4RS5 C;  3SQO A;  2RDQ A;  1W2A X;  2CGN A;  3HVD A;  3RJ2 X;  2XJR A;  3U75 A;  2AR6 A;  5L9B A;  5CIS A;  2XVG A;  2NMO A;  4CDU A;  2VZT A;  4JVA A;  2V4V A;  2ZXQ A;  4XZP A;  2GC3 A;  4RR3 A;  4YRD A;  4AYU A;  4QDQ A;  1J3Q A;  1WCU A;  1AYM 2;  4COV A;  1F35 A;  4GJZ A;  4AQ2 A;  4WM7 B;  3USS A;  2B4K A;  1DGL A;  4ASK A;  2RVA A;  4HKW A;  1YFY A;  1GAN A;  1JYN A;  1UF2 C;  1K5J A;  4LE3 A;  3MIC A;  4Q4W 3;  3USU A;  3CF6 E;  1XNC A;  1CAU A;  3EJK A;  3WDV A;  2DCT A;  5FY9 A;  1R08 3;  1SLI A;  2IUW A;  1AR8 3;  5LBF A;  4BIS A;  2XQR A;  2YV8 A;  2RR1 2;  1IKQ A;  2VM9 A;  4UYB A;  4RQP C;  3Q8F A;  4CPB A;  1HRV 1;  3ELN A;  3VBU B;  5DAX A;  1XNB A;  4P5H A;  1MZE A;  5D8A A;  4QT6 A;  3FLR A;  3T09 A;  3IM0 A;  3NNL A;  1DLC A;  2D3R A;  3B69 A;  4HL0 A;  2JG8 A;  2YG0 A;  1BVV A;  4LK7 A;  4A42 A;  1C8M 2;  3S30 A;  1N1S A;  2CYF A;  2Z5W A;  1SBD A;  2VQA A;  2YPD A;  4WV8 A;  4NII A;  1GMM A;  2ZGN A;  4B4P A;  5JDB A;  3ZX7 A;  3RDI A;  2WNO A;  5A7W A;  4PLM A;  1GR3 A;  3MW4 A;  1MEC 2;  3VZK A;  2VEC A;  2BV4 A;  2PEL A;  3VD5 A;  2WT2 A;  3ETQ A;  1FPN 2;  3ZYJ B;  2ZX4 A;  1H4H A;  3AKR A;  2VO5 A;  3AK0 A;  2YB7 A;  3ZSL A;  3UGG A;  4OI2 A;  5K0U B;  5CEH A;  1JYT A;  1GWM A;  4FPY A;  4XDO A;  2QUO A;  2W5F A;  2PAM A;  3OGR A;  5FMO S;  5FZI A;  3VBF C;  1OSG A;  3AVR A;  1VBD 1;  3HQX A;  3IDA A;  1LOE A;  4XBL A;  1NCR C;  2OA2 A;  2E53 A;  3D4K A;  3RZK A;  2WO3 A;  1HB2 A;  2VL4 A;  5IWF A;  2CGP A;  3MW3 A;  3WR0 A;  1BBT 2;  4PI0 A;  4IER A;  3N9P A;  1ODN A;  3VZM A;  4EV0 A;  5FMB A;  5F6K A;  5IK7 A;  1XBF A;  3OYW A;  5FZM A;  1R1A 2;  4FAG A;  4XAB A;  5F32 A;  1FXZ A;  5FYB A;  2OZJ A;  3D0S A;  4AI0 A;  2C9K A;  4B1L A;  3VDD A;  5I0U A;  1S2E A;  5C6C A;  3CJX A;  4QQL A;  3IAP A;  4K8R B;  1QWR A;  3DGT A;  1YQ8 A;  2AC1 A;  2BUK A;  2C24 A;  2BBV A;  4Y4Y A;  3HEI A;  3PIG A;  4IEZ A;  4DFS A;  1RHI 3;  3AJZ A;  4RN5 A;  3VKN A;  2VZQ A;  1KXG A;  3KT4 A;  3HN1 A;  1PVX A;  2VQT A;  1L7R A;  3SCH A;  5LK5 A;  4DUW A;  1H1M A;  1RUH 3;  3PHM A;  4CSW A;  4D6Q A;  2MHF A;  1D2S A;  4LKE A;  5IVE A;  5FUI A;  4WM8 A;  3ECQ A;  1MS3 A;  1H8V A;  3RSJ A;  1F15 A;  1F4A A;  1PHM A;  1COV 2;  4I09 A;  4Y22 A;  3WG2 A;  4MLO A;  5KC6 A;  5JMC A;  3V0B A;  2JDH A;  2Y64 A;  1QJX 2;  3DCQ A;  4RQP B;  2VXJ A;  1EAH 3;  4XJ8 A;  3VDA A;  2RM2 1;  3ENR A;  3OOX A;  2WAA A;  5HV0 A;  4LUK A;  5IAV A;  5FYH A;  1VMH A;  3THP A;  2QQP A;  4YG6 A;  3ZO0 B;  4UFM A;  1RIT A;  4LKD A;  3IB3 A;  5IHR A;  5CKQ A;  1SLB A;  4RA0 A;  4XF4 A;  4HN1 A;  5DAP A;  3N7M A;  1TQ5 A;  3APB A;  2Q8O A;  3SCG A;  3VKO A;  3NQH A;  5K7P A;  4WM7 A;  1Z78 A;  2XJQ A;  1AR9 3;  2LM3 A;  1UAI A;  3P1I A;  2RJ2 A;  4GXL A;  4LUL A;  1LOC A;  4XOG A;  1J1L A;  3DF0 A;  5KXE A;  4QQ2 A;  4OI0 A;  1A3K A;  2JXA A;  4FOV A;  1TMF 2;  1VRH 2;  2X5I C;  1J59 A;  2VW1 A;  4P02 B;  1U5X A;  3O0X A;  3HWJ A;  3POY A;  4GQ7 A;  2HWE 3;  4COZ A;  4CTE A;  1KEX A;  5FP8 A;  2QE3 A;  4QPG C;  1W39 A;  2YPJ A;  3ZFG C;  1JZ8 A;  3VBU A;  4BQX A;  1NUK A;  1WMX A;  3VBF B;  4LHK A;  1OH4 A;  1WUV A;  4HLT A;  3VBS C;  1LHU A;  2IFR A;  5T5L A;  1XJA A;  1NCR B;  5JWP A;  2YU2 A;  1EAH 1;  2VMF A;  4K9S A;  5EJ1 B;  4B7K A;  3H42 B;  3T2P A;  5SV8 A;  1UYP A;  1Y9M A;  5GZC A;  4A45 A;  4XMI A;  4G9S B;  4PLO A;  5IVB A;  5IK5 A;  4BK4 A;  3HD8 B;  1ASJ 2;  4AFC A;  4FVV A;  2LRO A;  4AL9 A;  1VRB A;  3HNY M;  5JAX A;  1RUC 3;  3BTZ A;  2EIC A;  1W8F A;  3ILN A;  4LQR A;  1FAY A;  4CCM A;  1LOF C;  3F2Z A;  1NX9 A;  4D7Y A;  1N1T A;  4IEV A;  3W5M A;  2UWC A;  2O14 A;  3I2J A;  3FJS A;  3JXS A;  4JDM A;  4XDQ A;  5K0U A;  4AOC A;  3WG3 A;  5I91 A;  1W6P B;  1PGL 1;  4LO6 B;  4S2H A;  1NCQ C;  1OC1 A;  3ZDV A;  5I0D A;  5F3I A;  1NZC A;  5GZG A;  1OA3 A;  1DU3 D;  1W99 A;  3IMM A;  2QDR A;  5FMO L;  5L36 A;  1UYX A;  2WS9 2;  4Q8L A;  4AGG A;  2EF6 A;  4LTA A;  4XDP A;  3VBO C;  4QB6 A;  1CJP A;  4CUA A;  4IEQ A;  2CHH A;  5TSW A;  2E7A A;  2ZKN A;  1POQ A;  4OZX A;  3HIF A;  1HB3 A;  1HB1 A;  1S0G A;  2MEV 2;  2GN7 A;  2J7M A;  4FP3 A;  2JEM A;  4RD7 A;  1UY3 A;  4BOW A;  5IFT A;  1US2 A;  3N9O A;  3ZFE B;  3FZ3 A;  3JCI A;  3MFC A;  2GDF A;  4O9E A;  3RZZ A;  5FP3 A;  2O8O A;  3LEM A;  2Q4S A;  4Y20 B;  3B3Q E;  1POV 1;  1QOS A;  1QXP A;  4MAD A;  4ZKT B;  2WQZ C;  5HXM A;  3LOB A;  1W0P A;  4AW7 A;  5HBA A;  4E8C A;  3NNJ A;  3SHR A;  3RZG A;  4R9A A;  1X36 A;  4QPW A;  2QQJ A;  5LA0 A;  3AZZ A;  5FUN A;  4XJU A;  2BU9 A;  1LTE A;  2X5I B;  4P5Y A;  1Q8Q A;  2Q30 A;  3RJR A;  1DGW A;  3TNP B;  4YM2 A;  1LB2 A;  5EYY A;  3TN9 2;  1IS4 A;  4GAL A;  4YM0 A;  2JE7 A;  2QQN A;  5JPN B;  3K4Z A;  1QNY A;  3WVJ A;  1DIW A;  3ILF A;  3NWK A;  1SDW A;  3I3D A;  4QPG B;  4RQP A;  5LAT A;  3VZJ A;  3K46 A;  1UYY A;  5FY0 A;  5A80 A;  1H4G A;  4QU2 A;  4FPL A;  3QAC A;  4LIT A;  2ZCW A;  1XND A;  2WO2 A;  3NMB A;  3RZH A;  1Q8S A;  3P5B A;  4AQS A;  4MO3 M;  4AI9 A;  4FPG A;  2HKX A;  1ENX A;  4K21 A;  1I5P A;  1V9U 2;  2RS5 3;  2VW2 A;  1APN A;  3PUQ A;  1E5R A;  3PUA A;  4AAP A;  5BV6 A;  5I8Y A;  5JIU A;  4GMP 1;  4LK6 A;  4QQP A;  4Z2W A;  2FDK A;  2UU8 A;  1W8Z A;  1GV9 A;  3CZU A;  4YAR A;  5EFU A;  5CA6 A;  3AKP A;  2AEY A;  5FBJ A;  2ZGQ A;  4AVC A;  2PA7 A;  1W6O B;  4OUL A;  4YZ5 A;  3ZR6 A;  5C5U A;  4L97 A;  4BZ4 A;  3HQR A;  2VNR A;  3TEY A;  1KGY A;  1JOD A;  4TN7 A;  3URF A;  3KSC A;  1GZW A;  4JKL A;  3A21 A;  1GQP A;  3LDR A;  4XBN A;  4CCN A;  2VOW A;  1N3P A;  3ILR A;  1PGW 2;  4NPL A;  3O5S A;  3VBF A;  4XTP A;  3KCC A;  4RGA A;  5FRE A;  4CUC A;  4Z1V A;  4XMA A;  4E2G A;  1Y4W A;  3AMQ A;  3NV1 A;  4WVV A;  4EN6 B;  1SFY A;  1NCR A;  2UYA A;  1IGO A;  2W1S A;  3AZV A;  1RUF 1;  2HYK A;  2OUH A;  3VBO B;  4JTN A;  1G6N A;  2DBN A;  2OUJ A;  4X8N A;  1ZRE A;  1H2K A;  4RFT 0;  3FHI B;  3BYW A;  4UFI A;  2FZ1 A;  2Q8D A;  2D6O X;  1UY4 A;  4AF9 A;  1XE8 A;  3I2D A;  4Q4V 1;  5A3W A;  3T1M A;  2UY8 A;  4QAW A;  4AEJ A;  3M70 A;  1QQP 2;  4FFH A;  5FYI A;  4GKY A;  1N3O A;  3OUI A;  2YY1 A;  1QDC A;  1NLQ A;  5F5I A;  1W8N A;  3V56 A;  3HT2 A;  1FT9 A;  1NQJ A;  2G9Z A;  4AED C;  1EV1 1;  1OHF A;  3DEM A;  3LEK A;  1I9R A;  1WD3 A;  4HBN A;  4G4F A;  4LHN A;  3UV9 A;  1DQ5 A;  4FXK B;  3WCS A;  1W6P A;  2LRP A;  5J1X A;  1UMH A;  3K2O A;  4UBH A;  4OZO A;  1FX5 A;  4FPK A;  4YW7 A;  4TWT A;  3E5U A;  1UQX A;  1OVP A;  1QGL A;  4O65 A;  4UI9 L;  3ACI A;  3O14 A;  3I3M A;  2FBE A;  4NAM A;  5CFC A;  1J3P A;  3O1P A;  4AGR A;  1L3J A;  2PQQ A;  4XJA A;  4YM1 A;  2ZAA A;  4XET A;  3KV4 A;  4IV3 C;  5F2W A;  1W0N A;  2BWA A;  3WW3 A;  1VB4 A;  1LNS A;  4BLI A;  3MUZ 1;  2QNK A;  3JBG 2;  3AJY A;  4CXY A;  2GP3 A;  2N7G A;  2VD7 A;  3QH6 A;  5FXX A;  3KWV A;  4LBK A;  5GLV A;  4LKS A;  3ZFE A;  2DTW A;  1VPH A;  1DHK B;  3MF6 A;  1YQ6 A;  4QKF A;  3D3A A;  4P9W A;  3MIE A;  4Y20 A;  2GND A;  5GKA C;  4MGK E;  3ZXG A;  4AEK A;  1Z7S 2;  4W8J A;  5JVV A;  2PXJ A;  3WX5 A;  1HDK A;  2O1Q A;  4NHK A;  4XAC A;  2WSV A;  1ZBE 3;  4ASL A;  4Y5S A;  5JLV A;  2Q0A A;  3KQR A;  1QHD A;  5KWR A;  4MGI E;  3VUO A;  1IS5 A;  1UN1 A;  3O1U A;  1F4H A;  3HNB M;  3GYD A;  1UKG A;  4JX0 A;  1LEC A;  3JQX A;  1T6B X;  3VZO A;  4Q5O A;  1GWK A;  5H9S A;  4AHY A;  1TG7 A;  3Q8B A;  4W6W A;  3WLU A;  4DRV A;  1PIV 3;  3RGB A;  1DDL A;  1MS5 A;  1GOF A;  3LQC A;  5CBL A;  2ZAB A;  1I6X A;  3AFK A;  4LEJ A;  4QPG A;  4W6X A;  1A8M A;  4GJY A;  3HJR A;  2PAK A;  3CKH A;  1NE6 A;  5F5Q A;  5LAS A;  4AVA A;  1PO2 3;  5FY5 A;  3BU0 A;  2J1A A;  4QHB A;  1S55 A;  2BOJ A;  3U11 A;  1ZZ6 A;  1WW6 A;  1DGW X;  3A0K A;  5CIR A;  3S7I A;  4MG2 A;  4M0N A;  2R49 A;  2D6N A;  5FYM A;  4A4A A;  1R08 2;  4N53 C;  1HN0 A;  2CDO A;  4P9J A;  3GCW A;  2RR1 1;  1BK0 A;  3TYJ A;  3IWZ A;  3KLS A;  1EPW A;  1VP6 A;  2PHW A;  2PLV 2;  4IW3 A;  4JKM A;  4V2V A;  5EHD A;  5LRR A;  1PM4 A;  1WCK A;  2YFZ A;  3LF7 A;  3TOJ A;  4CP9 B;  1OLM E;  1W05 A;  4DRR A;  1HQN A;  2ZGL A;  5A32 B;  1RUJ 3;  4QX1 A;  2Y33 A;  1W6O A;  2ZPX A;  3OD0 A;  1JZ5 A;  1H1I A;  5J98 B;  3GBW A;  1V6I A;  5FOJ B;  3ACL A;  4AED B;  1BLZ A;  2ZX3 A;  4QB1 A;  1VR3 A;  3LDB A;  1A34 A;  2HBT A;  4MHR A;  5T5J A;  5A6Y A;  3W9A A;  1S0J A;  5FV3 A;  2VZS A;  1KJR A;  2ZEX A;  2WR9 A;  1PIV 1;  1ULG A;  2GZW A;  1AR7 2;  3KV6 A;  2W3J A;  2Z42 A;  4M0H A;  1IS3 A;  1O5U A;  1VBA 3;  2OZ6 A;  3UK9 A;  4LA2 A;  4IV3 B;  3PMS A;  4FFI A;  1O3S A;  1JXN A;  4FOY A;  5F5C A;  5DDJ 2;  1JHN A;  3JD7 1;  4GA9 A;  2IVJ A;  2NP0 A;  1MQT C;  4Q4Y 3;  4Y1X A;  3ZKY A;  5G05 L;  4FAH A;  2YGM A;  1AL2 2;  1S1A A;  4ARX A;  3IIA A;  1HRI 1;  1S4C A;  3WW2 A;  4XCA A;  2WZR 2;  1BEV 2;  1XE7 A;  2DFC A;  2RE9 A;  3AMN A;  3U1X A;  3ZPY A;  2VNV A;  5KHK A;  3SLI A;  1M06 G;  1MS9 A;  1UPI A;  1F2N A;  1RUJ 1;  2W95 A;  2WC2 A;  4XC9 A;  4FPH A;  4XJZ A;  1ZX5 A;  1UW8 A;  5FZC A;  1WME A;  3ME2 A;  3WV6 A;  2WT1 A;  3SC7 X;  4EWD A;  2FMY A;  1VBB 3;  5A3P A;  1CQ9 A;  3WQB A;  2Y0I A;  4EN8 B;  5FDB A;  2C6S A;  1RUG 3;  2CWS A;  4TLF A;  4CDX C;  3WNN A;  1QJY 3;  2VUC A;  1G8W A;  1PO1 2;  4A41 A;  3AP6 A;  3SH4 A;  2HYX A;  2VPV A;  3ZFF C;  3POI A;  3I7D A;  1JI6 A;  1PMJ X;  1RUI 2;  2XH6 A;  3NV4 A;  3LCP A;  5FO8 B;  3D8C A;  3IAQ A;  3MPP G;  1COV 1;  4B4Q A;  4ATE A;  5L7O C;  4NHL A;  2SBA A;  3MV0 1;  4N53 B;  3W20 A;  5FIX A;  2RDS A;  3MI8 A;  3O0V A;  1H6Y A;  2WQ8 A;  4EN9 B;  2D40 A;  1HB4 A;  1E5H A;  2BER A;  3WNO A;  3FHQ A;  3OCP A;  3DV8 A;  2A3X A;  1FOD 3;  2WSU A;  4AI3 A;  5JI9 A;  2WN3 A;  2VMC A;  5LCW L;  3PVE A;  3I49 A;  4UOJ A;  4E9K A;  2WA4 A;  3I8T A;  1ZNP A;  1WW5 A;  1LED A;  4GZ9 A;  4P9Y A;  5CB7 A;  4MHU A;  1OFN A;  3KT7 A;  1RTV A;  4G3Y C;  4L8Q A;  4LOT A;  4IND A;  3N36 A;  4QPI C;  4IEX A;  3KCY A;  1VBE 2;  2JDK A;  5ISL A;  1RVF 1;  1UY1 A;  5JXJ A;  1PM7 A;  4XYX A;  5FPL A;  2RS3 1;  4Y1V A;  2AH2 A;  5E8A A;  5DAQ A;  4JGY C;  1RUG 1;  5BPX A;  4EZH A;  2ZGU A;  3RZL A;  1VBC 2;  4NPM A;  5KXB A;  4S2F A;  3WQ7 A;  3O1M A;  2HWE 2;  3FMG A;  4IXL A;  3UL2 A;  1QNW A;  3PDQ A;  2KA3 A;  3NNG A;  3SKV A;  2A7A A;  3A4U A;  4RGG A;  3KM5 A;  5LY2 A;  2PHR A;  5GLU A;  3ASI A;  3LA7 A;  1ZRF A;  1GNH A;  1JBC A;  3D6E A;  1J1T A;  2VCM A;  3FLT A;  5A32 A;  2HWC 1;  1MQT B;  1RXG A;  5BXX A;  2JIJ A;  2LS6 A;  3POS A;  4LJH A;  3RPQ A;  5K8S A;  3ZN6 B;  5C70 A;  4LBO A;  4X6R B;  4PDW C;  2P6C A;  4LO5 B;  2BW8 A;  3SEP A;  5L73 A;  2XJS A;  4AED A;  1S0I A;  4XVH A;  4YG0 A;  5FK8 A;  5T5O A;  3SMH A;  1ASJ 1;  5FZK A;  2GME A;  3WHT A;  1PVC 3;  2D3S A;  5EZW A;  2R06 3;  3LFI A;  5AVA A;  4Q4X 3;  5BNO C;  2E7T A;  2E51 A;  2JDY A;  4UFJ A;  4XW3 A;  3SIS A;  2W91 A;  4UW5 A;  3ZIW A;  4F3J A;  1ZRD A;  2X53 S;  2WFF 2;  3BAL A;  4HSL A;  5FBZ A;  1SMV A;  4CDX B;  2R04 2;  3WW4 A;  3F95 A;  4ES9 A;  2A6V A;  3NST A;  3VDB A;  4L11 A;  4JKK A;  2MPF A;  1ENS A;  1YJK A;  3LA2 A;  2EA7 A;  2PQS A;  4QXB A;  3WOG A;  2W39 A;  4M3C E;  2XJP A;  5LA9 A;  3ZFF B;  4YM3 A;  1YI7 A;  5ACA 2;  1AJK A;  3I3Q A;  1OPM A;  4EQV A;  2YHJ A;  3MLK A;  4FSJ A;  5F3G A;  1LJ7 A;  2FDJ A;  4D94 A;  2ARA A;  2ARC A;  4JQT A;  5L7O B;  4PF5 A;  1OF4 A;  1OQ1 A;  1NXM A;  2GC2 A;  2VUD A;  3LAG A;  1O5L A;  1PNG A;  2VH9 A;  4DXZ A;  5A6X A;  1RIN A;  5ERL A;  4ZZ8 A;  2MEV 1;  4YVS C;  4LBQ B;  2R07 2;  2KR2 A;  3CEW A;  1NOV A;  5T54 A;  4Y5T A;  2D7F A;  1S0C A;  1POV 0;  4S2G A;  2FCT A;  2VTX J;  5FCC A;  1G86 A;  1KS5 A;  2ARE A;  1DQ2 A;  3UKN A;  2Q1Z B;  3PVB B;  4QGL A;  4XIL A;  2FHR A;  1IPK A;  1PVC 1;  2JD4 A;  3SNM A;  5JOY A;  1QU0 A;  4LOS A;  5DZE A;  1YHF A;  1K3I A;  2HWD 2;  3AZX A;  4JRA A;  3AL5 A;  4Q4X 1;  1RC6 A;  3WDX A;  3B93 A;  1Y9G A;  4YW2 A;  2WQ4 A;  5DUW A;  4AHZ A;  2ZEY A;  4Q2F A;  4M00 A;  4DPN A;  4JGY B;  1OA2 A;  2FMD A;  4P08 A;  4RGK A;  4NRO A;  4UFH A;  3TN9 1;  1UU6 A;  1LOD A;  4UT5 A;  4BQ1 A;  4TTG A;  4N53 A;  4XFH A;  5AC9 3;  3AYA A;  3E97 A;  2E9Q A;  4BYY A;  1WBL A;  2Q1M A;  4IGQ A;  1TME 3;  1HX6 A;  1X9T A;  1WCQ A;  5FY7 A;  4AXO A;  1G9B A;  3M1H A;  2P3K A;  2WZ8 A;  4F7Z A;  3RZJ A;  4CDW C;  5FZ3 A;  5A3M A;  4HK9 A;  2B46 X;  1ND2 C;  1RJ8 A;  2D44 A;  2XUM A;  1EUT A;  2JIG A;  4GMP 0;  3OG2 A;  1KQR A;  3POF A;  2ZHN A;  1SBE A;  4PDW B;  4UFK A;  1DQ6 A;  4QHO A;  2HWF 2;  3O12 A;  1W3X A;  1WLC A;  2X10 A;  1UKR A;  2HEW F;  2I2S A;  3AYC A;  3J8F 2;  4NMI A;  3PU3 A;  2BOI A;  3C7F A;  1HRV 3;  1EUU A;  4YZ1 A;  4IE6 A;  1OF3 A;  1LR5 A;  5BNO B;  3UGF A;  2W08 A;  2D5F A;  1CON A;  3K77 A;  4BWO A;  4FTS A;  1Y3T A;  1RUD 2;  2ORZ A;  4I0W B;  5T52 A;  5C9A C;  2WKK A;  1X82 A;  5GM0 A;  5IYY A;  1UOJ A;  2Y6K A;  1DGR A;  5JOX A;  3MF9 A;  2DTY A;  3VKM A;  1OLR A;  5H9R A;  1N1V A;  1XOY A;  2P34 A;  2ZBJ A;  1IPJ A;  5FY4 A;  5LA1 A;  4XFB A;  5AC9 1;  1V70 A;  5C5T A;  1ACC A;  2D6M A;  1MQT A;  2JE8 A;  4IQP A;  1JS9 A;  5FZG A;  5BNN C;  1R09 2;  1TME 1;  3MYX A;  4IV1 A;  4PLN A;  3ZN6 A;  2G9G A;  1UD1 A;  5B4X A;  1BMV 2;  4J25 A;  4BMB A;  5FUP A;  2RMU 2;  5F6L B;  4ZXE A;  4ZXK A;  4COY A;  5A6Q A;  4PQ9 A;  4YVS B;  2ENR A;  3VL8 A;  3T1L A;  2WN2 A;  3RI8 A;  3M4F A;  3OUJ A;  1DZQ A;  3VBH C;  1O7F A;  2W87 A;  4KWK A;  1REF A;  4MXW B;  2DUO A;  4YGE A;  3WDW A;  1F9K A;  1C57 A;  4X8P A;  2A71 A;  5FZF A;  1YIP A;  1S0E A;  2XON A;  2TNF A;  3JZV A;  5F7U A;  3VDD B;  1VBD 3;  2JEN A;  3R6S A;  4UF0 B;  3CL1 A;  3KCX A;  2JDP A;  3I59 B;  4PJY A;  4AK3 A;  4CDX A;  1SG3 A;  1LGB A;  4IE0 A;  2KM2 A;  3C2U A;  2FCV A;  1J83 A;  2RS1 2;  4XQD A;  4YW3 A;  5EWS A;  2WRA A;  4UFL A;  2ZEZ A;  3ZFF A;  1CWP A;  3GZE A;  1S0B A;  4ISR A;  3TEZ A;  4CCO A;  4BHP A;  2ZHM A;  5L7O A;  5LB6 A;  4NIH A;  3OBZ A;  5E16 A;  5T55 A;  2QQU A;  1OUS A;  4FT8 A;  4AFM A;  1NA1 A;  1Q43 A;  2WNV C;  3GCX A;  5FLI A;  4NIG A;  4LBQ A;  5JMO A;  4QM9 A;  2CDP A;  2I45 A;  1CAV B;  4MX3 A;  2GN3 A;  4IGP A;  3GHM A;  4B3N A;  1CR7 A;  2VBP A;  2E6V A;  3I54 A;  2XPJ A;  4RHV 3;  2OX0 A;  1ZZ9 A;  1ND2 B;  2VBB A;  2V5D A;  4IE7 A;  2C5D A;  3THT A;  3VDC A;  2W52 A;  5JSR A;  3WDY A;  3VGI A;  2A1X A;  5EYX A;  1QJE A;  1Z7S 1;  3FC0 A;  4AE2 A;  4CDQ C;  1H2N A;  1CX4 A;  4DEV A;  1XB9 A;  4CZS A;  2BGO A;  2ARB A;  2VMG A;  3DYM A;  5L9R A;  2D3P A;  2XWB B;  1LU1 A;  4TYS A;  2RM2 3;  4JGY A;  5FO9 B;  1HXS 3;  1JOJ A;  3X29 B;  3JB8 A;  3W58 A;  4RS5 B;  5C9A B;  4CEW C;  2Y38 A;  4JGZ C;  4CP1 A;  4MOA A;  3MIF A;  4D6S A;  4E4H A;  2DVD A;  5LWB A;  3WG4 A;  5D21 A;  3BN6 A;  4QQH A;  2R0F A;  3VKL A;  3POE A;  5GAL A;  3H8U A;  5HV4 A;  5KHJ A;  1YXW A;  2C26 A;  3WD5 A;  4TSV A;  4HVQ A;  5BNN B;  2B5H A;  1KD7 A;  2QBX A;  3AMH A;  4GB3 2;  3FE5 A;  2HEV F;  5A3N A;  1ONA A;  1OI6 A;  1OKO A;  2PLV 1;  2UWA A;  1V6M A;  1ND3 C;  3OPZ A;  4PDW A;  3N9M A;  1DF0 A;  4Q0P A;  3RI9 A;  1V0A A;  1I5Z A;  1IHM A;  1X7N A;  3J7L A;  4KH9 A;  1AYN 2;  4K1Z A;  4RHV 1;  2J1V A;  4ZS2 A;  3WY6 A;  3KZ4 C;  3ZIX A;  1CZV A;  4XIK A;  5F2S A;  3PTR B;  1H8T C;  3VBH B;  4ONU A;  5BNO A;  1S0D A;  1D4M 3;  5A6Z A;  2W2I A;  1L7L A;  4HVR A;  4MGY E;  2XJT A;  1W8W A;  3ACH A;  3RMY A;  3T08 A;  3R4U A;  4JCK A;  4YSF A;  4GAZ A;  3LD8 A;  4C1W A;  5IAT A;  4CU9 A;  1ZRI A;  3POJ A;  3B94 A;  1W8O A;  1HXS 1;  3VZL A;  4AVT A;  2CY6 A;  2R6Q A;  3WQ0 A;  3H7J A;  2P2K A;  3HBZ A;  1AR7 1;  4L2N A;  2VOT A;  4HN0 A;  4AQ6 A;  1YUD A;  5FXZ A;  4CEY C;  2L9L A;  4FFG A;  4EYU A;  3H0O A;  3KMH A;  2BQP A;  4HET A;  1JYX A;  3DUI A;  1C4R A;  3IDB B;  2A6Z A;  3ZYH A;  2WNV B;  3I3B A;  4YVS A;  3O0W A;  5DDJ 1;  3Q8A A;  1WLD A;  2UUR A;  3CMG A;  2R7E B;  4AAX A;  1CAX B;  3B9I A;  5E88 A;  4YWA A;  4C90 A;  3NRU A;  1AL2 1;  2JG9 C;  3BUC A;  1O59 A;  1OUX A;  1UX7 A;  1Y9Q A;  4Q4Y 2;  5C7G A;  5FPX A;  1O4T A;  1BEV 1;  1UZV A;  2RJK A;  3QOP A;  5FLJ A;  2ZGK A;  3DYO A;  5E6H A;  2X05 A;  2ATF A;  3I59 A;  2BP6 A;  3O1R A;  1H2M A;  1DQ0 A;  2VOK A;  1SLC A;  2VU9 A;  3KGL A;  1NYW A;  1IG3 A;  1Q8V A; 
#chains in the Genus database with same CATH homology
 1LAJ A;  1F15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...